F487574

General Info

Members Datasets Scaffolds Average Seq Length
988 409 1976 211

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0426757|Ga0496106_0426757_219_974
Length 251
Sequence VSGGGDWDAAYGKLVLDKTSRSAVELFPLTAYHLRLTVLGMSYAVKEIFYTLQGEGANTGRPAVFCRFAGCNLWTGREEDRLQATCQFCDTDFVGIDGVGGGRFGSAAQLANAIAAAWPIDAETPRFVVCTGGEPLLQLDSALIGALHDEGFEVAVETNGTLEPPPDIDWLCVSPKAGAGLVVRQGDELKLVFPQAGAEPAEFEQLRFSHYFLQPMDGPEREVHTAAALQYCLRHPRWRLSLQTHKLLGIP

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
195 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
227 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
251 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
254 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
255 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
256 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
257 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
262 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
309 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
310 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
311 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
347 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
350 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
351 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
352 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
353 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
354 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
357 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
360 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
361 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
362 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
363 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
371 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
372 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
380 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
381 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
382 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
383 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
384 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
385 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
386 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
387 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
393 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
394 2718217927 Rhizobium sp. N324 Isolate Nodule
395 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
396 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
397 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
398 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
399 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
400 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
401 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
402 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
403 8005275841 Rhizobium sp. N4311 Isolate Nodule
404 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
405 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
406 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
407 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
408 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
409 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0.4
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0.4
Rhizoplane 2.02
Rhizosphere 93.93
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0426757 3300048909 Bacteria 1065
2 MBSR1b_contig_11739019 2162886012 Bacteria 1386
3 rootH2_10144468 3300003320 Bacteria 1065
4 Ga0065715_10167639 3300005293 Bacteria 1558
5 Ga0065715_10177927 3300005293 Bacteria 1497
6 Ga0065715_10196336 3300005293 Bacteria 1385
7 Ga0065707_10290892 3300005295 Bacteria 1025
8 Ga0065707_10319758 3300005295 Bacteria 969
9 Ga0070658_10045668 3300005327 Bacteria 3542
10 Ga0070658_10046895 3300005327 Bacteria 3496
11 Ga0070658_10069590 3300005327 Bacteria 2879
12 Ga0070658_10190980 3300005327 Bacteria 1726
13 Ga0070658_11061796 3300005327 Bacteria 704
14 Ga0070676_10036268 3300005328 Bacteria 2840
15 Ga0070676_10206723 3300005328 Bacteria 1290
16 Ga0070676_10237696 3300005328 Bacteria 1210
17 Ga0070683_100000655 3300005329 Bacteria 25019
18 Ga0070683_100006909 3300005329 Bacteria 9538
19 Ga0070683_100079053 3300005329 Bacteria 3078
20 Ga0070683_100369058 3300005329 Bacteria 1367
21 Ga0070683_100413459 3300005329 Bacteria 1286
22 Ga0070683_100604067 3300005329 Bacteria 1050
23 Ga0070690_100337578 3300005330 Bacteria 1090
24 Ga0070670_100002779 3300005331 Bacteria 14467
25 Ga0070670_100216564 3300005331 Bacteria 1666
26 Ga0070670_100339023 3300005331 Bacteria 1319
27 Ga0070666_10498290 3300005335 Bacteria 883
28 Ga0070680_100006802 3300005336 Bacteria 8711
29 Ga0070680_100024698 3300005336 Bacteria 4804
30 Ga0070680_100031242 3300005336 Bacteria 4281
31 Ga0070682_100071427 3300005337 Bacteria 2222
32 Ga0070682_100320308 3300005337 Bacteria 1145
33 Ga0068868_100089736 3300005338 Bacteria 2474
34 Ga0068868_100103379 3300005338 Bacteria 2308
35 Ga0070660_100065655 3300005339 Bacteria 2824
36 Ga0070660_100075721 3300005339 Bacteria 2635
37 Ga0070660_100117534 3300005339 Bacteria 2121
38 Ga0070660_100385862 3300005339 Bacteria 1157
39 Ga0070687_100049785 3300005343 Bacteria 2161
40 Ga0070661_100073631 3300005344 Bacteria 2515
41 Ga0070661_100121211 3300005344 Bacteria 1959
42 Ga0070692_10054394 3300005345 Bacteria 2090
43 Ga0070692_10282046 3300005345 Bacteria 1007
44 Ga0070668_100292271 3300005347 Bacteria 1364
45 Ga0070668_100663585 3300005347 Bacteria 917
46 Ga0070669_100000566 3300005353 Bacteria 27503
47 Ga0070675_100224962 3300005354 Bacteria 1635
48 Ga0070675_100267169 3300005354 Bacteria 1500
49 Ga0070675_100605232 3300005354 Bacteria 994
50 Ga0070675_101225365 3300005354 Bacteria 691
51 Ga0070671_100009865 3300005355 Bacteria 7665
52 Ga0070671_100010716 3300005355 Bacteria 7360
53 Ga0070671_100395295 3300005355 Bacteria 1182
54 Ga0070671_100451730 3300005355 Unclassified 1103
55 Ga0070674_100299205 3300005356 Bacteria 1282
56 Ga0070673_100064069 3300005364 Bacteria 2927
57 Ga0070673_100881302 3300005364 Bacteria 829
58 Ga0070659_100029486 3300005366 Bacteria 4241
59 Ga0070659_100038787 3300005366 Bacteria 3717
60 Ga0070659_100163612 3300005366 Bacteria 1820
61 Ga0070659_100205948 3300005366 Bacteria 1620
62 Ga0070659_100445278 3300005366 Bacteria 1098
63 Ga0070667_100147454 3300005367 Bacteria 2064
64 Ga0070709_10016652 3300005434 Bacteria 4201
65 Ga0070709_10463011 3300005434 Bacteria 957
66 Ga0070714_100006448 3300005435 Bacteria 9063
67 Ga0070714_100032491 3300005435 Bacteria 4356
68 Ga0070714_100095720 3300005435 Bacteria 2608
69 Ga0070714_100188936 3300005435 Bacteria 1878
70 Ga0070714_100242505 3300005435 Bacteria 1664
71 Ga0070713_100013756 3300005436 Bacteria 5985
72 Ga0070713_100017633 3300005436 Bacteria 5405
73 Ga0070713_100565883 3300005436 Bacteria 1077
74 Ga0070713_100687631 3300005436 Bacteria 976
75 Ga0070710_10003320 3300005437 Bacteria 7633
76 Ga0070710_10003572 3300005437 Bacteria 7374
77 Ga0070701_10003257 3300005438 Bacteria 6392
78 Ga0070701_10056268 3300005438 Bacteria 2057
79 Ga0070711_100023585 3300005439 Bacteria 4004
80 Ga0070705_100002041 3300005440 Bacteria 10319
81 Ga0070700_100131955 3300005441 Bacteria 1687
82 Ga0070700_100253087 3300005441 Bacteria 1264
83 Ga0070694_100007030 3300005444 Bacteria 6847
84 Ga0070694_100043995 3300005444 Bacteria 2987
85 Ga0070694_100061005 3300005444 Bacteria 2573
86 Ga0070694_100243159 3300005444 Bacteria 1358
87 Ga0070694_100547592 3300005444 Bacteria 926
88 Ga0070694_100577194 3300005444 Bacteria 903
89 Ga0070708_100000138 3300005445 Bacteria 49981
90 Ga0070708_100000381 3300005445 Bacteria 33426
91 Ga0070708_100012335 3300005445 Bacteria 6970
92 Ga0070708_100080082 3300005445 Bacteria 2955
93 Ga0070663_100006516 3300005455 Bacteria 7030
94 Ga0070678_100070099 3300005456 Bacteria 2619
95 Ga0070678_100533244 3300005456 Bacteria 1040
96 Ga0070662_100057016 3300005457 Bacteria 2837
97 Ga0070662_100089880 3300005457 Bacteria 2304
98 Ga0070681_10003042 3300005458 Bacteria 15549
99 Ga0070681_10008604 3300005458 Bacteria 10005
100 Ga0070681_10125458 3300005458 Bacteria 2500
101 Ga0070681_10169599 3300005458 Bacteria 2104
102 Ga0070681_10419523 3300005458 Bacteria 1250
103 Ga0068867_100032665 3300005459 Bacteria 3765
104 Ga0068867_100100291 3300005459 Bacteria 2211
105 Ga0068867_100230504 3300005459 Bacteria 1497
106 Ga0070685_10002911 3300005466 Bacteria 8749
107 Ga0070706_100008495 3300005467 Bacteria 9570
108 Ga0070706_100036866 3300005467 Bacteria 4517
109 Ga0070706_100074652 3300005467 Bacteria 3138
110 Ga0070706_100127696 3300005467 Bacteria 2372
111 Ga0070706_100191135 3300005467 Bacteria 1913
112 Ga0070706_100758452 3300005467 Bacteria 899
113 Ga0070707_100002489 3300005468 Bacteria 17550
114 Ga0070707_100032687 3300005468 Bacteria 4957
115 Ga0070707_100038820 3300005468 Bacteria 4549
116 Ga0070707_100044161 3300005468 Bacteria 4266
117 Ga0070707_100134698 3300005468 Bacteria 2403
118 Ga0070707_100233126 3300005468 Bacteria 1792
119 Ga0070707_101086147 3300005468 Bacteria 766
120 Ga0070698_100000122 3300005471 Bacteria 67115
121 Ga0070698_100002933 3300005471 Bacteria 18759
122 Ga0070698_100147322 3300005471 Bacteria 2303
123 Ga0070698_100165574 3300005471 Bacteria 2154
124 Ga0070698_100300389 3300005471 Bacteria 1536
125 Ga0070698_100351545 3300005471 Bacteria 1405
126 Ga0070698_100380437 3300005471 Bacteria 1344
127 Ga0070698_100504197 3300005471 Bacteria 1148
128 Ga0070699_100000779 3300005518 Bacteria 29462
129 Ga0070699_100001147 3300005518 Bacteria 24612
130 Ga0070699_100002138 3300005518 Bacteria 17923
131 Ga0070699_100010635 3300005518 Bacteria 7965
132 Ga0070699_100064235 3300005518 Bacteria 3184
133 Ga0070699_100074979 3300005518 Bacteria 2944
134 Ga0070699_100125188 3300005518 Bacteria 2262
135 Ga0070699_100740251 3300005518 Bacteria 899
136 Ga0070679_100013231 3300005530 Bacteria 7897
137 Ga0070679_100026551 3300005530 Bacteria 5691
138 Ga0070679_100060525 3300005530 Bacteria 3774
139 Ga0070679_100069429 3300005530 Bacteria 3514
140 Ga0070679_100127633 3300005530 Bacteria 2525
141 Ga0070679_100259329 3300005530 Bacteria 1694
142 Ga0070679_100605950 3300005530 Bacteria 1038
143 Ga0070679_101220636 3300005530 Bacteria 697
144 Ga0070684_100016107 3300005535 Bacteria 6107
145 Ga0070684_100031010 3300005535 Bacteria 4548
146 Ga0070684_100034276 3300005535 Bacteria 4340
147 Ga0070684_100055337 3300005535 Bacteria 3458
148 Ga0070684_100224294 3300005535 Bacteria 1715
149 Ga0070684_100349077 3300005535 Bacteria 1361
150 Ga0070684_100450704 3300005535 Bacteria 1189
151 Ga0070697_100000272 3300005536 Bacteria 42107
152 Ga0070697_100002379 3300005536 Bacteria 14478
153 Ga0070697_100008526 3300005536 Bacteria 8002
154 Ga0070697_100050347 3300005536 Bacteria 3380
155 Ga0070697_100064880 3300005536 Bacteria 2983
156 Ga0068853_100251114 3300005539 Bacteria 1623
157 Ga0068853_100266207 3300005539 Bacteria 1577
158 Ga0068853_100358428 3300005539 Bacteria 1358
159 Ga0068853_100948110 3300005539 Bacteria 827
160 Ga0070672_100164581 3300005543 Bacteria 1842
161 Ga0070672_100222904 3300005543 Bacteria 1582
162 Ga0070686_100110580 3300005544 Bacteria 1871
163 Ga0070695_100002517 3300005545 Bacteria 10569
164 Ga0070695_100021848 3300005545 Bacteria 3921
165 Ga0070695_100046003 3300005545 Bacteria 2784
166 Ga0070695_100130069 3300005545 Bacteria 1734
167 Ga0070696_100000059 3300005546 Bacteria 52787
168 Ga0070696_100003944 3300005546 Bacteria 9903
169 Ga0070696_100017114 3300005546 Bacteria 4893
170 Ga0070696_100018215 3300005546 Bacteria 4744
171 Ga0070696_100346782 3300005546 Bacteria 1149
172 Ga0070696_100409163 3300005546 Bacteria 1063
173 Ga0070693_100018308 3300005547 Bacteria 3656
174 Ga0070693_100270123 3300005547 Bacteria 1135
175 Ga0070665_100082484 3300005548 Bacteria 3221
176 Ga0070665_100120769 3300005548 Bacteria 2622
177 Ga0070665_100498637 3300005548 Bacteria 1229
178 Ga0070704_100471533 3300005549 Bacteria 1085
179 Ga0068855_100002369 3300005563 Bacteria 23238
180 Ga0068855_100030887 3300005563 Bacteria 6403
181 Ga0068855_100047437 3300005563 Bacteria 5075
182 Ga0068855_100373390 3300005563 Bacteria 1567
183 Ga0068855_100604565 3300005563 Bacteria 1182
184 Ga0070664_100013004 3300005564 Bacteria 6773
185 Ga0070664_100289697 3300005564 Bacteria 1478
186 Ga0070664_100300535 3300005564 Bacteria 1450
187 Ga0070664_100587608 3300005564 Bacteria 1032
188 Ga0068857_100009041 3300005577 Bacteria 8642
189 Ga0068857_100010828 3300005577 Bacteria 7940
190 Ga0068857_100014675 3300005577 Bacteria 6834
191 Ga0068854_100049592 3300005578 Bacteria 2999
192 Ga0068854_100224209 3300005578 Bacteria 1489
193 Ga0068856_100007921 3300005614 Bacteria 10377
194 Ga0068856_100111496 3300005614 Bacteria 2733
195 Ga0068856_100192461 3300005614 Bacteria 2053
196 Ga0068856_100195593 3300005614 Bacteria 2036
197 Ga0068856_100243791 3300005614 Bacteria 1812
198 Ga0068856_100364064 3300005614 Bacteria 1464
199 Ga0068856_100579993 3300005614 Bacteria 1143
200 Ga0070702_100151051 3300005615 Bacteria 1491
201 Ga0068852_100020060 3300005616 Bacteria 5308
202 Ga0068852_100128548 3300005616 Bacteria 2330
203 Ga0068852_100161080 3300005616 Bacteria 2095
204 Ga0068852_100189299 3300005616 Bacteria 1940
205 Ga0068852_100335586 3300005616 Bacteria 1472
206 Ga0068852_100464638 3300005616 Bacteria 1255
207 Ga0068859_100123633 3300005617 Bacteria 2655
208 Ga0068859_100182134 3300005617 Bacteria 2184
209 Ga0068859_100186844 3300005617 Unclassified 2156
210 Ga0068859_100228879 3300005617 Bacteria 1947
211 Ga0068859_100511465 3300005617 Bacteria 1296
212 Ga0068859_100620865 3300005617 Bacteria 1174
213 Ga0068864_100032802 3300005618 Bacteria 4414
214 Ga0068864_100216853 3300005618 Bacteria 1764
215 Ga0068866_10090041 3300005718 Bacteria 1669
216 Ga0068861_100231039 3300005719 Bacteria 1569
217 Ga0068870_10018009 3300005840 Bacteria 3403
218 Ga0068863_100099236 3300005841 Bacteria 2767
219 Ga0068863_100138558 3300005841 Bacteria 2325
220 Ga0068858_100020693 3300005842 Bacteria 6145
221 Ga0068858_100227595 3300005842 Bacteria 1767
222 Ga0068858_100318188 3300005842 Bacteria 1487
223 Ga0068860_100011796 3300005843 Bacteria 8612
224 Ga0068860_100481535 3300005843 Bacteria 1237
225 Ga0068860_100814766 3300005843 Bacteria 947
226 Ga0068860_100915722 3300005843 Bacteria 893
227 Ga0068862_100007064 3300005844 Bacteria 9325
228 Ga0068862_100640600 3300005844 Bacteria 1024
229 Ga0068862_100856178 3300005844 Bacteria 891
230 Ga0068862_100928672 3300005844 Bacteria 857
231 Ga0068862_101013634 3300005844 Bacteria 822
232 Ga0081455_10000733 3300005937 Bacteria 42613
233 Ga0081455_10147178 3300005937 Bacteria 1820
234 Ga0081538_10006932 3300005981 Bacteria 9857
235 Ga0081538_10013401 3300005981 Bacteria 6494
236 Ga0081538_10019713 3300005981 Bacteria 4995
237 Ga0081539_10000087 3300005985 Bacteria 214031
238 Ga0070716_100002710 3300006173 Bacteria 8207
239 Ga0070712_100058906 3300006175 Bacteria 2703
240 Ga0070712_100273466 3300006175 Bacteria 1358
241 Ga0075367_10086696 3300006178 Bacteria 1901
242 Ga0075366_10051119 3300006195 Bacteria 2455
243 Ga0075366_10168125 3300006195 Bacteria 1330
244 Ga0097621_100004481 3300006237 Bacteria 9736
245 Ga0097621_100077827 3300006237 Bacteria 2754
246 Ga0097621_100095490 3300006237 Bacteria 2494
247 Ga0097621_100369902 3300006237 Bacteria 1278
248 Ga0075370_10015474 3300006353 Bacteria 4085
249 Ga0068871_100004639 3300006358 Bacteria 9600
250 Ga0068871_100032288 3300006358 Bacteria 4135
251 Ga0068871_100049384 3300006358 Bacteria 3400
252 Ga0068871_100063462 3300006358 Bacteria 3021
253 Ga0075430_100042803 3300006846 Bacteria 3829
254 Ga0075430_100060159 3300006846 Bacteria 3193
255 Ga0075430_100283840 3300006846 Bacteria 1370
256 Ga0075431_100047077 3300006847 Bacteria 4446
257 Ga0075431_100067520 3300006847 Bacteria 3691
258 Ga0075431_100106084 3300006847 Bacteria 2899
259 Ga0075431_100189656 3300006847 Bacteria 2107
260 Ga0075431_100197940 3300006847 Bacteria 2057
261 Ga0075431_101006526 3300006847 Bacteria 800
262 Ga0075433_10438048 3300006852 Bacteria 1152
263 Ga0075434_100004223 3300006871 Bacteria 12876
264 Ga0075434_100038828 3300006871 Bacteria 4718
265 Ga0075434_100054837 3300006871 Bacteria 3960
266 Ga0075434_100383321 3300006871 Bacteria 1427
267 Ga0075434_100427666 3300006871 Bacteria 1345
268 Ga0075434_100770395 3300006871 Bacteria 979
269 Ga0075429_100719775 3300006880 Bacteria 874
270 Ga0068865_100001396 3300006881 Bacteria 14036
271 Ga0068865_100071903 3300006881 Bacteria 2455
272 Ga0068865_100194759 3300006881 Bacteria 1570
273 Ga0075436_100008037 3300006914 Bacteria 7222
274 Ga0075436_100016660 3300006914 Bacteria 5031
275 Ga0075436_100030317 3300006914 Bacteria 3723
276 Ga0075436_100048619 3300006914 Bacteria 2927
277 Ga0075436_100185848 3300006914 Bacteria 1470
278 Ga0075436_100341323 3300006914 Bacteria 1078
279 Ga0097620_100123624 3300006931 Bacteria 2655
280 Ga0097620_100182145 3300006931 Bacteria 2184
281 Ga0097620_100186859 3300006931 Unclassified 2156
282 Ga0097620_100228882 3300006931 Bacteria 1947
283 Ga0097620_100511434 3300006931 Bacteria 1296
284 Ga0097620_100620873 3300006931 Bacteria 1174
285 Ga0075435_100051075 3300007076 Bacteria 3329
286 Ga0075435_100089319 3300007076 Bacteria 2541
287 Ga0099794_10119513 3300007265 Bacteria 1325
288 Ga0099795_10018957 3300007788 Bacteria 2220
289 Ga0105240_10002142 3300009093 Bacteria 32242
290 Ga0105240_10003537 3300009093 Bacteria 24233
291 Ga0105240_10004066 3300009093 Bacteria 22506
292 Ga0105240_10016265 3300009093 Bacteria 10078
293 Ga0105240_10091573 3300009093 Bacteria 3714
294 Ga0105240_10179009 3300009093 Bacteria 2504
295 Ga0105240_11096136 3300009093 Bacteria 847
296 Ga0105240_11129592 3300009093 Bacteria 833
297 Ga0105240_11310902 3300009093 Bacteria 763
298 Ga0111539_10117554 3300009094 Bacteria 3116
299 Ga0105245_10075361 3300009098 Bacteria 3072
300 Ga0105245_10128517 3300009098 Bacteria 2374
301 Ga0105245_10230510 3300009098 Bacteria 1791
302 Ga0105245_10724424 3300009098 Bacteria 1029
303 Ga0114129_10000260 3300009147 Bacteria 59525
304 Ga0114129_10156707 3300009147 Bacteria 3113
305 Ga0105243_10791779 3300009148 Bacteria 933
306 Ga0105241_10019962 3300009174 Bacteria 4947
307 Ga0105241_10221046 3300009174 Bacteria 1592
308 Ga0105241_10431043 3300009174 Bacteria 1162
309 Ga0105241_10495752 3300009174 Bacteria 1088
310 Ga0105241_11155599 3300009174 Bacteria 731
311 Ga0105242_10000494 3300009176 Bacteria 31086
312 Ga0105242_10002807 3300009176 Bacteria 13645
313 Ga0105242_10116716 3300009176 Unclassified 2284
314 Ga0105242_10326789 3300009176 Bacteria 1409
315 Ga0105242_10560451 3300009176 Bacteria 1097
316 Ga0105248_10000006 3300009177 Bacteria 595060
317 Ga0105248_10045933 3300009177 Bacteria 4897
318 Ga0105248_10050185 3300009177 Bacteria 4679
319 Ga0105248_10110766 3300009177 Bacteria 3096
320 Ga0105248_10151528 3300009177 Bacteria 2616
321 Ga0105248_10157021 3300009177 Bacteria 2567
322 Ga0105248_10265137 3300009177 Bacteria 1934
323 Ga0105248_10360453 3300009177 Bacteria 1637
324 Ga0105248_10405388 3300009177 Bacteria 1535
325 Ga0105248_10500149 3300009177 Bacteria 1370
326 Ga0105248_10884624 3300009177 Bacteria 1008
327 Ga0105237_10314435 3300009545 Bacteria 1569
328 Ga0105238_10023340 3300009551 Bacteria 6306
329 Ga0105238_10040071 3300009551 Bacteria 4748
330 Ga0105238_10110244 3300009551 Bacteria 2733
331 Ga0105238_10136838 3300009551 Bacteria 2427
332 Ga0105238_10408914 3300009551 Bacteria 1351
333 Ga0105249_10000582 3300009553 Bacteria 33411
334 Ga0105249_10110848 3300009553 Bacteria 2594
335 Ga0105249_10320446 3300009553 Bacteria 1561
336 Ga0105249_10688532 3300009553 Bacteria 1082
337 Ga0105249_10707473 3300009553 Bacteria 1068
338 Ga0105239_10029595 3300010375 Bacteria 6022
339 Ga0105239_10065246 3300010375 Bacteria 3998
340 Ga0105239_10247823 3300010375 Bacteria 2000
341 Ga0105246_10239800 3300011119 Unclassified 1433
342 Ga0105246_10276024 3300011119 Bacteria 1346
343 Ga0105246_10517081 3300011119 Bacteria 1017
344 Ga0157323_1003327 3300012495 Bacteria 962
345 Ga0157371_10042745 3300013102 Bacteria 3230
346 Ga0157370_10089962 3300013104 Bacteria 2883
347 Ga0157370_10230707 3300013104 Bacteria 1713
348 Ga0157370_10708518 3300013104 Bacteria 919
349 Ga0157369_10001363 3300013105 Bacteria 30141
350 Ga0157369_10003286 3300013105 Bacteria 19260
351 Ga0157369_10058133 3300013105 Bacteria 4172
352 Ga0157369_10122350 3300013105 Bacteria 2760
353 Ga0157369_10147357 3300013105 Bacteria 2488
354 Ga0157369_10198817 3300013105 Bacteria 2104
355 Ga0157369_10228799 3300013105 Bacteria 1944
356 Ga0157369_10250883 3300013105 Bacteria 1847
357 Ga0157369_10381642 3300013105 Bacteria 1463
358 Ga0157369_10424739 3300013105 Bacteria 1378
359 Ga0157374_10000158 3300013296 Bacteria 62352
360 Ga0157374_10013300 3300013296 Bacteria 7181
361 Ga0157374_10133732 3300013296 Bacteria 2402
362 Ga0157374_10243823 3300013296 Bacteria 1767
363 Ga0157374_10280137 3300013296 Bacteria 1646
364 Ga0157374_10460804 3300013296 Bacteria 1273
365 Ga0157378_10025984 3300013297 Bacteria 5160
366 Ga0163162_10036600 3300013306 Bacteria 4893
367 Ga0163162_10087536 3300013306 Bacteria 3193
368 Ga0163162_10285468 3300013306 Bacteria 1782
369 Ga0163162_10374191 3300013306 Bacteria 1558
370 Ga0157372_10000968 3300013307 Bacteria 31318
371 Ga0157372_10012193 3300013307 Bacteria 9155
372 Ga0157372_10024833 3300013307 Bacteria 6513
373 Ga0157372_10024910 3300013307 Bacteria 6503
374 Ga0157372_10034058 3300013307 Bacteria 5597
375 Ga0157372_10056941 3300013307 Bacteria 4369
376 Ga0157372_10188970 3300013307 Bacteria 2385
377 Ga0157372_10457521 3300013307 Bacteria 1487
378 Ga0157372_10552813 3300013307 Bacteria 1342
379 Ga0157372_10565726 3300013307 Bacteria 1325
380 Ga0157372_10685876 3300013307 Bacteria 1192
381 Ga0157372_10752511 3300013307 Bacteria 1133
382 Ga0157372_10835362 3300013307 Bacteria 1070
383 Ga0157375_10014989 3300013308 Bacteria 6932
384 Ga0157375_10017676 3300013308 Bacteria 6443
385 Ga0157375_10161016 3300013308 Bacteria 2386
386 Ga0157375_10416950 3300013308 Bacteria 1509
387 Ga0163163_10913605 3300014325 Bacteria 941
388 Ga0157380_10005964 3300014326 Bacteria 8524
389 Ga0157380_10169393 3300014326 Bacteria 1906
390 Ga0182008_10021026 3300014497 Bacteria 3355
391 Ga0157377_10134404 3300014745 Bacteria 1514
392 Ga0157379_10051452 3300014968 Bacteria 3679
393 Ga0157379_10618953 3300014968 Bacteria 1012
394 Ga0157376_10000504 3300014969 Bacteria 25284
395 Ga0157376_10168130 3300014969 Unclassified 1994
396 Ga0157376_10192030 3300014969 Bacteria 1873
397 Ga0157376_10244356 3300014969 Bacteria 1673
398 Ga0157376_11439227 3300014969 Bacteria 721
399 Ga0183367_1001 3300015688 Bacteria 1225545
400 Ga0163161_10245198 3300017792 Bacteria 1395
401 Ga0197907_11166738 3300020069 Bacteria 1195
402 Ga0206356_10711775 3300020070 Bacteria 2030
403 Ga0206354_10069137 3300020081 Bacteria 1010
404 Ga0213876_10184708 3300021384 Bacteria 1109
405 Ga0213871_10023561 3300021441 Bacteria 1551
406 Ga0224712_10001684 3300022467 Bacteria 5229
407 Ga0207697_10071700 3300025315 Bacteria 1452
408 Ga0207682_10004059 3300025893 Bacteria 6219
409 Ga0207692_10016610 3300025898 Bacteria 3265
410 Ga0207642_10063368 3300025899 Bacteria 1729
411 Ga0207680_10239419 3300025903 Bacteria 1250
412 Ga0207699_10020457 3300025906 Bacteria 3548
413 Ga0207645_10016610 3300025907 Bacteria 4870
414 Ga0207645_10037069 3300025907 Bacteria 3130
415 Ga0207645_10260144 3300025907 Bacteria 1149
416 Ga0207643_10005910 3300025908 Bacteria 6536
417 Ga0207705_10017431 3300025909 Bacteria 5142
418 Ga0207705_10153349 3300025909 Bacteria 1727
419 Ga0207705_10337048 3300025909 Bacteria 1160
420 Ga0207705_10693964 3300025909 Bacteria 791
421 Ga0207684_10021616 3300025910 Bacteria 5493
422 Ga0207684_10055225 3300025910 Bacteria 3369
423 Ga0207684_10219347 3300025910 Bacteria 1641
424 Ga0207684_10257645 3300025910 Bacteria 1505
425 Ga0207654_10237808 3300025911 Bacteria 1216
426 Ga0207707_10001557 3300025912 Bacteria 21117
427 Ga0207707_10002130 3300025912 Bacteria 17924
428 Ga0207707_10010399 3300025912 Bacteria 8074
429 Ga0207707_10067287 3300025912 Bacteria 3120
430 Ga0207707_10834887 3300025912 Bacteria 765
431 Ga0207695_10001162 3300025913 Bacteria 45655
432 Ga0207695_10003501 3300025913 Bacteria 22022
433 Ga0207695_10061983 3300025913 Bacteria 3863
434 Ga0207695_10227897 3300025913 Bacteria 1769
435 Ga0207695_10249293 3300025913 Bacteria 1675
436 Ga0207693_10261133 3300025915 Bacteria 1358
437 Ga0207663_10026240 3300025916 Bacteria 3379
438 Ga0207660_10011149 3300025917 Bacteria 5844
439 Ga0207660_10030762 3300025917 Bacteria 3691
440 Ga0207660_10179379 3300025917 Bacteria 1644
441 Ga0207660_10188301 3300025917 Bacteria 1606
442 Ga0207660_10522818 3300025917 Bacteria 964
443 Ga0207660_10615744 3300025917 Bacteria 885
444 Ga0207657_10028851 3300025919 Bacteria 5056
445 Ga0207657_10060219 3300025919 Bacteria 3259
446 Ga0207657_10126537 3300025919 Bacteria 2098
447 Ga0207657_10496794 3300025919 Bacteria 956
448 Ga0207649_10092720 3300025920 Bacteria 1981
449 Ga0207652_10104650 3300025921 Bacteria 2504
450 Ga0207652_10183376 3300025921 Bacteria 1882
451 Ga0207652_10197228 3300025921 Bacteria 1811
452 Ga0207652_10218224 3300025921 Bacteria 1718
453 Ga0207652_10364194 3300025921 Bacteria 1305
454 Ga0207652_10953022 3300025921 Bacteria 756
455 Ga0207646_10012507 3300025922 Bacteria 8151
456 Ga0207646_10032401 3300025922 Bacteria 4730
457 Ga0207646_10097667 3300025922 Bacteria 2631
458 Ga0207646_10107926 3300025922 Bacteria 2497
459 Ga0207646_10285631 3300025922 Bacteria 1491
460 Ga0207646_10311500 3300025922 Bacteria 1422
461 Ga0207646_10630679 3300025922 Unclassified 961
462 Ga0207681_10001953 3300025923 Bacteria 13235
463 Ga0207681_10408253 3300025923 Bacteria 1098
464 Ga0207694_10035082 3300025924 Bacteria 3847
465 Ga0207694_10223768 3300025924 Bacteria 1535
466 Ga0207694_10238891 3300025924 Bacteria 1484
467 Ga0207694_10577942 3300025924 Bacteria 944
468 Ga0207650_10238267 3300025925 Bacteria 1470
469 Ga0207650_10557007 3300025925 Bacteria 961
470 Ga0207687_10269446 3300025927 Bacteria 1361
471 Ga0207687_10286280 3300025927 Bacteria 1323
472 Ga0207687_10399166 3300025927 Bacteria 1130
473 Ga0207700_10012282 3300025928 Bacteria 5514
474 Ga0207700_10024905 3300025928 Bacteria 4148
475 Ga0207664_10052569 3300025929 Bacteria 3222
476 Ga0207664_10074592 3300025929 Bacteria 2741
477 Ga0207664_10082927 3300025929 Bacteria 2612
478 Ga0207664_10225412 3300025929 Bacteria 1627
479 Ga0207664_10246337 3300025929 Bacteria 1558
480 Ga0207644_10024876 3300025931 Bacteria 4113
481 Ga0207644_10130483 3300025931 Bacteria 1923
482 Ga0207644_10916206 3300025931 Bacteria 735
483 Ga0207690_10170308 3300025932 Bacteria 1631
484 Ga0207690_10360263 3300025932 Bacteria 1152
485 Ga0207706_10001355 3300025933 Bacteria 24461
486 Ga0207706_10305637 3300025933 Bacteria 1385
487 Ga0207686_10003613 3300025934 Bacteria 8284
488 Ga0207686_10059287 3300025934 Bacteria 2417
489 Ga0207686_10108662 3300025934 Bacteria 1866
490 Ga0207686_10321583 3300025934 Bacteria 1156
491 Ga0207704_10009704 3300025938 Bacteria 4658
492 Ga0207704_10109335 3300025938 Bacteria 1864
493 Ga0207665_10000447 3300025939 Bacteria 28305
494 Ga0207691_10104455 3300025940 Bacteria 2525
495 Ga0207691_10235973 3300025940 Bacteria 1582
496 Ga0207711_10000064 3300025941 Bacteria 120779
497 Ga0207711_10028170 3300025941 Bacteria 4725
498 Ga0207711_10106774 3300025941 Bacteria 2485
499 Ga0207711_10198429 3300025941 Bacteria 1830
500 Ga0207711_10243019 3300025941 Bacteria 1651
501 Ga0207711_10463549 3300025941 Bacteria 1180
502 Ga0207711_10576668 3300025941 Bacteria 1049
503 Ga0207711_10633277 3300025941 Bacteria 998
504 Ga0207689_10429709 3300025942 Bacteria 1103
505 Ga0207661_10004560 3300025944 Bacteria 9716
506 Ga0207661_10035472 3300025944 Bacteria 3887
507 Ga0207661_10043953 3300025944 Bacteria 3527
508 Ga0207661_10054675 3300025944 Bacteria 3199
509 Ga0207661_10264876 3300025944 Bacteria 1532
510 Ga0207661_10423769 3300025944 Bacteria 1209
511 Ga0207679_10040294 3300025945 Bacteria 3342
512 Ga0207679_10211073 3300025945 Bacteria 1628
513 Ga0207667_10002772 3300025949 Bacteria 21680
514 Ga0207667_10011432 3300025949 Bacteria 10318
515 Ga0207667_10237727 3300025949 Bacteria 1865
516 Ga0207667_10267382 3300025949 Bacteria 1748
517 Ga0207667_10299157 3300025949 Bacteria 1644
518 Ga0207667_10602328 3300025949 Bacteria 1108
519 Ga0207667_10661481 3300025949 Bacteria 1049
520 Ga0207651_10314553 3300025960 Bacteria 1307
521 Ga0207651_10710825 3300025960 Bacteria 886
522 Ga0207712_10033535 3300025961 Bacteria 3472
523 Ga0207712_10090893 3300025961 Bacteria 2247
524 Ga0207712_10677967 3300025961 Bacteria 898
525 Ga0207668_10021239 3300025972 Bacteria 4138
526 Ga0207668_10135080 3300025972 Bacteria 1889
527 Ga0207668_10290103 3300025972 Bacteria 1346
528 Ga0207658_10119678 3300025986 Bacteria 2097
529 Ga0207677_10207681 3300026023 Bacteria 1561
530 Ga0207703_10016259 3300026035 Bacteria 5799
531 Ga0207639_10020607 3300026041 Bacteria 4722
532 Ga0207639_10097046 3300026041 Bacteria 2372
533 Ga0207639_10313713 3300026041 Bacteria 1390
534 Ga0207678_10004751 3300026067 Bacteria 12204
535 Ga0207678_10260919 3300026067 Bacteria 1485
536 Ga0207708_10027253 3300026075 Bacteria 4326
537 Ga0207708_10081783 3300026075 Bacteria 2483
538 Ga0207702_10002702 3300026078 Bacteria 16652
539 Ga0207702_10163517 3300026078 Bacteria 2034
540 Ga0207702_10215461 3300026078 Bacteria 1787
541 Ga0207702_10216516 3300026078 Bacteria 1783
542 Ga0207702_10419076 3300026078 Bacteria 1294
543 Ga0207702_10667301 3300026078 Bacteria 1023
544 Ga0207641_10084028 3300026088 Bacteria 2770
545 Ga0207641_10157741 3300026088 Bacteria 2060
546 Ga0207641_10579111 3300026088 Bacteria 1097
547 Ga0207648_10091323 3300026089 Bacteria 2662
548 Ga0207648_10109890 3300026089 Bacteria 2420
549 Ga0207648_10154034 3300026089 Bacteria 2028
550 Ga0207648_10271522 3300026089 Bacteria 1515
551 Ga0207648_10294290 3300026089 Bacteria 1454
552 Ga0207676_10351848 3300026095 Bacteria 1362
553 Ga0207676_10671134 3300026095 Bacteria 1002
554 Ga0207674_10001358 3300026116 Bacteria 31659
555 Ga0207674_10020080 3300026116 Bacteria 7227
556 Ga0207674_10229698 3300026116 Bacteria 1803
557 Ga0207675_100186703 3300026118 Bacteria 1987
558 Ga0207675_100376531 3300026118 Bacteria 1395
559 Ga0207683_10016698 3300026121 Bacteria 6246
560 Ga0207683_10170602 3300026121 Bacteria 1970
561 Ga0207683_10674667 3300026121 Bacteria 958
562 Ga0207698_10034196 3300026142 Bacteria 3703
563 Ga0207698_10366481 3300026142 Bacteria 1366
564 Ga0207698_10646115 3300026142 Bacteria 1047
565 Ga0207698_10845076 3300026142 Bacteria 920
566 Ga0209588_1040615 3300027671 Bacteria 1501
567 Ga0209966_1008583 3300027695 Bacteria 1816
568 Ga0209998_10002474 3300027717 Bacteria 4225
569 Ga0209974_10029724 3300027876 Bacteria 1811
570 Ga0265356_1009420 3300028017 Bacteria 1101
571 Ga0268266_10113298 3300028379 Bacteria 2405
572 Ga0268266_10294592 3300028379 Bacteria 1512
573 Ga0268266_11028465 3300028379 Bacteria 797
574 Ga0268265_10001794 3300028380 Bacteria 17212
575 Ga0268265_10140629 3300028380 Bacteria 2020
576 Ga0268265_10144093 3300028380 Bacteria 1999
577 Ga0268265_10257721 3300028380 Bacteria 1549
578 Ga0268264_10115371 3300028381 Bacteria 2359
579 Ga0268264_10408325 3300028381 Bacteria 1307
580 Ga0268264_10428336 3300028381 Bacteria 1277
581 Ga0268264_10953771 3300028381 Bacteria 863
582 Ga0268264_11138541 3300028381 Bacteria 789
583 Ga0265337_1005073 3300028556 Bacteria 5313
584 Ga0265334_10005808 3300028573 Bacteria 5372
585 Ga0265336_10097129 3300028666 Bacteria 878
586 Ga0265338_10009207 3300028800 Bacteria 11824
587 Ga0265338_10049107 3300028800 Bacteria 3829
588 Ga0265338_10094073 3300028800 Bacteria 2467
589 Ga0265324_10006770 3300029957 Bacteria 4730
590 Ga0307511_10214577 3300030521 Bacteria 976
591 Ga0265330_10014736 3300031235 Bacteria 3626
592 Ga0265330_10134665 3300031235 Bacteria 1051
593 Ga0265328_10049034 3300031239 Bacteria 1551
594 Ga0265325_10072037 3300031241 Bacteria 1733
595 Ga0265325_10079165 3300031241 Bacteria 1636
596 Ga0265339_10000209 3300031249 Bacteria 48039
597 Ga0265339_10078648 3300031249 Bacteria 1746
598 Ga0265339_10102181 3300031249 Bacteria 1490
599 Ga0265339_10105466 3300031249 Bacteria 1463
600 Ga0265331_10002092 3300031250 Bacteria 13775
601 Ga0265331_10003605 3300031250 Bacteria 9913
602 Ga0265327_10000176 3300031251 Bacteria 137002
603 Ga0265316_10004054 3300031344 Bacteria 14658
604 Ga0265316_10004227 3300031344 Bacteria 14342
605 Ga0265316_10198831 3300031344 Bacteria 1487
606 Ga0307408_100061935 3300031548 Bacteria 2732
607 Ga0307408_100185011 3300031548 Bacteria 1674
608 Ga0265313_10000004 3300031595 Bacteria 188027
609 Ga0265313_10062762 3300031595 Bacteria 1735
610 Ga0265314_10002032 3300031711 Bacteria 21431
611 Ga0265314_10031258 3300031711 Bacteria 3934
612 Ga0265314_10058659 3300031711 Bacteria 2637
613 Ga0265342_10006946 3300031712 Bacteria 8366
614 Ga0265342_10177902 3300031712 Bacteria 1166
615 Ga0316576_10012341 3300031727 Bacteria 5640
616 Ga0316576_10096914 3300031727 Bacteria 2202
617 Ga0316578_10133806 3300031728 Bacteria 1492
618 Ga0316578_10317503 3300031728 Bacteria 930
619 Ga0307405_10019903 3300031731 Bacteria 3740
620 Ga0307405_10037115 3300031731 Bacteria 2926
621 Ga0307405_10164712 3300031731 Bacteria 1575
622 Ga0307405_10999306 3300031731 Bacteria 714
623 Ga0307413_10082285 3300031824 Bacteria 2067
624 Ga0307518_10152317 3300031838 Bacteria 1598
625 Ga0307410_10007540 3300031852 Bacteria 5964
626 Ga0307410_10081588 3300031852 Bacteria 2272
627 Ga0307410_10141492 3300031852 Bacteria 1780
628 Ga0307410_10204546 3300031852 Bacteria 1509
629 Ga0307410_10316451 3300031852 Bacteria 1237
630 Ga0307406_10026687 3300031901 Bacteria 3471
631 Ga0307406_10083486 3300031901 Bacteria 2130
632 Ga0307407_10006582 3300031903 Bacteria 5184
633 Ga0307407_10092424 3300031903 Bacteria 1858
634 Ga0307407_10123813 3300031903 Bacteria 1643
635 Ga0307409_100100105 3300031995 Bacteria 2402
636 Ga0307409_100203471 3300031995 Bacteria 1773
637 Ga0307409_100211985 3300031995 Bacteria 1741
638 Ga0307409_100386489 3300031995 Bacteria 1332
639 Ga0307409_100576246 3300031995 Bacteria 1109
640 Ga0307409_100962409 3300031995 Bacteria 870
641 Ga0307416_100017432 3300032002 Bacteria 5026
642 Ga0307416_100176034 3300032002 Bacteria 1998
643 Ga0307416_100518137 3300032002 Bacteria 1260
644 Ga0307414_10053577 3300032004 Bacteria 2814
645 Ga0307414_10140692 3300032004 Bacteria 1889
646 Ga0307414_10282147 3300032004 Bacteria 1396
647 Ga0307414_10906373 3300032004 Bacteria 808
648 Ga0307411_10038737 3300032005 Bacteria 3010
649 Ga0307411_10073014 3300032005 Bacteria 2332
650 Ga0307411_10095944 3300032005 Bacteria 2083
651 Ga0307411_10147723 3300032005 Bacteria 1742
652 Ga0307411_10150085 3300032005 Unclassified 1731
653 Ga0307411_10155673 3300032005 Bacteria 1704
654 Ga0307415_100006168 3300032126 Bacteria 6436
655 Ga0307415_100049196 3300032126 Bacteria 2849
656 Ga0307415_100228616 3300032126 Bacteria 1496
657 Ga0307507_10082573 3300033179 Bacteria 2816
658 Ga0373926_0001823 3300035083 Bacteria 6623
659 Ga0373929_0030848 3300035085 Bacteria 1145
660 Ga0373952_0066259 3300035092 Bacteria 894
661 Ga0373939_0130243 3300035114 Bacteria 897
662 Ga0373939_0149164 3300035114 Bacteria 850
663 Ga0373954_0106603 3300035118 Bacteria 1354
664 Ga0373956_0020139 3300035119 Bacteria 2836
665 Ga0373956_0052367 3300035119 Bacteria 1836
666 Ga0373943_0244677 3300035170 Bacteria 1006
667 Ga0373946_0036679 3300035171 Bacteria 1989
668 Ga0373946_0075875 3300035171 Bacteria 1462
669 Ga0373946_0372657 3300035171 Bacteria 717
670 Ga0373942_0008853 3300035207 Bacteria 2352
671 Ga0373931_0044305 3300035691 Bacteria 2346
672 Ga0373931_0052452 3300035691 Bacteria 2174
673 Ga0373931_0141454 3300035691 Bacteria 1394
674 Ga0373935_0197784 3300035692 Bacteria 1388
675 Ga0373935_0325804 3300035692 Bacteria 1091
676 Ga0373933_0013413 3300035724 Bacteria 4541
677 Ga0373947_0000031 3300035725 Bacteria 73833
678 Ga0373947_0158352 3300035725 Bacteria 1463
679 Ga0373937_0022396 3300036401 Bacteria 5681
680 Ga0373937_0126984 3300036401 Bacteria 2380
681 Ga0373937_0286638 3300036401 Bacteria 1556
682 Ga0373937_0715890 3300036401 Bacteria 948
683 Ga0316584_0024092 3300036712 Bacteria 4452
684 Ga0316584_0172788 3300036712 Bacteria 1602
685 Ga0373925_0271028 3300037068 Bacteria 1365
686 Ga0373925_0301996 3300037068 Bacteria 1293
687 Ga0395899_0000421 3300037312 Bacteria 49097
688 Ga0395899_0003093 3300037312 Bacteria 13244
689 Ga0395900_0000159 3300037418 Bacteria 111486
690 Ga0395900_0000445 3300037418 Bacteria 59139
691 Ga0395900_0055109 3300037418 Bacteria 4093
692 Ga0395900_0136280 3300037418 Bacteria 2515
693 Ga0395900_0138891 3300037418 Bacteria 2489
694 Ga0395898_0000425 3300037466 Bacteria 89768
695 Ga0395898_0002174 3300037466 Bacteria 24017
696 Ga0395898_0005757 3300037466 Bacteria 13337
697 Ga0395898_0217076 3300037466 Bacteria 1824
698 Ga0395905_0531470 3300037471 Bacteria 1077
699 Ga0395901_0000017 3300038443 Bacteria 345003
700 Ga0395901_0000109 3300038443 Bacteria 112882
701 Ga0395901_0009637 3300038443 Bacteria 9798
702 Ga0395901_0043931 3300038443 Bacteria 4635
703 Ga0436365_1876799 3300039437 Bacteria 3966
704 Ga0436360_0035010 3300039438 Bacteria 1878
705 Ga0436361_0807603 3300039447 Bacteria 982
706 Ga0436361_1124937 3300039447 Bacteria 3569
707 Ga0436363_0588233 3300039450 Bacteria 1294
708 Ga0451837_1244620 3300041494 Bacteria 1099
709 Ga0451849_0243995 3300041505 Bacteria 720
710 Ga0451853_2650962 3300041512 Bacteria 616
711 Ga0439445_0005495 3300042004 Bacteria 2889
712 Ga0439448_0012918 3300042005 Bacteria 2505
713 Ga0450898_003049 3300042134 Bacteria 2376
714 Ga0450910_023046 3300042147 Bacteria 950
715 Ga0439444_0025165 3300042437 Bacteria 1081
716 Ga0451577_0008981 3300042876 Bacteria 9662
717 Ga0451577_0065552 3300042876 Bacteria 3239
718 Ga0451577_0125156 3300042876 Bacteria 2303
719 Ga0451577_0703078 3300042876 Bacteria 915
720 Ga0466969_0000008 3300044656 Bacteria 139607
721 Ga0466969_0028334 3300044656 Bacteria 2863
722 Ga0466969_0029616 3300044656 Bacteria 2794
723 Ga0466969_0037730 3300044656 Bacteria 2435
724 Ga0466972_0032516 3300044658 Bacteria 2561
725 Ga0466973_0022991 3300044659 Bacteria 5971
726 Ga0466977_0000673 3300044666 Bacteria 12021
727 Ga0453683_0143288 3300044673 Bacteria 1509
728 Ga0466965_0000743 3300044683 Bacteria 12188
729 Ga0466966_0000082 3300044684 Bacteria 59091
730 Ga0466966_0009579 3300044684 Bacteria 6411
731 Ga0466966_0037145 3300044684 Bacteria 3142
732 Ga0466966_0038085 3300044684 Bacteria 3099
733 Ga0466966_0045063 3300044684 Bacteria 2821
734 Ga0466961_0001496 3300044693 Bacteria 14495
735 Ga0466961_0009743 3300044693 Bacteria 6113
736 Ga0466963_0001180 3300044694 Bacteria 13723
737 Ga0466963_0033456 3300044694 Bacteria 3338
738 Ga0466963_0086023 3300044694 Bacteria 2135
739 Ga0466963_0088979 3300044694 Bacteria 2100
740 Ga0466963_0336435 3300044694 Bacteria 1063
741 Ga0466964_0022176 3300044706 Bacteria 2461
742 Ga0466964_0475049 3300044706 Bacteria 667
743 Ga0453684_0001146 3300044712 Bacteria 82773
744 Ga0453684_0736806 3300044712 Bacteria 1068
745 Ga0466971_0007186 3300044719 Bacteria 4848
746 Ga0466971_0039338 3300044719 Bacteria 2122
747 Ga0466971_0204817 3300044719 Bacteria 932
748 Ga0466971_0281552 3300044719 Bacteria 796
749 Ga0466970_0025967 3300044765 Bacteria 3069
750 Ga0466970_0110582 3300044765 Bacteria 1500
751 Ga0466957_0181816 3300044842 Bacteria 1373
752 Ga0466959_0029019 3300045049 Bacteria 4097
753 Ga0466959_0117826 3300045049 Bacteria 1890
754 Ga0451576_0291384 3300045051 Bacteria 1706
755 Ga0451576_0468889 3300045051 Bacteria 1322
756 Ga0466958_0001820 3300045836 Bacteria 10358
757 Ga0466958_0002956 3300045836 Bacteria 8700
758 Ga0466958_0380643 3300045836 Bacteria 910
759 Ga0466967_0257460 3300045976 Bacteria 1669
760 Ga0466967_0373277 3300045976 Bacteria 1384
761 Ga0466967_0664439 3300045976 Bacteria 1031
762 Ga0495592_0030243 3300046454 Bacteria 4097
763 Ga0495629_0483559 3300046459 Bacteria 836
764 Ga0495638_0135704 3300046460 Bacteria 1441
765 Ga0495653_0139753 3300046463 Bacteria 1705
766 Ga0495580_0283406 3300046472 Bacteria 1130
767 Ga0495582_0148080 3300046473 Bacteria 1332
768 Ga0495639_0210381 3300046475 Bacteria 954
769 Ga0495662_0050118 3300046476 Bacteria 2015
770 Ga0495594_0054450 3300046499 Bacteria 2205
771 Ga0495594_0062189 3300046499 Bacteria 2067
772 Ga0495618_0020940 3300046514 Bacteria 4027
773 Ga0495618_0237874 3300046514 Bacteria 1145
774 Ga0495618_0315385 3300046514 Bacteria 969
775 Ga0495630_0098480 3300046517 Bacteria 2212
776 Ga0495630_0300125 3300046517 Bacteria 1227
777 Ga0495642_0039507 3300046528 Bacteria 1915
778 Ga0495652_0041799 3300046529 Bacteria 3955
779 Ga0495665_0008286 3300046531 Bacteria 5635
780 Ga0495665_0161935 3300046531 Bacteria 1166
781 Ga0495640_0083114 3300046533 Bacteria 2125
782 Ga0495586_0052221 3300046535 Bacteria 2213
783 Ga0495586_0175633 3300046535 Bacteria 1211
784 Ga0495586_0248381 3300046535 Bacteria 1015
785 Ga0495587_0063377 3300046536 Bacteria 2162
786 Ga0495587_0104224 3300046536 Bacteria 1633
787 Ga0495587_0189405 3300046536 Bacteria 1165
788 Ga0495645_0006492 3300046543 Bacteria 8120
789 Ga0495645_0031033 3300046543 Bacteria 3892
790 Ga0495645_0063452 3300046543 Bacteria 2675
791 Ga0495622_0061393 3300046557 Bacteria 1740
792 Ga0495667_0039532 3300046559 Bacteria 3136
793 Ga0495656_0222307 3300046615 Bacteria 944
794 Ga0495634_0023766 3300046642 Bacteria 4306
795 Ga0495634_0069434 3300046642 Bacteria 2325
796 Ga0495634_0102008 3300046642 Bacteria 1853
797 Ga0495625_0105085 3300046660 Bacteria 1935
798 Ga0495635_0079368 3300046663 Bacteria 2246
799 Ga0495635_0083784 3300046663 Bacteria 2182
800 Ga0495635_0305641 3300046663 Bacteria 1066
801 Ga0495659_0101908 3300046664 Bacteria 1113
802 Ga0495588_0082529 3300046674 Bacteria 1679
803 Ga0495657_0138140 3300046675 Bacteria 1521
804 Ga0495599_0168889 3300046678 Bacteria 1350
805 Ga0495599_0195806 3300046678 Bacteria 1242
806 Ga0495647_0134608 3300046681 Bacteria 1050
807 Ga0495669_0084137 3300046684 Bacteria 1463
808 Ga0495600_0042250 3300046809 Bacteria 2972
809 Ga0495600_0117065 3300046809 Bacteria 1734
810 Ga0495581_0357677 3300047315 Bacteria 852
811 Ga0495604_0071217 3300047317 Bacteria 2630
812 Ga0495674_0073126 3300047319 Bacteria 2956
813 Ga0495674_0120872 3300047319 Bacteria 2213
814 Ga0495672_0088848 3300047320 Bacteria 1702
815 Ga0495675_0115959 3300047444 Bacteria 1670
816 Ga0495684_0008456 3300047471 Bacteria 7967
817 Ga0495686_0000007 3300047472 Bacteria 732622
818 Ga0495686_0016441 3300047472 Bacteria 5016
819 Ga0495686_0116205 3300047472 Bacteria 1599
820 Ga0495602_0035227 3300048088 Bacteria 4670
821 Ga0496100_0334857 3300048903 Bacteria 1140
822 Ga0496102_0000693 3300048905 Bacteria 33499
823 Ga0496102_0076207 3300048905 Bacteria 3085
824 Ga0496102_0129691 3300048905 Bacteria 2359
825 Ga0496102_0237220 3300048905 Bacteria 1720
826 Ga0496104_0000014 3300048907 Bacteria 377972
827 Ga0496104_0000542 3300048907 Bacteria 32369
828 Ga0496105_0089615 3300048908 Bacteria 2541
829 Ga0496107_0009969 3300048910 Bacteria 6593
830 Ga0496107_0330020 3300048910 Bacteria 1135
831 Ga0496108_0000659 3300048911 Bacteria 26589
832 Ga0496109_0001342 3300048912 Bacteria 20335
833 Ga0496109_0165812 3300048912 Bacteria 2071
834 Ga0496110_0010771 3300048913 Bacteria 7452
835 Ga0496110_0014556 3300048913 Bacteria 6537
836 Ga0496112_0036657 3300048915 Bacteria 4784
837 Ga0496115_0000923 3300048918 Bacteria 21295
838 Ga0496115_0001557 3300048918 Bacteria 16490
839 Ga0496115_0445497 3300048918 Bacteria 1047
840 Ga0501033_0134943 3300049570 Bacteria 1786
841 Ga0501034_0008979 3300049571 Bacteria 10501
842 Ga0501036_0238656 3300049572 Bacteria 1525
843 Ga0501037_0099222 3300049573 Bacteria 2103
844 Ga0501038_0008308 3300049574 Bacteria 9555
845 Ga0501038_0297491 3300049574 Bacteria 1267
846 Ga0501039_0075802 3300049575 Bacteria 2614
847 Ga0501039_0122578 3300049575 Bacteria 2038
848 Ga0501039_0676276 3300049575 Bacteria 808
849 Ga0501040_0132370 3300049576 Bacteria 1754
850 Ga0501040_0196896 3300049576 Bacteria 1430
851 Ga0501041_0045415 3300049577 Bacteria 2671
852 Ga0501042_0251306 3300049578 Bacteria 1276
853 Ga0501043_0018518 3300049579 Bacteria 5463
854 Ga0501043_0074691 3300049579 Bacteria 2663
855 Ga0501043_0543496 3300049579 Bacteria 864
856 Ga0501046_0048523 3300049580 Bacteria 3362
857 Ga0501046_0108943 3300049580 Bacteria 2118
858 Ga0501047_0124677 3300049581 Bacteria 2456
859 Ga0501047_0179023 3300049581 Bacteria 1987
860 Ga0501047_0358482 3300049581 Bacteria 1294
861 Ga0501048_0001269 3300049582 Bacteria 19114
862 Ga0501067_0021474 3300049583 Bacteria 3572
863 Ga0501067_0030717 3300049583 Bacteria 2980
864 Ga0501067_0084445 3300049583 Bacteria 1761
865 Ga0501068_0003826 3300049584 Bacteria 8164
866 Ga0501069_0004771 3300049585 Bacteria 7017
867 Ga0501069_0009983 3300049585 Bacteria 5019
868 Ga0501070_0018564 3300049586 Bacteria 5834
869 Ga0501070_0024586 3300049586 Bacteria 5051
870 Ga0501070_0066405 3300049586 Bacteria 2987
871 Ga0501070_0172373 3300049586 Bacteria 1782
872 Ga0501070_0432306 3300049586 Bacteria 1062
873 Ga0501071_0003078 3300049587 Bacteria 10338
874 Ga0501072_0002641 3300049588 Bacteria 13433
875 Ga0501072_0141522 3300049588 Bacteria 1918
876 Ga0501072_0367758 3300049588 Bacteria 1141
877 Ga0501073_0088631 3300049589 Bacteria 2151
878 Ga0501074_0001140 3300049590 Bacteria 17400
879 Ga0501074_0145963 3300049590 Bacteria 1692
880 Ga0501074_0767700 3300049590 Bacteria 680
881 Ga0501075_0046762 3300049591 Bacteria 3251
882 Ga0501076_0147375 3300049592 Bacteria 1914
883 Ga0501076_0208768 3300049592 Bacteria 1595
884 Ga0501076_0572006 3300049592 Bacteria 932
885 Ga0501077_0001806 3300049593 Bacteria 12930
886 Ga0501077_0155092 3300049593 Bacteria 1453
887 Ga0501217_045400 3300049661 Bacteria 1132
888 Ga0501233_037201 3300049668 Bacteria 1129
889 Ga0501233_081863 3300049668 Bacteria 832
890 Ga0501260_005022 3300049689 Bacteria 1235
891 Ga0501234_005779 3300049707 Bacteria 1933
892 Ga0501245_005183 3300049708 Bacteria 1803
893 Ga0501079_0268600 3300049741 Bacteria 1333
894 Ga0501080_0021326 3300049742 Bacteria 5996
895 Ga0501080_0085723 3300049742 Bacteria 2927
896 Ga0501081_0083532 3300049743 Bacteria 2239
897 Ga0501081_0124233 3300049743 Bacteria 1840
898 Ga0501083_0004908 3300049744 Bacteria 9462
899 Ga0501232_029030 3300049757 Bacteria 758
900 Ga0501262_030517 3300049759 Bacteria 775
901 Ga0501268_002141 3300049765 Bacteria 2569
902 Ga0501268_009827 3300049765 Bacteria 1477
903 Ga0501270_014857 3300049767 Bacteria 1103
904 Ga0501272_001712 3300049769 Bacteria 2111
905 Ga0501035_0407055 3300049822 Bacteria 1131
906 Ga0501044_0008204 3300049823 Bacteria 11460
907 Ga0501045_0061254 3300049824 Bacteria 2761
908 Ga0501045_0225827 3300049824 Bacteria 1394
909 Ga0501045_0476465 3300049824 Bacteria 927
910 nmdc:mga0k408_363755_c1 3300050493 Bacteria 862
911 nmdc:mga0k408_49684_c1 3300050493 Bacteria 2428
912 nmdc:mga06z11_432393_c1 3300050494 Bacteria 794
913 nmdc:mga06z11_97626_c1 3300050494 Bacteria 1606
914 nmdc:mga05p37_162125_c1 3300050507 Bacteria 2730
915 nmdc:mga05p37_458105_c1 3300050507 Bacteria 1474
916 nmdc:mga05p37_69749_c1 3300050507 Bacteria 4324
917 nmdc:mga09592_4370_c1 3300050508 Bacteria 11429
918 nmdc:mga09592_64643_c1 3300050508 Bacteria 3097
919 nmdc:mga0qj67_145_c1 3300050509 Bacteria 41305
920 nmdc:mga0qj67_24987_c1 3300050509 Bacteria 4610
921 nmdc:mga0qj67_36230_c1 3300050509 Bacteria 3859
922 nmdc:mga0qj67_41314_c1 3300050509 Bacteria 3626
923 nmdc:mga06r32_113138_c1 3300050510 Bacteria 2671
924 nmdc:mga06r32_244046_c1 3300050510 Bacteria 1783
925 nmdc:mga06r32_244491_c1 3300050510 Bacteria 1782
926 nmdc:mga06r32_30913_c1 3300050510 Bacteria 5025
927 nmdc:mga06r32_6579_c1 3300050510 Bacteria 10441
928 nmdc:mga08y16_50614_c1 3300050511 Bacteria 4347
929 nmdc:mga08y16_762988_c1 3300050511 Bacteria 962
930 nmdc:mga08y16_76635_c1 3300050511 Bacteria 3485
931 nmdc:mga0n895_156754_c1 3300050512 Bacteria 2308
932 nmdc:mga0n895_163392_c1 3300050512 Bacteria 2258
933 nmdc:mga0n895_36095_c1 3300050512 Bacteria 4771
934 nmdc:mga0n895_55943_c1 3300050512 Bacteria 3885
935 nmdc:mga0n895_693533_c1 3300050512 Bacteria 1015
936 nmdc:mga0rr50_224953_c1 3300050513 Bacteria 1551
937 nmdc:mga0rr50_244214_c1 3300050513 Bacteria 1489
938 nmdc:mga0rr50_45452_c1 3300050513 Bacteria 3227
939 nmdc:mga0rr50_762536_c1 3300050513 Bacteria 826
940 nmdc:mga0rr50_83232_c1 3300050513 Bacteria 2473
941 nmdc:mga0rr50_852479_c1 3300050513 Bacteria 777
942 nmdc:mga08x19_126962_c1 3300050514 Bacteria 1713
943 nmdc:mga08x19_14339_c1 3300050514 Bacteria 4807
944 nmdc:mga08x19_264729_c1 3300050514 Bacteria 1189
945 nmdc:mga08x19_289370_c1 3300050514 Bacteria 1136
946 nmdc:mga08x19_6037_c1 3300050514 Bacteria 7159
947 nmdc:mga08x19_88799_c1 3300050514 Bacteria 2038
948 nmdc:mga0a205_115483_c1 3300050515 Bacteria 2583
949 nmdc:mga0a205_177653_c1 3300050515 Bacteria 2024
950 nmdc:mga0a205_327552_c1 3300050515 Bacteria 1402
951 nmdc:mga0a205_51645_c1 3300050515 Bacteria 3969
952 nmdc:mga0a205_913489_c1 3300050515 Bacteria 725
953 Ga0495601_0041642 3300053077 Bacteria 2880
954 Ga0495601_0054612 3300053077 Bacteria 2527
955 Ga0495595_0023819 3300053084 Bacteria 2699
956 Ga0500583_0030584 3300053092 Bacteria 2360
957 Ga0500566_0026880 3300053094 Bacteria 3368
958 Ga0500595_006337 3300053119 Bacteria 5027
959 Ga0500618_002101 3300053125 Bacteria 7898
960 Ga0500618_002594 3300053125 Bacteria 6670
961 Ga0500655_008591 3300053133 Bacteria 1839
962 Ga0500559_0284678 3300053136 Bacteria 777
963 Ga0500603_054851 3300053150 Bacteria 1100
964 Ga0500601_000465 3300053737 Bacteria 6552
965 Ga0501084_0005169 3300054114 Bacteria 10676
966 Ga0501084_0005653 3300054114 Bacteria 10265
967 Ga0501084_0481064 3300054114 Bacteria 1049
968 Ga0590071_001022 3300059421 Bacteria 7605
969 Ga0590077_005597 3300059426 Bacteria 2569
970 Ga0501082_0007067 3300060353 Bacteria 9686
971 Ga0466962_0046644 3300061719 Bacteria 2070
972 2515688237 2515154123 Bacteria 6387382
973 2719384146 2718217927 Bacteria 6972593
974 2723875837 2721755763 Bacteria 4464185
975 2842462823 2842462802 Bacteria 6588055
976 2884700044 2884693830 Bacteria 11273186
977 2891330014 2891326441 Bacteria 6439512
978 2895450016 2895442618 Bacteria 11027144
979 2904436662 2904434214 Bacteria 6230908
980 3006428595 3006425503 Bacteria 6491253
981 3006488871 3006486233 Bacteria 8157040
982 8005278856 8005275841 Bacteria 6929066
983 8008487469 8008485437 Bacteria 7198341
984 8025481731 8025478263 Bacteria 8209203
985 8025527011 8025524527 Bacteria 7197316
986 8033689934 8033684223 Bacteria 6906479
987 8047896765 8047893842 Bacteria 11723082
988 8056832119 8056829672 Bacteria 9045328
989 Ga0496106_0426757
990 MBSR1b_contig_11739019
991 rootH2_10144468
992 Ga0065715_10167639
993 Ga0065715_10177927
994 Ga0065715_10196336
995 Ga0065707_10290892
996 Ga0065707_10319758
997 Ga0070658_10045668
998 Ga0070658_10046895
999 Ga0070658_10069590
1000 Ga0070658_10190980
1001 Ga0070658_11061796
1002 Ga0070676_10036268
1003 Ga0070676_10206723
1004 Ga0070676_10237696
1005 Ga0070683_100000655
1006 Ga0070683_100006909
1007 Ga0070683_100079053
1008 Ga0070683_100369058
1009 Ga0070683_100413459
1010 Ga0070683_100604067
1011 Ga0070690_100337578
1012 Ga0070670_100002779
1013 Ga0070670_100216564
1014 Ga0070670_100339023
1015 Ga0070666_10498290
1016 Ga0070680_100006802
1017 Ga0070680_100024698
1018 Ga0070680_100031242
1019 Ga0070682_100071427
1020 Ga0070682_100320308
1021 Ga0068868_100089736
1022 Ga0068868_100103379
1023 Ga0070660_100065655
1024 Ga0070660_100075721
1025 Ga0070660_100117534
1026 Ga0070660_100385862
1027 Ga0070687_100049785
1028 Ga0070661_100073631
1029 Ga0070661_100121211
1030 Ga0070692_10054394
1031 Ga0070692_10282046
1032 Ga0070668_100292271
1033 Ga0070668_100663585
1034 Ga0070669_100000566
1035 Ga0070675_100224962
1036 Ga0070675_100267169
1037 Ga0070675_100605232
1038 Ga0070675_101225365
1039 Ga0070671_100009865
1040 Ga0070671_100010716
1041 Ga0070671_100395295
1042 Ga0070671_100451730
1043 Ga0070674_100299205
1044 Ga0070673_100064069
1045 Ga0070673_100881302
1046 Ga0070659_100029486
1047 Ga0070659_100038787
1048 Ga0070659_100163612
1049 Ga0070659_100205948
1050 Ga0070659_100445278
1051 Ga0070667_100147454
1052 Ga0070709_10016652
1053 Ga0070709_10463011
1054 Ga0070714_100006448
1055 Ga0070714_100032491
1056 Ga0070714_100095720
1057 Ga0070714_100188936
1058 Ga0070714_100242505
1059 Ga0070713_100013756
1060 Ga0070713_100017633
1061 Ga0070713_100565883
1062 Ga0070713_100687631
1063 Ga0070710_10003320
1064 Ga0070710_10003572
1065 Ga0070701_10003257
1066 Ga0070701_10056268
1067 Ga0070711_100023585
1068 Ga0070705_100002041
1069 Ga0070700_100131955
1070 Ga0070700_100253087
1071 Ga0070694_100007030
1072 Ga0070694_100043995
1073 Ga0070694_100061005
1074 Ga0070694_100243159
1075 Ga0070694_100547592
1076 Ga0070694_100577194
1077 Ga0070708_100000138
1078 Ga0070708_100000381
1079 Ga0070708_100012335
1080 Ga0070708_100080082
1081 Ga0070663_100006516
1082 Ga0070678_100070099
1083 Ga0070678_100533244
1084 Ga0070662_100057016
1085 Ga0070662_100089880
1086 Ga0070681_10003042
1087 Ga0070681_10008604
1088 Ga0070681_10125458
1089 Ga0070681_10169599
1090 Ga0070681_10419523
1091 Ga0068867_100032665
1092 Ga0068867_100100291
1093 Ga0068867_100230504
1094 Ga0070685_10002911
1095 Ga0070706_100008495
1096 Ga0070706_100036866
1097 Ga0070706_100074652
1098 Ga0070706_100127696
1099 Ga0070706_100191135
1100 Ga0070706_100758452
1101 Ga0070707_100002489
1102 Ga0070707_100032687
1103 Ga0070707_100038820
1104 Ga0070707_100044161
1105 Ga0070707_100134698
1106 Ga0070707_100233126
1107 Ga0070707_101086147
1108 Ga0070698_100000122
1109 Ga0070698_100002933
1110 Ga0070698_100147322
1111 Ga0070698_100165574
1112 Ga0070698_100300389
1113 Ga0070698_100351545
1114 Ga0070698_100380437
1115 Ga0070698_100504197
1116 Ga0070699_100000779
1117 Ga0070699_100001147
1118 Ga0070699_100002138
1119 Ga0070699_100010635
1120 Ga0070699_100064235
1121 Ga0070699_100074979
1122 Ga0070699_100125188
1123 Ga0070699_100740251
1124 Ga0070679_100013231
1125 Ga0070679_100026551
1126 Ga0070679_100060525
1127 Ga0070679_100069429
1128 Ga0070679_100127633
1129 Ga0070679_100259329
1130 Ga0070679_100605950
1131 Ga0070679_101220636
1132 Ga0070684_100016107
1133 Ga0070684_100031010
1134 Ga0070684_100034276
1135 Ga0070684_100055337
1136 Ga0070684_100224294
1137 Ga0070684_100349077
1138 Ga0070684_100450704
1139 Ga0070697_100000272
1140 Ga0070697_100002379
1141 Ga0070697_100008526
1142 Ga0070697_100050347
1143 Ga0070697_100064880
1144 Ga0068853_100251114
1145 Ga0068853_100266207
1146 Ga0068853_100358428
1147 Ga0068853_100948110
1148 Ga0070672_100164581
1149 Ga0070672_100222904
1150 Ga0070686_100110580
1151 Ga0070695_100002517
1152 Ga0070695_100021848
1153 Ga0070695_100046003
1154 Ga0070695_100130069
1155 Ga0070696_100000059
1156 Ga0070696_100003944
1157 Ga0070696_100017114
1158 Ga0070696_100018215
1159 Ga0070696_100346782
1160 Ga0070696_100409163
1161 Ga0070693_100018308
1162 Ga0070693_100270123
1163 Ga0070665_100082484
1164 Ga0070665_100120769
1165 Ga0070665_100498637
1166 Ga0070704_100471533
1167 Ga0068855_100002369
1168 Ga0068855_100030887
1169 Ga0068855_100047437
1170 Ga0068855_100373390
1171 Ga0068855_100604565
1172 Ga0070664_100013004
1173 Ga0070664_100289697
1174 Ga0070664_100300535
1175 Ga0070664_100587608
1176 Ga0068857_100009041
1177 Ga0068857_100010828
1178 Ga0068857_100014675
1179 Ga0068854_100049592
1180 Ga0068854_100224209
1181 Ga0068856_100007921
1182 Ga0068856_100111496
1183 Ga0068856_100192461
1184 Ga0068856_100195593
1185 Ga0068856_100243791
1186 Ga0068856_100364064
1187 Ga0068856_100579993
1188 Ga0070702_100151051
1189 Ga0068852_100020060
1190 Ga0068852_100128548
1191 Ga0068852_100161080
1192 Ga0068852_100189299
1193 Ga0068852_100335586
1194 Ga0068852_100464638
1195 Ga0068859_100123633
1196 Ga0068859_100182134
1197 Ga0068859_100186844
1198 Ga0068859_100228879
1199 Ga0068859_100511465
1200 Ga0068859_100620865
1201 Ga0068864_100032802
1202 Ga0068864_100216853
1203 Ga0068866_10090041
1204 Ga0068861_100231039
1205 Ga0068870_10018009
1206 Ga0068863_100099236
1207 Ga0068863_100138558
1208 Ga0068858_100020693
1209 Ga0068858_100227595
1210 Ga0068858_100318188
1211 Ga0068860_100011796
1212 Ga0068860_100481535
1213 Ga0068860_100814766
1214 Ga0068860_100915722
1215 Ga0068862_100007064
1216 Ga0068862_100640600
1217 Ga0068862_100856178
1218 Ga0068862_100928672
1219 Ga0068862_101013634
1220 Ga0081455_10000733
1221 Ga0081455_10147178
1222 Ga0081538_10006932
1223 Ga0081538_10013401
1224 Ga0081538_10019713
1225 Ga0081539_10000087
1226 Ga0070716_100002710
1227 Ga0070712_100058906
1228 Ga0070712_100273466
1229 Ga0075367_10086696
1230 Ga0075366_10051119
1231 Ga0075366_10168125
1232 Ga0097621_100004481
1233 Ga0097621_100077827
1234 Ga0097621_100095490
1235 Ga0097621_100369902
1236 Ga0075370_10015474
1237 Ga0068871_100004639
1238 Ga0068871_100032288
1239 Ga0068871_100049384
1240 Ga0068871_100063462
1241 Ga0075430_100042803
1242 Ga0075430_100060159
1243 Ga0075430_100283840
1244 Ga0075431_100047077
1245 Ga0075431_100067520
1246 Ga0075431_100106084
1247 Ga0075431_100189656
1248 Ga0075431_100197940
1249 Ga0075431_101006526
1250 Ga0075433_10438048
1251 Ga0075434_100004223
1252 Ga0075434_100038828
1253 Ga0075434_100054837
1254 Ga0075434_100383321
1255 Ga0075434_100427666
1256 Ga0075434_100770395
1257 Ga0075429_100719775
1258 Ga0068865_100001396
1259 Ga0068865_100071903
1260 Ga0068865_100194759
1261 Ga0075436_100008037
1262 Ga0075436_100016660
1263 Ga0075436_100030317
1264 Ga0075436_100048619
1265 Ga0075436_100185848
1266 Ga0075436_100341323
1267 Ga0097620_100123624
1268 Ga0097620_100182145
1269 Ga0097620_100186859
1270 Ga0097620_100228882
1271 Ga0097620_100511434
1272 Ga0097620_100620873
1273 Ga0075435_100051075
1274 Ga0075435_100089319
1275 Ga0099794_10119513
1276 Ga0099795_10018957
1277 Ga0105240_10002142
1278 Ga0105240_10003537
1279 Ga0105240_10004066
1280 Ga0105240_10016265
1281 Ga0105240_10091573
1282 Ga0105240_10179009
1283 Ga0105240_11096136
1284 Ga0105240_11129592
1285 Ga0105240_11310902
1286 Ga0111539_10117554
1287 Ga0105245_10075361
1288 Ga0105245_10128517
1289 Ga0105245_10230510
1290 Ga0105245_10724424
1291 Ga0114129_10000260
1292 Ga0114129_10156707
1293 Ga0105243_10791779
1294 Ga0105241_10019962
1295 Ga0105241_10221046
1296 Ga0105241_10431043
1297 Ga0105241_10495752
1298 Ga0105241_11155599
1299 Ga0105242_10000494
1300 Ga0105242_10002807
1301 Ga0105242_10116716
1302 Ga0105242_10326789
1303 Ga0105242_10560451
1304 Ga0105248_10000006
1305 Ga0105248_10045933
1306 Ga0105248_10050185
1307 Ga0105248_10110766
1308 Ga0105248_10151528
1309 Ga0105248_10157021
1310 Ga0105248_10265137
1311 Ga0105248_10360453
1312 Ga0105248_10405388
1313 Ga0105248_10500149
1314 Ga0105248_10884624
1315 Ga0105237_10314435
1316 Ga0105238_10023340
1317 Ga0105238_10040071
1318 Ga0105238_10110244
1319 Ga0105238_10136838
1320 Ga0105238_10408914
1321 Ga0105249_10000582
1322 Ga0105249_10110848
1323 Ga0105249_10320446
1324 Ga0105249_10688532
1325 Ga0105249_10707473
1326 Ga0105239_10029595
1327 Ga0105239_10065246
1328 Ga0105239_10247823
1329 Ga0105246_10239800
1330 Ga0105246_10276024
1331 Ga0105246_10517081
1332 Ga0157323_1003327
1333 Ga0157371_10042745
1334 Ga0157370_10089962
1335 Ga0157370_10230707
1336 Ga0157370_10708518
1337 Ga0157369_10001363
1338 Ga0157369_10003286
1339 Ga0157369_10058133
1340 Ga0157369_10122350
1341 Ga0157369_10147357
1342 Ga0157369_10198817
1343 Ga0157369_10228799
1344 Ga0157369_10250883
1345 Ga0157369_10381642
1346 Ga0157369_10424739
1347 Ga0157374_10000158
1348 Ga0157374_10013300
1349 Ga0157374_10133732
1350 Ga0157374_10243823
1351 Ga0157374_10280137
1352 Ga0157374_10460804
1353 Ga0157378_10025984
1354 Ga0163162_10036600
1355 Ga0163162_10087536
1356 Ga0163162_10285468
1357 Ga0163162_10374191
1358 Ga0157372_10000968
1359 Ga0157372_10012193
1360 Ga0157372_10024833
1361 Ga0157372_10024910
1362 Ga0157372_10034058
1363 Ga0157372_10056941
1364 Ga0157372_10188970
1365 Ga0157372_10457521
1366 Ga0157372_10552813
1367 Ga0157372_10565726
1368 Ga0157372_10685876
1369 Ga0157372_10752511
1370 Ga0157372_10835362
1371 Ga0157375_10014989
1372 Ga0157375_10017676
1373 Ga0157375_10161016
1374 Ga0157375_10416950
1375 Ga0163163_10913605
1376 Ga0157380_10005964
1377 Ga0157380_10169393
1378 Ga0182008_10021026
1379 Ga0157377_10134404
1380 Ga0157379_10051452
1381 Ga0157379_10618953
1382 Ga0157376_10000504
1383 Ga0157376_10168130
1384 Ga0157376_10192030
1385 Ga0157376_10244356
1386 Ga0157376_11439227
1387 Ga0183367_1001
1388 Ga0163161_10245198
1389 Ga0197907_11166738
1390 Ga0206356_10711775
1391 Ga0206354_10069137
1392 Ga0213876_10184708
1393 Ga0213871_10023561
1394 Ga0224712_10001684
1395 Ga0207697_10071700
1396 Ga0207682_10004059
1397 Ga0207692_10016610
1398 Ga0207642_10063368
1399 Ga0207680_10239419
1400 Ga0207699_10020457
1401 Ga0207645_10016610
1402 Ga0207645_10037069
1403 Ga0207645_10260144
1404 Ga0207643_10005910
1405 Ga0207705_10017431
1406 Ga0207705_10153349
1407 Ga0207705_10337048
1408 Ga0207705_10693964
1409 Ga0207684_10021616
1410 Ga0207684_10055225
1411 Ga0207684_10219347
1412 Ga0207684_10257645
1413 Ga0207654_10237808
1414 Ga0207707_10001557
1415 Ga0207707_10002130
1416 Ga0207707_10010399
1417 Ga0207707_10067287
1418 Ga0207707_10834887
1419 Ga0207695_10001162
1420 Ga0207695_10003501
1421 Ga0207695_10061983
1422 Ga0207695_10227897
1423 Ga0207695_10249293
1424 Ga0207693_10261133
1425 Ga0207663_10026240
1426 Ga0207660_10011149
1427 Ga0207660_10030762
1428 Ga0207660_10179379
1429 Ga0207660_10188301
1430 Ga0207660_10522818
1431 Ga0207660_10615744
1432 Ga0207657_10028851
1433 Ga0207657_10060219
1434 Ga0207657_10126537
1435 Ga0207657_10496794
1436 Ga0207649_10092720
1437 Ga0207652_10104650
1438 Ga0207652_10183376
1439 Ga0207652_10197228
1440 Ga0207652_10218224
1441 Ga0207652_10364194
1442 Ga0207652_10953022
1443 Ga0207646_10012507
1444 Ga0207646_10032401
1445 Ga0207646_10097667
1446 Ga0207646_10107926
1447 Ga0207646_10285631
1448 Ga0207646_10311500
1449 Ga0207646_10630679
1450 Ga0207681_10001953
1451 Ga0207681_10408253
1452 Ga0207694_10035082
1453 Ga0207694_10223768
1454 Ga0207694_10238891
1455 Ga0207694_10577942
1456 Ga0207650_10238267
1457 Ga0207650_10557007
1458 Ga0207687_10269446
1459 Ga0207687_10286280
1460 Ga0207687_10399166
1461 Ga0207700_10012282
1462 Ga0207700_10024905
1463 Ga0207664_10052569
1464 Ga0207664_10074592
1465 Ga0207664_10082927
1466 Ga0207664_10225412
1467 Ga0207664_10246337
1468 Ga0207644_10024876
1469 Ga0207644_10130483
1470 Ga0207644_10916206
1471 Ga0207690_10170308
1472 Ga0207690_10360263
1473 Ga0207706_10001355
1474 Ga0207706_10305637
1475 Ga0207686_10003613
1476 Ga0207686_10059287
1477 Ga0207686_10108662
1478 Ga0207686_10321583
1479 Ga0207704_10009704
1480 Ga0207704_10109335
1481 Ga0207665_10000447
1482 Ga0207691_10104455
1483 Ga0207691_10235973
1484 Ga0207711_10000064
1485 Ga0207711_10028170
1486 Ga0207711_10106774
1487 Ga0207711_10198429
1488 Ga0207711_10243019
1489 Ga0207711_10463549
1490 Ga0207711_10576668
1491 Ga0207711_10633277
1492 Ga0207689_10429709
1493 Ga0207661_10004560
1494 Ga0207661_10035472
1495 Ga0207661_10043953
1496 Ga0207661_10054675
1497 Ga0207661_10264876
1498 Ga0207661_10423769
1499 Ga0207679_10040294
1500 Ga0207679_10211073
1501 Ga0207667_10002772
1502 Ga0207667_10011432
1503 Ga0207667_10237727
1504 Ga0207667_10267382
1505 Ga0207667_10299157
1506 Ga0207667_10602328
1507 Ga0207667_10661481
1508 Ga0207651_10314553
1509 Ga0207651_10710825
1510 Ga0207712_10033535
1511 Ga0207712_10090893
1512 Ga0207712_10677967
1513 Ga0207668_10021239
1514 Ga0207668_10135080
1515 Ga0207668_10290103
1516 Ga0207658_10119678
1517 Ga0207677_10207681
1518 Ga0207703_10016259
1519 Ga0207639_10020607
1520 Ga0207639_10097046
1521 Ga0207639_10313713
1522 Ga0207678_10004751
1523 Ga0207678_10260919
1524 Ga0207708_10027253
1525 Ga0207708_10081783
1526 Ga0207702_10002702
1527 Ga0207702_10163517
1528 Ga0207702_10215461
1529 Ga0207702_10216516
1530 Ga0207702_10419076
1531 Ga0207702_10667301
1532 Ga0207641_10084028
1533 Ga0207641_10157741
1534 Ga0207641_10579111
1535 Ga0207648_10091323
1536 Ga0207648_10109890
1537 Ga0207648_10154034
1538 Ga0207648_10271522
1539 Ga0207648_10294290
1540 Ga0207676_10351848
1541 Ga0207676_10671134
1542 Ga0207674_10001358
1543 Ga0207674_10020080
1544 Ga0207674_10229698
1545 Ga0207675_100186703
1546 Ga0207675_100376531
1547 Ga0207683_10016698
1548 Ga0207683_10170602
1549 Ga0207683_10674667
1550 Ga0207698_10034196
1551 Ga0207698_10366481
1552 Ga0207698_10646115
1553 Ga0207698_10845076
1554 Ga0209588_1040615
1555 Ga0209966_1008583
1556 Ga0209998_10002474
1557 Ga0209974_10029724
1558 Ga0265356_1009420
1559 Ga0268266_10113298
1560 Ga0268266_10294592
1561 Ga0268266_11028465
1562 Ga0268265_10001794
1563 Ga0268265_10140629
1564 Ga0268265_10144093
1565 Ga0268265_10257721
1566 Ga0268264_10115371
1567 Ga0268264_10408325
1568 Ga0268264_10428336
1569 Ga0268264_10953771
1570 Ga0268264_11138541
1571 Ga0265337_1005073
1572 Ga0265334_10005808
1573 Ga0265336_10097129
1574 Ga0265338_10009207
1575 Ga0265338_10049107
1576 Ga0265338_10094073
1577 Ga0265324_10006770
1578 Ga0307511_10214577
1579 Ga0265330_10014736
1580 Ga0265330_10134665
1581 Ga0265328_10049034
1582 Ga0265325_10072037
1583 Ga0265325_10079165
1584 Ga0265339_10000209
1585 Ga0265339_10078648
1586 Ga0265339_10102181
1587 Ga0265339_10105466
1588 Ga0265331_10002092
1589 Ga0265331_10003605
1590 Ga0265327_10000176
1591 Ga0265316_10004054
1592 Ga0265316_10004227
1593 Ga0265316_10198831
1594 Ga0307408_100061935
1595 Ga0307408_100185011
1596 Ga0265313_10000004
1597 Ga0265313_10062762
1598 Ga0265314_10002032
1599 Ga0265314_10031258
1600 Ga0265314_10058659
1601 Ga0265342_10006946
1602 Ga0265342_10177902
1603 Ga0316576_10012341
1604 Ga0316576_10096914
1605 Ga0316578_10133806
1606 Ga0316578_10317503
1607 Ga0307405_10019903
1608 Ga0307405_10037115
1609 Ga0307405_10164712
1610 Ga0307405_10999306
1611 Ga0307413_10082285
1612 Ga0307518_10152317
1613 Ga0307410_10007540
1614 Ga0307410_10081588
1615 Ga0307410_10141492
1616 Ga0307410_10204546
1617 Ga0307410_10316451
1618 Ga0307406_10026687
1619 Ga0307406_10083486
1620 Ga0307407_10006582
1621 Ga0307407_10092424
1622 Ga0307407_10123813
1623 Ga0307409_100100105
1624 Ga0307409_100203471
1625 Ga0307409_100211985
1626 Ga0307409_100386489
1627 Ga0307409_100576246
1628 Ga0307409_100962409
1629 Ga0307416_100017432
1630 Ga0307416_100176034
1631 Ga0307416_100518137
1632 Ga0307414_10053577
1633 Ga0307414_10140692
1634 Ga0307414_10282147
1635 Ga0307414_10906373
1636 Ga0307411_10038737
1637 Ga0307411_10073014
1638 Ga0307411_10095944
1639 Ga0307411_10147723
1640 Ga0307411_10150085
1641 Ga0307411_10155673
1642 Ga0307415_100006168
1643 Ga0307415_100049196
1644 Ga0307415_100228616
1645 Ga0307507_10082573
1646 Ga0373926_0001823
1647 Ga0373929_0030848
1648 Ga0373952_0066259
1649 Ga0373939_0130243
1650 Ga0373939_0149164
1651 Ga0373954_0106603
1652 Ga0373956_0020139
1653 Ga0373956_0052367
1654 Ga0373943_0244677
1655 Ga0373946_0036679
1656 Ga0373946_0075875
1657 Ga0373946_0372657
1658 Ga0373942_0008853
1659 Ga0373931_0044305
1660 Ga0373931_0052452
1661 Ga0373931_0141454
1662 Ga0373935_0197784
1663 Ga0373935_0325804
1664 Ga0373933_0013413
1665 Ga0373947_0000031
1666 Ga0373947_0158352
1667 Ga0373937_0022396
1668 Ga0373937_0126984
1669 Ga0373937_0286638
1670 Ga0373937_0715890
1671 Ga0316584_0024092
1672 Ga0316584_0172788
1673 Ga0373925_0271028
1674 Ga0373925_0301996
1675 Ga0395899_0000421
1676 Ga0395899_0003093
1677 Ga0395900_0000159
1678 Ga0395900_0000445
1679 Ga0395900_0055109
1680 Ga0395900_0136280
1681 Ga0395900_0138891
1682 Ga0395898_0000425
1683 Ga0395898_0002174
1684 Ga0395898_0005757
1685 Ga0395898_0217076
1686 Ga0395905_0531470
1687 Ga0395901_0000017
1688 Ga0395901_0000109
1689 Ga0395901_0009637
1690 Ga0395901_0043931
1691 Ga0436365_1876799
1692 Ga0436360_0035010
1693 Ga0436361_0807603
1694 Ga0436361_1124937
1695 Ga0436363_0588233
1696 Ga0451837_1244620
1697 Ga0451849_0243995
1698 Ga0451853_2650962
1699 Ga0439445_0005495
1700 Ga0439448_0012918
1701 Ga0450898_003049
1702 Ga0450910_023046
1703 Ga0439444_0025165
1704 Ga0451577_0008981
1705 Ga0451577_0065552
1706 Ga0451577_0125156
1707 Ga0451577_0703078
1708 Ga0466969_0000008
1709 Ga0466969_0028334
1710 Ga0466969_0029616
1711 Ga0466969_0037730
1712 Ga0466972_0032516
1713 Ga0466973_0022991
1714 Ga0466977_0000673
1715 Ga0453683_0143288
1716 Ga0466965_0000743
1717 Ga0466966_0000082
1718 Ga0466966_0009579
1719 Ga0466966_0037145
1720 Ga0466966_0038085
1721 Ga0466966_0045063
1722 Ga0466961_0001496
1723 Ga0466961_0009743
1724 Ga0466963_0001180
1725 Ga0466963_0033456
1726 Ga0466963_0086023
1727 Ga0466963_0088979
1728 Ga0466963_0336435
1729 Ga0466964_0022176
1730 Ga0466964_0475049
1731 Ga0453684_0001146
1732 Ga0453684_0736806
1733 Ga0466971_0007186
1734 Ga0466971_0039338
1735 Ga0466971_0204817
1736 Ga0466971_0281552
1737 Ga0466970_0025967
1738 Ga0466970_0110582
1739 Ga0466957_0181816
1740 Ga0466959_0029019
1741 Ga0466959_0117826
1742 Ga0451576_0291384
1743 Ga0451576_0468889
1744 Ga0466958_0001820
1745 Ga0466958_0002956
1746 Ga0466958_0380643
1747 Ga0466967_0257460
1748 Ga0466967_0373277
1749 Ga0466967_0664439
1750 Ga0495592_0030243
1751 Ga0495629_0483559
1752 Ga0495638_0135704
1753 Ga0495653_0139753
1754 Ga0495580_0283406
1755 Ga0495582_0148080
1756 Ga0495639_0210381
1757 Ga0495662_0050118
1758 Ga0495594_0054450
1759 Ga0495594_0062189
1760 Ga0495618_0020940
1761 Ga0495618_0237874
1762 Ga0495618_0315385
1763 Ga0495630_0098480
1764 Ga0495630_0300125
1765 Ga0495642_0039507
1766 Ga0495652_0041799
1767 Ga0495665_0008286
1768 Ga0495665_0161935
1769 Ga0495640_0083114
1770 Ga0495586_0052221
1771 Ga0495586_0175633
1772 Ga0495586_0248381
1773 Ga0495587_0063377
1774 Ga0495587_0104224
1775 Ga0495587_0189405
1776 Ga0495645_0006492
1777 Ga0495645_0031033
1778 Ga0495645_0063452
1779 Ga0495622_0061393
1780 Ga0495667_0039532
1781 Ga0495656_0222307
1782 Ga0495634_0023766
1783 Ga0495634_0069434
1784 Ga0495634_0102008
1785 Ga0495625_0105085
1786 Ga0495635_0079368
1787 Ga0495635_0083784
1788 Ga0495635_0305641
1789 Ga0495659_0101908
1790 Ga0495588_0082529
1791 Ga0495657_0138140
1792 Ga0495599_0168889
1793 Ga0495599_0195806
1794 Ga0495647_0134608
1795 Ga0495669_0084137
1796 Ga0495600_0042250
1797 Ga0495600_0117065
1798 Ga0495581_0357677
1799 Ga0495604_0071217
1800 Ga0495674_0073126
1801 Ga0495674_0120872
1802 Ga0495672_0088848
1803 Ga0495675_0115959
1804 Ga0495684_0008456
1805 Ga0495686_0000007
1806 Ga0495686_0016441
1807 Ga0495686_0116205
1808 Ga0495602_0035227
1809 Ga0496100_0334857
1810 Ga0496102_0000693
1811 Ga0496102_0076207
1812 Ga0496102_0129691
1813 Ga0496102_0237220
1814 Ga0496104_0000014
1815 Ga0496104_0000542
1816 Ga0496105_0089615
1817 Ga0496107_0009969
1818 Ga0496107_0330020
1819 Ga0496108_0000659
1820 Ga0496109_0001342
1821 Ga0496109_0165812
1822 Ga0496110_0010771
1823 Ga0496110_0014556
1824 Ga0496112_0036657
1825 Ga0496115_0000923
1826 Ga0496115_0001557
1827 Ga0496115_0445497
1828 Ga0501033_0134943
1829 Ga0501034_0008979
1830 Ga0501036_0238656
1831 Ga0501037_0099222
1832 Ga0501038_0008308
1833 Ga0501038_0297491
1834 Ga0501039_0075802
1835 Ga0501039_0122578
1836 Ga0501039_0676276
1837 Ga0501040_0132370
1838 Ga0501040_0196896
1839 Ga0501041_0045415
1840 Ga0501042_0251306
1841 Ga0501043_0018518
1842 Ga0501043_0074691
1843 Ga0501043_0543496
1844 Ga0501046_0048523
1845 Ga0501046_0108943
1846 Ga0501047_0124677
1847 Ga0501047_0179023
1848 Ga0501047_0358482
1849 Ga0501048_0001269
1850 Ga0501067_0021474
1851 Ga0501067_0030717
1852 Ga0501067_0084445
1853 Ga0501068_0003826
1854 Ga0501069_0004771
1855 Ga0501069_0009983
1856 Ga0501070_0018564
1857 Ga0501070_0024586
1858 Ga0501070_0066405
1859 Ga0501070_0172373
1860 Ga0501070_0432306
1861 Ga0501071_0003078
1862 Ga0501072_0002641
1863 Ga0501072_0141522
1864 Ga0501072_0367758
1865 Ga0501073_0088631
1866 Ga0501074_0001140
1867 Ga0501074_0145963
1868 Ga0501074_0767700
1869 Ga0501075_0046762
1870 Ga0501076_0147375
1871 Ga0501076_0208768
1872 Ga0501076_0572006
1873 Ga0501077_0001806
1874 Ga0501077_0155092
1875 Ga0501217_045400
1876 Ga0501233_037201
1877 Ga0501233_081863
1878 Ga0501260_005022
1879 Ga0501234_005779
1880 Ga0501245_005183
1881 Ga0501079_0268600
1882 Ga0501080_0021326
1883 Ga0501080_0085723
1884 Ga0501081_0083532
1885 Ga0501081_0124233
1886 Ga0501083_0004908
1887 Ga0501232_029030
1888 Ga0501262_030517
1889 Ga0501268_002141
1890 Ga0501268_009827
1891 Ga0501270_014857
1892 Ga0501272_001712
1893 Ga0501035_0407055
1894 Ga0501044_0008204
1895 Ga0501045_0061254
1896 Ga0501045_0225827
1897 Ga0501045_0476465
1898 nmdc:mga0k408_363755_c1
1899 nmdc:mga0k408_49684_c1
1900 nmdc:mga06z11_432393_c1
1901 nmdc:mga06z11_97626_c1
1902 nmdc:mga05p37_162125_c1
1903 nmdc:mga05p37_458105_c1
1904 nmdc:mga05p37_69749_c1
1905 nmdc:mga09592_4370_c1
1906 nmdc:mga09592_64643_c1
1907 nmdc:mga0qj67_145_c1
1908 nmdc:mga0qj67_24987_c1
1909 nmdc:mga0qj67_36230_c1
1910 nmdc:mga0qj67_41314_c1
1911 nmdc:mga06r32_113138_c1
1912 nmdc:mga06r32_244046_c1
1913 nmdc:mga06r32_244491_c1
1914 nmdc:mga06r32_30913_c1
1915 nmdc:mga06r32_6579_c1
1916 nmdc:mga08y16_50614_c1
1917 nmdc:mga08y16_762988_c1
1918 nmdc:mga08y16_76635_c1
1919 nmdc:mga0n895_156754_c1
1920 nmdc:mga0n895_163392_c1
1921 nmdc:mga0n895_36095_c1
1922 nmdc:mga0n895_55943_c1
1923 nmdc:mga0n895_693533_c1
1924 nmdc:mga0rr50_224953_c1
1925 nmdc:mga0rr50_244214_c1
1926 nmdc:mga0rr50_45452_c1
1927 nmdc:mga0rr50_762536_c1
1928 nmdc:mga0rr50_83232_c1
1929 nmdc:mga0rr50_852479_c1
1930 nmdc:mga08x19_126962_c1
1931 nmdc:mga08x19_14339_c1
1932 nmdc:mga08x19_264729_c1
1933 nmdc:mga08x19_289370_c1
1934 nmdc:mga08x19_6037_c1
1935 nmdc:mga08x19_88799_c1
1936 nmdc:mga0a205_115483_c1
1937 nmdc:mga0a205_177653_c1
1938 nmdc:mga0a205_327552_c1
1939 nmdc:mga0a205_51645_c1
1940 nmdc:mga0a205_913489_c1
1941 Ga0495601_0041642
1942 Ga0495601_0054612
1943 Ga0495595_0023819
1944 Ga0500583_0030584
1945 Ga0500566_0026880
1946 Ga0500595_006337
1947 Ga0500618_002101
1948 Ga0500618_002594
1949 Ga0500655_008591
1950 Ga0500559_0284678
1951 Ga0500603_054851
1952 Ga0500601_000465
1953 Ga0501084_0005169
1954 Ga0501084_0005653
1955 Ga0501084_0481064
1956 Ga0590071_001022
1957 Ga0590077_005597
1958 Ga0501082_0007067
1959 Ga0466962_0046644
1960 2515688237
1961 2719384146
1962 2723875837
1963 2842462823
1964 2884700044
1965 2891330014
1966 2895450016
1967 2904436662
1968 3006428595
1969 3006488871
1970 8005278856
1971 8008487469
1972 8025481731
1973 8025527011
1974 8033689934
1975 8047896765
1976 8056832119

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4njh-assembly1.cif.gz_B crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin 0.9727 3 211
4njh-assembly1.cif.gz_B crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin 0.9635 3 211
6phu-assembly1.cif.gz_A spaga wild type apo structure 0.7661 87 118
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.7381 1 205
5tgs-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with methionine bound 0.7178 3 208
ID Description Score Start End Superfamily
4njjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9757 3 211 3.20.20.70
4njjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9665 3 211 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7519 3 211 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.742 3 211 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7218 4 208 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7S1HJL5-F1-model_v4 Radical SAM core domain-containing protein 0.9927 84 192 GO:0051539
AF-A0A519Y4H4-F1-model_v4 deleted 0.9897 128 211
AF-A0A357V077-F1-model_v4 7-carboxy-7-deazaguanine synthase (CDG synthase) (EC 4.3.99.3) (Queuosine biosynthesis protein QueE) 0.9868 1 211 GO:0000287
GO:0008616
GO:0016840
GO:0051539
GO:1904047
AF-A0A1B3LL78-F1-model_v4 7-carboxy-7-deazaguanine synthase (CDG synthase) (EC 4.3.99.3) (Queuosine biosynthesis protein QueE) 0.985 2 211 GO:0000287
GO:0008616
GO:0016840
GO:0051539
GO:1904047
AF-A0A383C4D5-F1-model_v4 Radical SAM core domain-containing protein 0.985 87 211 GO:0051539

Map