F487585

General Info

Members Datasets Scaffolds Average Seq Length
989 669 1978 333

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10000319|Ga0157378_1000031949
Length 335
Sequence VKAFIVDRYKKGGALRLGEMPEPAVRDHDVLVAVHAAALNPLDAKIRDGEFKLILPYRLPLILGNDVAGVVVRVGPKVRRFKPGDEVYARPSKDRIGTFAEYIAMDEADVALKPRNLSMEEAASVPLVALTAWQVLIERAELKQGQKVLIHAGSGGVGAFAIQLAKHLGATVATTTSTTNVDVVIDYKKENFARVLSGYDVVLNSLGKDTLEQSIDVLKPGGKLISISGPPDVAFAKENGLNWFLQQVMRLLSFGIRTKANRRGISYSFLFMRANGEQLGKITSLIEAGVIRQVVDRIFPFREFNEGMRYLETGRAVGKVVIRVGANENAHPGVP

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
189 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
190 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
216 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
217 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
220 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
221 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
222 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
226 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
227 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
228 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
248 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
298 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
299 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
321 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
325 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
326 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
327 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
340 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
341 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
342 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
343 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
344 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
345 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
346 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
347 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
348 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
349 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
350 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
351 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
352 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
353 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
356 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
357 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
358 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
359 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
362 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
365 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
366 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
367 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
368 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
369 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
370 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
371 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
372 2508501050 Microvirga lupini Lut6 Isolate Nodule
373 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
374 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
375 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
376 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
377 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
378 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
379 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
380 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
381 2512875024
382 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
383 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
384 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
385 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
386 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
387 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
388 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
389 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
390 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
391 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
392 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
393 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
394 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
395 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
396 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
397 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
398 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
399 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
400 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
401 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
402 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
403 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
404 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
405 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
406 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
407 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
408 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
409 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
410 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
411 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
412 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
413 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
414 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
415 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
416 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
417 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
418 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
419 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
420 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
421 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
422 2643221573 Lysobacter sp. Root604 Isolate Unclassified
423 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
424 2643221596 Acidovorax sp. Root70 Isolate Unclassified
425 2643221609 Acidovorax sp. Root217 Isolate Unclassified
426 2643221611 Acidovorax sp. Root219 Isolate Unclassified
427 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
428 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
429 2643221626 Ensifer sp. Root31 Isolate Unclassified
430 2643221640 Caulobacter sp. Root342 Isolate Unclassified
431 2643221642 Caulobacter sp. Root343 Isolate Unclassified
432 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
433 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
434 2643221659 Ensifer sp. Root127 Isolate Unclassified
435 2643221698 Ensifer sp. Root142 Isolate Unclassified
436 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
437 2643221719 Rhizobium sp. Root274 Isolate Unclassified
438 2643221720 Lysobacter sp. Root916 Isolate Unclassified
439 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
440 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
441 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
442 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
443 2738541277 Variovorax sp. GV051 Isolate Unclassified
444 2738541283 Pedobacter sp. OK701 Isolate Unclassified
445 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
446 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
447 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
448 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
449 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
450 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
451 2738543019 Variovorax sp. GV040 Isolate Unclassified
452 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
453 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
454 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
455 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
456 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
457 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
458 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
459 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
460 2791355263 Rhizobium chutanense C5 Isolate Nodule
461 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
462 2802429633 Rhizobium anhuiense J3 Isolate Nodule
463 2802429634 Rhizobium anhuiense S10 Isolate Nodule
464 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
465 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
466 2802429637 Rhizobium anhuiense C15 Isolate Nodule
467 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
468 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
469 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
470 2818991435 Caulobacter henricii 536 Isolate Unclassified
471 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
472 2818991450 Burkholderia sp. 604 Isolate Unclassified
473 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
474 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
475 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
476 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
477 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
478 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
479 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
480 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
481 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
482 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
483 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
484 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
485 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
486 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
487 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
488 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
489 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
490 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
491 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
492 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
493 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
494 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
495 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
496 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
497 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
498 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
499 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
500 2844163670 Ensifer sp. 1H6 Isolate Unclassified
501 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
502 2851182111 Bosea sp. Tri-44 Isolate Nodule
503 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
504 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
505 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
506 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
507 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
508 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
509 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
510 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
511 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
512 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
513 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
514 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
515 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
516 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
517 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
518 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
519 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
520 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
521 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
522 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
523 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
524 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
525 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
526 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
527 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
528 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
529 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
530 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
531 2885198086 Variovorax sp. 679 Isolate Unclassified
532 2885211737 Variovorax sp. 553 Isolate Unclassified
533 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
534 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
535 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
536 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
537 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
538 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
539 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
540 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
541 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
542 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
543 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
544 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
545 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
546 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
547 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
548 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
549 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
550 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
551 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
552 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
553 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
554 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
555 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
556 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
557 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
558 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
559 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
560 2928070936 Variovorax gossypii 1167 Isolate Unclassified
561 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
562 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
563 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
564 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
565 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
566 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
567 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
568 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
569 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
570 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
571 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
572 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
573 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
574 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
575 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
576 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
577 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
578 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
579 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
580 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
581 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
582 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
583 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
584 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
585 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
586 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
587 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
588 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
589 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
590 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
591 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
592 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
593 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
594 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
595 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
596 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
597 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
598 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
599 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
600 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
601 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
602 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
603 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
604 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
605 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
606 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
607 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
608 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
609 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
610 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
611 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
612 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
613 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
614 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
615 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
616 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
617 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
618 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
619 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
620 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
621 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
622 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
623 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
624 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
625 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
626 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
627 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
628 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
629 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
630 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
631 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
632 3004167301 Mesorhizobium loti 582 Isolate Unclassified
633 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
634 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
635 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
636 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
637 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
638 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
639 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
640 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
641 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
642 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
643 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
644 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
645 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
646 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
647 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
648 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
649 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
650 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
651 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
652 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
653 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
654 8005258706 Rhizobium sp. R693 Isolate Nodule
655 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
656 8005321885 Rhizobium sp. R72 Isolate Nodule
657 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
658 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
659 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
660 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
661 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
662 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
663 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
664 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
665 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
666 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
667 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
668 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
669 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.87
Metatranscriptomes 0
Isolates 30.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.44
Nodule 17.8
Rhizoplane 1.82
Rhizosphere 56.52
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10000319 3300013297 Bacteria 47265
2 JGI24740J21852_10001788 3300001979 Bacteria 9857
3 JGI24739J22299_10008123 3300001989 Bacteria 3918
4 JGI24739J22299_10023597 3300001989 Bacteria 2173
5 JGI24737J22298_10003380 3300001990 Bacteria 5642
6 JGI24737J22298_10004822 3300001990 Bacteria 4683
7 JGI24743J22301_10006797 3300001991 Bacteria 1963
8 JGI24738J21930_10001816 3300002075 Bacteria 5787
9 JGI24738J21930_10010554 3300002075 Bacteria 2054
10 JGI25156J39149_1000873 3300002705 Bacteria 15026
11 JGI25156J39149_1001284 3300002705 Bacteria 10895
12 JGI25162J39368_1000642 3300002737 Bacteria 24772
13 JGI25154J39366_1000069 3300002738 Bacteria 96438
14 JGI25154J39366_1001801 3300002738 Bacteria 6715
15 JGI25157J39369_1000851 3300002741 Bacteria 15031
16 JGI25151J46595_10001575 3300003187 Bacteria 15220
17 JGI25165J46597_1000999 3300003214 Bacteria 18766
18 JGI25165J46597_1001072 3300003214 Bacteria 17563
19 JGI25165J46597_1002307 3300003214 Bacteria 6506
20 JGI25153J46596_10001714 3300003215 Bacteria 12988
21 rootL2_10004516 3300003322 Bacteria 8575
22 rootL2_10363542 3300003322 Unclassified 1741
23 JGI25160J50197_1012841 3300003354 Bacteria 2885
24 JGI25161J50226_1002832 3300003374 Bacteria 4250
25 Ga0055539_1000513 3300003752 Bacteria 11908
26 Ga0055524_1012206 3300003775 Bacteria 3312
27 Ga0055531_10000965 3300003794 Bacteria 23016
28 Ga0058692_1000035 3300003856 Bacteria 152983
29 Ga0055543_1001188 3300004625 Bacteria 10960
30 Ga0065165_1000241 3300005262 Bacteria 93644
31 Ga0065165_1002670 3300005262 Bacteria 14404
32 Ga0065715_10089106 3300005293 Bacteria 14278
33 Ga0070658_10005121 3300005327 Bacteria 10670
34 Ga0070658_10041562 3300005327 Bacteria 3710
35 Ga0070670_100043399 3300005331 Bacteria 3865
36 Ga0068869_100051298 3300005334 Bacteria 2993
37 Ga0068869_100072738 3300005334 Bacteria 2548
38 Ga0068869_100454803 3300005334 Bacteria 1062
39 Ga0070666_10025670 3300005335 Bacteria 3843
40 Ga0070666_10193979 3300005335 Bacteria 1428
41 Ga0068868_100087708 3300005338 Bacteria 2503
42 Ga0070660_100133936 3300005339 Bacteria 1985
43 Ga0070660_100188043 3300005339 Bacteria 1672
44 Ga0070660_100252382 3300005339 Bacteria 1439
45 Ga0070668_100053824 3300005347 Bacteria 3103
46 Ga0070668_100203068 3300005347 Bacteria 1628
47 Ga0070669_100204096 3300005353 Bacteria 1557
48 Ga0070675_100276405 3300005354 Bacteria 1475
49 Ga0070675_100388678 3300005354 Bacteria 1243
50 Ga0070671_100122939 3300005355 Bacteria 2184
51 Ga0070671_100153126 3300005355 Bacteria 1947
52 Ga0070674_100033790 3300005356 Bacteria 3408
53 Ga0070674_100249814 3300005356 Bacteria 1393
54 Ga0070673_100029907 3300005364 Bacteria 4068
55 Ga0070673_100048494 3300005364 Bacteria 3311
56 Ga0070659_100001718 3300005366 Bacteria 15751
57 Ga0070659_100028187 3300005366 Bacteria 4334
58 Ga0070659_100162400 3300005366 Bacteria 1827
59 Ga0070667_100057349 3300005367 Bacteria 3292
60 Ga0070667_100290157 3300005367 Bacteria 1471
61 Ga0070705_100075763 3300005440 Bacteria 2049
62 Ga0070700_100076132 3300005441 Bacteria 2154
63 Ga0070708_100118089 3300005445 Bacteria 2443
64 Ga0070708_100205401 3300005445 Bacteria 1845
65 Ga0070662_100000167 3300005457 Bacteria 38204
66 Ga0070662_100079420 3300005457 Bacteria 2440
67 Ga0070662_100220601 3300005457 Bacteria 1513
68 Ga0068867_100126997 3300005459 Bacteria 1977
69 Ga0068867_100134289 3300005459 Bacteria 1927
70 Ga0070706_100003698 3300005467 Bacteria 14968
71 Ga0070706_100193872 3300005467 Bacteria 1898
72 Ga0070707_100005425 3300005468 Bacteria 11927
73 Ga0070707_100108298 3300005468 Bacteria 2695
74 Ga0070698_100054281 3300005471 Bacteria 4069
75 Ga0070698_100147290 3300005471 Bacteria 2303
76 Ga0070698_100487148 3300005471 Bacteria 1170
77 Ga0070699_100007692 3300005518 Bacteria 9368
78 Ga0070699_100227605 3300005518 Bacteria 1662
79 Ga0070679_100221311 3300005530 Bacteria 1854
80 Ga0070684_100051678 3300005535 Bacteria 3571
81 Ga0070697_100006095 3300005536 Bacteria 9327
82 Ga0070697_100296960 3300005536 Bacteria 1388
83 Ga0068853_100018261 3300005539 Bacteria 5803
84 Ga0068853_100156821 3300005539 Bacteria 2051
85 Ga0070672_100001960 3300005543 Bacteria 12906
86 Ga0070672_100074753 3300005543 Bacteria 2704
87 Ga0070665_100000006 3300005548 Bacteria 718034
88 Ga0070665_100007151 3300005548 Bacteria 11349
89 Ga0070665_100016065 3300005548 Bacteria 7512
90 Ga0070665_100303727 3300005548 Bacteria 1599
91 Ga0070704_100024496 3300005549 Bacteria 3960
92 Ga0070704_100181522 3300005549 Bacteria 1684
93 Ga0070704_100425153 3300005549 Bacteria 1138
94 Ga0068855_100007578 3300005563 Bacteria 13132
95 Ga0068855_100064015 3300005563 Bacteria 4289
96 Ga0068855_100275068 3300005563 Bacteria 1871
97 Ga0068855_100343998 3300005563 Bacteria 1644
98 Ga0068857_100000489 3300005577 Bacteria 28341
99 Ga0068857_100117345 3300005577 Bacteria 2395
100 Ga0068857_100220463 3300005577 Bacteria 1732
101 Ga0068854_100008799 3300005578 Bacteria 6497
102 Ga0068854_100071479 3300005578 Bacteria 2538
103 Ga0068856_100000991 3300005614 Bacteria 30324
104 Ga0068856_100041460 3300005614 Bacteria 4524
105 Ga0068856_100209029 3300005614 Bacteria 1967
106 Ga0068852_100052049 3300005616 Bacteria 3518
107 Ga0068852_100117952 3300005616 Bacteria 2424
108 Ga0068852_100122678 3300005616 Bacteria 2382
109 Ga0068859_100000151 3300005617 Bacteria 66183
110 Ga0068859_100007089 3300005617 Bacteria 11377
111 Ga0068861_100001690 3300005719 Bacteria 14160
112 Ga0068851_10010112 3300005834 Bacteria 4396
113 Ga0068851_10018502 3300005834 Bacteria 3356
114 Ga0068851_10105116 3300005834 Bacteria 1502
115 Ga0068863_100026949 3300005841 Bacteria 5480
116 Ga0068863_100054170 3300005841 Bacteria 3801
117 Ga0068863_100117728 3300005841 Bacteria 2532
118 Ga0068863_100250274 3300005841 Bacteria 1711
119 Ga0068863_100456958 3300005841 Bacteria 1254
120 Ga0068858_100000273 3300005842 Bacteria 55482
121 Ga0068858_100006378 3300005842 Bacteria 11490
122 Ga0068858_100008996 3300005842 Bacteria 9552
123 Ga0068858_100113852 3300005842 Bacteria 2526
124 Ga0068858_100365369 3300005842 Bacteria 1383
125 Ga0068860_100046091 3300005843 Bacteria 4157
126 Ga0068860_100341009 3300005843 Bacteria 1473
127 Ga0068862_100020999 3300005844 Bacteria 5456
128 Ga0068862_100024533 3300005844 Bacteria 5061
129 Ga0068862_100234316 3300005844 Bacteria 1666
130 Ga0068862_100284396 3300005844 Bacteria 1517
131 Ga0070717_10006422 3300006028 Bacteria 8647
132 Ga0070717_10101276 3300006028 Bacteria 2446
133 Ga0075365_10002167 3300006038 Bacteria 9449
134 Ga0075365_10144624 3300006038 Bacteria 1652
135 Ga0075368_10007659 3300006042 Bacteria 3817
136 Ga0075368_10019634 3300006042 Bacteria 2552
137 Ga0075364_10106867 3300006051 Bacteria 1865
138 Ga0075432_10013171 3300006058 Bacteria 2809
139 Ga0070715_10063920 3300006163 Bacteria 1624
140 Ga0075362_10000508 3300006177 Bacteria 11381
141 Ga0075367_10036200 3300006178 Bacteria 2861
142 Ga0075367_10176970 3300006178 Bacteria 1329
143 Ga0075369_10005799 3300006186 Bacteria 4637
144 Ga0075369_10023666 3300006186 Bacteria 2540
145 Ga0075366_10001556 3300006195 Bacteria 11484
146 Ga0075366_10015983 3300006195 Bacteria 4309
147 Ga0075366_10034597 3300006195 Bacteria 2976
148 Ga0075366_10121530 3300006195 Unclassified 1574
149 Ga0075370_10008118 3300006353 Bacteria 5390
150 Ga0075370_10052305 3300006353 Bacteria 2317
151 Ga0075370_10058171 3300006353 Bacteria 2198
152 Ga0075428_100026574 3300006844 Bacteria 6408
153 Ga0075428_100100604 3300006844 Bacteria 3152
154 Ga0075430_100010209 3300006846 Bacteria 7952
155 Ga0075430_100037469 3300006846 Bacteria 4110
156 Ga0075430_100129903 3300006846 Bacteria 2100
157 Ga0075431_100113557 3300006847 Bacteria 2796
158 Ga0075434_100017992 3300006871 Bacteria 6820
159 Ga0075429_100006117 3300006880 Bacteria 10402
160 Ga0075429_100049552 3300006880 Bacteria 3652
161 Ga0068865_100180466 3300006881 Bacteria 1625
162 Ga0075436_100087478 3300006914 Bacteria 2164
163 Ga0097620_100000151 3300006931 Bacteria 66183
164 Ga0097620_100007089 3300006931 Bacteria 11377
165 Ga0075435_100041263 3300007076 Bacteria 3688
166 Ga0105251_10000837 3300009011 Bacteria 27603
167 Ga0105244_10003082 3300009036 Bacteria 12199
168 Ga0105244_10030578 3300009036 Bacteria 2864
169 Ga0105240_10000142 3300009093 Bacteria 146932
170 Ga0105240_10068267 3300009093 Bacteria 4403
171 Ga0105240_10085783 3300009093 Bacteria 3857
172 Ga0105240_10095230 3300009093 Bacteria 3630
173 Ga0105240_10108637 3300009093 Bacteria 3360
174 Ga0105240_10472789 3300009093 Bacteria 1399
175 Ga0111539_10348399 3300009094 Bacteria 1724
176 Ga0105245_10102479 3300009098 Bacteria 2651
177 Ga0105247_10014016 3300009101 Bacteria 4807
178 Ga0105247_10035380 3300009101 Bacteria 3044
179 Ga0114129_10561688 3300009147 Unclassified 1483
180 Ga0105243_10005104 3300009148 Bacteria 10305
181 Ga0105243_10218194 3300009148 Bacteria 1684
182 Ga0105241_10012545 3300009174 Bacteria 6216
183 Ga0105241_10027870 3300009174 Bacteria 4207
184 Ga0105241_10064139 3300009174 Bacteria 2836
185 Ga0105248_10000764 3300009177 Bacteria 36109
186 Ga0105248_10132844 3300009177 Bacteria 2808
187 Ga0105248_10139030 3300009177 Bacteria 2740
188 Ga0105248_10301610 3300009177 Bacteria 1804
189 Ga0105237_10053876 3300009545 Bacteria 4033
190 Ga0105237_10131081 3300009545 Bacteria 2501
191 Ga0105237_10358871 3300009545 Bacteria 1462
192 Ga0105238_10038755 3300009551 Bacteria 4839
193 Ga0105238_10113596 3300009551 Bacteria 2688
194 Ga0105238_10222572 3300009551 Bacteria 1863
195 Ga0105249_10019476 3300009553 Bacteria 6055
196 Ga0123342_1017216 3300009766 Bacteria 6065
197 Ga0105239_10009037 3300010375 Bacteria 11282
198 Ga0105239_10033221 3300010375 Bacteria 5666
199 Ga0105239_10044778 3300010375 Bacteria 4850
200 Ga0105239_10062150 3300010375 Bacteria 4099
201 Ga0105239_10064171 3300010375 Bacteria 4032
202 Ga0105239_10072703 3300010375 Bacteria 3781
203 Ga0105239_10081086 3300010375 Bacteria 3571
204 Ga0105239_10722216 3300010375 Bacteria 1140
205 Ga0105246_10051609 3300011119 Bacteria 2825
206 Ga0105246_10062221 3300011119 Bacteria 2599
207 Ga0105246_10148420 3300011119 Bacteria 1772
208 Ga0157373_10048454 3300013100 Bacteria 3029
209 Ga0157373_10056285 3300013100 Bacteria 2793
210 Ga0157373_10057525 3300013100 Bacteria 2758
211 Ga0157370_10001666 3300013104 Bacteria 27356
212 Ga0157370_10018690 3300013104 Bacteria 6969
213 Ga0157370_10122823 3300013104 Bacteria 2425
214 Ga0157369_10027598 3300013105 Bacteria 6290
215 Ga0157369_10031335 3300013105 Bacteria 5855
216 Ga0157369_10098085 3300013105 Bacteria 3126
217 Ga0157369_10103270 3300013105 Bacteria 3036
218 Ga0157374_10004368 3300013296 Bacteria 11900
219 Ga0157374_10007769 3300013296 Bacteria 9154
220 Ga0157374_10065564 3300013296 Bacteria 3411
221 Ga0157374_10179313 3300013296 Bacteria 2069
222 Ga0157374_10204448 3300013296 Bacteria 1935
223 Ga0163162_10137842 3300013306 Bacteria 2551
224 Ga0157372_10018994 3300013307 Bacteria 7397
225 Ga0157372_10043036 3300013307 Bacteria 4998
226 Ga0157375_10003013 3300013308 Bacteria 14623
227 Ga0163163_10034598 3300014325 Bacteria 4895
228 Ga0157380_10057383 3300014326 Bacteria 3100
229 Ga0182008_10025740 3300014497 Bacteria 2988
230 Ga0182008_10039458 3300014497 Bacteria 2359
231 Ga0182008_10046900 3300014497 Bacteria 2147
232 Ga0157379_10008013 3300014968 Bacteria 9166
233 Ga0157379_10022204 3300014968 Bacteria 5622
234 Ga0157376_10407585 3300014969 Bacteria 1316
235 Ga0182006_1013342 3300015261 Bacteria 3567
236 Ga0182006_1013820 3300015261 Bacteria 3492
237 Ga0182006_1027109 3300015261 Bacteria 2341
238 Ga0182006_1042021 3300015261 Bacteria 1793
239 Ga0182007_10000445 3300015262 Bacteria 25030
240 Ga0182007_10005878 3300015262 Bacteria 5332
241 Ga0182007_10010414 3300015262 Bacteria 3675
242 Ga0163161_10123495 3300017792 Bacteria 1947
243 Ga0163161_10220475 3300017792 Bacteria 1469
244 Ga0163161_10247922 3300017792 Bacteria 1387
245 Ga0209437_100179 3300025233 Bacteria 134210
246 Ga0209437_102131 3300025233 Bacteria 3989
247 Ga0207425_1003095 3300025245 Bacteria 5499
248 Ga0209646_1000299 3300025246 Bacteria 40564
249 Ga0209026_1000382 3300025250 Bacteria 40564
250 Ga0209677_100222 3300025253 Bacteria 40564
251 Ga0209677_101959 3300025253 Bacteria 8209
252 Ga0209759_1000085 3300025256 Bacteria 168382
253 Ga0209759_1000529 3300025256 Bacteria 40564
254 Ga0209129_1000566 3300025258 Bacteria 25492
255 Ga0209233_1000185 3300025261 Bacteria 133788
256 Ga0209233_1000263 3300025261 Bacteria 79293
257 Ga0209455_1005371 3300025272 Bacteria 3975
258 Ga0209025_1000082 3300025294 Bacteria 265613
259 Ga0209758_1000319 3300025297 Bacteria 92649
260 Ga0209758_1003930 3300025297 Bacteria 12947
261 Ga0209758_1049084 3300025297 Bacteria 1494
262 Ga0209050_1000221 3300025298 Bacteria 126843
263 Ga0209256_1000794 3300025299 Bacteria 40601
264 Ga0207426_1000210 3300025302 Bacteria 138932
265 Ga0209257_1000538 3300025304 Bacteria 65300
266 Ga0207656_10057803 3300025321 Bacteria 1693
267 Ga0207655_1004047 3300025728 Bacteria 10557
268 Ga0207713_1000336 3300025735 Bacteria 52391
269 Ga0207653_10045597 3300025885 Bacteria 1448
270 Ga0207642_10072020 3300025899 Bacteria 1648
271 Ga0207710_10004946 3300025900 Bacteria 5774
272 Ga0207680_10090403 3300025903 Bacteria 1946
273 Ga0207647_10000209 3300025904 Bacteria 47604
274 Ga0207647_10000515 3300025904 Bacteria 30820
275 Ga0207647_10101113 3300025904 Bacteria 1710
276 Ga0207645_10042759 3300025907 Bacteria 2899
277 Ga0207705_10000607 3300025909 Bacteria 30025
278 Ga0207684_10009256 3300025910 Bacteria 8706
279 Ga0207684_10071261 3300025910 Bacteria 2954
280 Ga0207684_10081248 3300025910 Bacteria 2758
281 Ga0207684_10235168 3300025910 Bacteria 1581
282 Ga0207654_10042723 3300025911 Bacteria 2567
283 Ga0207695_10000234 3300025913 Bacteria 146987
284 Ga0207695_10076941 3300025913 Bacteria 3391
285 Ga0207695_10251458 3300025913 Bacteria 1667
286 Ga0207695_10305432 3300025913 Bacteria 1482
287 Ga0207671_10000234 3300025914 Bacteria 83448
288 Ga0207671_10059513 3300025914 Bacteria 2833
289 Ga0207657_10002587 3300025919 Bacteria 19578
290 Ga0207657_10074458 3300025919 Bacteria 2867
291 Ga0207657_10185208 3300025919 Bacteria 1682
292 Ga0207657_10329041 3300025919 Bacteria 1207
293 Ga0207657_10342764 3300025919 Bacteria 1179
294 Ga0207652_10087941 3300025921 Bacteria 2725
295 Ga0207646_10003418 3300025922 Bacteria 17930
296 Ga0207681_10115444 3300025923 Bacteria 1960
297 Ga0207694_10013955 3300025924 Bacteria 6057
298 Ga0207694_10083669 3300025924 Bacteria 2509
299 Ga0207650_10038633 3300025925 Bacteria 3487
300 Ga0207659_10351313 3300025926 Unclassified 1223
301 Ga0207687_10042786 3300025927 Bacteria 3118
302 Ga0207644_10042344 3300025931 Bacteria 3227
303 Ga0207644_10140771 3300025931 Bacteria 1858
304 Ga0207644_10168459 3300025931 Bacteria 1708
305 Ga0207690_10004275 3300025932 Bacteria 8432
306 Ga0207690_10013606 3300025932 Bacteria 4892
307 Ga0207706_10000257 3300025933 Bacteria 57965
308 Ga0207706_10019903 3300025933 Bacteria 6033
309 Ga0207706_10098669 3300025933 Bacteria 2569
310 Ga0207706_10115917 3300025933 Bacteria 2356
311 Ga0207686_10176222 3300025934 Bacteria 1512
312 Ga0207669_10022696 3300025937 Bacteria 3338
313 Ga0207691_10099715 3300025940 Bacteria 2593
314 Ga0207691_10101366 3300025940 Bacteria 2569
315 Ga0207711_10005529 3300025941 Bacteria 10687
316 Ga0207689_10050301 3300025942 Bacteria 3437
317 Ga0207689_10061444 3300025942 Bacteria 3089
318 Ga0207667_10003616 3300025949 Bacteria 19076
319 Ga0207667_10011742 3300025949 Bacteria 10157
320 Ga0207667_10070109 3300025949 Bacteria 3649
321 Ga0207667_10267979 3300025949 Bacteria 1746
322 Ga0207651_10009347 3300025960 Bacteria 5360
323 Ga0207651_10014951 3300025960 Bacteria 4496
324 Ga0207712_10101881 3300025961 Bacteria 2136
325 Ga0207668_10045810 3300025972 Bacteria 2985
326 Ga0207668_10132961 3300025972 Bacteria 1902
327 Ga0207658_10095119 3300025986 Bacteria 2320
328 Ga0207677_10132242 3300026023 Bacteria 1897
329 Ga0207677_10165885 3300026023 Bacteria 1721
330 Ga0207703_10000403 3300026035 Bacteria 46432
331 Ga0207703_10005587 3300026035 Bacteria 10096
332 Ga0207703_10006415 3300026035 Bacteria 9402
333 Ga0207703_10161961 3300026035 Bacteria 1960
334 Ga0207703_10177879 3300026035 Bacteria 1876
335 Ga0207703_10421249 3300026035 Bacteria 1242
336 Ga0207639_10034832 3300026041 Bacteria 3723
337 Ga0207639_10165050 3300026041 Bacteria 1870
338 Ga0207678_10046737 3300026067 Bacteria 3743
339 Ga0207678_10157794 3300026067 Bacteria 1937
340 Ga0207708_10015977 3300026075 Bacteria 5637
341 Ga0207702_10000308 3300026078 Bacteria 55913
342 Ga0207702_10096893 3300026078 Bacteria 2595
343 Ga0207641_10315288 3300026088 Bacteria 1481
344 Ga0207641_10321578 3300026088 Bacteria 1467
345 Ga0207648_10012463 3300026089 Bacteria 7960
346 Ga0207676_10490367 3300026095 Bacteria 1165
347 Ga0207674_10006843 3300026116 Bacteria 13372
348 Ga0207674_10012468 3300026116 Bacteria 9499
349 Ga0207674_10161660 3300026116 Bacteria 2194
350 Ga0207674_10179049 3300026116 Bacteria 2072
351 Ga0207675_100000049 3300026118 Bacteria 84016
352 Ga0207675_100215474 3300026118 Bacteria 1849
353 Ga0207698_10063959 3300026142 Bacteria 2882
354 Ga0207698_10134992 3300026142 Bacteria 2116
355 Ga0207698_10266661 3300026142 Bacteria 1576
356 Ga0207698_10580566 3300026142 Bacteria 1103
357 Ga0209371_1000043 3300027312 Bacteria 331009
358 Ga0209371_1000693 3300027312 Bacteria 28682
359 Ga0207428_10203424 3300027907 Bacteria 1490
360 Ga0268266_10000010 3300028379 Bacteria 1030233
361 Ga0268266_10022317 3300028379 Bacteria 5395
362 Ga0268266_10044623 3300028379 Bacteria 3790
363 Ga0268265_10000554 3300028380 Bacteria 38099
364 Ga0268265_10120267 3300028380 Bacteria 2162
365 Ga0268265_10276271 3300028380 Bacteria 1501
366 Ga0268264_10034265 3300028381 Bacteria 4175
367 Ga0268264_10127727 3300028381 Bacteria 2249
368 Ga0307517_10006006 3300028786 Bacteria 18095
369 Ga0307517_10195873 3300028786 Bacteria 1273
370 Ga0307515_10023583 3300028794 Bacteria 10775
371 Ga0307515_10104763 3300028794 Bacteria 3375
372 Ga0307515_10213156 3300028794 Bacteria 1770
373 Ga0307515_10320094 3300028794 Bacteria 1218
374 Ga0268256_1000044 3300030500 Bacteria 330997
375 Ga0268256_1003158 3300030500 Bacteria 7671
376 Ga0307511_10005062 3300030521 Bacteria 13442
377 Ga0316177_1027618 3300030731 Bacteria 2660
378 Ga0316177_1054620 3300030731 Bacteria 3918
379 Ga0314311_1034637 3300030733 Bacteria 15856
380 Ga0316182_1382167 3300030745 Bacteria 2095
381 Ga0265331_10006389 3300031250 Bacteria 6977
382 Ga0265327_10000776 3300031251 Bacteria 49288
383 Ga0307513_10031414 3300031456 Bacteria 6015
384 Ga0307513_10223624 3300031456 Bacteria 1701
385 Ga0307509_10251876 3300031507 Bacteria 1549
386 Ga0307408_100045052 3300031548 Bacteria 3148
387 Ga0307508_10000011 3300031616 Bacteria 248001
388 Ga0307508_10166018 3300031616 Bacteria 1811
389 Ga0307508_10197080 3300031616 Bacteria 1615
390 Ga0307516_10029463 3300031730 Bacteria 5551
391 Ga0307405_10074830 3300031731 Bacteria 2191
392 Ga0307405_10082389 3300031731 Bacteria 2106
393 Ga0307405_10112653 3300031731 Bacteria 1846
394 Ga0307413_10015987 3300031824 Bacteria 3861
395 Ga0307413_10040896 3300031824 Bacteria 2710
396 Ga0307413_10083185 3300031824 Bacteria 2059
397 Ga0307413_10201367 3300031824 Bacteria 1438
398 Ga0307410_10059987 3300031852 Bacteria 2598
399 Ga0307410_10203726 3300031852 Bacteria 1512
400 Ga0307406_10000348 3300031901 Bacteria 26954
401 Ga0307406_10018310 3300031901 Bacteria 4090
402 Ga0307406_10105655 3300031901 Bacteria 1927
403 Ga0307406_10192149 3300031901 Bacteria 1495
404 Ga0307407_10018450 3300031903 Bacteria 3529
405 Ga0307412_10000002 3300031911 Bacteria 743446
406 Ga0307412_10012181 3300031911 Bacteria 5001
407 Ga0307412_10064347 3300031911 Bacteria 2478
408 Ga0307412_10130063 3300031911 Bacteria 1827
409 Ga0307409_100046305 3300031995 Bacteria 3291
410 Ga0307409_100434140 3300031995 Bacteria 1263
411 Ga0307416_100007386 3300032002 Bacteria 6984
412 Ga0307416_100044158 3300032002 Bacteria 3496
413 Ga0307416_100087157 3300032002 Bacteria 2664
414 Ga0307414_10000449 3300032004 Bacteria 21733
415 Ga0307414_10006402 3300032004 Bacteria 6564
416 Ga0307414_10030580 3300032004 Bacteria 3520
417 Ga0307414_10047460 3300032004 Bacteria 2955
418 Ga0307414_10079892 3300032004 Bacteria 2389
419 Ga0307414_10114750 3300032004 Bacteria 2058
420 Ga0307414_10456842 3300032004 Bacteria 1121
421 Ga0307411_10018881 3300032005 Bacteria 3968
422 Ga0307411_10033515 3300032005 Bacteria 3186
423 Ga0307411_10076867 3300032005 Bacteria 2283
424 Ga0307411_10095807 3300032005 Bacteria 2084
425 Ga0307411_10121251 3300032005 Bacteria 1892
426 Ga0307411_10150027 3300032005 Bacteria 1731
427 Ga0307415_100002524 3300032126 Bacteria 9145
428 Ga0307415_100060274 3300032126 Bacteria 2621
429 Ga0307415_100175145 3300032126 Bacteria 1677
430 Ga0307510_10000038 3300033180 Bacteria 106256
431 Ga0307510_10001244 3300033180 Bacteria 27679
432 Ga0307510_10021309 3300033180 Bacteria 7553
433 Ga0373937_0171774 3300036401 Bacteria 2034
434 Ga0395900_0067817 3300037418 Bacteria 3665
435 Ga0395905_0001404 3300037471 Bacteria 29151
436 Ga0395905_0142624 3300037471 Bacteria 2253
437 Ga0395905_0200010 3300037471 Bacteria 1873
438 Ga0395905_0350576 3300037471 Bacteria 1368
439 Ga0395901_0497604 3300038443 Bacteria 1241
440 Ga0436363_1258129 3300039450 Bacteria 2874
441 Ga0439438_000156 3300041405 Bacteria 31119
442 Ga0439447_000119 3300041407 Bacteria 26584
443 Ga0439447_000835 3300041407 Bacteria 11291
444 Ga0439447_003351 3300041407 Bacteria 5700
445 Ga0439466_0004964 3300041411 Bacteria 5110
446 Ga0439465_0004512 3300041413 Bacteria 4500
447 Ga0451793_0479790 3300041452 Bacteria 3720
448 Ga0451795_0032520 3300041456 Bacteria 2482
449 Ga0451798_0892919 3300041458 Bacteria 1884
450 Ga0451800_0392314 3300041459 Bacteria 6297
451 Ga0451853_1117171 3300041512 Bacteria 1422
452 Ga0439431_0042390 3300041997 Bacteria 1162
453 Ga0439432_015862 3300042006 Bacteria 2537
454 Ga0439450_033524 3300042008 Bacteria 1165
455 Ga0439457_000344 3300042014 Bacteria 12945
456 Ga0439457_020551 3300042014 Bacteria 1465
457 Ga0450897_001337 3300042128 Bacteria 1663
458 Ga0451577_0002536 3300042876 Bacteria 21608
459 Ga0451577_0286976 3300042876 Bacteria 1491
460 Ga0453683_0064422 3300044673 Bacteria 2291
461 Ga0453684_0000353 3300044712 Bacteria 191059
462 Ga0453684_0006286 3300044712 Bacteria 22724
463 Ga0453684_0107062 3300044712 Bacteria 3405
464 Ga0451576_0029879 3300045051 Bacteria 5829
465 Ga0451576_0070120 3300045051 Bacteria 3648
466 Ga0495627_000331 3300046453 Bacteria 45362
467 Ga0495592_0000365 3300046454 Bacteria 35662
468 Ga0495591_001338 3300046458 Bacteria 15489
469 Ga0495629_0002327 3300046459 Bacteria 14641
470 Ga0495638_0011307 3300046460 Bacteria 6151
471 Ga0495638_0033665 3300046460 Bacteria 3276
472 Ga0495638_0074968 3300046460 Bacteria 2063
473 Ga0495638_0082992 3300046460 Bacteria 1942
474 Ga0495638_0109978 3300046460 Bacteria 1638
475 Ga0495651_0031485 3300046462 Bacteria 4136
476 Ga0495653_0044885 3300046463 Bacteria 3428
477 Ga0495580_0001754 3300046472 Bacteria 19061
478 Ga0495580_0050085 3300046472 Bacteria 2953
479 Ga0495582_0021696 3300046473 Bacteria 3514
480 Ga0495582_0086888 3300046473 Bacteria 1740
481 Ga0495605_0041917 3300046474 Bacteria 2278
482 Ga0495605_0090807 3300046474 Bacteria 1416
483 Ga0495662_0093665 3300046476 Bacteria 1466
484 Ga0495664_0015337 3300046477 Bacteria 4355
485 Ga0495584_0057005 3300046491 Bacteria 1966
486 Ga0495585_0001312 3300046492 Bacteria 19806
487 Ga0495585_0028214 3300046492 Bacteria 3202
488 Ga0495596_0002121 3300046500 Bacteria 10856
489 Ga0495596_0007856 3300046500 Bacteria 4780
490 Ga0495607_0115014 3300046501 Bacteria 1421
491 Ga0495583_0004366 3300046506 Bacteria 10181
492 Ga0495606_0014221 3300046507 Bacteria 6227
493 Ga0495606_0090702 3300046507 Bacteria 1880
494 Ga0495606_0180150 3300046507 Bacteria 1219
495 Ga0495608_0017253 3300046511 Bacteria 4996
496 Ga0495610_0005616 3300046512 Bacteria 8854
497 Ga0495616_0063544 3300046513 Bacteria 1804
498 Ga0495618_0013317 3300046514 Bacteria 5005
499 Ga0495620_0012967 3300046515 Bacteria 4283
500 Ga0495620_0062069 3300046515 Bacteria 1553
501 Ga0495628_0008078 3300046516 Bacteria 9052
502 Ga0495628_0025243 3300046516 Bacteria 4855
503 Ga0495630_0024065 3300046517 Bacteria 4503
504 Ga0495631_0003492 3300046518 Bacteria 8591
505 Ga0495632_0000615 3300046519 Bacteria 32915
506 Ga0495643_0022266 3300046522 Bacteria 3618
507 Ga0495648_0000650 3300046524 Bacteria 37082
508 Ga0495648_0003114 3300046524 Bacteria 14787
509 Ga0495648_0031744 3300046524 Bacteria 3475
510 Ga0495648_0044815 3300046524 Bacteria 2757
511 Ga0495648_0095850 3300046524 Bacteria 1650
512 Ga0495666_0011584 3300046526 Bacteria 4395
513 Ga0495652_0027497 3300046529 Bacteria 5009
514 Ga0495654_0008860 3300046530 Bacteria 5532
515 Ga0495665_0015494 3300046531 Bacteria 4105
516 Ga0495665_0026698 3300046531 Bacteria 3101
517 Ga0495640_0026245 3300046533 Bacteria 4212
518 Ga0495586_0133825 3300046535 Bacteria 1389
519 Ga0495587_0012329 3300046536 Bacteria 5385
520 Ga0495587_0044837 3300046536 Bacteria 2630
521 Ga0495609_0029155 3300046538 Bacteria 2514
522 Ga0495597_0020551 3300046542 Bacteria 3074
523 Ga0495667_0035781 3300046559 Bacteria 3317
524 Ga0495668_0005238 3300046616 Bacteria 8884
525 Ga0495668_0005998 3300046616 Bacteria 8065
526 Ga0495668_0006677 3300046616 Bacteria 7512
527 Ga0495668_0129691 3300046616 Bacteria 1380
528 Ga0495634_0034802 3300046642 Bacteria 3453
529 Ga0495611_0000338 3300046648 Bacteria 30531
530 Ga0495611_0043288 3300046648 Bacteria 2013
531 Ga0495625_0000398 3300046660 Bacteria 66474
532 Ga0495625_0002639 3300046660 Bacteria 19152
533 Ga0495625_0005332 3300046660 Bacteria 11778
534 Ga0495625_0023964 3300046660 Bacteria 4654
535 Ga0495625_0045187 3300046660 Bacteria 3185
536 Ga0495625_0055265 3300046660 Bacteria 2831
537 Ga0495635_0004307 3300046663 Bacteria 9857
538 Ga0495661_0008892 3300046665 Bacteria 6917
539 Ga0495661_0022964 3300046665 Bacteria 4054
540 Ga0495661_0049329 3300046665 Bacteria 2553
541 Ga0495657_0042048 3300046675 Bacteria 3123
542 Ga0495599_0028843 3300046678 Bacteria 3478
543 Ga0495646_0019414 3300046680 Bacteria 4304
544 Ga0495669_0057008 3300046684 Bacteria 1762
545 Ga0495613_0003319 3300046689 Bacteria 12051
546 Ga0495624_0001210 3300046690 Bacteria 20399
547 Ga0495624_0010782 3300046690 Bacteria 6299
548 Ga0495649_0020224 3300046694 Bacteria 3734
549 Ga0495589_0012592 3300046794 Bacteria 4375
550 Ga0495600_0018671 3300046809 Bacteria 4421
551 Ga0495660_0030605 3300046810 Bacteria 3031
552 Ga0495604_0004068 3300047317 Bacteria 11623
553 Ga0495604_0015789 3300047317 Bacteria 6027
554 Ga0495636_0002305 3300047318 Bacteria 7330
555 Ga0495636_0044306 3300047318 Bacteria 1852
556 Ga0495636_0077057 3300047318 Bacteria 1431
557 Ga0495674_0002116 3300047319 Bacteria 19499
558 Ga0495674_0002272 3300047319 Bacteria 18868
559 Ga0495672_0004957 3300047320 Bacteria 10693
560 Ga0495676_0016536 3300047321 Bacteria 6543
561 Ga0495676_0082230 3300047321 Bacteria 2438
562 Ga0495680_0023678 3300047322 Bacteria 5102
563 Ga0495680_0154093 3300047322 Bacteria 1673
564 Ga0495683_0011094 3300047323 Bacteria 4749
565 Ga0495687_001236 3300047443 Bacteria 24392
566 Ga0495687_027256 3300047443 Bacteria 2676
567 Ga0495687_050697 3300047443 Bacteria 1767
568 Ga0495687_058816 3300047443 Bacteria 1593
569 Ga0495675_0020835 3300047444 Bacteria 4172
570 Ga0495679_000183 3300047446 Bacteria 56008
571 Ga0495679_008362 3300047446 Bacteria 4213
572 Ga0495673_0014057 3300047469 Bacteria 4176
573 Ga0495681_0067650 3300047470 Bacteria 1627
574 Ga0495593_0001368 3300047673 Bacteria 14246
575 Ga0495593_0001757 3300047673 Bacteria 12828
576 Ga0495602_0035786 3300048088 Bacteria 4626
577 Ga0495614_0011632 3300048089 Bacteria 3869
578 Ga0495626_0011713 3300048091 Bacteria 4626
579 Ga0496101_0250648 3300048904 Bacteria 1379
580 Ga0496103_0153161 3300048906 Bacteria 1477
581 Ga0496104_0010697 3300048907 Bacteria 8204
582 Ga0496105_0043074 3300048908 Bacteria 3723
583 Ga0496106_0012180 3300048909 Bacteria 6347
584 Ga0496107_0055487 3300048910 Bacteria 2862
585 Ga0496112_0015518 3300048915 Bacteria 7114
586 Ga0496116_0013736 3300048919 Bacteria 6510
587 Ga0496117_0002431 3300048920 Bacteria 23546
588 Ga0496117_0009276 3300048920 Bacteria 9193
589 Ga0496117_0047085 3300048920 Bacteria 3096
590 Ga0496117_0087514 3300048920 Bacteria 2019
591 Ga0496118_0005091 3300048921 Bacteria 15118
592 Ga0496119_0028863 3300048922 Bacteria 3775
593 Ga0496121_0003338 3300048924 Bacteria 23036
594 Ga0496121_0017890 3300048924 Bacteria 7192
595 Ga0496123_0030984 3300048926 Bacteria 3902
596 Ga0496124_0023755 3300048927 Bacteria 5588
597 Ga0496125_0001021 3300048928 Bacteria 43477
598 Ga0496125_0009713 3300048928 Bacteria 9824
599 Ga0496125_0068580 3300048928 Bacteria 2789
600 Ga0496126_0069428 3300048929 Bacteria 3143
601 Ga0496126_0173482 3300048929 Bacteria 1835
602 Ga0495682_0006252 3300049460 Bacteria 4839
603 Ga0495682_0011202 3300049460 Bacteria 3455
604 Ga0495682_0045654 3300049460 Bacteria 1600
605 Ga0501297_009640 3300049520 Bacteria 1083
606 Ga0501034_0287285 3300049571 Bacteria 1584
607 Ga0501038_0014418 3300049574 Bacteria 7202
608 Ga0501249_003383 3300049679 Bacteria 3199
609 Ga0501249_024246 3300049679 Bacteria 1336
610 Ga0501262_000019 3300049759 Bacteria 23083
611 Ga0501266_000190 3300049763 Bacteria 7859
612 Ga0501212_020169 3300049851 Bacteria 1026
613 nmdc:mga03683_13362_c1 3300050489 Bacteria 3020
614 nmdc:mga03n38_17482_c1 3300050490 Bacteria 2137
615 nmdc:mga00v17_37146_c2 3300050491 Bacteria 2197
616 nmdc:mga00v17_4_c1 3300050491 Bacteria 238758
617 nmdc:mga0k408_115892_c1 3300050493 Unclassified 1585
618 nmdc:mga0k408_19195_c1 3300050493 Bacteria 3818
619 nmdc:mga0k408_3654_c1 3300050493 Bacteria 8141
620 nmdc:mga0k408_39926_c2 3300050493 Bacteria 1246
621 nmdc:mga0k408_41120_c1 3300050493 Bacteria 2661
622 nmdc:mga0k408_9698_c1 3300050493 Bacteria 5199
623 nmdc:mga06z11_18457_c1 3300050494 Bacteria 3186
624 nmdc:mga06z11_22063_c1 3300050494 Bacteria 2967
625 nmdc:mga07m45_4202_c1 3300050496 Bacteria 7040
626 nmdc:mga05p37_250037_c1 3300050507 Bacteria 2127
627 nmdc:mga08y16_308720_c1 3300050511 Bacteria 1629
628 nmdc:mga0n895_359_c1 3300050512 Bacteria 30652
629 nmdc:mga0rr50_15494_c1 3300050513 Bacteria 5034
630 nmdc:mga0a205_5241_c1 3300050515 Bacteria 10392
631 nmdc:mga0sz30_33157_c1 3300050516 Bacteria 2145
632 nmdc:mga0sz30_718_c1 3300050516 Bacteria 12197
633 Ga0500610_0000398 3300053079 Bacteria 13232
634 Ga0500635_0027882 3300053080 Bacteria 1799
635 Ga0500578_0000002 3300053086 Bacteria 293507
636 Ga0500578_0059895 3300053086 Bacteria 2433
637 Ga0500643_000007 3300053087 Bacteria 462836
638 Ga0500643_000023 3300053087 Bacteria 273090
639 Ga0500643_000485 3300053087 Bacteria 28889
640 Ga0500644_0000316 3300053088 Bacteria 25207
641 Ga0500644_0001815 3300053088 Bacteria 5518
642 Ga0500646_0005804 3300053090 Bacteria 3129
643 Ga0500646_0012785 3300053090 Bacteria 2170
644 Ga0500646_0017594 3300053090 Bacteria 1876
645 Ga0500646_0031569 3300053090 Bacteria 1458
646 Ga0500646_0032025 3300053090 Bacteria 1449
647 Ga0500583_0000330 3300053092 Bacteria 15790
648 Ga0500651_0011141 3300053093 Bacteria 5412
649 Ga0500651_0036634 3300053093 Bacteria 3091
650 Ga0500566_0024737 3300053094 Bacteria 3523
651 Ga0500650_0068764 3300053098 Bacteria 1655
652 Ga0500562_000050 3300053108 Bacteria 60058
653 Ga0500594_0000743 3300053118 Bacteria 6936
654 Ga0500595_000113 3300053119 Bacteria 53829
655 Ga0500607_022569 3300053121 Bacteria 3537
656 Ga0500642_0008557 3300053130 Bacteria 3511
657 Ga0500652_002040 3300053131 Bacteria 6083
658 Ga0500652_005790 3300053131 Bacteria 3926
659 Ga0500655_011094 3300053133 Bacteria 1630
660 Ga0500658_0000009 3300053134 Bacteria 270303
661 Ga0500658_0001322 3300053134 Bacteria 10025
662 Ga0500658_0009256 3300053134 Bacteria 3633
663 Ga0500559_0000038 3300053136 Bacteria 109922
664 Ga0500559_0016915 3300053136 Bacteria 3081
665 Ga0500561_0000073 3300053137 Bacteria 19888
666 Ga0500568_0000205 3300053139 Bacteria 51687
667 Ga0500568_0010186 3300053139 Bacteria 4418
668 Ga0500577_0010259 3300053142 Bacteria 2751
669 Ga0500604_0000807 3300053151 Bacteria 8632
670 Ga0500604_0008000 3300053151 Bacteria 2805
671 Ga0500604_0021103 3300053151 Bacteria 1839
672 Ga0500616_0002510 3300053153 Bacteria 15189
673 Ga0500620_004905 3300053155 Bacteria 3041
674 Ga0500622_0000227 3300053156 Bacteria 58653
675 Ga0500622_0000290 3300053156 Bacteria 51286
676 Ga0500622_0001746 3300053156 Bacteria 16757
677 Ga0500622_0002334 3300053156 Bacteria 13843
678 Ga0500622_0003764 3300053156 Bacteria 9907
679 Ga0500622_0004702 3300053156 Bacteria 8445
680 Ga0500622_0019763 3300053156 Bacteria 3576
681 Ga0500627_0036272 3300053158 Bacteria 2098
682 Ga0500633_0004460 3300053160 Bacteria 3213
683 Ga0500636_0014267 3300053177 Bacteria 4672
684 Ga0500636_0017930 3300053177 Bacteria 4185
685 Ga0500636_0026685 3300053177 Bacteria 3411
686 Ga0500636_0035954 3300053177 Bacteria 2931
687 Ga0500645_001097 3300053730 Bacteria 14801
688 Ga0500645_030402 3300053730 Unclassified 1625
689 Ga0500587_003299 3300053739 Bacteria 2264
690 Ga0500661_002854 3300055283 Bacteria 3257
691 Ga0500661_003700 3300055283 Unclassified 2871
692 2508731839 2508501050 Bacteria 9633614
693 2509142552 2508501127 Bacteria 7037543
694 2510136659 2510065019 Bacteria 6903379
695 2511121787 2510917020 Bacteria 5657507
696 2511134170 2510917022 Bacteria 6504556
697 2511173894 2510917026 Bacteria 7046020
698 2511198709 2510917030 Bacteria 7460662
699 2511251464 2511231003 Bacteria 5606035
700 2512346687 2512047030 Bacteria 9031815
701 2512960015 2512875024 Bacteria 7195110
702 2513569462 2513237084 Bacteria 7231967
703 2513709928 2513237103 Bacteria 7647401
704 2513866128 2513237138 Bacteria 7368160
705 2513910854 2513237144 Bacteria 7530820
706 2513996851 2513237159 Bacteria 6810126
707 2514035964 2513237164 Bacteria 7563725
708 2516021016 2515154189 Bacteria 9629850
709 2517041786 2516653077 Bacteria 7555578
710 2517099227 2517093000 Bacteria 7412387
711 2524613303 2524023250 Bacteria 5457705
712 2585150413 2582581280 Bacteria 5994497
713 2585166089 2582581283 Bacteria 6030556
714 2585198711 2582581293 Bacteria 5907401
715 2585266601 2582581306 Bacteria 6450535
716 2585273573 2582581307 Bacteria 6597605
717 2585279601 2582581308 Bacteria 7413247
718 2585328027 2582581315 Bacteria 7318924
719 2585334022 2582581316 Bacteria 7774528
720 2585387616 2582581865 Bacteria 6644329
721 2585393210 2582581866 Bacteria 6859583
722 2585404758 2582581867 Bacteria 7184437
723 2585524308 2585427526 Bacteria 7258840
724 2585535680 2585427527 Bacteria 7273426
725 2585544483 2585427529 Bacteria 7395659
726 2585551058 2585427530 Bacteria 7383882
727 2585559746 2585427531 Bacteria 6992870
728 2585823383 2585427590 Bacteria 6824633
729 2585900434 2585427608 Bacteria 6544331
730 2585906074 2585427609 Bacteria 6667127
731 2585994931 2585427633 Bacteria 6413184
732 2585999473 2585427634 Bacteria 6455027
733 2587728480 2585428057 Bacteria 6737412
734 2587918729 2585428106 Bacteria 5179711
735 2587978811 2585428125 Bacteria 6662905
736 2599627698 2599185214 Bacteria 8209958
737 2599677267 2599185226 Bacteria 8233575
738 2599684712 2599185227 Bacteria 8246414
739 2599696621 2599185229 Bacteria 8216126
740 2616306388 2615840626 Bacteria 7921970
741 2617382355 2617270742 Bacteria 6808054
742 2643878321 2643221573 Bacteria 4784121
743 2643969450 2643221592 Bacteria 6608788
744 2643990690 2643221596 Bacteria 5006805
745 2644060416 2643221609 Bacteria 6756331
746 2644076155 2643221611 Bacteria 6820941
747 2644128837 2643221622 Bacteria 4212502
748 2644143750 2643221625 Bacteria 6512927
749 2644146178 2643221626 Bacteria 8069654
750 2644225376 2643221640 Bacteria 5258820
751 2644232684 2643221642 Bacteria 5357871
752 2644276544 2643221648 Bacteria 6521465
753 2644297026 2643221653 Bacteria 4569637
754 2644332806 2643221659 Bacteria 7890716
755 2644540286 2643221698 Bacteria 7756764
756 2644639887 2643221715 Bacteria 6671032
757 2644655279 2643221719 Bacteria 4568197
758 2644659626 2643221720 Bacteria 4694283
759 2657682111 2657244999 Bacteria 5946535
760 2671115997 2667528174 Bacteria 6435400
761 2688598029 2687453392 Bacteria 6880454
762 2692319489 2690316117 Bacteria 6800650
763 2738717890 2738541277 Bacteria 7458140
764 2738755163 2738541283 Bacteria 7222293
765 2738820538 2738541296 Bacteria 7285013
766 2738833018 2738541298 Bacteria 7286732
767 2738874545 2738541306 Bacteria 7284992
768 2739186175 2738543002 Bacteria 7284546
769 2739197190 2738543004 Bacteria 6381073
770 2739221143 2738543008 Bacteria 7282815
771 2739278576 2738543019 Bacteria 7459457
772 2739332561 2738543028 Bacteria 6917070
773 2753458321 2751185821 Bacteria 6189929
774 2753763065 2751185897 Bacteria 5322941
775 2756672088 2756170246 Bacteria 7451806
776 2765465370 2765235802 Bacteria 5618596
777 2770199203 2767802442 Bacteria 5747986
778 2778179248 2775507266 Bacteria 7392367
779 2792623284 2791355091 Bacteria 6135441
780 2793344857 2791355263 Bacteria 6872478
781 2804751129 2802429268 Bacteria 6094027
782 2806045705 2802429633 Bacteria 7341974
783 2806053275 2802429634 Bacteria 7083200
784 2806062316 2802429635 Bacteria 7650140
785 2806066356 2802429636 Bacteria 7597525
786 2806073064 2802429637 Bacteria 7067217
787 2808983711 2808606386 Bacteria 4471946
788 2809129375 2808606415 Bacteria 4576710
789 2809149570 2808606419 Bacteria 4576925
790 2819539496 2818991435 Bacteria 5433759
791 2819578065 2818991442 Bacteria 8318214
792 2819621343 2818991450 Bacteria 6962147
793 2819638456 2818991453 Bacteria 7181617
794 2819649278 2818991454 Bacteria 5563326
795 2838026732 2838022645 Bacteria 6494267
796 2838034151 2838029111 Bacteria 6603031
797 2838045796 2838042994 Bacteria 6046894
798 2838686216 2838680041 Bacteria 6545511
799 2838713979 2838707686 Bacteria 6619912
800 2839994979 2839993093 Bacteria 5512535
801 2840769872 2840764183 Bacteria 6358399
802 2841738752 2841734538 Bacteria 6784580
803 2842083377 2842077413 Bacteria 6508645
804 2842115652 2842110456 Bacteria 7656360
805 2842124324 2842118031 Bacteria 7033875
806 2842202335 2842198810 Bacteria 6608673
807 2842222107 2842217011 Bacteria 7497767
808 2842243340 2842237096 Bacteria 6620661
809 2842297522 2842291075 Bacteria 7076806
810 2842308770 2842304105 Bacteria 7023636
811 2842376607 2842370503 Bacteria 7038661
812 2842383860 2842377471 Bacteria 7140707
813 2842390947 2842384541 Bacteria 7057858
814 2842480881 2842475841 Bacteria 6603183
815 2842507508 2842502639 Bacteria 6604161
816 2842522912 2842521101 Bacteria 6569494
817 2842719704 2842718218 Bacteria 4560148
818 2844007963 2844002411 Bacteria 7168230
819 2844013253 2844009547 Bacteria 6728125
820 2844167216 2844163670 Bacteria 7266046
821 2847422009 2847417321 Bacteria 6913799
822 2851186247 2851182111 Bacteria 6047226
823 2852619722 2852618963 Bacteria 4577824
824 2856326992 2856320880 Bacteria 7263508
825 2856338128 2856334872 Bacteria 7037011
826 2856344295 2856342000 Bacteria 7176905
827 2856355949 2856349417 Bacteria 6230045
828 2856363680 2856356410 Bacteria 6297484
829 2869173354 2869169390 Bacteria 6659796
830 2869239267 2869234852 Bacteria 6654993
831 2869248345 2869242130 Bacteria 6609239
832 2869256412 2869249662 Bacteria 6868783
833 2869260758 2869256925 Bacteria 6981691
834 2869283462 2869278585 Bacteria 7077053
835 2871435994 2871435913 Bacteria 6880295
836 2871476746 2871474448 Bacteria 6806570
837 2871486757 2871481445 Bacteria 6700002
838 2871492563 2871488783 Bacteria 6929816
839 2874132663 2874131515 Bacteria 6820270
840 2874169324 2874168670 Bacteria 8062617
841 2876387505 2876386047 Bacteria 6698674
842 2876815588 2876808645 Bacteria 8824342
843 2878737842 2878730984 Bacteria 6380721
844 2878758445 2878753008 Bacteria 6922523
845 2878793235 2878788777 Bacteria 6567085
846 2879116504 2879110137 Bacteria 8907982
847 2881157992 2881155292 Bacteria 6461656
848 2881859459 2881853255 Bacteria 6698367
849 2881867363 2881861095 Bacteria 7128710
850 2882913395 2882912400 Bacteria 6801539
851 2885204640 2885198086 Bacteria 7212419
852 2885218293 2885211737 Bacteria 7212420
853 2885319924 2885318864 Bacteria 6729568
854 2885348075 2885342637 Bacteria 7011821
855 2885352933 2885350715 Bacteria 6787678
856 2886849591 2886848708 Bacteria 5632523
857 2899847450 2899845264 Bacteria 5672268
858 2903496706 2903492973 Bacteria 13473544
859 2903519944 2903513507 Bacteria 6344008
860 2904581536 2904578770 Bacteria 5302906
861 2906364103 2906363423 Bacteria 6856682
862 2906375285 2906370794 Bacteria 6881062
863 2906395027 2906393657 Bacteria 6790866
864 2906405799 2906401398 Bacteria 6693206
865 2906434582 2906427513 Bacteria 6375796
866 2916028659 2916028427 Bacteria 6748433
867 2916056049 2916055098 Bacteria 6758838
868 2919108204 2919100787 Bacteria 7710546
869 2919122771 2919119836 Bacteria 5208557
870 2919131303 2919130084 Bacteria 5301837
871 2919411485 2919408235 Bacteria 6149349
872 2921264283 2921263974 Bacteria 6864552
873 2922157868 2922151315 Bacteria 6902399
874 2923562402 2923556063 Bacteria 6793593
875 2924179476 2924172951 Bacteria 6749356
876 2924716234 2924710171 Bacteria 6752351
877 2924734938 2924733363 Bacteria 7574837
878 2924741721 2924741084 Bacteria 6661321
879 2924785027 2924784321 Bacteria 7416538
880 2928078252 2928070936 Bacteria 8062541
881 2928503850 2928503688 Bacteria 7268108
882 2928525977 2928521798 Bacteria 4960112
883 2929182041 2929177148 Bacteria 7883697
884 2929196548 2929195423 Bacteria 5325372
885 2929925906 2929921140 Bacteria 8649150
886 2932795332 2932794094 Bacteria 7915132
887 2932805862 2932801729 Bacteria 7987968
888 2933575100 2933570622 Bacteria 7023390
889 2933591619 2933586486 Bacteria 7667493
890 2935708191 2935703347 Bacteria 10242284
891 2935883775 2935883170 Bacteria 7964738
892 2935900965 2935894831 Bacteria 6620579
893 2936009427 2936002035 Bacteria 9362176
894 2936370328 2936367885 Bacteria 7324495
895 2937017998 2937016420 Bacteria 6782579
896 2937047645 2937042894 Bacteria 6741576
897 2937075848 2937071275 Bacteria 6984483
898 2937126589 2937126314 Bacteria 6771275
899 2937854009 2937848649 Bacteria 6983481
900 2937868949 2937861824 Bacteria 6660327
901 2937979822 2937972304 Bacteria 7532020
902 2937986880 2937980651 Bacteria 6517427
903 2945912742 2945909444 Bacteria 7065066
904 2945938681 2945934425 Bacteria 7444609
905 2945947552 2945945610 Bacteria 5951079
906 2945977982 2945977869 Bacteria 7777518
907 2945984997 2945984333 Bacteria 7358892
908 2946016165 2946013367 Bacteria 7766675
909 2954011932 2954011201 Bacteria 4762601
910 2957478262 2957478035 Bacteria 6756658
911 2958039975 2958034702 Bacteria 6989922
912 2958054319 2958041894 Bacteria 13082850
913 2958071643 2958071322 Bacteria 6815895
914 2958097982 2958092219 Bacteria 6861151
915 2958111878 2958108152 Bacteria 6681128
916 2958124145 2958122699 Bacteria 7280457
917 2961133700 2961127735 Bacteria 7196641
918 2961173362 2961170736 Bacteria 7072258
919 2961184961 2961183825 Bacteria 6688536
920 2964706873 2964705432 Bacteria 7114648
921 2965036081 2965032056 Bacteria 6887443
922 2967744211 2967742019 Bacteria 6794534
923 2967780354 2967775926 Bacteria 6738189
924 2967998532 2967996073 Bacteria 6787468
925 2968006042 2968003550 Bacteria 6929263
926 2968138867 2968138860 Bacteria 6605449
927 2970178935 2970177841 Bacteria 6768001
928 2970505955 2970503327 Bacteria 7099517
929 2970515782 2970510686 Bacteria 7006402
930 2970528194 2970524798 Bacteria 6840927
931 2970535461 2970532167 Bacteria 6553173
932 2970598112 2970593180 Bacteria 7073582
933 2970619541 2970619444 Bacteria 6986144
934 2970628152 2970627176 Bacteria 6680862
935 2977826978 2977821940 Bacteria 6906439
936 2977833747 2977828996 Bacteria 7007971
937 2977854821 2977851361 Bacteria 6694324
938 2977874883 2977872689 Bacteria 7270173
939 2977905780 2977898635 Bacteria 6675551
940 2977916529 2977915119 Bacteria 6829656
941 2977928617 2977922695 Bacteria 6956781
942 2977957116 2977950692 Bacteria 6893264
943 2977958069 2977957713 Bacteria 6877875
944 2979768284 2979764755 Bacteria 6610066
945 2979795753 2979793036 Bacteria 6808957
946 2979810676 2979808191 Bacteria 7179355
947 2987678707 2987673487 Bacteria 6884027
948 2990708680 2990703756 Bacteria 7715990
949 2996315093 2996310559 Bacteria 6357320
950 2996388910 2996386984 Bacteria 6978667
951 3002143022 3002141150 Bacteria 5254435
952 3004168305 3004167301 Bacteria 8330599
953 3004197796 3004195979 Bacteria 6776956
954 3004212015 3004211236 Bacteria 7417683
955 3004224680 3004218560 Bacteria 7421728
956 3004233354 3004232784 Bacteria 6662140
957 3004242157 3004239961 Bacteria 6892290
958 3004250122 3004248173 Bacteria 6563236
959 3004272950 3004268573 Bacteria 7043476
960 3004293549 3004289098 Bacteria 6135450
961 3004335091 3004334049 Bacteria 8449246
962 3005416857 3005416602 Bacteria 7064308
963 3005512795 3005506211 Bacteria 6943378
964 3005719876 3005718088 Bacteria 8283608
965 639651857 639633055 Bacteria 7751309
966 642426414 641736151 Bacteria 7477263
967 642621616 642555113 Bacteria 8214658
968 649872561 649633066 Bacteria 6690028
969 8003322940 8003314358 Bacteria 10575343
970 8004364851 8004361976 Bacteria 6858373
971 8004379961 8004374579 Bacteria 6898112
972 8004639763 8004633249 Bacteria 6723080
973 8004732505 8004727605 Bacteria 6643904
974 8005264570 8005258706 Bacteria 6184835
975 8005315939 8005314921 Bacteria 7072929
976 8005321997 8005321885 Bacteria 5795980
977 8005382004 8005376324 Bacteria 6590079
978 8005562240 8005556819 Bacteria 6908598
979 8005566995 8005563573 Bacteria 7153261
980 8005576633 8005570704 Bacteria 6957481
981 8018127834 8018127388 Bacteria 7351159
982 8018166039 8018163183 Bacteria 7277977
983 8023688199 8023680758 Bacteria 7729763
984 8024483855 8024479707 Bacteria 6954785
985 8054291378 8054285046 Bacteria 6919322
986 8055269823 8055266321 Bacteria 7999742
987 8055620325 8055617313 Bacteria 7548464
988 8057582319 8057575449 Bacteria 7367519
989 8057878552 8057874678 Bacteria 7494653
990 Ga0157378_10000319
991 JGI24740J21852_10001788
992 JGI24739J22299_10008123
993 JGI24739J22299_10023597
994 JGI24737J22298_10003380
995 JGI24737J22298_10004822
996 JGI24743J22301_10006797
997 JGI24738J21930_10001816
998 JGI24738J21930_10010554
999 JGI25156J39149_1000873
1000 JGI25156J39149_1001284
1001 JGI25162J39368_1000642
1002 JGI25154J39366_1000069
1003 JGI25154J39366_1001801
1004 JGI25157J39369_1000851
1005 JGI25151J46595_10001575
1006 JGI25165J46597_1000999
1007 JGI25165J46597_1001072
1008 JGI25165J46597_1002307
1009 JGI25153J46596_10001714
1010 rootL2_10004516
1011 rootL2_10363542
1012 JGI25160J50197_1012841
1013 JGI25161J50226_1002832
1014 Ga0055539_1000513
1015 Ga0055524_1012206
1016 Ga0055531_10000965
1017 Ga0058692_1000035
1018 Ga0055543_1001188
1019 Ga0065165_1000241
1020 Ga0065165_1002670
1021 Ga0065715_10089106
1022 Ga0070658_10005121
1023 Ga0070658_10041562
1024 Ga0070670_100043399
1025 Ga0068869_100051298
1026 Ga0068869_100072738
1027 Ga0068869_100454803
1028 Ga0070666_10025670
1029 Ga0070666_10193979
1030 Ga0068868_100087708
1031 Ga0070660_100133936
1032 Ga0070660_100188043
1033 Ga0070660_100252382
1034 Ga0070668_100053824
1035 Ga0070668_100203068
1036 Ga0070669_100204096
1037 Ga0070675_100276405
1038 Ga0070675_100388678
1039 Ga0070671_100122939
1040 Ga0070671_100153126
1041 Ga0070674_100033790
1042 Ga0070674_100249814
1043 Ga0070673_100029907
1044 Ga0070673_100048494
1045 Ga0070659_100001718
1046 Ga0070659_100028187
1047 Ga0070659_100162400
1048 Ga0070667_100057349
1049 Ga0070667_100290157
1050 Ga0070705_100075763
1051 Ga0070700_100076132
1052 Ga0070708_100118089
1053 Ga0070708_100205401
1054 Ga0070662_100000167
1055 Ga0070662_100079420
1056 Ga0070662_100220601
1057 Ga0068867_100126997
1058 Ga0068867_100134289
1059 Ga0070706_100003698
1060 Ga0070706_100193872
1061 Ga0070707_100005425
1062 Ga0070707_100108298
1063 Ga0070698_100054281
1064 Ga0070698_100147290
1065 Ga0070698_100487148
1066 Ga0070699_100007692
1067 Ga0070699_100227605
1068 Ga0070679_100221311
1069 Ga0070684_100051678
1070 Ga0070697_100006095
1071 Ga0070697_100296960
1072 Ga0068853_100018261
1073 Ga0068853_100156821
1074 Ga0070672_100001960
1075 Ga0070672_100074753
1076 Ga0070665_100000006
1077 Ga0070665_100007151
1078 Ga0070665_100016065
1079 Ga0070665_100303727
1080 Ga0070704_100024496
1081 Ga0070704_100181522
1082 Ga0070704_100425153
1083 Ga0068855_100007578
1084 Ga0068855_100064015
1085 Ga0068855_100275068
1086 Ga0068855_100343998
1087 Ga0068857_100000489
1088 Ga0068857_100117345
1089 Ga0068857_100220463
1090 Ga0068854_100008799
1091 Ga0068854_100071479
1092 Ga0068856_100000991
1093 Ga0068856_100041460
1094 Ga0068856_100209029
1095 Ga0068852_100052049
1096 Ga0068852_100117952
1097 Ga0068852_100122678
1098 Ga0068859_100000151
1099 Ga0068859_100007089
1100 Ga0068861_100001690
1101 Ga0068851_10010112
1102 Ga0068851_10018502
1103 Ga0068851_10105116
1104 Ga0068863_100026949
1105 Ga0068863_100054170
1106 Ga0068863_100117728
1107 Ga0068863_100250274
1108 Ga0068863_100456958
1109 Ga0068858_100000273
1110 Ga0068858_100006378
1111 Ga0068858_100008996
1112 Ga0068858_100113852
1113 Ga0068858_100365369
1114 Ga0068860_100046091
1115 Ga0068860_100341009
1116 Ga0068862_100020999
1117 Ga0068862_100024533
1118 Ga0068862_100234316
1119 Ga0068862_100284396
1120 Ga0070717_10006422
1121 Ga0070717_10101276
1122 Ga0075365_10002167
1123 Ga0075365_10144624
1124 Ga0075368_10007659
1125 Ga0075368_10019634
1126 Ga0075364_10106867
1127 Ga0075432_10013171
1128 Ga0070715_10063920
1129 Ga0075362_10000508
1130 Ga0075367_10036200
1131 Ga0075367_10176970
1132 Ga0075369_10005799
1133 Ga0075369_10023666
1134 Ga0075366_10001556
1135 Ga0075366_10015983
1136 Ga0075366_10034597
1137 Ga0075366_10121530
1138 Ga0075370_10008118
1139 Ga0075370_10052305
1140 Ga0075370_10058171
1141 Ga0075428_100026574
1142 Ga0075428_100100604
1143 Ga0075430_100010209
1144 Ga0075430_100037469
1145 Ga0075430_100129903
1146 Ga0075431_100113557
1147 Ga0075434_100017992
1148 Ga0075429_100006117
1149 Ga0075429_100049552
1150 Ga0068865_100180466
1151 Ga0075436_100087478
1152 Ga0097620_100000151
1153 Ga0097620_100007089
1154 Ga0075435_100041263
1155 Ga0105251_10000837
1156 Ga0105244_10003082
1157 Ga0105244_10030578
1158 Ga0105240_10000142
1159 Ga0105240_10068267
1160 Ga0105240_10085783
1161 Ga0105240_10095230
1162 Ga0105240_10108637
1163 Ga0105240_10472789
1164 Ga0111539_10348399
1165 Ga0105245_10102479
1166 Ga0105247_10014016
1167 Ga0105247_10035380
1168 Ga0114129_10561688
1169 Ga0105243_10005104
1170 Ga0105243_10218194
1171 Ga0105241_10012545
1172 Ga0105241_10027870
1173 Ga0105241_10064139
1174 Ga0105248_10000764
1175 Ga0105248_10132844
1176 Ga0105248_10139030
1177 Ga0105248_10301610
1178 Ga0105237_10053876
1179 Ga0105237_10131081
1180 Ga0105237_10358871
1181 Ga0105238_10038755
1182 Ga0105238_10113596
1183 Ga0105238_10222572
1184 Ga0105249_10019476
1185 Ga0123342_1017216
1186 Ga0105239_10009037
1187 Ga0105239_10033221
1188 Ga0105239_10044778
1189 Ga0105239_10062150
1190 Ga0105239_10064171
1191 Ga0105239_10072703
1192 Ga0105239_10081086
1193 Ga0105239_10722216
1194 Ga0105246_10051609
1195 Ga0105246_10062221
1196 Ga0105246_10148420
1197 Ga0157373_10048454
1198 Ga0157373_10056285
1199 Ga0157373_10057525
1200 Ga0157370_10001666
1201 Ga0157370_10018690
1202 Ga0157370_10122823
1203 Ga0157369_10027598
1204 Ga0157369_10031335
1205 Ga0157369_10098085
1206 Ga0157369_10103270
1207 Ga0157374_10004368
1208 Ga0157374_10007769
1209 Ga0157374_10065564
1210 Ga0157374_10179313
1211 Ga0157374_10204448
1212 Ga0163162_10137842
1213 Ga0157372_10018994
1214 Ga0157372_10043036
1215 Ga0157375_10003013
1216 Ga0163163_10034598
1217 Ga0157380_10057383
1218 Ga0182008_10025740
1219 Ga0182008_10039458
1220 Ga0182008_10046900
1221 Ga0157379_10008013
1222 Ga0157379_10022204
1223 Ga0157376_10407585
1224 Ga0182006_1013342
1225 Ga0182006_1013820
1226 Ga0182006_1027109
1227 Ga0182006_1042021
1228 Ga0182007_10000445
1229 Ga0182007_10005878
1230 Ga0182007_10010414
1231 Ga0163161_10123495
1232 Ga0163161_10220475
1233 Ga0163161_10247922
1234 Ga0209437_100179
1235 Ga0209437_102131
1236 Ga0207425_1003095
1237 Ga0209646_1000299
1238 Ga0209026_1000382
1239 Ga0209677_100222
1240 Ga0209677_101959
1241 Ga0209759_1000085
1242 Ga0209759_1000529
1243 Ga0209129_1000566
1244 Ga0209233_1000185
1245 Ga0209233_1000263
1246 Ga0209455_1005371
1247 Ga0209025_1000082
1248 Ga0209758_1000319
1249 Ga0209758_1003930
1250 Ga0209758_1049084
1251 Ga0209050_1000221
1252 Ga0209256_1000794
1253 Ga0207426_1000210
1254 Ga0209257_1000538
1255 Ga0207656_10057803
1256 Ga0207655_1004047
1257 Ga0207713_1000336
1258 Ga0207653_10045597
1259 Ga0207642_10072020
1260 Ga0207710_10004946
1261 Ga0207680_10090403
1262 Ga0207647_10000209
1263 Ga0207647_10000515
1264 Ga0207647_10101113
1265 Ga0207645_10042759
1266 Ga0207705_10000607
1267 Ga0207684_10009256
1268 Ga0207684_10071261
1269 Ga0207684_10081248
1270 Ga0207684_10235168
1271 Ga0207654_10042723
1272 Ga0207695_10000234
1273 Ga0207695_10076941
1274 Ga0207695_10251458
1275 Ga0207695_10305432
1276 Ga0207671_10000234
1277 Ga0207671_10059513
1278 Ga0207657_10002587
1279 Ga0207657_10074458
1280 Ga0207657_10185208
1281 Ga0207657_10329041
1282 Ga0207657_10342764
1283 Ga0207652_10087941
1284 Ga0207646_10003418
1285 Ga0207681_10115444
1286 Ga0207694_10013955
1287 Ga0207694_10083669
1288 Ga0207650_10038633
1289 Ga0207659_10351313
1290 Ga0207687_10042786
1291 Ga0207644_10042344
1292 Ga0207644_10140771
1293 Ga0207644_10168459
1294 Ga0207690_10004275
1295 Ga0207690_10013606
1296 Ga0207706_10000257
1297 Ga0207706_10019903
1298 Ga0207706_10098669
1299 Ga0207706_10115917
1300 Ga0207686_10176222
1301 Ga0207669_10022696
1302 Ga0207691_10099715
1303 Ga0207691_10101366
1304 Ga0207711_10005529
1305 Ga0207689_10050301
1306 Ga0207689_10061444
1307 Ga0207667_10003616
1308 Ga0207667_10011742
1309 Ga0207667_10070109
1310 Ga0207667_10267979
1311 Ga0207651_10009347
1312 Ga0207651_10014951
1313 Ga0207712_10101881
1314 Ga0207668_10045810
1315 Ga0207668_10132961
1316 Ga0207658_10095119
1317 Ga0207677_10132242
1318 Ga0207677_10165885
1319 Ga0207703_10000403
1320 Ga0207703_10005587
1321 Ga0207703_10006415
1322 Ga0207703_10161961
1323 Ga0207703_10177879
1324 Ga0207703_10421249
1325 Ga0207639_10034832
1326 Ga0207639_10165050
1327 Ga0207678_10046737
1328 Ga0207678_10157794
1329 Ga0207708_10015977
1330 Ga0207702_10000308
1331 Ga0207702_10096893
1332 Ga0207641_10315288
1333 Ga0207641_10321578
1334 Ga0207648_10012463
1335 Ga0207676_10490367
1336 Ga0207674_10006843
1337 Ga0207674_10012468
1338 Ga0207674_10161660
1339 Ga0207674_10179049
1340 Ga0207675_100000049
1341 Ga0207675_100215474
1342 Ga0207698_10063959
1343 Ga0207698_10134992
1344 Ga0207698_10266661
1345 Ga0207698_10580566
1346 Ga0209371_1000043
1347 Ga0209371_1000693
1348 Ga0207428_10203424
1349 Ga0268266_10000010
1350 Ga0268266_10022317
1351 Ga0268266_10044623
1352 Ga0268265_10000554
1353 Ga0268265_10120267
1354 Ga0268265_10276271
1355 Ga0268264_10034265
1356 Ga0268264_10127727
1357 Ga0307517_10006006
1358 Ga0307517_10195873
1359 Ga0307515_10023583
1360 Ga0307515_10104763
1361 Ga0307515_10213156
1362 Ga0307515_10320094
1363 Ga0268256_1000044
1364 Ga0268256_1003158
1365 Ga0307511_10005062
1366 Ga0316177_1027618
1367 Ga0316177_1054620
1368 Ga0314311_1034637
1369 Ga0316182_1382167
1370 Ga0265331_10006389
1371 Ga0265327_10000776
1372 Ga0307513_10031414
1373 Ga0307513_10223624
1374 Ga0307509_10251876
1375 Ga0307408_100045052
1376 Ga0307508_10000011
1377 Ga0307508_10166018
1378 Ga0307508_10197080
1379 Ga0307516_10029463
1380 Ga0307405_10074830
1381 Ga0307405_10082389
1382 Ga0307405_10112653
1383 Ga0307413_10015987
1384 Ga0307413_10040896
1385 Ga0307413_10083185
1386 Ga0307413_10201367
1387 Ga0307410_10059987
1388 Ga0307410_10203726
1389 Ga0307406_10000348
1390 Ga0307406_10018310
1391 Ga0307406_10105655
1392 Ga0307406_10192149
1393 Ga0307407_10018450
1394 Ga0307412_10000002
1395 Ga0307412_10012181
1396 Ga0307412_10064347
1397 Ga0307412_10130063
1398 Ga0307409_100046305
1399 Ga0307409_100434140
1400 Ga0307416_100007386
1401 Ga0307416_100044158
1402 Ga0307416_100087157
1403 Ga0307414_10000449
1404 Ga0307414_10006402
1405 Ga0307414_10030580
1406 Ga0307414_10047460
1407 Ga0307414_10079892
1408 Ga0307414_10114750
1409 Ga0307414_10456842
1410 Ga0307411_10018881
1411 Ga0307411_10033515
1412 Ga0307411_10076867
1413 Ga0307411_10095807
1414 Ga0307411_10121251
1415 Ga0307411_10150027
1416 Ga0307415_100002524
1417 Ga0307415_100060274
1418 Ga0307415_100175145
1419 Ga0307510_10000038
1420 Ga0307510_10001244
1421 Ga0307510_10021309
1422 Ga0373937_0171774
1423 Ga0395900_0067817
1424 Ga0395905_0001404
1425 Ga0395905_0142624
1426 Ga0395905_0200010
1427 Ga0395905_0350576
1428 Ga0395901_0497604
1429 Ga0436363_1258129
1430 Ga0439438_000156
1431 Ga0439447_000119
1432 Ga0439447_000835
1433 Ga0439447_003351
1434 Ga0439466_0004964
1435 Ga0439465_0004512
1436 Ga0451793_0479790
1437 Ga0451795_0032520
1438 Ga0451798_0892919
1439 Ga0451800_0392314
1440 Ga0451853_1117171
1441 Ga0439431_0042390
1442 Ga0439432_015862
1443 Ga0439450_033524
1444 Ga0439457_000344
1445 Ga0439457_020551
1446 Ga0450897_001337
1447 Ga0451577_0002536
1448 Ga0451577_0286976
1449 Ga0453683_0064422
1450 Ga0453684_0000353
1451 Ga0453684_0006286
1452 Ga0453684_0107062
1453 Ga0451576_0029879
1454 Ga0451576_0070120
1455 Ga0495627_000331
1456 Ga0495592_0000365
1457 Ga0495591_001338
1458 Ga0495629_0002327
1459 Ga0495638_0011307
1460 Ga0495638_0033665
1461 Ga0495638_0074968
1462 Ga0495638_0082992
1463 Ga0495638_0109978
1464 Ga0495651_0031485
1465 Ga0495653_0044885
1466 Ga0495580_0001754
1467 Ga0495580_0050085
1468 Ga0495582_0021696
1469 Ga0495582_0086888
1470 Ga0495605_0041917
1471 Ga0495605_0090807
1472 Ga0495662_0093665
1473 Ga0495664_0015337
1474 Ga0495584_0057005
1475 Ga0495585_0001312
1476 Ga0495585_0028214
1477 Ga0495596_0002121
1478 Ga0495596_0007856
1479 Ga0495607_0115014
1480 Ga0495583_0004366
1481 Ga0495606_0014221
1482 Ga0495606_0090702
1483 Ga0495606_0180150
1484 Ga0495608_0017253
1485 Ga0495610_0005616
1486 Ga0495616_0063544
1487 Ga0495618_0013317
1488 Ga0495620_0012967
1489 Ga0495620_0062069
1490 Ga0495628_0008078
1491 Ga0495628_0025243
1492 Ga0495630_0024065
1493 Ga0495631_0003492
1494 Ga0495632_0000615
1495 Ga0495643_0022266
1496 Ga0495648_0000650
1497 Ga0495648_0003114
1498 Ga0495648_0031744
1499 Ga0495648_0044815
1500 Ga0495648_0095850
1501 Ga0495666_0011584
1502 Ga0495652_0027497
1503 Ga0495654_0008860
1504 Ga0495665_0015494
1505 Ga0495665_0026698
1506 Ga0495640_0026245
1507 Ga0495586_0133825
1508 Ga0495587_0012329
1509 Ga0495587_0044837
1510 Ga0495609_0029155
1511 Ga0495597_0020551
1512 Ga0495667_0035781
1513 Ga0495668_0005238
1514 Ga0495668_0005998
1515 Ga0495668_0006677
1516 Ga0495668_0129691
1517 Ga0495634_0034802
1518 Ga0495611_0000338
1519 Ga0495611_0043288
1520 Ga0495625_0000398
1521 Ga0495625_0002639
1522 Ga0495625_0005332
1523 Ga0495625_0023964
1524 Ga0495625_0045187
1525 Ga0495625_0055265
1526 Ga0495635_0004307
1527 Ga0495661_0008892
1528 Ga0495661_0022964
1529 Ga0495661_0049329
1530 Ga0495657_0042048
1531 Ga0495599_0028843
1532 Ga0495646_0019414
1533 Ga0495669_0057008
1534 Ga0495613_0003319
1535 Ga0495624_0001210
1536 Ga0495624_0010782
1537 Ga0495649_0020224
1538 Ga0495589_0012592
1539 Ga0495600_0018671
1540 Ga0495660_0030605
1541 Ga0495604_0004068
1542 Ga0495604_0015789
1543 Ga0495636_0002305
1544 Ga0495636_0044306
1545 Ga0495636_0077057
1546 Ga0495674_0002116
1547 Ga0495674_0002272
1548 Ga0495672_0004957
1549 Ga0495676_0016536
1550 Ga0495676_0082230
1551 Ga0495680_0023678
1552 Ga0495680_0154093
1553 Ga0495683_0011094
1554 Ga0495687_001236
1555 Ga0495687_027256
1556 Ga0495687_050697
1557 Ga0495687_058816
1558 Ga0495675_0020835
1559 Ga0495679_000183
1560 Ga0495679_008362
1561 Ga0495673_0014057
1562 Ga0495681_0067650
1563 Ga0495593_0001368
1564 Ga0495593_0001757
1565 Ga0495602_0035786
1566 Ga0495614_0011632
1567 Ga0495626_0011713
1568 Ga0496101_0250648
1569 Ga0496103_0153161
1570 Ga0496104_0010697
1571 Ga0496105_0043074
1572 Ga0496106_0012180
1573 Ga0496107_0055487
1574 Ga0496112_0015518
1575 Ga0496116_0013736
1576 Ga0496117_0002431
1577 Ga0496117_0009276
1578 Ga0496117_0047085
1579 Ga0496117_0087514
1580 Ga0496118_0005091
1581 Ga0496119_0028863
1582 Ga0496121_0003338
1583 Ga0496121_0017890
1584 Ga0496123_0030984
1585 Ga0496124_0023755
1586 Ga0496125_0001021
1587 Ga0496125_0009713
1588 Ga0496125_0068580
1589 Ga0496126_0069428
1590 Ga0496126_0173482
1591 Ga0495682_0006252
1592 Ga0495682_0011202
1593 Ga0495682_0045654
1594 Ga0501297_009640
1595 Ga0501034_0287285
1596 Ga0501038_0014418
1597 Ga0501249_003383
1598 Ga0501249_024246
1599 Ga0501262_000019
1600 Ga0501266_000190
1601 Ga0501212_020169
1602 nmdc:mga03683_13362_c1
1603 nmdc:mga03n38_17482_c1
1604 nmdc:mga00v17_37146_c2
1605 nmdc:mga00v17_4_c1
1606 nmdc:mga0k408_115892_c1
1607 nmdc:mga0k408_19195_c1
1608 nmdc:mga0k408_3654_c1
1609 nmdc:mga0k408_39926_c2
1610 nmdc:mga0k408_41120_c1
1611 nmdc:mga0k408_9698_c1
1612 nmdc:mga06z11_18457_c1
1613 nmdc:mga06z11_22063_c1
1614 nmdc:mga07m45_4202_c1
1615 nmdc:mga05p37_250037_c1
1616 nmdc:mga08y16_308720_c1
1617 nmdc:mga0n895_359_c1
1618 nmdc:mga0rr50_15494_c1
1619 nmdc:mga0a205_5241_c1
1620 nmdc:mga0sz30_33157_c1
1621 nmdc:mga0sz30_718_c1
1622 Ga0500610_0000398
1623 Ga0500635_0027882
1624 Ga0500578_0000002
1625 Ga0500578_0059895
1626 Ga0500643_000007
1627 Ga0500643_000023
1628 Ga0500643_000485
1629 Ga0500644_0000316
1630 Ga0500644_0001815
1631 Ga0500646_0005804
1632 Ga0500646_0012785
1633 Ga0500646_0017594
1634 Ga0500646_0031569
1635 Ga0500646_0032025
1636 Ga0500583_0000330
1637 Ga0500651_0011141
1638 Ga0500651_0036634
1639 Ga0500566_0024737
1640 Ga0500650_0068764
1641 Ga0500562_000050
1642 Ga0500594_0000743
1643 Ga0500595_000113
1644 Ga0500607_022569
1645 Ga0500642_0008557
1646 Ga0500652_002040
1647 Ga0500652_005790
1648 Ga0500655_011094
1649 Ga0500658_0000009
1650 Ga0500658_0001322
1651 Ga0500658_0009256
1652 Ga0500559_0000038
1653 Ga0500559_0016915
1654 Ga0500561_0000073
1655 Ga0500568_0000205
1656 Ga0500568_0010186
1657 Ga0500577_0010259
1658 Ga0500604_0000807
1659 Ga0500604_0008000
1660 Ga0500604_0021103
1661 Ga0500616_0002510
1662 Ga0500620_004905
1663 Ga0500622_0000227
1664 Ga0500622_0000290
1665 Ga0500622_0001746
1666 Ga0500622_0002334
1667 Ga0500622_0003764
1668 Ga0500622_0004702
1669 Ga0500622_0019763
1670 Ga0500627_0036272
1671 Ga0500633_0004460
1672 Ga0500636_0014267
1673 Ga0500636_0017930
1674 Ga0500636_0026685
1675 Ga0500636_0035954
1676 Ga0500645_001097
1677 Ga0500645_030402
1678 Ga0500587_003299
1679 Ga0500661_002854
1680 Ga0500661_003700
1681 2508731839
1682 2509142552
1683 2510136659
1684 2511121787
1685 2511134170
1686 2511173894
1687 2511198709
1688 2511251464
1689 2512346687
1690 2512960015
1691 2513569462
1692 2513709928
1693 2513866128
1694 2513910854
1695 2513996851
1696 2514035964
1697 2516021016
1698 2517041786
1699 2517099227
1700 2524613303
1701 2585150413
1702 2585166089
1703 2585198711
1704 2585266601
1705 2585273573
1706 2585279601
1707 2585328027
1708 2585334022
1709 2585387616
1710 2585393210
1711 2585404758
1712 2585524308
1713 2585535680
1714 2585544483
1715 2585551058
1716 2585559746
1717 2585823383
1718 2585900434
1719 2585906074
1720 2585994931
1721 2585999473
1722 2587728480
1723 2587918729
1724 2587978811
1725 2599627698
1726 2599677267
1727 2599684712
1728 2599696621
1729 2616306388
1730 2617382355
1731 2643878321
1732 2643969450
1733 2643990690
1734 2644060416
1735 2644076155
1736 2644128837
1737 2644143750
1738 2644146178
1739 2644225376
1740 2644232684
1741 2644276544
1742 2644297026
1743 2644332806
1744 2644540286
1745 2644639887
1746 2644655279
1747 2644659626
1748 2657682111
1749 2671115997
1750 2688598029
1751 2692319489
1752 2738717890
1753 2738755163
1754 2738820538
1755 2738833018
1756 2738874545
1757 2739186175
1758 2739197190
1759 2739221143
1760 2739278576
1761 2739332561
1762 2753458321
1763 2753763065
1764 2756672088
1765 2765465370
1766 2770199203
1767 2778179248
1768 2792623284
1769 2793344857
1770 2804751129
1771 2806045705
1772 2806053275
1773 2806062316
1774 2806066356
1775 2806073064
1776 2808983711
1777 2809129375
1778 2809149570
1779 2819539496
1780 2819578065
1781 2819621343
1782 2819638456
1783 2819649278
1784 2838026732
1785 2838034151
1786 2838045796
1787 2838686216
1788 2838713979
1789 2839994979
1790 2840769872
1791 2841738752
1792 2842083377
1793 2842115652
1794 2842124324
1795 2842202335
1796 2842222107
1797 2842243340
1798 2842297522
1799 2842308770
1800 2842376607
1801 2842383860
1802 2842390947
1803 2842480881
1804 2842507508
1805 2842522912
1806 2842719704
1807 2844007963
1808 2844013253
1809 2844167216
1810 2847422009
1811 2851186247
1812 2852619722
1813 2856326992
1814 2856338128
1815 2856344295
1816 2856355949
1817 2856363680
1818 2869173354
1819 2869239267
1820 2869248345
1821 2869256412
1822 2869260758
1823 2869283462
1824 2871435994
1825 2871476746
1826 2871486757
1827 2871492563
1828 2874132663
1829 2874169324
1830 2876387505
1831 2876815588
1832 2878737842
1833 2878758445
1834 2878793235
1835 2879116504
1836 2881157992
1837 2881859459
1838 2881867363
1839 2882913395
1840 2885204640
1841 2885218293
1842 2885319924
1843 2885348075
1844 2885352933
1845 2886849591
1846 2899847450
1847 2903496706
1848 2903519944
1849 2904581536
1850 2906364103
1851 2906375285
1852 2906395027
1853 2906405799
1854 2906434582
1855 2916028659
1856 2916056049
1857 2919108204
1858 2919122771
1859 2919131303
1860 2919411485
1861 2921264283
1862 2922157868
1863 2923562402
1864 2924179476
1865 2924716234
1866 2924734938
1867 2924741721
1868 2924785027
1869 2928078252
1870 2928503850
1871 2928525977
1872 2929182041
1873 2929196548
1874 2929925906
1875 2932795332
1876 2932805862
1877 2933575100
1878 2933591619
1879 2935708191
1880 2935883775
1881 2935900965
1882 2936009427
1883 2936370328
1884 2937017998
1885 2937047645
1886 2937075848
1887 2937126589
1888 2937854009
1889 2937868949
1890 2937979822
1891 2937986880
1892 2945912742
1893 2945938681
1894 2945947552
1895 2945977982
1896 2945984997
1897 2946016165
1898 2954011932
1899 2957478262
1900 2958039975
1901 2958054319
1902 2958071643
1903 2958097982
1904 2958111878
1905 2958124145
1906 2961133700
1907 2961173362
1908 2961184961
1909 2964706873
1910 2965036081
1911 2967744211
1912 2967780354
1913 2967998532
1914 2968006042
1915 2968138867
1916 2970178935
1917 2970505955
1918 2970515782
1919 2970528194
1920 2970535461
1921 2970598112
1922 2970619541
1923 2970628152
1924 2977826978
1925 2977833747
1926 2977854821
1927 2977874883
1928 2977905780
1929 2977916529
1930 2977928617
1931 2977957116
1932 2977958069
1933 2979768284
1934 2979795753
1935 2979810676
1936 2987678707
1937 2990708680
1938 2996315093
1939 2996388910
1940 3002143022
1941 3004168305
1942 3004197796
1943 3004212015
1944 3004224680
1945 3004233354
1946 3004242157
1947 3004250122
1948 3004272950
1949 3004293549
1950 3004335091
1951 3005416857
1952 3005512795
1953 3005719876
1954 639651857
1955 642426414
1956 642621616
1957 649872561
1958 8003322940
1959 8004364851
1960 8004379961
1961 8004639763
1962 8004732505
1963 8005264570
1964 8005315939
1965 8005321997
1966 8005382004
1967 8005562240
1968 8005566995
1969 8005576633
1970 8018127834
1971 8018166039
1972 8023688199
1973 8024483855
1974 8054291378
1975 8055269823
1976 8055620325
1977 8057582319
1978 8057878552

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

179

322

0.94

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

156

249

0.88

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

26

115

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.9119 2 331
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9043 1 332
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8996 1 333
5a4d-assembly5.cif.gz_E crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13kote and nadp 0.8984 1 332
5a4d-assembly5.cif.gz_E crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13kote and nadp 0.8957 1 332
ID Description Score Start End Superfamily
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9465 2 126 3.90.180.10
af_Q0JDV3_9_115_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.945 1 93 3.90.180.10
af_Q54II4_2_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9409 2 122 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9404 1 123 3.90.180.10
af_B0BNC9_25_138_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9388 2 118 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A536VTB4-F1-model_v4 NADP-dependent oxidoreductase 0.9956 55 333 GO:0008270
GO:0016491
AF-A0A536VTB4-F1-model_v4 NADP-dependent oxidoreductase 0.9921 55 333 GO:0008270
GO:0016491
AF-A0A2V7NA27-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.992 1 333 GO:0008270
GO:0016491
AF-W9EF68-F1-model_v4 Zinc-containing alcohol dehydrogenase, quinone oxidoreductase 0.9909 1 333 GO:0016491
AF-A0A5B8TNI8-F1-model_v4 NADP-dependent oxidoreductase 0.9896 1 333 GO:0008270
GO:0016491

Map