F487592

General Info

Members Datasets Scaffolds Average Seq Length
989 536 1978 122

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0024483|Ga0466969_0024483_1142_1567
Length 141
Sequence VPRQTSAIELKELAEMARLVGVDLPREKRLEIALTYIYGIGRTRAQATCAGAGVSPDVRVKDLSEDDLIKLRDWIDGNYKIEGDLRREVAADIRRKMEIGCYQGLRHRRGLPVRGQRTHTNARTRKGPRRAIAGKKKPGKK

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
19 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
77 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020071 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
156 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
160 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
161 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
162 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
163 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
164 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
165 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
166 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
167 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
168 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
178 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
202 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
205 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
213 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
214 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
221 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
224 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
227 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
228 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
229 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
232 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
233 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
234 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
235 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
236 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
237 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
238 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
239 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
240 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
241 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
242 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
243 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
244 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
245 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
281 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
309 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
310 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
317 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
318 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
319 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
337 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
338 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
339 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
340 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
341 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
344 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
382 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
383 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
384 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
385 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
386 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
387 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
388 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
389 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
390 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
391 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
392 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
393 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
394 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
395 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
396 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
397 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
400 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
409 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
410 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
411 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
412 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
413 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
414 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
415 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
416 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
417 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
420 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
421 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
422 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
423 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
424 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
425 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
426 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
427 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
428 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
429 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
430 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
431 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
432 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
433 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
434 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
435 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
436 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
437 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
438 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
439 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
440 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
441 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
442 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
443 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
478 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
479 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
480 2506783011 Frankia datiscae Dg1 Isolate Nodule
481 2508501039 Frankia saprophytica CN3 Isolate Nodule
482 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
483 2517572101 Frankia sp. DC12 Isolate Nodule
484 2527291627 Frankia casuarinae Thr Isolate Nodule
485 2527291629 Frankia sp. BMG5.23 Isolate Nodule
486 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
487 2558860280 Kutzneria sp. 744 Isolate Unclassified
488 2576861822 Frankia sp. CeD Isolate Nodule
489 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
490 2619618881 Frankia sp. ACN1ag Isolate Unclassified
491 2619619003 Frankia sp. CpI1-P Isolate Nodule
492 2626541554 Frankia sp. AvcI.1 Isolate Nodule
493 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
494 2643221670 Streptomyces sp. Root431 Isolate Unclassified
495 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
496 2671180195 Frankia sp. CcI49 Isolate Nodule
497 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
498 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
499 2684623036 Frankia sp. CgIM4 Isolate Nodule
500 2687453737 Frankia sp. BMG5.36 Isolate Nodule
501 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
502 2710264753 Frankia sp. KB5 Isolate Nodule
503 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
504 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
505 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
506 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
507 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
508 2773857922 Frankia sp. CcI49 Isolate Nodule
509 2773857924 Frankia sp. CgIS1 Isolate Nodule
510 2773857933 Frankia sp. BMG5.30 Isolate Nodule
511 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
512 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
513 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
514 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
515 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
516 2862574272 Streptomyces sp. AcE210 Isolate Nodule
517 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
518 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
519 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
520 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
521 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
522 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
523 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
524 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
525 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
526 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
527 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
528 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
529 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
530 637000116 Frankia casuarinae CcI3 Isolate Nodule
531 8002775197 Frankia nepalensis CN7 Isolate Nodule
532 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
533 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
534 8054920844 Frankia tisae Agncl-8 Isolate Nodule
535 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
536 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.13
Metatranscriptomes 19.11
Isolates 5.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 2.53
Rhizoplane 3.64
Rhizosphere 79.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0024483 3300044656 Bacteria 3104
2 JGI24739J22299_10012589 3300001989 Bacteria 3103
3 JGI24737J22298_10004109 3300001990 Bacteria 5084
4 JGI24735J21928_10037966 3300002067 Bacteria 1411
5 JGI24738J21930_10009088 3300002075 Bacteria 2248
6 JGI25406J46586_10054419 3300003203 Bacteria 1324
7 Ga0006777J48905_1016128 3300003308 Bacteria 1474
8 rootH1_10087441 3300003316 Bacteria 1319
9 rootH1_10044574 3300003323 Bacteria 1269
10 JGI25160J50197_1013781 3300003354 Bacteria 2738
11 JGI25160J50197_1026569 3300003354 Bacteria 1593
12 Ga0007410J51695_1079086 3300003574 Bacteria 815
13 Ga0007409J51694_1027373 3300003575 Bacteria 920
14 Ga0007409J51694_1095426 3300003575 Bacteria 836
15 Ga0007429J51699_1077728 3300003579 Bacteria 773
16 Ga0007429J51699_1098508 3300003579 Bacteria 590
17 Ga0058858_1005032 3300004785 Bacteria 2048
18 Ga0058859_11826058 3300004798 Bacteria 929
19 Ga0058863_10085417 3300004799 Bacteria 885
20 Ga0058863_10169109 3300004799 Bacteria 997
21 Ga0058863_11770428 3300004799 Bacteria 982
22 Ga0058861_10106487 3300004800 Bacteria 846
23 Ga0058861_10162069 3300004800 Bacteria 677
24 Ga0058861_10186282 3300004800 Bacteria 597
25 Ga0058861_11881892 3300004800 Bacteria 865
26 Ga0058860_10025829 3300004801 Bacteria 1322
27 Ga0058860_10028160 3300004801 Bacteria 1054
28 Ga0058860_10106898 3300004801 Bacteria 637
29 Ga0058860_10115660 3300004801 Bacteria 982
30 Ga0058860_10229221 3300004801 Bacteria 940
31 Ga0058862_10127495 3300004803 Bacteria 979
32 Ga0058862_10191375 3300004803 Bacteria 860
33 Ga0058862_12724420 3300004803 Bacteria 855
34 Ga0070658_10786068 3300005327 Bacteria 827
35 Ga0070670_100338738 3300005331 Bacteria 1320
36 Ga0070670_101097127 3300005331 Bacteria 726
37 Ga0068869_100018620 3300005334 Bacteria 4731
38 Ga0068869_100883330 3300005334 Bacteria 773
39 Ga0068869_100940981 3300005334 Bacteria 750
40 Ga0068868_100702561 3300005338 Bacteria 905
41 Ga0070687_101127276 3300005343 Bacteria 575
42 Ga0070668_100196908 3300005347 Bacteria 1653
43 Ga0070675_100194727 3300005354 Bacteria 1757
44 Ga0070674_100077936 3300005356 Bacteria 2361
45 Ga0070667_102079642 3300005367 Bacteria 535
46 Ga0070709_10111103 3300005434 Bacteria 1843
47 Ga0070709_11011019 3300005434 Bacteria 662
48 Ga0070714_100182078 3300005435 Bacteria 1912
49 Ga0070714_101424383 3300005435 Bacteria 677
50 Ga0070713_100075640 3300005436 Bacteria 2856
51 Ga0070710_10000334 3300005437 Bacteria 22500
52 Ga0070701_10390157 3300005438 Bacteria 880
53 Ga0070711_100127812 3300005439 Bacteria 1889
54 Ga0070678_100314920 3300005456 Bacteria 1334
55 Ga0070678_101138709 3300005456 Bacteria 722
56 Ga0070681_10448711 3300005458 Bacteria 1202
57 Ga0068853_101415438 3300005539 Bacteria 673
58 Ga0070672_100332582 3300005543 Bacteria 1293
59 Ga0070693_101327412 3300005547 Bacteria 557
60 Ga0068856_100081044 3300005614 Bacteria 3220
61 Ga0068856_102522922 3300005614 Bacteria 521
62 Ga0068859_100034160 3300005617 Bacteria 5105
63 Ga0068859_100092242 3300005617 Bacteria 3080
64 Ga0068864_101053908 3300005618 Bacteria 808
65 Ga0068863_100001338 3300005841 Bacteria 24526
66 Ga0068858_100000010 3300005842 Bacteria 234748
67 Ga0068858_100010928 3300005842 Bacteria 8579
68 Ga0068862_100000362 3300005844 Bacteria 49253
69 Ga0081455_10006542 3300005937 Bacteria 12469
70 Ga0081540_1245936 3300005983 Bacteria 626
71 Ga0081539_10002050 3300005985 Bacteria 30294
72 Ga0081539_10021084 3300005985 Bacteria 4370
73 Ga0070717_10294088 3300006028 Bacteria 1442
74 Ga0075365_10244325 3300006038 Bacteria 1261
75 Ga0075368_10003605 3300006042 Bacteria 5187
76 Ga0075363_100018785 3300006048 Bacteria 3447
77 Ga0075364_10008222 3300006051 Bacteria 6229
78 Ga0070712_100506623 3300006175 Bacteria 1012
79 Ga0075367_10075343 3300006178 Bacteria 2035
80 Ga0075367_10172232 3300006178 Bacteria 1348
81 Ga0075369_10014830 3300006186 Bacteria 3118
82 Ga0075366_10481228 3300006195 Bacteria 767
83 Ga0075370_10088385 3300006353 Bacteria 1786
84 Ga0075370_10119183 3300006353 Bacteria 1535
85 Ga0075430_100325169 3300006846 Bacteria 1271
86 Ga0075431_100246785 3300006847 Bacteria 1815
87 Ga0075431_100657837 3300006847 Bacteria 1028
88 Ga0075429_100140830 3300006880 Bacteria 2111
89 Ga0097620_100034160 3300006931 Bacteria 5105
90 Ga0097620_100092239 3300006931 Bacteria 3080
91 Ga0099826_10027493 3300006948 Bacteria 4179
92 Ga0099794_10369792 3300007265 Bacteria 747
93 Ga0105244_10100475 3300009036 Bacteria 1415
94 Ga0105240_10204243 3300009093 Bacteria 2314
95 Ga0111539_11717097 3300009094 Bacteria 728
96 Ga0105245_10575897 3300009098 Bacteria 1150
97 Ga0105247_10000016 3300009101 Bacteria 263389
98 Ga0105247_10212251 3300009101 Bacteria 1306
99 Ga0105243_10162470 3300009148 Bacteria 1927
100 Ga0105243_10994620 3300009148 Bacteria 841
101 Ga0105241_10796030 3300009174 Bacteria 870
102 Ga0105248_10000035 3300009177 Bacteria 187578
103 Ga0105248_10002899 3300009177 Bacteria 19028
104 Ga0105248_12584018 3300009177 Bacteria 579
105 Ga0105248_13437596 3300009177 Bacteria 503
106 Ga0105249_10068762 3300009553 Bacteria 3267
107 Ga0105249_10687247 3300009553 Bacteria 1083
108 Ga0105239_11608217 3300010375 Bacteria 751
109 Ga0105239_12859172 3300010375 Bacteria 563
110 Ga0105239_13205203 3300010375 Bacteria 533
111 Ga0105246_10002569 3300011119 Bacteria 10977
112 Ga0105246_10434317 3300011119 Bacteria 1099
113 Ga0157322_1013348 3300012490 Bacteria 705
114 Ga0154012_109278 3300013059 Bacteria 1212
115 Ga0154010_148221 3300013062 Bacteria 888
116 Ga0157370_12126253 3300013104 Bacteria 503
117 Ga0157374_10520828 3300013296 Bacteria 1195
118 Ga0157378_10490338 3300013297 Bacteria 1226
119 Ga0157378_11560850 3300013297 Bacteria 705
120 Ga0157375_11093622 3300013308 Bacteria 933
121 Ga0163163_10010268 3300014325 Bacteria 8414
122 Ga0163163_12067520 3300014325 Bacteria 629
123 Ga0157380_10213417 3300014326 Bacteria 1722
124 Ga0182008_10009535 3300014497 Bacteria 5233
125 Ga0182008_10354699 3300014497 Bacteria 779
126 Ga0157377_10543637 3300014745 Bacteria 819
127 Ga0157379_10009461 3300014968 Bacteria 8492
128 Ga0157379_10101600 3300014968 Bacteria 2581
129 Ga0157379_10388618 3300014968 Bacteria 1281
130 Ga0157379_10784670 3300014968 Bacteria 898
131 Ga0157376_10865869 3300014969 Bacteria 920
132 Ga0182006_1012482 3300015261 Bacteria 3715
133 Ga0182007_10010395 3300015262 Bacteria 3680
134 Ga0183367_1002 3300015688 Bacteria 1101531
135 Ga0197907_10071147 3300020069 Bacteria 1633
136 Ga0197907_10456483 3300020069 Bacteria 3929
137 Ga0197907_10872862 3300020069 Bacteria 1123
138 Ga0197907_10874185 3300020069 Bacteria 1074
139 Ga0197907_11028216 3300020069 Bacteria 816
140 Ga0206356_10671161 3300020070 Bacteria 1880
141 Ga0206356_10797342 3300020070 Bacteria 1342
142 Ga0206356_10880070 3300020070 Bacteria 587
143 Ga0206356_10946215 3300020070 Bacteria 2606
144 Ga0206348_113828 3300020071 Bacteria 859
145 Ga0206349_1484921 3300020075 Bacteria 1124
146 Ga0206349_1782543 3300020075 Bacteria 949
147 Ga0206349_1815480 3300020075 Bacteria 2024
148 Ga0206355_1131249 3300020076 Bacteria 2134
149 Ga0206355_1350876 3300020076 Bacteria 1097
150 Ga0206351_10013403 3300020077 Bacteria 1454
151 Ga0206351_10035715 3300020077 Bacteria 1337
152 Ga0206351_10267213 3300020077 Bacteria 1843
153 Ga0206351_10945162 3300020077 Bacteria 1666
154 Ga0206352_10000892 3300020078 Bacteria 1414
155 Ga0206352_10048704 3300020078 Bacteria 1153
156 Ga0206352_10486095 3300020078 Bacteria 949
157 Ga0206352_10571914 3300020078 Bacteria 1283
158 Ga0206352_10718751 3300020078 Bacteria 1697
159 Ga0206350_10201708 3300020080 Bacteria 908
160 Ga0206350_10308689 3300020080 Bacteria 2085
161 Ga0206350_10386703 3300020080 Bacteria 1202
162 Ga0206350_10762397 3300020080 Bacteria 777
163 Ga0206350_11076420 3300020080 Bacteria 668
164 Ga0206354_10049783 3300020081 Bacteria 1695
165 Ga0206354_10458357 3300020081 Bacteria 1553
166 Ga0206354_10517799 3300020081 Bacteria 2547
167 Ga0206354_11155240 3300020081 Bacteria 2060
168 Ga0206353_10186563 3300020082 Bacteria 1139
169 Ga0206353_10222344 3300020082 Bacteria 4182
170 Ga0206353_11116048 3300020082 Bacteria 8566
171 Ga0206353_11628847 3300020082 Bacteria 1009
172 Ga0154015_1218295 3300020610 Bacteria 1822
173 Ga0154015_1608521 3300020610 Bacteria 883
174 Ga0213875_10001257 3300021388 Bacteria 17050
175 Ga0213875_10001291 3300021388 Bacteria 16695
176 Ga0213875_10050952 3300021388 Bacteria 1939
177 Ga0224712_10000543 3300022467 Bacteria 7653
178 Ga0224712_10113455 3300022467 Bacteria 1165
179 Ga0224712_10141630 3300022467 Bacteria 1059
180 Ga0224712_10182575 3300022467 Bacteria 946
181 Ga0209758_1000870 3300025297 Bacteria 41550
182 Ga0207426_1005272 3300025302 Bacteria 5953
183 Ga0207426_1012521 3300025302 Bacteria 3181
184 Ga0207426_1061190 3300025302 Bacteria 1082
185 Ga0209051_1121767 3300025303 Bacteria 661
186 Ga0207655_1087485 3300025728 Bacteria 1105
187 Ga0207692_10007633 3300025898 Bacteria 4437
188 Ga0207710_10000017 3300025900 Bacteria 370962
189 Ga0207710_10000048 3300025900 Bacteria 189597
190 Ga0207688_10041350 3300025901 Bacteria 2564
191 Ga0207688_10972313 3300025901 Bacteria 537
192 Ga0207647_10006322 3300025904 Bacteria 8617
193 Ga0207699_10027891 3300025906 Bacteria 3132
194 Ga0207699_10275966 3300025906 Bacteria 1166
195 Ga0207705_10003438 3300025909 Bacteria 12045
196 Ga0207705_10989837 3300025909 Bacteria 650
197 Ga0207707_10241686 3300025912 Bacteria 1570
198 Ga0207695_10715601 3300025913 Bacteria 882
199 Ga0207693_10451024 3300025915 Bacteria 1005
200 Ga0207663_10047146 3300025916 Bacteria 2659
201 Ga0207662_10975540 3300025918 Bacteria 601
202 Ga0207649_10604024 3300025920 Bacteria 844
203 Ga0207652_10386953 3300025921 Bacteria 1262
204 Ga0207652_11042144 3300025921 Bacteria 717
205 Ga0207681_11787568 3300025923 Bacteria 513
206 Ga0207694_11063285 3300025924 Bacteria 685
207 Ga0207659_10145326 3300025926 Bacteria 1846
208 Ga0207659_11303460 3300025926 Bacteria 623
209 Ga0207687_10380765 3300025927 Bacteria 1156
210 Ga0207700_10075738 3300025928 Bacteria 2609
211 Ga0207664_10003521 3300025929 Bacteria 10458
212 Ga0207664_10187099 3300025929 Bacteria 1781
213 Ga0207664_10823035 3300025929 Bacteria 835
214 Ga0207690_11281629 3300025932 Bacteria 612
215 Ga0207706_10285731 3300025933 Bacteria 1438
216 Ga0207686_10589347 3300025934 Bacteria 874
217 Ga0207669_10278193 3300025937 Bacteria 1261
218 Ga0207691_10220168 3300025940 Bacteria 1646
219 Ga0207691_10223984 3300025940 Bacteria 1630
220 Ga0207711_10000134 3300025941 Bacteria 77843
221 Ga0207711_10002995 3300025941 Bacteria 14760
222 Ga0207689_10020564 3300025942 Bacteria 5554
223 Ga0207661_10721492 3300025944 Bacteria 917
224 Ga0207679_10912924 3300025945 Bacteria 803
225 Ga0207651_10189905 3300025960 Bacteria 1638
226 Ga0207712_10040803 3300025961 Bacteria 3187
227 Ga0207712_10119117 3300025961 Bacteria 1994
228 Ga0207712_11405517 3300025961 Bacteria 624
229 Ga0207668_10264527 3300025972 Bacteria 1403
230 Ga0207640_11328698 3300025981 Bacteria 642
231 Ga0207658_10002262 3300025986 Bacteria 14246
232 Ga0207658_12136008 3300025986 Bacteria 509
233 Ga0207677_11330309 3300026023 Bacteria 660
234 Ga0207677_11416085 3300026023 Bacteria 640
235 Ga0207703_10000002 3300026035 Bacteria 600711
236 Ga0207703_10003502 3300026035 Bacteria 13129
237 Ga0207639_11335699 3300026041 Bacteria 673
238 Ga0207702_10123630 3300026078 Bacteria 2319
239 Ga0207702_10204359 3300026078 Bacteria 1833
240 Ga0207702_10547570 3300026078 Bacteria 1132
241 Ga0207641_10002679 3300026088 Bacteria 16261
242 Ga0207674_10226074 3300026116 Bacteria 1820
243 Ga0207683_10691384 3300026121 Bacteria 945
244 Ga0209371_1016429 3300027312 Bacteria 1952
245 Ga0209813_10004425 3300027866 Bacteria 3355
246 Ga0268265_10000363 3300028380 Bacteria 49150
247 Ga0268265_10373786 3300028380 Bacteria 1309
248 Ga0265334_10003386 3300028573 Bacteria 7272
249 Ga0307517_10006905 3300028786 Bacteria 16700
250 Ga0307515_10107145 3300028794 Bacteria 3307
251 Ga0307515_10255141 3300028794 Bacteria 1499
252 Ga0311003_147053 3300029282 Bacteria 926
253 Ga0310981_1041238 3300029285 Bacteria 910
254 Ga0268256_1015007 3300030500 Bacteria 2277
255 Ga0307511_10017698 3300030521 Bacteria 6830
256 Ga0307511_10100912 3300030521 Bacteria 1896
257 Ga0307512_10083358 3300030522 Bacteria 2280
258 Ga0307512_10197589 3300030522 Bacteria 1095
259 Ga0316177_1047979 3300030731 Bacteria 3401
260 Ga0316176_1038867 3300030732 Bacteria 1785
261 Ga0314311_1019554 3300030733 Bacteria 3266
262 Ga0314311_1063336 3300030733 Bacteria 534
263 Ga0316179_1032206 3300030734 Bacteria 2864
264 Ga0316178_1099044 3300030735 Bacteria 1529
265 Ga0316180_1042781 3300030736 Bacteria 1586
266 Ga0316181_1204309 3300030744 Bacteria 1025
267 Ga0316181_1229376 3300030744 Bacteria 964
268 Ga0316182_1033344 3300030745 Bacteria 2098
269 Ga0265766_1000574 3300030863 Bacteria 1640
270 Ga0265768_108547 3300030963 Bacteria 637
271 Ga0265325_10040754 3300031241 Bacteria 2437
272 Ga0265340_10007092 3300031247 Bacteria 6109
273 Ga0265340_10074702 3300031247 Bacteria 1602
274 Ga0265339_10047818 3300031249 Bacteria 2348
275 Ga0265316_10124459 3300031344 Bacteria 1945
276 Ga0307513_10342355 3300031456 Bacteria 1245
277 Ga0307509_10009247 3300031507 Bacteria 12366
278 Ga0307509_10411162 3300031507 Bacteria 1056
279 Ga0307408_102136462 3300031548 Bacteria 540
280 Ga0310117_105392 3300031592 Bacteria 1385
281 Ga0310103_131967 3300031614 Bacteria 629
282 Ga0307508_10000924 3300031616 Bacteria 34111
283 Ga0307508_10031723 3300031616 Bacteria 4775
284 Ga0307508_10066550 3300031616 Bacteria 3172
285 Ga0307508_10115798 3300031616 Bacteria 2282
286 Ga0307514_10117565 3300031649 Bacteria 1864
287 Ga0307514_10121653 3300031649 Bacteria 1819
288 Ga0307514_10219817 3300031649 Bacteria 1166
289 Ga0310111_106844 3300031667 Bacteria 1477
290 Ga0316579_10000038 3300031691 Bacteria 30399
291 Ga0265342_10057885 3300031712 Bacteria 2292
292 Ga0316576_10109103 3300031727 Bacteria 2074
293 Ga0316576_10350768 3300031727 Bacteria 1098
294 Ga0307516_10034474 3300031730 Bacteria 5085
295 Ga0307516_10594784 3300031730 Bacteria 760
296 Ga0307405_10309324 3300031731 Bacteria 1202
297 Ga0307405_10476937 3300031731 Bacteria 995
298 Ga0307405_10517444 3300031731 Bacteria 959
299 Ga0316577_10165966 3300031733 Bacteria 1246
300 Ga0307413_10556118 3300031824 Bacteria 932
301 Ga0307413_11065620 3300031824 Bacteria 696
302 Ga0307413_11171584 3300031824 Bacteria 667
303 Ga0307518_10578106 3300031838 Bacteria 545
304 Ga0307410_10137079 3300031852 Bacteria 1805
305 Ga0307406_10004670 3300031901 Bacteria 7462
306 Ga0307406_10465426 3300031901 Bacteria 1017
307 Ga0307406_10754113 3300031901 Bacteria 817
308 Ga0307406_11264342 3300031901 Bacteria 643
309 Ga0307406_11729656 3300031901 Bacteria 555
310 Ga0307406_11867102 3300031901 Bacteria 535
311 Ga0307407_10029824 3300031903 Bacteria 2935
312 Ga0307407_10199153 3300031903 Bacteria 1341
313 Ga0307412_10692764 3300031911 Bacteria 874
314 Ga0307409_100330395 3300031995 Bacteria 1430
315 Ga0307409_100399841 3300031995 Bacteria 1312
316 Ga0307409_100416549 3300031995 Bacteria 1287
317 Ga0307409_100651764 3300031995 Bacteria 1047
318 Ga0307409_101081770 3300031995 Bacteria 822
319 Ga0307409_102410040 3300031995 Bacteria 555
320 Ga0307416_100124216 3300032002 Bacteria 2308
321 Ga0307416_100583936 3300032002 Bacteria 1195
322 Ga0307416_100721571 3300032002 Bacteria 1087
323 Ga0307414_10423502 3300032004 Bacteria 1161
324 Ga0307411_10148286 3300032005 Bacteria 1740
325 Ga0307411_10283867 3300032005 Bacteria 1319
326 Ga0307415_100029200 3300032126 Bacteria 3521
327 Ga0307415_100049757 3300032126 Bacteria 2836
328 Ga0307415_100591499 3300032126 Bacteria 986
329 Ga0307415_101146559 3300032126 Bacteria 730
330 Ga0307507_10003799 3300033179 Bacteria 28240
331 Ga0307507_10024930 3300033179 Bacteria 6500
332 Ga0307507_10025585 3300033179 Bacteria 6396
333 Ga0307510_10090689 3300033180 Bacteria 2901
334 Ga0307510_10206325 3300033180 Bacteria 1493
335 Ga0307510_10229710 3300033180 Bacteria 1359
336 Ga0373958_0132797 3300034819 Bacteria 611
337 Ga0316574_0197315 3300035398 Bacteria 1293
338 Ga0316574_0631025 3300035398 Bacteria 660
339 Ga0373947_0204412 3300035725 Bacteria 1293
340 Ga0316582_0184816 3300036647 Bacteria 1419
341 Ga0316584_0038993 3300036712 Bacteria 3536
342 Ga0373925_0106577 3300037068 Bacteria 2161
343 Ga0395899_0008026 3300037312 Bacteria 8128
344 Ga0395900_0199314 3300037418 Bacteria 2026
345 Ga0395898_0026184 3300037466 Bacteria 5870
346 Ga0395898_0030243 3300037466 Bacteria 5420
347 Ga0436364_0010700 3300037853 Bacteria 115369
348 Ga0436364_0424211 3300037853 Bacteria 2368
349 Ga0436364_1354648 3300037853 Bacteria 115417
350 Ga0395901_0031729 3300038443 Bacteria 5447
351 Ga0400485_08169 3300038735 Bacteria 55719
352 Ga0400486_03564 3300038742 Bacteria 38786
353 Ga0400483_019574 3300039062 Bacteria 7106
354 Ga0436365_0340703 3300039437 Bacteria 1430
355 Ga0436363_0020748 3300039450 Bacteria 1009
356 Ga0436362_0399705 3300039453 Bacteria 1097
357 Ga0439436_0003559 3300041404 Bacteria 4735
358 Ga0439436_0029047 3300041404 Bacteria 1611
359 Ga0439439_0004725 3300041406 Bacteria 3080
360 Ga0439453_0083764 3300041408 Bacteria 691
361 Ga0439461_0044338 3300041410 Bacteria 970
362 Ga0439465_0069611 3300041413 Bacteria 1178
363 Ga0451801_20119 3300041455 Bacteria 536
364 Ga0451798_0882651 3300041458 Bacteria 714
365 Ga0451802_0369205 3300041460 Bacteria 1034
366 Ga0451805_128977 3300041461 Bacteria 1445
367 Ga0451839_0534569 3300041496 Bacteria 1178
368 Ga0451847_0358713 3300041503 Bacteria 806
369 Ga0451843_1340122 3300041509 Bacteria 1786
370 Ga0451853_1319955 3300041512 Bacteria 1805
371 Ga0451853_1446781 3300041512 Bacteria 1028
372 Ga0439431_0105579 3300041997 Bacteria 777
373 Ga0439433_0002570 3300041999 Bacteria 3854
374 Ga0439433_0005893 3300041999 Bacteria 2631
375 Ga0439442_049219 3300042002 Bacteria 888
376 Ga0439449_0009099 3300042007 Bacteria 3766
377 Ga0439449_0011760 3300042007 Bacteria 3289
378 Ga0439450_071020 3300042008 Bacteria 854
379 Ga0439454_012822 3300042011 Bacteria 1142
380 Ga0439455_0001031 3300042012 Bacteria 4400
381 Ga0439457_002785 3300042014 Bacteria 4890
382 Ga0439457_068365 3300042014 Bacteria 808
383 Ga0439462_0000539 3300042015 Bacteria 7498
384 Ga0450890_006468 3300042127 Bacteria 1498
385 Ga0450894_015795 3300042131 Bacteria 1001
386 Ga0450899_001611 3300042135 Bacteria 2496
387 Ga0450900_015844 3300042136 Bacteria 1016
388 Ga0450903_000013 3300042138 Bacteria 34246
389 Ga0450903_047020 3300042138 Bacteria 634
390 Ga0439458_0000117 3300042157 Bacteria 16127
391 Ga0439458_0039956 3300042157 Bacteria 1136
392 Ga0439458_0083099 3300042157 Bacteria 818
393 Ga0439434_0091373 3300042435 Bacteria 974
394 Ga0439434_0154515 3300042435 Bacteria 761
395 Ga0466969_0035870 3300044656 Bacteria 2507
396 Ga0466969_0096611 3300044656 Bacteria 1394
397 Ga0466972_0004874 3300044658 Bacteria 6730
398 Ga0466972_0156714 3300044658 Bacteria 1070
399 Ga0466972_0272087 3300044658 Bacteria 791
400 Ga0466965_0011265 3300044683 Bacteria 4187
401 Ga0466966_0004478 3300044684 Bacteria 9214
402 Ga0466966_0025877 3300044684 Bacteria 3832
403 Ga0466966_0038688 3300044684 Bacteria 3073
404 Ga0466966_0548959 3300044684 Bacteria 695
405 Ga0466961_0004915 3300044693 Bacteria 8405
406 Ga0466961_0007268 3300044693 Bacteria 7046
407 Ga0466961_0051070 3300044693 Bacteria 2641
408 Ga0466961_0139137 3300044693 Bacteria 1520
409 Ga0466961_0424699 3300044693 Bacteria 805
410 Ga0466961_0970695 3300044693 Bacteria 505
411 Ga0466963_0097420 3300044694 Bacteria 2009
412 Ga0466963_0143823 3300044694 Bacteria 1653
413 Ga0466963_0359955 3300044694 Bacteria 1025
414 Ga0466963_0464430 3300044694 Bacteria 893
415 Ga0466963_1046536 3300044694 Bacteria 574
416 Ga0466964_0062147 3300044706 Bacteria 1556
417 Ga0466964_0390469 3300044706 Bacteria 725
418 Ga0453684_0949489 3300044712 Bacteria 918
419 Ga0466971_0000019 3300044719 Bacteria 79360
420 Ga0466971_0007920 3300044719 Bacteria 4628
421 Ga0466971_0113681 3300044719 Bacteria 1250
422 Ga0466971_0365821 3300044719 Bacteria 699
423 Ga0466968_0019909 3300044735 Bacteria 2705
424 Ga0466968_0030937 3300044735 Bacteria 2219
425 Ga0466968_0106395 3300044735 Bacteria 1257
426 Ga0466968_0359593 3300044735 Bacteria 708
427 Ga0466970_0003004 3300044765 Bacteria 8183
428 Ga0466970_0039008 3300044765 Bacteria 2520
429 Ga0466970_0067568 3300044765 Bacteria 1919
430 Ga0466970_0158678 3300044765 Bacteria 1250
431 Ga0466970_0751525 3300044765 Bacteria 570
432 Ga0466957_0015619 3300044842 Bacteria 4435
433 Ga0466957_0045585 3300044842 Bacteria 2659
434 Ga0466957_0203573 3300044842 Bacteria 1301
435 Ga0466957_0297570 3300044842 Bacteria 1083
436 Ga0466957_0859709 3300044842 Bacteria 647
437 Ga0466957_1269351 3300044842 Bacteria 534
438 Ga0466960_0005266 3300044901 Bacteria 5111
439 Ga0466960_0066960 3300044901 Bacteria 1777
440 Ga0466960_0103264 3300044901 Bacteria 1471
441 Ga0466960_0294693 3300044901 Bacteria 912
442 Ga0466960_0800708 3300044901 Bacteria 570
443 Ga0466960_0880139 3300044901 Bacteria 545
444 Ga0466959_0004638 3300045049 Bacteria 9244
445 Ga0466959_0032055 3300045049 Bacteria 3889
446 Ga0466959_0048320 3300045049 Bacteria 3126
447 Ga0466959_0064455 3300045049 Bacteria 2660
448 Ga0466959_0274074 3300045049 Bacteria 1159
449 Ga0466959_0293401 3300045049 Bacteria 1114
450 Ga0466959_0743902 3300045049 Bacteria 656
451 Ga0466959_0937830 3300045049 Bacteria 577
452 Ga0466958_0000701 3300045836 Bacteria 14601
453 Ga0466958_0054273 3300045836 Bacteria 2430
454 Ga0466958_0195593 3300045836 Bacteria 1286
455 Ga0466958_0261995 3300045836 Bacteria 1107
456 Ga0466958_0275195 3300045836 Bacteria 1078
457 Ga0466958_0849536 3300045836 Bacteria 595
458 Ga0466967_0075222 3300045976 Bacteria 3035
459 Ga0466967_0188862 3300045976 Bacteria 1946
460 Ga0466967_0215478 3300045976 Bacteria 1822
461 Ga0466967_0308089 3300045976 Bacteria 1525
462 Ga0466967_0321893 3300045976 Bacteria 1491
463 Ga0466967_0841565 3300045976 Bacteria 911
464 Ga0466967_0984587 3300045976 Bacteria 839
465 Ga0466967_1447019 3300045976 Bacteria 684
466 Ga0466967_1623790 3300045976 Bacteria 644
467 Ga0495592_0002384 3300046454 Bacteria 13242
468 Ga0495592_0011378 3300046454 Bacteria 6730
469 Ga0495592_0052602 3300046454 Bacteria 3023
470 Ga0495629_0037614 3300046459 Bacteria 3411
471 Ga0495629_0247996 3300046459 Bacteria 1225
472 Ga0495629_0498077 3300046459 Bacteria 822
473 Ga0495638_0024349 3300046460 Bacteria 3947
474 Ga0495638_0105562 3300046460 Bacteria 1679
475 Ga0495638_0119177 3300046460 Bacteria 1561
476 Ga0495641_0474423 3300046461 Bacteria 570
477 Ga0495651_0000169 3300046462 Bacteria 48128
478 Ga0495651_0002063 3300046462 Bacteria 15529
479 Ga0495651_0011730 3300046462 Bacteria 6733
480 Ga0495653_0023969 3300046463 Bacteria 4923
481 Ga0495653_0317694 3300046463 Bacteria 1010
482 Ga0495653_0828413 3300046463 Bacteria 555
483 Ga0495580_0005827 3300046472 Bacteria 10107
484 Ga0495582_0156632 3300046473 Bacteria 1294
485 Ga0495639_0235128 3300046475 Bacteria 903
486 Ga0495662_0002247 3300046476 Bacteria 9741
487 Ga0495662_0005288 3300046476 Bacteria 6466
488 Ga0495662_0018980 3300046476 Bacteria 3328
489 Ga0495662_0190885 3300046476 Bacteria 1010
490 Ga0495664_0002322 3300046477 Bacteria 10191
491 Ga0495664_0072068 3300046477 Bacteria 2063
492 Ga0495664_0245293 3300046477 Bacteria 1083
493 Ga0495584_0346047 3300046491 Bacteria 755
494 Ga0495594_0143365 3300046499 Bacteria 1355
495 Ga0495594_0211202 3300046499 Bacteria 1106
496 Ga0495608_0014048 3300046511 Bacteria 5557
497 Ga0495608_0465813 3300046511 Bacteria 768
498 Ga0495610_0340423 3300046512 Bacteria 567
499 Ga0495618_0347589 3300046514 Bacteria 914
500 Ga0495628_0007000 3300046516 Bacteria 9781
501 Ga0495628_0403214 3300046516 Bacteria 998
502 Ga0495630_0015711 3300046517 Bacteria 5530
503 Ga0495630_0087245 3300046517 Bacteria 2356
504 Ga0495631_0238779 3300046518 Bacteria 775
505 Ga0495643_0000013 3300046522 Bacteria 315700
506 Ga0495666_0000307 3300046526 Bacteria 21312
507 Ga0495652_0000728 3300046529 Bacteria 38187
508 Ga0495652_0030154 3300046529 Bacteria 4759
509 Ga0495652_0319361 3300046529 Bacteria 1122
510 Ga0495665_0013217 3300046531 Bacteria 4466
511 Ga0495640_0027443 3300046533 Bacteria 4106
512 Ga0495640_0124534 3300046533 Bacteria 1672
513 Ga0495640_0237058 3300046533 Bacteria 1146
514 Ga0495586_0065641 3300046535 Bacteria 1978
515 Ga0495586_0223039 3300046535 Bacteria 1071
516 Ga0495587_0000793 3300046536 Bacteria 21073
517 Ga0495587_0139260 3300046536 Bacteria 1385
518 Ga0495645_0002261 3300046543 Bacteria 13098
519 Ga0495645_0007022 3300046543 Bacteria 7830
520 Ga0495645_0052372 3300046543 Bacteria 2969
521 Ga0495645_0300633 3300046543 Bacteria 1048
522 Ga0495622_0017744 3300046557 Bacteria 3313
523 Ga0495633_0327938 3300046558 Bacteria 694
524 Ga0495667_0034555 3300046559 Bacteria 3380
525 Ga0495667_0337720 3300046559 Bacteria 953
526 Ga0495667_0481324 3300046559 Bacteria 778
527 Ga0495667_0837715 3300046559 Bacteria 566
528 Ga0495634_0005875 3300046642 Bacteria 9378
529 Ga0495634_0044010 3300046642 Bacteria 3023
530 Ga0495625_0095757 3300046660 Bacteria 2045
531 Ga0495625_0261981 3300046660 Bacteria 1118
532 Ga0495635_0015642 3300046663 Bacteria 5299
533 Ga0495635_0067659 3300046663 Bacteria 2449
534 Ga0495635_0613993 3300046663 Bacteria 709
535 Ga0495659_0095751 3300046664 Bacteria 1145
536 Ga0495588_0026982 3300046674 Bacteria 2868
537 Ga0495588_0160161 3300046674 Bacteria 1190
538 Ga0495657_0014293 3300046675 Bacteria 5830
539 Ga0495657_0024880 3300046675 Bacteria 4256
540 Ga0495657_0866061 3300046675 Bacteria 514
541 Ga0495599_0031629 3300046678 Bacteria 3321
542 Ga0495599_0076762 3300046678 Bacteria 2086
543 Ga0495599_0183912 3300046678 Bacteria 1287
544 Ga0495623_0012719 3300046679 Bacteria 5449
545 Ga0495623_0030831 3300046679 Bacteria 3449
546 Ga0495623_0054899 3300046679 Bacteria 2512
547 Ga0495623_0242477 3300046679 Bacteria 1017
548 Ga0495646_0009635 3300046680 Bacteria 6132
549 Ga0495646_0021225 3300046680 Bacteria 4105
550 Ga0495646_0061524 3300046680 Bacteria 2235
551 Ga0495658_0120358 3300046683 Bacteria 1587
552 Ga0495669_0047578 3300046684 Bacteria 1916
553 Ga0495613_0037419 3300046689 Bacteria 3597
554 Ga0495613_0263347 3300046689 Bacteria 1200
555 Ga0495613_0675840 3300046689 Bacteria 681
556 Ga0495624_0278293 3300046690 Bacteria 1010
557 Ga0495670_0561469 3300046691 Bacteria 621
558 Ga0495649_0097685 3300046694 Bacteria 1562
559 Ga0495600_0008026 3300046809 Bacteria 6470
560 Ga0495600_0055477 3300046809 Bacteria 2587
561 Ga0495600_0068521 3300046809 Bacteria 2318
562 Ga0495581_0105647 3300047315 Bacteria 1636
563 Ga0495581_0131774 3300047315 Bacteria 1456
564 Ga0495604_0000113 3300047317 Bacteria 68389
565 Ga0495604_0013519 3300047317 Bacteria 6506
566 Ga0495604_0015097 3300047317 Bacteria 6162
567 Ga0495636_0188804 3300047318 Bacteria 937
568 Ga0495674_0018748 3300047319 Bacteria 6440
569 Ga0495674_0262273 3300047319 Bacteria 1419
570 Ga0495674_0335241 3300047319 Bacteria 1230
571 Ga0495674_1096470 3300047319 Bacteria 606
572 Ga0495676_0059662 3300047321 Bacteria 2994
573 Ga0495680_0551908 3300047322 Bacteria 776
574 Ga0495687_015578 3300047443 Bacteria 3860
575 Ga0495675_0013484 3300047444 Bacteria 5159
576 Ga0495675_0017801 3300047444 Bacteria 4504
577 Ga0495675_0295316 3300047444 Bacteria 963
578 Ga0495675_0487073 3300047444 Bacteria 709
579 Ga0495685_063453 3300047447 Bacteria 1243
580 Ga0495685_183751 3300047447 Bacteria 673
581 Ga0495685_193437 3300047447 Bacteria 653
582 Ga0495681_0011573 3300047470 Bacteria 5243
583 Ga0495684_0004072 3300047471 Bacteria 11412
584 Ga0495684_0340967 3300047471 Bacteria 1066
585 Ga0495686_0066423 3300047472 Bacteria 2228
586 Ga0495593_0005852 3300047673 Bacteria 7246
587 Ga0495593_0054339 3300047673 Bacteria 2111
588 Ga0495602_0014250 3300048088 Bacteria 8077
589 Ga0495602_0083799 3300048088 Bacteria 2669
590 Ga0495614_0023593 3300048089 Bacteria 2655
591 Ga0496101_1096877 3300048904 Bacteria 625
592 Ga0496102_0000840 3300048905 Bacteria 29492
593 Ga0496102_0064536 3300048905 Bacteria 3354
594 Ga0496102_0384958 3300048905 Bacteria 1320
595 Ga0496102_1208301 3300048905 Bacteria 675
596 Ga0496103_0024379 3300048906 Bacteria 3652
597 Ga0496103_0042936 3300048906 Bacteria 2783
598 Ga0496103_0690213 3300048906 Bacteria 647
599 Ga0496104_0463699 3300048907 Bacteria 1178
600 Ga0496104_0761824 3300048907 Bacteria 875
601 Ga0496104_0877151 3300048907 Bacteria 802
602 Ga0496104_1149751 3300048907 Bacteria 680
603 Ga0496104_1528605 3300048907 Bacteria 570
604 Ga0496104_1723267 3300048907 Bacteria 529
605 Ga0496105_0096230 3300048908 Bacteria 2445
606 Ga0496105_0672910 3300048908 Bacteria 797
607 Ga0496105_0791532 3300048908 Bacteria 722
608 Ga0496105_0805483 3300048908 Bacteria 714
609 Ga0496106_1374099 3300048909 Bacteria 546
610 Ga0496107_0126090 3300048910 Bacteria 1888
611 Ga0496108_0048893 3300048911 Bacteria 3537
612 Ga0496108_0446455 3300048911 Bacteria 1130
613 Ga0496108_1042862 3300048911 Bacteria 697
614 Ga0496109_0954148 3300048912 Bacteria 795
615 Ga0496110_0216609 3300048913 Bacteria 1741
616 Ga0496111_0402489 3300048914 Bacteria 1011
617 Ga0496113_0639166 3300048916 Bacteria 851
618 Ga0496113_1329193 3300048916 Bacteria 558
619 Ga0496114_0183723 3300048917 Bacteria 1827
620 Ga0496114_0317906 3300048917 Bacteria 1375
621 Ga0496115_0703040 3300048918 Bacteria 794
622 Ga0496116_0001739 3300048919 Bacteria 23720
623 Ga0496117_0027016 3300048920 Bacteria 4479
624 Ga0496118_0000359 3300048921 Bacteria 77146
625 Ga0496118_0040681 3300048921 Bacteria 3693
626 Ga0496118_0046572 3300048921 Bacteria 3371
627 Ga0496118_0104172 3300048921 Bacteria 1905
628 Ga0496119_0000855 3300048922 Bacteria 40135
629 Ga0496119_0014521 3300048922 Bacteria 6154
630 Ga0496119_0020106 3300048922 Bacteria 4882
631 Ga0496120_0000372 3300048923 Bacteria 72951
632 Ga0496120_0219854 3300048923 Bacteria 908
633 Ga0496121_0013339 3300048924 Bacteria 8843
634 Ga0496121_0048393 3300048924 Bacteria 3617
635 Ga0496126_0231208 3300048929 Bacteria 1549
636 Ga0501306_001285 3300049127 Bacteria 2319
637 Ga0501306_002479 3300049127 Bacteria 1896
638 Ga0501306_037217 3300049127 Bacteria 744
639 Ga0501306_041690 3300049127 Bacteria 714
640 Ga0501308_014057 3300049128 Bacteria 932
641 Ga0501309_001533 3300049129 Bacteria 2299
642 Ga0501310_002257 3300049130 Bacteria 1820
643 Ga0501310_015292 3300049130 Bacteria 909
644 Ga0501310_023831 3300049130 Bacteria 780
645 Ga0501304_000819 3300049160 Bacteria 1796
646 Ga0501304_019525 3300049160 Bacteria 662
647 Ga0501305_009204 3300049161 Bacteria 1294
648 Ga0501305_015320 3300049161 Bacteria 1082
649 Ga0501305_025799 3300049161 Bacteria 893
650 Ga0501305_066565 3300049161 Bacteria 628
651 Ga0501307_005481 3300049162 Bacteria 1339
652 Ga0501307_008933 3300049162 Bacteria 1137
653 Ga0501307_009579 3300049162 Bacteria 1109
654 Ga0501311_000597 3300049527 Bacteria 2637
655 Ga0501311_029531 3300049527 Bacteria 787
656 Ga0501311_078820 3300049527 Bacteria 557
657 Ga0501312_001837 3300049528 Bacteria 2184
658 Ga0501313_000328 3300049529 Bacteria 3055
659 Ga0501314_005184 3300049530 Bacteria 1103
660 Ga0501314_005250 3300049530 Bacteria 1098
661 Ga0501315_000243 3300049531 Bacteria 3402
662 Ga0501315_014041 3300049531 Bacteria 1010
663 Ga0501315_021352 3300049531 Bacteria 876
664 Ga0501315_081123 3300049531 Bacteria 551
665 Ga0501316_002447 3300049532 Bacteria 1718
666 Ga0501316_026425 3300049532 Bacteria 760
667 Ga0501316_038014 3300049532 Bacteria 663
668 Ga0501316_075151 3300049532 Bacteria 516
669 Ga0501317_000282 3300049533 Bacteria 3286
670 Ga0501317_015074 3300049533 Bacteria 988
671 Ga0501317_017825 3300049533 Bacteria 934
672 Ga0501317_027117 3300049533 Bacteria 812
673 Ga0501318_000119 3300049534 Bacteria 3651
674 Ga0501318_029316 3300049534 Bacteria 741
675 Ga0501318_049585 3300049534 Bacteria 621
676 Ga0501319_001265 3300049535 Bacteria 1428
677 Ga0501320_000186 3300049536 Bacteria 3154
678 Ga0501320_000755 3300049536 Bacteria 2053
679 Ga0501320_004388 3300049536 Bacteria 1244
680 Ga0501321_002301 3300049537 Bacteria 1642
681 Ga0501321_005600 3300049537 Bacteria 1248
682 Ga0501321_028860 3300049537 Bacteria 732
683 Ga0501322_001303 3300049538 Bacteria 1379
684 Ga0501322_002966 3300049538 Bacteria 1073
685 Ga0501322_006978 3300049538 Bacteria 814
686 Ga0501323_001192 3300049539 Bacteria 2228
687 Ga0501323_010056 3300049539 Bacteria 1123
688 Ga0501323_017099 3300049539 Bacteria 929
689 Ga0501323_026907 3300049539 Bacteria 790
690 Ga0501324_000083 3300049540 Bacteria 3478
691 Ga0501324_001843 3300049540 Bacteria 1472
692 Ga0501324_003168 3300049540 Bacteria 1245
693 Ga0501324_011359 3300049540 Bacteria 822
694 Ga0501324_017437 3300049540 Bacteria 712
695 Ga0501325_009559 3300049541 Bacteria 863
696 Ga0501031_0010894 3300049568 Bacteria 5922
697 Ga0501031_0213047 3300049568 Bacteria 1258
698 Ga0501031_0223452 3300049568 Bacteria 1226
699 Ga0501032_0001347 3300049569 Bacteria 19514
700 Ga0501032_0002622 3300049569 Bacteria 14061
701 Ga0501032_0021244 3300049569 Bacteria 4514
702 Ga0501032_0072160 3300049569 Bacteria 2301
703 Ga0501032_0194673 3300049569 Bacteria 1324
704 Ga0501033_0053340 3300049570 Bacteria 2994
705 Ga0501033_0055262 3300049570 Bacteria 2935
706 Ga0501033_0067467 3300049570 Bacteria 2630
707 Ga0501033_0157907 3300049570 Bacteria 1633
708 Ga0501033_0215801 3300049570 Bacteria 1367
709 Ga0501033_0498729 3300049570 Bacteria 842
710 Ga0501034_0011858 3300049571 Bacteria 9022
711 Ga0501034_0017758 3300049571 Bacteria 7296
712 Ga0501034_0039901 3300049571 Bacteria 4755
713 Ga0501034_0147492 3300049571 Bacteria 2329
714 Ga0501034_0154851 3300049571 Bacteria 2266
715 Ga0501034_0461188 3300049571 Bacteria 1187
716 Ga0501034_0507480 3300049571 Bacteria 1119
717 Ga0501036_0005851 3300049572 Bacteria 9958
718 Ga0501036_0012989 3300049572 Bacteria 6914
719 Ga0501036_0034382 3300049572 Bacteria 4286
720 Ga0501036_0193864 3300049572 Bacteria 1709
721 Ga0501036_0728855 3300049572 Bacteria 818
722 Ga0501037_0003123 3300049573 Bacteria 12009
723 Ga0501037_0018283 3300049573 Bacteria 5164
724 Ga0501037_0064068 3300049573 Bacteria 2679
725 Ga0501038_0008698 3300049574 Bacteria 9320
726 Ga0501038_0031768 3300049574 Bacteria 4664
727 Ga0501038_0163095 3300049574 Bacteria 1809
728 Ga0501039_0015102 3300049575 Bacteria 5908
729 Ga0501039_0023714 3300049575 Bacteria 4709
730 Ga0501039_0210458 3300049575 Bacteria 1529
731 Ga0501039_0584517 3300049575 Bacteria 876
732 Ga0501039_0768942 3300049575 Bacteria 752
733 Ga0501040_0008475 3300049576 Bacteria 6677
734 Ga0501040_0860682 3300049576 Bacteria 656
735 Ga0501041_0009850 3300049577 Bacteria 5627
736 Ga0501041_0518724 3300049577 Bacteria 759
737 Ga0501041_0642533 3300049577 Bacteria 678
738 Ga0501042_0021020 3300049578 Bacteria 4544
739 Ga0501042_0037805 3300049578 Bacteria 3426
740 Ga0501042_0320729 3300049578 Bacteria 1119
741 Ga0501042_1248859 3300049578 Bacteria 542
742 Ga0501043_0005651 3300049579 Bacteria 10076
743 Ga0501043_0176539 3300049579 Bacteria 1665
744 Ga0501043_0178224 3300049579 Bacteria 1656
745 Ga0501043_0408922 3300049579 Bacteria 1024
746 Ga0501043_1100598 3300049579 Bacteria 561
747 Ga0501046_0002011 3300049580 Bacteria 19297
748 Ga0501046_0124048 3300049580 Bacteria 1963
749 Ga0501047_0000005 3300049581 Bacteria 456524
750 Ga0501047_0000278 3300049581 Bacteria 59271
751 Ga0501047_0004445 3300049581 Bacteria 13204
752 Ga0501047_0067707 3300049581 Bacteria 3440
753 Ga0501047_0087734 3300049581 Bacteria 2989
754 Ga0501047_0281796 3300049581 Bacteria 1506
755 Ga0501047_0284524 3300049581 Bacteria 1497
756 Ga0501048_0001026 3300049582 Bacteria 20878
757 Ga0501048_0120527 3300049582 Bacteria 1853
758 Ga0501048_0669896 3300049582 Bacteria 745
759 Ga0501048_0681329 3300049582 Bacteria 738
760 Ga0501067_0000592 3300049583 Bacteria 19503
761 Ga0501067_0431140 3300049583 Bacteria 736
762 Ga0501068_0001668 3300049584 Bacteria 11862
763 Ga0501068_0124538 3300049584 Bacteria 1609
764 Ga0501068_0697278 3300049584 Bacteria 664
765 Ga0501069_0003831 3300049585 Bacteria 7749
766 Ga0501070_0000089 3300049586 Bacteria 77368
767 Ga0501070_0021842 3300049586 Bacteria 5362
768 Ga0501070_0025003 3300049586 Bacteria 5008
769 Ga0501070_0162235 3300049586 Bacteria 1842
770 Ga0501070_0425216 3300049586 Bacteria 1072
771 Ga0501070_0806179 3300049586 Bacteria 737
772 Ga0501071_0008674 3300049587 Bacteria 6724
773 Ga0501071_0011550 3300049587 Bacteria 5959
774 Ga0501071_0718294 3300049587 Bacteria 769
775 Ga0501072_0001152 3300049588 Bacteria 19660
776 Ga0501072_0589979 3300049588 Bacteria 876
777 Ga0501072_0609189 3300049588 Bacteria 861
778 Ga0501073_0078941 3300049589 Bacteria 2290
779 Ga0501074_0005219 3300049590 Bacteria 9340
780 Ga0501074_0011734 3300049590 Bacteria 6369
781 Ga0501074_0026050 3300049590 Bacteria 4241
782 Ga0501074_0507749 3300049590 Bacteria 854
783 Ga0501075_1549946 3300049591 Bacteria 501
784 Ga0501076_0051723 3300049592 Bacteria 3252
785 Ga0501077_0087819 3300049593 Bacteria 1970
786 Ga0501202_019719 3300049652 Bacteria 1335
787 Ga0501217_044712 3300049661 Bacteria 1138
788 Ga0501250_032907 3300049680 Bacteria 728
789 Ga0501257_106123 3300049686 Bacteria 741
790 Ga0501221_181713 3300049704 Bacteria 575
791 Ga0501079_0023462 3300049741 Bacteria 4733
792 Ga0501079_0285006 3300049741 Bacteria 1292
793 Ga0501080_0002681 3300049742 Bacteria 15586
794 Ga0501080_0004649 3300049742 Bacteria 12241
795 Ga0501080_0007063 3300049742 Bacteria 10140
796 Ga0501080_0094218 3300049742 Bacteria 2781
797 Ga0501080_0364990 3300049742 Bacteria 1302
798 Ga0501081_0361548 3300049743 Bacteria 1071
799 Ga0501083_0004200 3300049744 Bacteria 10143
800 Ga0501035_0006472 3300049822 Bacteria 11004
801 Ga0501035_0042008 3300049822 Bacteria 4125
802 Ga0501035_0045844 3300049822 Bacteria 3932
803 Ga0501035_0062362 3300049822 Bacteria 3317
804 Ga0501035_0145280 3300049822 Bacteria 2060
805 Ga0501035_0500276 3300049822 Bacteria 1000
806 Ga0501044_0000425 3300049823 Bacteria 52201
807 Ga0501044_0005788 3300049823 Bacteria 13687
808 Ga0501044_0013601 3300049823 Bacteria 8795
809 Ga0501044_0064165 3300049823 Bacteria 3750
810 Ga0501044_1198351 3300049823 Bacteria 627
811 Ga0501044_1642641 3300049823 Bacteria 507
812 Ga0501045_0079425 3300049824 Bacteria 2418
813 Ga0501045_0282589 3300049824 Bacteria 1235
814 nmdc:mga03n38_275355_c1 3300050490 Bacteria 897
815 nmdc:mga00v17_382505_c1 3300050491 Bacteria 915
816 nmdc:mga00v17_937_c1 3300050491 Bacteria 15681
817 nmdc:mga0k408_221211_c1 3300050493 Bacteria 1130
818 nmdc:mga06z11_27935_c1 3300050494 Bacteria 2702
819 nmdc:mga04h51_1822_c1 3300050495 Bacteria 4980
820 nmdc:mga04h51_230696_c1 3300050495 Bacteria 736
821 nmdc:mga07m45_19238_c1 3300050496 Bacteria 1941
822 nmdc:mga07m45_20663_c1 3300050496 Bacteria 3577
823 nmdc:mga09592_535318_c1 3300050508 Bacteria 1007
824 nmdc:mga09592_70174_c1 3300050508 Bacteria 2973
825 nmdc:mga0qj67_248168_c1 3300050509 Bacteria 1444
826 nmdc:mga06r32_228853_c1 3300050510 Bacteria 1847
827 nmdc:mga06r32_328695_c1 3300050510 Bacteria 1514
828 nmdc:mga0sz30_5215_c1 3300050516 Bacteria 3169
829 Ga0495601_0019194 3300053077 Bacteria 4167
830 Ga0495601_0097418 3300053077 Bacteria 1898
831 Ga0495612_0003894 3300053078 Bacteria 6188
832 Ga0495612_0033956 3300053078 Bacteria 2065
833 Ga0495612_0114248 3300053078 Bacteria 1158
834 Ga0500610_0035276 3300053079 Bacteria 2564
835 Ga0495655_0063403 3300053083 Bacteria 1014
836 Ga0495655_0095229 3300053083 Bacteria 873
837 Ga0495655_0097352 3300053083 Bacteria 866
838 Ga0495655_0303268 3300053083 Bacteria 549
839 Ga0495655_0375449 3300053083 Bacteria 501
840 Ga0495619_0016029 3300053085 Bacteria 4744
841 Ga0495619_0044831 3300053085 Bacteria 2904
842 Ga0495619_0239380 3300053085 Bacteria 1258
843 Ga0495619_0382459 3300053085 Bacteria 973
844 Ga0500644_0019335 3300053088 Bacteria 2009
845 Ga0500644_0338151 3300053088 Bacteria 650
846 Ga0500647_0039633 3300053091 Bacteria 2259
847 Ga0500583_0062555 3300053092 Bacteria 1761
848 Ga0500583_0131398 3300053092 Bacteria 1242
849 Ga0500566_0227339 3300053094 Bacteria 923
850 Ga0500640_018648 3300053095 Bacteria 2962
851 Ga0500660_108747 3300053100 Bacteria 1188
852 Ga0500553_035854 3300053101 Bacteria 2456
853 Ga0500562_034742 3300053108 Bacteria 1334
854 Ga0500572_004783 3300053111 Bacteria 3069
855 Ga0500608_059636 3300053122 Bacteria 1825
856 Ga0500614_080617 3300053123 Bacteria 910
857 Ga0500618_101516 3300053125 Bacteria 648
858 Ga0500628_055816 3300053129 Bacteria 951
859 Ga0500642_0078535 3300053130 Bacteria 1512
860 Ga0500642_0267373 3300053130 Bacteria 781
861 Ga0500652_244217 3300053131 Bacteria 713
862 Ga0500655_082250 3300053133 Bacteria 663
863 Ga0500573_0482656 3300053140 Bacteria 564
864 Ga0500577_0093719 3300053142 Bacteria 1218
865 Ga0500586_066611 3300053145 Bacteria 1258
866 Ga0500616_0063036 3300053153 Bacteria 1913
867 Ga0500624_001345 3300053157 Bacteria 4158
868 Ga0500634_0081366 3300053161 Bacteria 1668
869 Ga0500636_0224281 3300053177 Bacteria 977
870 Ga0501084_0001550 3300054114 Bacteria 18271
871 Ga0501084_0426431 3300054114 Bacteria 1121
872 Ga0501084_0443129 3300054114 Bacteria 1098
873 Ga0587084_020516 3300059477 Bacteria 983
874 Ga0587084_040445 3300059477 Bacteria 790
875 Ga0587084_047703 3300059477 Bacteria 749
876 Ga0587073_0019682 3300059492 Bacteria 1278
877 Ga0587073_0117642 3300059492 Bacteria 713
878 Ga0587077_081037 3300059493 Bacteria 745
879 Ga0587080_017869 3300059503 Bacteria 1134
880 Ga0587082_022970 3300059504 Bacteria 1031
881 Ga0587082_053755 3300059504 Bacteria 776
882 Ga0587082_164409 3300059504 Bacteria 534
883 Ga0587083_0090540 3300059505 Bacteria 745
884 Ga0587085_050956 3300059506 Bacteria 754
885 Ga0587085_083532 3300059506 Bacteria 647
886 Ga0587086_009836 3300059507 Bacteria 1145
887 Ga0587088_047833 3300059508 Bacteria 828
888 Ga0587088_069038 3300059508 Bacteria 733
889 Ga0587090_042555 3300059510 Bacteria 805
890 Ga0587092_042458 3300059512 Bacteria 796
891 Ga0587092_051993 3300059512 Bacteria 745
892 Ga0587095_006161 3300059514 Bacteria 926
893 Ga0587095_017025 3300059514 Bacteria 671
894 Ga0587098_006769 3300059604 Bacteria 1173
895 Ga0587106_015835 3300059605 Bacteria 1059
896 Ga0587129_015014 3300059608 Bacteria 642
897 Ga0587101_056672 3300059623 Bacteria 689
898 Ga0587101_149617 3300059623 Bacteria 505
899 Ga0587109_094454 3300059624 Bacteria 679
900 Ga0587115_013310 3300059626 Bacteria 1063
901 Ga0587117_079424 3300059627 Bacteria 595
902 Ga0587122_001696 3300059628 Bacteria 1484
903 Ga0587062_013640 3300059639 Bacteria 1061
904 Ga0587067_017595 3300059640 Bacteria 1189
905 Ga0587067_036608 3300059640 Bacteria 934
906 Ga0587068_007908 3300059641 Bacteria 1528
907 Ga0587072_137080 3300059643 Bacteria 581
908 Ga0587075_014952 3300059644 Bacteria 1087
909 Ga0587076_008284 3300059645 Bacteria 1447
910 Ga0587100_005415 3300059648 Bacteria 949
911 Ga0587100_008942 3300059648 Bacteria 819
912 Ga0587100_035933 3300059648 Bacteria 543
913 Ga0587102_010002 3300059649 Bacteria 930
914 Ga0587107_003716 3300059652 Bacteria 1501
915 Ga0587108_006945 3300059653 Bacteria 887
916 Ga0587114_009440 3300059655 Bacteria 1169
917 Ga0587114_060338 3300059655 Bacteria 664
918 Ga0587119_017129 3300059658 Bacteria 893
919 Ga0587071_008622 3300060344 Bacteria 1657
920 Ga0587071_023819 3300060344 Bacteria 1139
921 Ga0587111_0020096 3300060346 Bacteria 1274
922 Ga0587111_0061905 3300060346 Bacteria 853
923 Ga0587111_0076183 3300060346 Bacteria 793
924 Ga0587111_0273527 3300060346 Bacteria 508
925 Ga0501082_0044117 3300060353 Bacteria 3846
926 Ga0501082_0109969 3300060353 Bacteria 2386
927 Ga0501082_0392570 3300060353 Bacteria 1211
928 Ga0466962_0000779 3300061719 Bacteria 14329
929 Ga0466962_0004946 3300061719 Bacteria 6409
930 Ga0466962_0008164 3300061719 Bacteria 5019
931 Ga0530510_0060320 3300061734 Bacteria 2745
932 Ga0530510_0925468 3300061734 Bacteria 666
933 2506868501 2506783011 Bacteria 5323186
934 2508670615 2508501039 Bacteria 9978592
935 2515851639 2515154155 Bacteria 7985436
936 2517762559 2517572101 Bacteria 6884336
937 2528204305 2527291627 Bacteria 5309833
938 2528212125 2527291629 Bacteria 5267418
939 2546946876 2546825537 Bacteria 5389291
940 2559428752 2558860280 Bacteria 11429938
941 2579747614 2576861822 Bacteria 5004595
942 2579853579 2579778521 Bacteria 7624758
943 2619853740 2619618881 Bacteria 7521104
944 2620349866 2619619003 Bacteria 7619552
945 2626634914 2626541554 Bacteria 7741902
946 2643941973 2643221587 Bacteria 7586415
947 2644389596 2643221670 Bacteria 6497041
948 2644429056 2643221677 Bacteria 7584031
949 2671835719 2671180195 Bacteria 9757215
950 2676199457 2675902999 Bacteria 9438463
951 2686539256 2684623035 Bacteria 8032739
952 2686543608 2684623036 Bacteria 5199090
953 2689960393 2687453737 Bacteria 11203906
954 2689992372 2687453743 Bacteria 8361025
955 2710602537 2710264753 Bacteria 5455564
956 2723643130 2721755702 Bacteria 4373124
957 2729906656 2728369276 Bacteria 5610032
958 2731908949 2731639228 Bacteria 4187555
959 2753069957 2751185734 Bacteria 8863695
960 2774844035 2773857921 Bacteria 9435764
961 2774853875 2773857922 Bacteria 9757215
962 2774866998 2773857924 Bacteria 5256821
963 2774902882 2773857933 Bacteria 5818019
964 2785370798 2784746768 Bacteria 10036182
965 2786671982 2786546132 Bacteria 10419719
966 2799184978 2799112218 Bacteria 4315149
967 2808912948 2808606375 Bacteria 9466072
968 2861525554 2861520306 Bacteria 8348283
969 2862578153 2862574272 Bacteria 10567477
970 2870727546 2870721527 Bacteria 9689237
971 2877679780 2877676314 Bacteria 9512378
972 2895884587 2895880812 Bacteria 11255272
973 2918505854 2918501144 Bacteria 8668083
974 2919445575 2919443155 Bacteria 4072969
975 2935412140 2935409751 Bacteria 4179611
976 2954003149 2954002825 Bacteria 9173742
977 2954384710 2954380949 Bacteria 10050426
978 2954678254 2954673503 Bacteria 9685905
979 2954685903 2954682443 Bacteria 9862841
980 2956940996 2956939328 Bacteria 3474458
981 3001120689 3001119090 Bacteria 3449530
982 3006326196 3006321560 Bacteria 8247479
983 637877940 637000116 Bacteria 5433628
984 8002782915 8002775197 Bacteria 10728764
985 8047717755 8047710418 Bacteria 11023148
986 8054918450 8054913762 Bacteria 7713009
987 8054926309 8054920844 Bacteria 7068637
988 8055160622 8055157932 Bacteria 6429399
989 8057570075 8057568493 Bacteria 7221719
990 Ga0466969_0024483
991 JGI24739J22299_10012589
992 JGI24737J22298_10004109
993 JGI24735J21928_10037966
994 JGI24738J21930_10009088
995 JGI25406J46586_10054419
996 Ga0006777J48905_1016128
997 rootH1_10087441
998 rootH1_10044574
999 JGI25160J50197_1013781
1000 JGI25160J50197_1026569
1001 Ga0007410J51695_1079086
1002 Ga0007409J51694_1027373
1003 Ga0007409J51694_1095426
1004 Ga0007429J51699_1077728
1005 Ga0007429J51699_1098508
1006 Ga0058858_1005032
1007 Ga0058859_11826058
1008 Ga0058863_10085417
1009 Ga0058863_10169109
1010 Ga0058863_11770428
1011 Ga0058861_10106487
1012 Ga0058861_10162069
1013 Ga0058861_10186282
1014 Ga0058861_11881892
1015 Ga0058860_10025829
1016 Ga0058860_10028160
1017 Ga0058860_10106898
1018 Ga0058860_10115660
1019 Ga0058860_10229221
1020 Ga0058862_10127495
1021 Ga0058862_10191375
1022 Ga0058862_12724420
1023 Ga0070658_10786068
1024 Ga0070670_100338738
1025 Ga0070670_101097127
1026 Ga0068869_100018620
1027 Ga0068869_100883330
1028 Ga0068869_100940981
1029 Ga0068868_100702561
1030 Ga0070687_101127276
1031 Ga0070668_100196908
1032 Ga0070675_100194727
1033 Ga0070674_100077936
1034 Ga0070667_102079642
1035 Ga0070709_10111103
1036 Ga0070709_11011019
1037 Ga0070714_100182078
1038 Ga0070714_101424383
1039 Ga0070713_100075640
1040 Ga0070710_10000334
1041 Ga0070701_10390157
1042 Ga0070711_100127812
1043 Ga0070678_100314920
1044 Ga0070678_101138709
1045 Ga0070681_10448711
1046 Ga0068853_101415438
1047 Ga0070672_100332582
1048 Ga0070693_101327412
1049 Ga0068856_100081044
1050 Ga0068856_102522922
1051 Ga0068859_100034160
1052 Ga0068859_100092242
1053 Ga0068864_101053908
1054 Ga0068863_100001338
1055 Ga0068858_100000010
1056 Ga0068858_100010928
1057 Ga0068862_100000362
1058 Ga0081455_10006542
1059 Ga0081540_1245936
1060 Ga0081539_10002050
1061 Ga0081539_10021084
1062 Ga0070717_10294088
1063 Ga0075365_10244325
1064 Ga0075368_10003605
1065 Ga0075363_100018785
1066 Ga0075364_10008222
1067 Ga0070712_100506623
1068 Ga0075367_10075343
1069 Ga0075367_10172232
1070 Ga0075369_10014830
1071 Ga0075366_10481228
1072 Ga0075370_10088385
1073 Ga0075370_10119183
1074 Ga0075430_100325169
1075 Ga0075431_100246785
1076 Ga0075431_100657837
1077 Ga0075429_100140830
1078 Ga0097620_100034160
1079 Ga0097620_100092239
1080 Ga0099826_10027493
1081 Ga0099794_10369792
1082 Ga0105244_10100475
1083 Ga0105240_10204243
1084 Ga0111539_11717097
1085 Ga0105245_10575897
1086 Ga0105247_10000016
1087 Ga0105247_10212251
1088 Ga0105243_10162470
1089 Ga0105243_10994620
1090 Ga0105241_10796030
1091 Ga0105248_10000035
1092 Ga0105248_10002899
1093 Ga0105248_12584018
1094 Ga0105248_13437596
1095 Ga0105249_10068762
1096 Ga0105249_10687247
1097 Ga0105239_11608217
1098 Ga0105239_12859172
1099 Ga0105239_13205203
1100 Ga0105246_10002569
1101 Ga0105246_10434317
1102 Ga0157322_1013348
1103 Ga0154012_109278
1104 Ga0154010_148221
1105 Ga0157370_12126253
1106 Ga0157374_10520828
1107 Ga0157378_10490338
1108 Ga0157378_11560850
1109 Ga0157375_11093622
1110 Ga0163163_10010268
1111 Ga0163163_12067520
1112 Ga0157380_10213417
1113 Ga0182008_10009535
1114 Ga0182008_10354699
1115 Ga0157377_10543637
1116 Ga0157379_10009461
1117 Ga0157379_10101600
1118 Ga0157379_10388618
1119 Ga0157379_10784670
1120 Ga0157376_10865869
1121 Ga0182006_1012482
1122 Ga0182007_10010395
1123 Ga0183367_1002
1124 Ga0197907_10071147
1125 Ga0197907_10456483
1126 Ga0197907_10872862
1127 Ga0197907_10874185
1128 Ga0197907_11028216
1129 Ga0206356_10671161
1130 Ga0206356_10797342
1131 Ga0206356_10880070
1132 Ga0206356_10946215
1133 Ga0206348_113828
1134 Ga0206349_1484921
1135 Ga0206349_1782543
1136 Ga0206349_1815480
1137 Ga0206355_1131249
1138 Ga0206355_1350876
1139 Ga0206351_10013403
1140 Ga0206351_10035715
1141 Ga0206351_10267213
1142 Ga0206351_10945162
1143 Ga0206352_10000892
1144 Ga0206352_10048704
1145 Ga0206352_10486095
1146 Ga0206352_10571914
1147 Ga0206352_10718751
1148 Ga0206350_10201708
1149 Ga0206350_10308689
1150 Ga0206350_10386703
1151 Ga0206350_10762397
1152 Ga0206350_11076420
1153 Ga0206354_10049783
1154 Ga0206354_10458357
1155 Ga0206354_10517799
1156 Ga0206354_11155240
1157 Ga0206353_10186563
1158 Ga0206353_10222344
1159 Ga0206353_11116048
1160 Ga0206353_11628847
1161 Ga0154015_1218295
1162 Ga0154015_1608521
1163 Ga0213875_10001257
1164 Ga0213875_10001291
1165 Ga0213875_10050952
1166 Ga0224712_10000543
1167 Ga0224712_10113455
1168 Ga0224712_10141630
1169 Ga0224712_10182575
1170 Ga0209758_1000870
1171 Ga0207426_1005272
1172 Ga0207426_1012521
1173 Ga0207426_1061190
1174 Ga0209051_1121767
1175 Ga0207655_1087485
1176 Ga0207692_10007633
1177 Ga0207710_10000017
1178 Ga0207710_10000048
1179 Ga0207688_10041350
1180 Ga0207688_10972313
1181 Ga0207647_10006322
1182 Ga0207699_10027891
1183 Ga0207699_10275966
1184 Ga0207705_10003438
1185 Ga0207705_10989837
1186 Ga0207707_10241686
1187 Ga0207695_10715601
1188 Ga0207693_10451024
1189 Ga0207663_10047146
1190 Ga0207662_10975540
1191 Ga0207649_10604024
1192 Ga0207652_10386953
1193 Ga0207652_11042144
1194 Ga0207681_11787568
1195 Ga0207694_11063285
1196 Ga0207659_10145326
1197 Ga0207659_11303460
1198 Ga0207687_10380765
1199 Ga0207700_10075738
1200 Ga0207664_10003521
1201 Ga0207664_10187099
1202 Ga0207664_10823035
1203 Ga0207690_11281629
1204 Ga0207706_10285731
1205 Ga0207686_10589347
1206 Ga0207669_10278193
1207 Ga0207691_10220168
1208 Ga0207691_10223984
1209 Ga0207711_10000134
1210 Ga0207711_10002995
1211 Ga0207689_10020564
1212 Ga0207661_10721492
1213 Ga0207679_10912924
1214 Ga0207651_10189905
1215 Ga0207712_10040803
1216 Ga0207712_10119117
1217 Ga0207712_11405517
1218 Ga0207668_10264527
1219 Ga0207640_11328698
1220 Ga0207658_10002262
1221 Ga0207658_12136008
1222 Ga0207677_11330309
1223 Ga0207677_11416085
1224 Ga0207703_10000002
1225 Ga0207703_10003502
1226 Ga0207639_11335699
1227 Ga0207702_10123630
1228 Ga0207702_10204359
1229 Ga0207702_10547570
1230 Ga0207641_10002679
1231 Ga0207674_10226074
1232 Ga0207683_10691384
1233 Ga0209371_1016429
1234 Ga0209813_10004425
1235 Ga0268265_10000363
1236 Ga0268265_10373786
1237 Ga0265334_10003386
1238 Ga0307517_10006905
1239 Ga0307515_10107145
1240 Ga0307515_10255141
1241 Ga0311003_147053
1242 Ga0310981_1041238
1243 Ga0268256_1015007
1244 Ga0307511_10017698
1245 Ga0307511_10100912
1246 Ga0307512_10083358
1247 Ga0307512_10197589
1248 Ga0316177_1047979
1249 Ga0316176_1038867
1250 Ga0314311_1019554
1251 Ga0314311_1063336
1252 Ga0316179_1032206
1253 Ga0316178_1099044
1254 Ga0316180_1042781
1255 Ga0316181_1204309
1256 Ga0316181_1229376
1257 Ga0316182_1033344
1258 Ga0265766_1000574
1259 Ga0265768_108547
1260 Ga0265325_10040754
1261 Ga0265340_10007092
1262 Ga0265340_10074702
1263 Ga0265339_10047818
1264 Ga0265316_10124459
1265 Ga0307513_10342355
1266 Ga0307509_10009247
1267 Ga0307509_10411162
1268 Ga0307408_102136462
1269 Ga0310117_105392
1270 Ga0310103_131967
1271 Ga0307508_10000924
1272 Ga0307508_10031723
1273 Ga0307508_10066550
1274 Ga0307508_10115798
1275 Ga0307514_10117565
1276 Ga0307514_10121653
1277 Ga0307514_10219817
1278 Ga0310111_106844
1279 Ga0316579_10000038
1280 Ga0265342_10057885
1281 Ga0316576_10109103
1282 Ga0316576_10350768
1283 Ga0307516_10034474
1284 Ga0307516_10594784
1285 Ga0307405_10309324
1286 Ga0307405_10476937
1287 Ga0307405_10517444
1288 Ga0316577_10165966
1289 Ga0307413_10556118
1290 Ga0307413_11065620
1291 Ga0307413_11171584
1292 Ga0307518_10578106
1293 Ga0307410_10137079
1294 Ga0307406_10004670
1295 Ga0307406_10465426
1296 Ga0307406_10754113
1297 Ga0307406_11264342
1298 Ga0307406_11729656
1299 Ga0307406_11867102
1300 Ga0307407_10029824
1301 Ga0307407_10199153
1302 Ga0307412_10692764
1303 Ga0307409_100330395
1304 Ga0307409_100399841
1305 Ga0307409_100416549
1306 Ga0307409_100651764
1307 Ga0307409_101081770
1308 Ga0307409_102410040
1309 Ga0307416_100124216
1310 Ga0307416_100583936
1311 Ga0307416_100721571
1312 Ga0307414_10423502
1313 Ga0307411_10148286
1314 Ga0307411_10283867
1315 Ga0307415_100029200
1316 Ga0307415_100049757
1317 Ga0307415_100591499
1318 Ga0307415_101146559
1319 Ga0307507_10003799
1320 Ga0307507_10024930
1321 Ga0307507_10025585
1322 Ga0307510_10090689
1323 Ga0307510_10206325
1324 Ga0307510_10229710
1325 Ga0373958_0132797
1326 Ga0316574_0197315
1327 Ga0316574_0631025
1328 Ga0373947_0204412
1329 Ga0316582_0184816
1330 Ga0316584_0038993
1331 Ga0373925_0106577
1332 Ga0395899_0008026
1333 Ga0395900_0199314
1334 Ga0395898_0026184
1335 Ga0395898_0030243
1336 Ga0436364_0010700
1337 Ga0436364_0424211
1338 Ga0436364_1354648
1339 Ga0395901_0031729
1340 Ga0400485_08169
1341 Ga0400486_03564
1342 Ga0400483_019574
1343 Ga0436365_0340703
1344 Ga0436363_0020748
1345 Ga0436362_0399705
1346 Ga0439436_0003559
1347 Ga0439436_0029047
1348 Ga0439439_0004725
1349 Ga0439453_0083764
1350 Ga0439461_0044338
1351 Ga0439465_0069611
1352 Ga0451801_20119
1353 Ga0451798_0882651
1354 Ga0451802_0369205
1355 Ga0451805_128977
1356 Ga0451839_0534569
1357 Ga0451847_0358713
1358 Ga0451843_1340122
1359 Ga0451853_1319955
1360 Ga0451853_1446781
1361 Ga0439431_0105579
1362 Ga0439433_0002570
1363 Ga0439433_0005893
1364 Ga0439442_049219
1365 Ga0439449_0009099
1366 Ga0439449_0011760
1367 Ga0439450_071020
1368 Ga0439454_012822
1369 Ga0439455_0001031
1370 Ga0439457_002785
1371 Ga0439457_068365
1372 Ga0439462_0000539
1373 Ga0450890_006468
1374 Ga0450894_015795
1375 Ga0450899_001611
1376 Ga0450900_015844
1377 Ga0450903_000013
1378 Ga0450903_047020
1379 Ga0439458_0000117
1380 Ga0439458_0039956
1381 Ga0439458_0083099
1382 Ga0439434_0091373
1383 Ga0439434_0154515
1384 Ga0466969_0035870
1385 Ga0466969_0096611
1386 Ga0466972_0004874
1387 Ga0466972_0156714
1388 Ga0466972_0272087
1389 Ga0466965_0011265
1390 Ga0466966_0004478
1391 Ga0466966_0025877
1392 Ga0466966_0038688
1393 Ga0466966_0548959
1394 Ga0466961_0004915
1395 Ga0466961_0007268
1396 Ga0466961_0051070
1397 Ga0466961_0139137
1398 Ga0466961_0424699
1399 Ga0466961_0970695
1400 Ga0466963_0097420
1401 Ga0466963_0143823
1402 Ga0466963_0359955
1403 Ga0466963_0464430
1404 Ga0466963_1046536
1405 Ga0466964_0062147
1406 Ga0466964_0390469
1407 Ga0453684_0949489
1408 Ga0466971_0000019
1409 Ga0466971_0007920
1410 Ga0466971_0113681
1411 Ga0466971_0365821
1412 Ga0466968_0019909
1413 Ga0466968_0030937
1414 Ga0466968_0106395
1415 Ga0466968_0359593
1416 Ga0466970_0003004
1417 Ga0466970_0039008
1418 Ga0466970_0067568
1419 Ga0466970_0158678
1420 Ga0466970_0751525
1421 Ga0466957_0015619
1422 Ga0466957_0045585
1423 Ga0466957_0203573
1424 Ga0466957_0297570
1425 Ga0466957_0859709
1426 Ga0466957_1269351
1427 Ga0466960_0005266
1428 Ga0466960_0066960
1429 Ga0466960_0103264
1430 Ga0466960_0294693
1431 Ga0466960_0800708
1432 Ga0466960_0880139
1433 Ga0466959_0004638
1434 Ga0466959_0032055
1435 Ga0466959_0048320
1436 Ga0466959_0064455
1437 Ga0466959_0274074
1438 Ga0466959_0293401
1439 Ga0466959_0743902
1440 Ga0466959_0937830
1441 Ga0466958_0000701
1442 Ga0466958_0054273
1443 Ga0466958_0195593
1444 Ga0466958_0261995
1445 Ga0466958_0275195
1446 Ga0466958_0849536
1447 Ga0466967_0075222
1448 Ga0466967_0188862
1449 Ga0466967_0215478
1450 Ga0466967_0308089
1451 Ga0466967_0321893
1452 Ga0466967_0841565
1453 Ga0466967_0984587
1454 Ga0466967_1447019
1455 Ga0466967_1623790
1456 Ga0495592_0002384
1457 Ga0495592_0011378
1458 Ga0495592_0052602
1459 Ga0495629_0037614
1460 Ga0495629_0247996
1461 Ga0495629_0498077
1462 Ga0495638_0024349
1463 Ga0495638_0105562
1464 Ga0495638_0119177
1465 Ga0495641_0474423
1466 Ga0495651_0000169
1467 Ga0495651_0002063
1468 Ga0495651_0011730
1469 Ga0495653_0023969
1470 Ga0495653_0317694
1471 Ga0495653_0828413
1472 Ga0495580_0005827
1473 Ga0495582_0156632
1474 Ga0495639_0235128
1475 Ga0495662_0002247
1476 Ga0495662_0005288
1477 Ga0495662_0018980
1478 Ga0495662_0190885
1479 Ga0495664_0002322
1480 Ga0495664_0072068
1481 Ga0495664_0245293
1482 Ga0495584_0346047
1483 Ga0495594_0143365
1484 Ga0495594_0211202
1485 Ga0495608_0014048
1486 Ga0495608_0465813
1487 Ga0495610_0340423
1488 Ga0495618_0347589
1489 Ga0495628_0007000
1490 Ga0495628_0403214
1491 Ga0495630_0015711
1492 Ga0495630_0087245
1493 Ga0495631_0238779
1494 Ga0495643_0000013
1495 Ga0495666_0000307
1496 Ga0495652_0000728
1497 Ga0495652_0030154
1498 Ga0495652_0319361
1499 Ga0495665_0013217
1500 Ga0495640_0027443
1501 Ga0495640_0124534
1502 Ga0495640_0237058
1503 Ga0495586_0065641
1504 Ga0495586_0223039
1505 Ga0495587_0000793
1506 Ga0495587_0139260
1507 Ga0495645_0002261
1508 Ga0495645_0007022
1509 Ga0495645_0052372
1510 Ga0495645_0300633
1511 Ga0495622_0017744
1512 Ga0495633_0327938
1513 Ga0495667_0034555
1514 Ga0495667_0337720
1515 Ga0495667_0481324
1516 Ga0495667_0837715
1517 Ga0495634_0005875
1518 Ga0495634_0044010
1519 Ga0495625_0095757
1520 Ga0495625_0261981
1521 Ga0495635_0015642
1522 Ga0495635_0067659
1523 Ga0495635_0613993
1524 Ga0495659_0095751
1525 Ga0495588_0026982
1526 Ga0495588_0160161
1527 Ga0495657_0014293
1528 Ga0495657_0024880
1529 Ga0495657_0866061
1530 Ga0495599_0031629
1531 Ga0495599_0076762
1532 Ga0495599_0183912
1533 Ga0495623_0012719
1534 Ga0495623_0030831
1535 Ga0495623_0054899
1536 Ga0495623_0242477
1537 Ga0495646_0009635
1538 Ga0495646_0021225
1539 Ga0495646_0061524
1540 Ga0495658_0120358
1541 Ga0495669_0047578
1542 Ga0495613_0037419
1543 Ga0495613_0263347
1544 Ga0495613_0675840
1545 Ga0495624_0278293
1546 Ga0495670_0561469
1547 Ga0495649_0097685
1548 Ga0495600_0008026
1549 Ga0495600_0055477
1550 Ga0495600_0068521
1551 Ga0495581_0105647
1552 Ga0495581_0131774
1553 Ga0495604_0000113
1554 Ga0495604_0013519
1555 Ga0495604_0015097
1556 Ga0495636_0188804
1557 Ga0495674_0018748
1558 Ga0495674_0262273
1559 Ga0495674_0335241
1560 Ga0495674_1096470
1561 Ga0495676_0059662
1562 Ga0495680_0551908
1563 Ga0495687_015578
1564 Ga0495675_0013484
1565 Ga0495675_0017801
1566 Ga0495675_0295316
1567 Ga0495675_0487073
1568 Ga0495685_063453
1569 Ga0495685_183751
1570 Ga0495685_193437
1571 Ga0495681_0011573
1572 Ga0495684_0004072
1573 Ga0495684_0340967
1574 Ga0495686_0066423
1575 Ga0495593_0005852
1576 Ga0495593_0054339
1577 Ga0495602_0014250
1578 Ga0495602_0083799
1579 Ga0495614_0023593
1580 Ga0496101_1096877
1581 Ga0496102_0000840
1582 Ga0496102_0064536
1583 Ga0496102_0384958
1584 Ga0496102_1208301
1585 Ga0496103_0024379
1586 Ga0496103_0042936
1587 Ga0496103_0690213
1588 Ga0496104_0463699
1589 Ga0496104_0761824
1590 Ga0496104_0877151
1591 Ga0496104_1149751
1592 Ga0496104_1528605
1593 Ga0496104_1723267
1594 Ga0496105_0096230
1595 Ga0496105_0672910
1596 Ga0496105_0791532
1597 Ga0496105_0805483
1598 Ga0496106_1374099
1599 Ga0496107_0126090
1600 Ga0496108_0048893
1601 Ga0496108_0446455
1602 Ga0496108_1042862
1603 Ga0496109_0954148
1604 Ga0496110_0216609
1605 Ga0496111_0402489
1606 Ga0496113_0639166
1607 Ga0496113_1329193
1608 Ga0496114_0183723
1609 Ga0496114_0317906
1610 Ga0496115_0703040
1611 Ga0496116_0001739
1612 Ga0496117_0027016
1613 Ga0496118_0000359
1614 Ga0496118_0040681
1615 Ga0496118_0046572
1616 Ga0496118_0104172
1617 Ga0496119_0000855
1618 Ga0496119_0014521
1619 Ga0496119_0020106
1620 Ga0496120_0000372
1621 Ga0496120_0219854
1622 Ga0496121_0013339
1623 Ga0496121_0048393
1624 Ga0496126_0231208
1625 Ga0501306_001285
1626 Ga0501306_002479
1627 Ga0501306_037217
1628 Ga0501306_041690
1629 Ga0501308_014057
1630 Ga0501309_001533
1631 Ga0501310_002257
1632 Ga0501310_015292
1633 Ga0501310_023831
1634 Ga0501304_000819
1635 Ga0501304_019525
1636 Ga0501305_009204
1637 Ga0501305_015320
1638 Ga0501305_025799
1639 Ga0501305_066565
1640 Ga0501307_005481
1641 Ga0501307_008933
1642 Ga0501307_009579
1643 Ga0501311_000597
1644 Ga0501311_029531
1645 Ga0501311_078820
1646 Ga0501312_001837
1647 Ga0501313_000328
1648 Ga0501314_005184
1649 Ga0501314_005250
1650 Ga0501315_000243
1651 Ga0501315_014041
1652 Ga0501315_021352
1653 Ga0501315_081123
1654 Ga0501316_002447
1655 Ga0501316_026425
1656 Ga0501316_038014
1657 Ga0501316_075151
1658 Ga0501317_000282
1659 Ga0501317_015074
1660 Ga0501317_017825
1661 Ga0501317_027117
1662 Ga0501318_000119
1663 Ga0501318_029316
1664 Ga0501318_049585
1665 Ga0501319_001265
1666 Ga0501320_000186
1667 Ga0501320_000755
1668 Ga0501320_004388
1669 Ga0501321_002301
1670 Ga0501321_005600
1671 Ga0501321_028860
1672 Ga0501322_001303
1673 Ga0501322_002966
1674 Ga0501322_006978
1675 Ga0501323_001192
1676 Ga0501323_010056
1677 Ga0501323_017099
1678 Ga0501323_026907
1679 Ga0501324_000083
1680 Ga0501324_001843
1681 Ga0501324_003168
1682 Ga0501324_011359
1683 Ga0501324_017437
1684 Ga0501325_009559
1685 Ga0501031_0010894
1686 Ga0501031_0213047
1687 Ga0501031_0223452
1688 Ga0501032_0001347
1689 Ga0501032_0002622
1690 Ga0501032_0021244
1691 Ga0501032_0072160
1692 Ga0501032_0194673
1693 Ga0501033_0053340
1694 Ga0501033_0055262
1695 Ga0501033_0067467
1696 Ga0501033_0157907
1697 Ga0501033_0215801
1698 Ga0501033_0498729
1699 Ga0501034_0011858
1700 Ga0501034_0017758
1701 Ga0501034_0039901
1702 Ga0501034_0147492
1703 Ga0501034_0154851
1704 Ga0501034_0461188
1705 Ga0501034_0507480
1706 Ga0501036_0005851
1707 Ga0501036_0012989
1708 Ga0501036_0034382
1709 Ga0501036_0193864
1710 Ga0501036_0728855
1711 Ga0501037_0003123
1712 Ga0501037_0018283
1713 Ga0501037_0064068
1714 Ga0501038_0008698
1715 Ga0501038_0031768
1716 Ga0501038_0163095
1717 Ga0501039_0015102
1718 Ga0501039_0023714
1719 Ga0501039_0210458
1720 Ga0501039_0584517
1721 Ga0501039_0768942
1722 Ga0501040_0008475
1723 Ga0501040_0860682
1724 Ga0501041_0009850
1725 Ga0501041_0518724
1726 Ga0501041_0642533
1727 Ga0501042_0021020
1728 Ga0501042_0037805
1729 Ga0501042_0320729
1730 Ga0501042_1248859
1731 Ga0501043_0005651
1732 Ga0501043_0176539
1733 Ga0501043_0178224
1734 Ga0501043_0408922
1735 Ga0501043_1100598
1736 Ga0501046_0002011
1737 Ga0501046_0124048
1738 Ga0501047_0000005
1739 Ga0501047_0000278
1740 Ga0501047_0004445
1741 Ga0501047_0067707
1742 Ga0501047_0087734
1743 Ga0501047_0281796
1744 Ga0501047_0284524
1745 Ga0501048_0001026
1746 Ga0501048_0120527
1747 Ga0501048_0669896
1748 Ga0501048_0681329
1749 Ga0501067_0000592
1750 Ga0501067_0431140
1751 Ga0501068_0001668
1752 Ga0501068_0124538
1753 Ga0501068_0697278
1754 Ga0501069_0003831
1755 Ga0501070_0000089
1756 Ga0501070_0021842
1757 Ga0501070_0025003
1758 Ga0501070_0162235
1759 Ga0501070_0425216
1760 Ga0501070_0806179
1761 Ga0501071_0008674
1762 Ga0501071_0011550
1763 Ga0501071_0718294
1764 Ga0501072_0001152
1765 Ga0501072_0589979
1766 Ga0501072_0609189
1767 Ga0501073_0078941
1768 Ga0501074_0005219
1769 Ga0501074_0011734
1770 Ga0501074_0026050
1771 Ga0501074_0507749
1772 Ga0501075_1549946
1773 Ga0501076_0051723
1774 Ga0501077_0087819
1775 Ga0501202_019719
1776 Ga0501217_044712
1777 Ga0501250_032907
1778 Ga0501257_106123
1779 Ga0501221_181713
1780 Ga0501079_0023462
1781 Ga0501079_0285006
1782 Ga0501080_0002681
1783 Ga0501080_0004649
1784 Ga0501080_0007063
1785 Ga0501080_0094218
1786 Ga0501080_0364990
1787 Ga0501081_0361548
1788 Ga0501083_0004200
1789 Ga0501035_0006472
1790 Ga0501035_0042008
1791 Ga0501035_0045844
1792 Ga0501035_0062362
1793 Ga0501035_0145280
1794 Ga0501035_0500276
1795 Ga0501044_0000425
1796 Ga0501044_0005788
1797 Ga0501044_0013601
1798 Ga0501044_0064165
1799 Ga0501044_1198351
1800 Ga0501044_1642641
1801 Ga0501045_0079425
1802 Ga0501045_0282589
1803 nmdc:mga03n38_275355_c1
1804 nmdc:mga00v17_382505_c1
1805 nmdc:mga00v17_937_c1
1806 nmdc:mga0k408_221211_c1
1807 nmdc:mga06z11_27935_c1
1808 nmdc:mga04h51_1822_c1
1809 nmdc:mga04h51_230696_c1
1810 nmdc:mga07m45_19238_c1
1811 nmdc:mga07m45_20663_c1
1812 nmdc:mga09592_535318_c1
1813 nmdc:mga09592_70174_c1
1814 nmdc:mga0qj67_248168_c1
1815 nmdc:mga06r32_228853_c1
1816 nmdc:mga06r32_328695_c1
1817 nmdc:mga0sz30_5215_c1
1818 Ga0495601_0019194
1819 Ga0495601_0097418
1820 Ga0495612_0003894
1821 Ga0495612_0033956
1822 Ga0495612_0114248
1823 Ga0500610_0035276
1824 Ga0495655_0063403
1825 Ga0495655_0095229
1826 Ga0495655_0097352
1827 Ga0495655_0303268
1828 Ga0495655_0375449
1829 Ga0495619_0016029
1830 Ga0495619_0044831
1831 Ga0495619_0239380
1832 Ga0495619_0382459
1833 Ga0500644_0019335
1834 Ga0500644_0338151
1835 Ga0500647_0039633
1836 Ga0500583_0062555
1837 Ga0500583_0131398
1838 Ga0500566_0227339
1839 Ga0500640_018648
1840 Ga0500660_108747
1841 Ga0500553_035854
1842 Ga0500562_034742
1843 Ga0500572_004783
1844 Ga0500608_059636
1845 Ga0500614_080617
1846 Ga0500618_101516
1847 Ga0500628_055816
1848 Ga0500642_0078535
1849 Ga0500642_0267373
1850 Ga0500652_244217
1851 Ga0500655_082250
1852 Ga0500573_0482656
1853 Ga0500577_0093719
1854 Ga0500586_066611
1855 Ga0500616_0063036
1856 Ga0500624_001345
1857 Ga0500634_0081366
1858 Ga0500636_0224281
1859 Ga0501084_0001550
1860 Ga0501084_0426431
1861 Ga0501084_0443129
1862 Ga0587084_020516
1863 Ga0587084_040445
1864 Ga0587084_047703
1865 Ga0587073_0019682
1866 Ga0587073_0117642
1867 Ga0587077_081037
1868 Ga0587080_017869
1869 Ga0587082_022970
1870 Ga0587082_053755
1871 Ga0587082_164409
1872 Ga0587083_0090540
1873 Ga0587085_050956
1874 Ga0587085_083532
1875 Ga0587086_009836
1876 Ga0587088_047833
1877 Ga0587088_069038
1878 Ga0587090_042555
1879 Ga0587092_042458
1880 Ga0587092_051993
1881 Ga0587095_006161
1882 Ga0587095_017025
1883 Ga0587098_006769
1884 Ga0587106_015835
1885 Ga0587129_015014
1886 Ga0587101_056672
1887 Ga0587101_149617
1888 Ga0587109_094454
1889 Ga0587115_013310
1890 Ga0587117_079424
1891 Ga0587122_001696
1892 Ga0587062_013640
1893 Ga0587067_017595
1894 Ga0587067_036608
1895 Ga0587068_007908
1896 Ga0587072_137080
1897 Ga0587075_014952
1898 Ga0587076_008284
1899 Ga0587100_005415
1900 Ga0587100_008942
1901 Ga0587100_035933
1902 Ga0587102_010002
1903 Ga0587107_003716
1904 Ga0587108_006945
1905 Ga0587114_009440
1906 Ga0587114_060338
1907 Ga0587119_017129
1908 Ga0587071_008622
1909 Ga0587071_023819
1910 Ga0587111_0020096
1911 Ga0587111_0061905
1912 Ga0587111_0076183
1913 Ga0587111_0273527
1914 Ga0501082_0044117
1915 Ga0501082_0109969
1916 Ga0501082_0392570
1917 Ga0466962_0000779
1918 Ga0466962_0004946
1919 Ga0466962_0008164
1920 Ga0530510_0060320
1921 Ga0530510_0925468
1922 2506868501
1923 2508670615
1924 2515851639
1925 2517762559
1926 2528204305
1927 2528212125
1928 2546946876
1929 2559428752
1930 2579747614
1931 2579853579
1932 2619853740
1933 2620349866
1934 2626634914
1935 2643941973
1936 2644389596
1937 2644429056
1938 2671835719
1939 2676199457
1940 2686539256
1941 2686543608
1942 2689960393
1943 2689992372
1944 2710602537
1945 2723643130
1946 2729906656
1947 2731908949
1948 2753069957
1949 2774844035
1950 2774853875
1951 2774866998
1952 2774902882
1953 2785370798
1954 2786671982
1955 2799184978
1956 2808912948
1957 2861525554
1958 2862578153
1959 2870727546
1960 2877679780
1961 2895884587
1962 2918505854
1963 2919445575
1964 2935412140
1965 2954003149
1966 2954384710
1967 2954678254
1968 2954685903
1969 2956940996
1970 3001120689
1971 3006326196
1972 637877940
1973 8002782915
1974 8047717755
1975 8054918450
1976 8054926309
1977 8055160622
1978 8057570075

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

18

124

0.99

Map