F487597

General Info

Members Datasets Scaffolds Average Seq Length
989 725 1978 232

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991461|2819684062
Length 255
Sequence RCSGSMLPTAKIRKAEVRKKTPMTETDERRKTEQLPLQFTHDAARGRDDLLVSERLAAAVSIVDEWPAWPSPVVILAGPVGSGKSHLAHIWQERAAARDIHPLAGSEAAVIAASGPVLFEDADRRGFDETELFHVINSVRENGHSLLMTSRLWPASWSVTLPDLKSRLKAATVVEIGEPDEELLAQVIVKLFSDRQLYIDDKLVAYIVARMERSLGAAQAIVDRLDRLALSRGTKINRVLAAEVLSDFGNAGTGD

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
46 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
55 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
58 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
59 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
60 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
107 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
112 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
118 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
119 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
199 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
209 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
213 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
214 2509276019 Ensifer aridi TW10 Isolate Nodule
215 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
216 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
217 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
218 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
219 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
220 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
221 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
222 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
223 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
224 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
225 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
226 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
227 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
228 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
229 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
230 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
231 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
232 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
233 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
234 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
235 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
236 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
237 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
238 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
239 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
240 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
241 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
242 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
243 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
244 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
245 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
246 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
247 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
248 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
249 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
250 2516143018 Ensifer sp. BR816 Isolate Nodule
251 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
252 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
253 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
254 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
255 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
256 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
257 2519899620 Rhizobium sp. Pop5 Isolate Nodule
258 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
259 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
260 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
261 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
262 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
263 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
264 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
265 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
266 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
267 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
268 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
269 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
270 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
271 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
272 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
273 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
274 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
275 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
276 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
277 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
278 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
279 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
280 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
281 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
282 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
283 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
284 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
285 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
286 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
287 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
288 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
289 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
290 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
291 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
292 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
293 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
294 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
295 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
296 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
297 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
298 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
299 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
300 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
301 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
302 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
303 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
304 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
305 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
306 2643221557 Ensifer sp. Root558 Isolate Unclassified
307 2643221558 Rhizobium sp. Root149 Isolate Unclassified
308 2643221568 Rhizobium sp. Root564 Isolate Unclassified
309 2643221599 Rhizobium sp. Root708 Isolate Unclassified
310 2643221607 Rhizobium sp. Root73 Isolate Unclassified
311 2643221610 Ensifer sp. Root74 Isolate Unclassified
312 2643221618 Ensifer sp. Root231 Isolate Unclassified
313 2643221626 Ensifer sp. Root31 Isolate Unclassified
314 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
315 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
316 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
317 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
318 2643221655 Ensifer sp. Root1252 Isolate Unclassified
319 2643221659 Ensifer sp. Root127 Isolate Unclassified
320 2643221668 Ensifer sp. Root423 Isolate Unclassified
321 2643221675 Ensifer sp. Root1298 Isolate Unclassified
322 2643221680 Ensifer sp. Root1312 Isolate Unclassified
323 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
324 2643221688 Rhizobium sp. Root482 Isolate Unclassified
325 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
326 2643221698 Ensifer sp. Root142 Isolate Unclassified
327 2643221712 Ensifer sp. Root258 Isolate Unclassified
328 2643221718 Rhizobium sp. Root268 Isolate Unclassified
329 2643221723 Ensifer sp. Root278 Isolate Unclassified
330 2643221726 Ensifer sp. Root954 Isolate Unclassified
331 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
332 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
333 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
334 2718217882 Rhizobium sp. N741 Isolate Nodule
335 2718217927 Rhizobium sp. N324 Isolate Nodule
336 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
337 2718218009 Rhizobium sp. N561 Isolate Nodule
338 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
339 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
340 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
341 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
342 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
343 2718218363 Rhizobium sp. N113 Isolate Nodule
344 2718218365 Rhizobium sp. N731 Isolate Nodule
345 2718218366 Rhizobium sp. N621 Isolate Nodule
346 2718218423 Rhizobium sp. N941 Isolate Nodule
347 2721755514 Rhizobium sp. N6212 Isolate Nodule
348 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
349 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
350 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
351 2721755809 Rhizobium sp. N541 Isolate Nodule
352 2721755810 Rhizobium sp. N871 Isolate Nodule
353 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
354 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
355 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
356 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
357 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
358 2728369365 Rhizobium sp. N1341 Isolate Nodule
359 2728369397 Rhizobium sp. N1314 Isolate Nodule
360 2738541293 Rhizobium sp. GV031 Isolate Unclassified
361 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
362 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
363 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
364 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
365 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
366 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
367 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
368 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
369 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
370 2791355256 Rhizobium sp. M10 Isolate Nodule
371 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
372 2791355260 Rhizobium sp. L9 Isolate Nodule
373 2791355261 Rhizobium sp. J15 Isolate Nodule
374 2791355262 Rhizobium sp. M1 Isolate Nodule
375 2791355263 Rhizobium chutanense C5 Isolate Nodule
376 2791355264 Rhizobium sp. S9 Isolate Nodule
377 2791355265 Rhizobium sp. H4 Isolate Nodule
378 2791355266 Rhizobium sp. L43 Isolate Nodule
379 2791355267 Rhizobium sp. L18 Isolate Nodule
380 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
381 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
382 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
383 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
384 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
385 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
386 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
387 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
388 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
389 2802429633 Rhizobium anhuiense J3 Isolate Nodule
390 2802429634 Rhizobium anhuiense S10 Isolate Nodule
391 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
392 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
393 2802429637 Rhizobium anhuiense C15 Isolate Nodule
394 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
395 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
396 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
397 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
398 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
399 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
400 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
401 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
402 2838048938 Rhizobium pisi 27/80 Isolate Nodule
403 2838061910 Rhizobium phaseoli L15 Isolate Nodule
404 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
405 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
406 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
407 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
408 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
409 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
410 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
411 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
412 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
413 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
414 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
415 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
416 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
417 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
418 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
419 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
420 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
421 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
422 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
423 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
424 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
425 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
426 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
427 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
428 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
429 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
430 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
431 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
432 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
433 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
434 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
435 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
436 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
437 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
438 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
439 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
440 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
441 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
442 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
443 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
444 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
445 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
446 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
447 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
448 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
449 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
450 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
451 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
452 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
453 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
454 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
455 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
456 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
457 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
458 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
459 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
460 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
461 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
462 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
463 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
464 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
465 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
466 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
467 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
468 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
469 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
470 2844163670 Ensifer sp. 1H6 Isolate Unclassified
471 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
472 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
473 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
474 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
475 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
476 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
477 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
478 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
479 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
480 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
481 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
482 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
483 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
484 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
485 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
486 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
487 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
488 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
489 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
490 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
491 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
492 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
493 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
494 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
495 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
496 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
497 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
498 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
499 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
500 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
501 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
502 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
503 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
504 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
505 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
506 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
507 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
508 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
509 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
510 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
511 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
512 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
513 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
514 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
515 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
516 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
517 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
518 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
519 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
520 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
521 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
522 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
523 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
524 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
525 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
526 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
527 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
528 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
529 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
530 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
531 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
532 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
533 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
534 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
535 2933599457 Rhizobium phaseoli M3 Isolate Nodule
536 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
537 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
538 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
539 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
540 2936381700 Rhizobium chutanense C16 Isolate Unclassified
541 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
542 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
543 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
544 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
545 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
546 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
547 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
548 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
549 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
550 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
551 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
552 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
553 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
554 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
555 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
556 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
557 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
558 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
559 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
560 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
561 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
562 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
563 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
564 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
565 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
566 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
567 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
568 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
569 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
570 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
571 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
572 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
573 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
574 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
575 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
576 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
577 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
578 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
579 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
580 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
581 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
582 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
583 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
584 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
585 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
586 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
587 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
588 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
589 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
590 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
591 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
592 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
593 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
594 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
595 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
596 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
597 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
598 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
599 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
600 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
601 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
602 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
603 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
604 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
605 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
606 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
607 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
608 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
609 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
610 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
611 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
612 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
613 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
614 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
615 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
616 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
617 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
618 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
619 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
620 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
621 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
622 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
623 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
624 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
625 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
626 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
627 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
628 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
629 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
630 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
631 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
632 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
633 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
634 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
635 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
636 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
637 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
638 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
639 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
640 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
641 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
642 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
643 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
644 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
645 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
646 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
647 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
648 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
649 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
650 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
651 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
652 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
653 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
654 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
655 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
656 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
657 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
658 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
659 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
660 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
661 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
662 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
663 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
664 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
665 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
666 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
667 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
668 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
669 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
670 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
671 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
672 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
673 2996887358 Rhizobium sp. R711 Isolate Nodule
674 2996893221 Rhizobium sp. R635 Isolate Nodule
675 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
676 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
677 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
678 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
679 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
680 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
681 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
682 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
683 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
684 8005258706 Rhizobium sp. R693 Isolate Nodule
685 8005275841 Rhizobium sp. N4311 Isolate Nodule
686 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
687 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
688 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
689 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
690 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
691 8005321885 Rhizobium sp. R72 Isolate Nodule
692 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
693 8005382845 Rhizobium sp. R634 Isolate Nodule
694 8005395548 Rhizobium sp. R339 Isolate Nodule
695 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
696 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
697 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
698 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
699 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
700 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
701 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
702 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
703 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
704 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
705 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
706 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
707 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
708 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
709 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
710 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
711 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
712 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
713 8018176218 Rhizobium sp. N122 Isolate Nodule
714 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
715 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
716 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
717 8024501048 Rhizobium sp. H4 Isolate Nodule
718 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
719 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
720 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
721 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
722 8056382006 Rhizobium croatiense 13T Isolate Nodule
723 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
724 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
725 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.03
Metatranscriptomes 0
Isolates 51.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 19.82
Nodule 42.26
Rhizoplane 2.22
Rhizosphere 18.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C8180 2010549000 Bacteria 1863
2 JGI25155J39150_1000032 3300002704 Bacteria 105511
3 JGI25156J39149_1000129 3300002705 Bacteria 54812
4 JGI25162J39368_1000663 3300002737 Bacteria 24312
5 JGI25154J39366_1000393 3300002738 Bacteria 23858
6 JGI25158J39367_1004696 3300002739 Bacteria 2040
7 JGI25157J39369_1000061 3300002741 Bacteria 105511
8 JGI25152J39213_1000780 3300002773 Bacteria 16053
9 JGI25152J39213_1001828 3300002773 Bacteria 8589
10 JGI25152J39213_1005400 3300002773 Bacteria 3737
11 JGI25152J39213_1006674 3300002773 Bacteria 3088
12 JGI25150J39212_1000033 3300002774 Bacteria 96269
13 JGI25150J39212_1005579 3300002774 Bacteria 2673
14 JGI25150J39212_1007494 3300002774 Bacteria 2187
15 JGI25159J45721_1000002 3300002987 Bacteria 289163
16 JGI25159J45721_1000539 3300002987 Bacteria 17199
17 JGI25151J46595_10000108 3300003187 Bacteria 112874
18 JGI25151J46595_10000591 3300003187 Bacteria 32186
19 JGI25151J46595_10001664 3300003187 Bacteria 14579
20 JGI25151J46595_10004059 3300003187 Bacteria 7850
21 JGI25151J46595_10026643 3300003187 Bacteria 2329
22 JGI25165J46597_1000887 3300003214 Bacteria 21063
23 JGI25165J46597_1001344 3300003214 Bacteria 13749
24 JGI25165J46597_1009603 3300003214 Bacteria 1448
25 JGI25153J46596_10000780 3300003215 Bacteria 19521
26 JGI25153J46596_10025870 3300003215 Bacteria 2088
27 JGI25153J46596_10026083 3300003215 Bacteria 2076
28 JGI25153J46596_10047530 3300003215 Bacteria 1262
29 rootL2_10016212 3300003322 Bacteria 1524
30 rootL2_10087531 3300003322 Bacteria 3733
31 JGI25160J50197_1000008 3300003354 Bacteria 289163
32 JGI25160J50197_1000015 3300003354 Bacteria 250902
33 JGI25160J50197_1000191 3300003354 Bacteria 51959
34 JGI25160J50197_1011039 3300003354 Bacteria 3228
35 JGI25161J50226_1000005 3300003374 Bacteria 292548
36 JGI25161J50226_1000051 3300003374 Bacteria 110051
37 JGI25161J50226_1000645 3300003374 Bacteria 14023
38 JGI25161J50226_1002162 3300003374 Bacteria 5251
39 Ga0055539_1002106 3300003752 Bacteria 3232
40 Ga0055526_1006943 3300003771 Bacteria 6017
41 Ga0055526_1007111 3300003771 Bacteria 5904
42 Ga0055526_1030599 3300003771 Bacteria 1566
43 Ga0055526_1046772 3300003771 Bacteria 1022
44 Ga0055526_1048253 3300003771 Bacteria 992
45 Ga0055524_1001028 3300003775 Bacteria 17224
46 Ga0055524_1038465 3300003775 Bacteria 1251
47 Ga0055528_1000201 3300003790 Bacteria 50283
48 Ga0055528_1005168 3300003790 Bacteria 6135
49 Ga0055528_1006194 3300003790 Bacteria 5450
50 Ga0055528_1014920 3300003790 Bacteria 2838
51 Ga0055528_1016650 3300003790 Bacteria 2588
52 Ga0055528_1029202 3300003790 Bacteria 1499
53 Ga0055530_10006713 3300003791 Bacteria 5046
54 Ga0055540_1000220 3300003792 Bacteria 53660
55 Ga0055540_1003015 3300003792 Bacteria 8420
56 Ga0055540_1008253 3300003792 Bacteria 3777
57 Ga0055540_1010689 3300003792 Bacteria 3033
58 Ga0055531_10002199 3300003794 Bacteria 13276
59 Ga0055531_10011531 3300003794 Bacteria 4248
60 Ga0055531_10025012 3300003794 Bacteria 2183
61 Ga0055543_1000012 3300004625 Bacteria 186581
62 Ga0055543_1000040 3300004625 Bacteria 122485
63 Ga0055543_1000258 3300004625 Bacteria 39859
64 Ga0055543_1001853 3300004625 Bacteria 7713
65 Ga0065165_1000015 3300005262 Bacteria 289201
66 Ga0065165_1000125 3300005262 Bacteria 130283
67 Ga0065165_1007789 3300005262 Bacteria 5168
68 Ga0065165_1007971 3300005262 Bacteria 5070
69 Ga0065165_1014790 3300005262 Bacteria 3012
70 Ga0070668_100049726 3300005347 Bacteria 3226
71 Ga0070669_100154288 3300005353 Bacteria 1780
72 Ga0070671_100048227 3300005355 Bacteria 3542
73 Ga0070667_100137138 3300005367 Bacteria 2140
74 Ga0070667_100411523 3300005367 Bacteria 1232
75 Ga0070662_100143598 3300005457 Bacteria 1852
76 Ga0070665_100020587 3300005548 Bacteria 6628
77 Ga0070665_100436866 3300005548 Bacteria 1318
78 Ga0068855_100270219 3300005563 Bacteria 1891
79 Ga0068856_100188527 3300005614 Bacteria 2076
80 Ga0075365_10000858 3300006038 Bacteria 12642
81 Ga0075365_10001303 3300006038 Bacteria 11124
82 Ga0075365_10002765 3300006038 Bacteria 8765
83 Ga0075364_10002314 3300006051 Bacteria 10683
84 Ga0075364_10080742 3300006051 Bacteria 2150
85 Ga0075362_10001499 3300006177 Bacteria 7503
86 Ga0075367_10002234 3300006178 Bacteria 8746
87 Ga0075367_10026454 3300006178 Bacteria 3291
88 Ga0075367_10094480 3300006178 Bacteria 1823
89 Ga0075369_10000760 3300006186 Bacteria 10508
90 Ga0075369_10107671 3300006186 Bacteria 1255
91 Ga0075370_10011081 3300006353 Bacteria 4729
92 Ga0075370_10052058 3300006353 Bacteria 2322
93 Ga0075370_10145295 3300006353 Bacteria 1388
94 Ga0079104_1000032 3300006946 Bacteria 203094
95 Ga0079104_1003297 3300006946 Bacteria 7679
96 Ga0079104_1006476 3300006946 Bacteria 4423
97 Ga0105250_10054287 3300009092 Bacteria 1607
98 Ga0105240_10000032 3300009093 Bacteria 283907
99 Ga0105248_10545507 3300009177 Bacteria 1308
100 Ga0105237_10002365 3300009545 Bacteria 23399
101 Ga0105237_10941201 3300009545 Bacteria 871
102 Ga0123341_1008630 3300009765 Bacteria 9310
103 Ga0123341_1056455 3300009765 Bacteria 2050
104 Ga0123342_1042580 3300009766 Bacteria 1596
105 Ga0123342_1064466 3300009766 Bacteria 931
106 Ga0105239_10012679 3300010375 Bacteria 9377
107 Ga0157373_10155408 3300013100 Bacteria 1609
108 Ga0157371_10010008 3300013102 Bacteria 7419
109 Ga0157371_10170756 3300013102 Bacteria 1554
110 Ga0157370_10006055 3300013104 Bacteria 13428
111 Ga0171463_1001 3300013249 Bacteria 1406070
112 Ga0182007_10000460 3300015262 Bacteria 24598
113 Ga0182005_1001195 3300015265 Bacteria 10741
114 Ga0183363_1174 3300015690 Bacteria 14284
115 Ga0214544_1000017 3300021320 Bacteria 193638
116 Ga0214542_1000006 3300021321 Bacteria 345164
117 Ga0214542_1023682 3300021321 Bacteria 3614
118 Ga0214543_1000003 3300021327 Bacteria 692327
119 Ga0214543_1000014 3300021327 Bacteria 324986
120 Ga0228711_1000001 3300022739 Bacteria 357377
121 Ga0228710_1009445 3300022740 Bacteria 13516
122 Ga0209435_100042 3300025206 Bacteria 105563
123 Ga0209436_102619 3300025208 Bacteria 5272
124 Ga0209436_111258 3300025208 Bacteria 1582
125 Ga0209563_109026 3300025230 Bacteria 1534
126 Ga0209437_100033 3300025233 Bacteria 512520
127 Ga0209437_100075 3300025233 Bacteria 297202
128 Ga0207425_1000031 3300025245 Bacteria 261181
129 Ga0207425_1002025 3300025245 Bacteria 7551
130 Ga0207425_1005375 3300025245 Bacteria 3661
131 Ga0207425_1019359 3300025245 Bacteria 1466
132 Ga0209646_1000145 3300025246 Bacteria 105563
133 Ga0209026_1000160 3300025250 Bacteria 105563
134 Ga0209677_101318 3300025253 Bacteria 10964
135 Ga0209148_1006231 3300025254 Bacteria 2608
136 Ga0209759_1000177 3300025256 Bacteria 105563
137 Ga0209129_1000053 3300025258 Bacteria 262823
138 Ga0209129_1000137 3300025258 Bacteria 123213
139 Ga0209129_1001658 3300025258 Bacteria 12046
140 Ga0209129_1003401 3300025258 Bacteria 6972
141 Ga0209129_1003754 3300025258 Bacteria 6413
142 Ga0209129_1004220 3300025258 Bacteria 5759
143 Ga0209233_1000056 3300025261 Bacteria 438104
144 Ga0209233_1000064 3300025261 Bacteria 392156
145 Ga0209233_1000209 3300025261 Bacteria 115124
146 Ga0209455_1022909 3300025272 Bacteria 1181
147 Ga0209673_1000041 3300025273 Bacteria 307397
148 Ga0209673_1000319 3300025273 Bacteria 88129
149 Ga0209673_1000603 3300025273 Bacteria 55646
150 Ga0209673_1001904 3300025273 Bacteria 16728
151 Ga0209673_1002052 3300025273 Bacteria 15245
152 Ga0209673_1005246 3300025273 Bacteria 6593
153 Ga0209673_1009732 3300025273 Bacteria 4127
154 Ga0209673_1023011 3300025273 Bacteria 2133
155 Ga0209673_1032712 3300025273 Bacteria 1598
156 Ga0209673_1047185 3300025273 Bacteria 1170
157 Ga0209130_1000006 3300025284 Bacteria 596528
158 Ga0209130_1000007 3300025284 Bacteria 591584
159 Ga0209130_1000018 3300025284 Bacteria 388301
160 Ga0209130_1017462 3300025284 Bacteria 1708
161 Ga0209676_1003604 3300025292 Bacteria 9324
162 Ga0209676_1005303 3300025292 Bacteria 6793
163 Ga0209676_1044856 3300025292 Bacteria 1208
164 Ga0209025_1000087 3300025294 Bacteria 261181
165 Ga0209025_1000165 3300025294 Bacteria 164692
166 Ga0209025_1000199 3300025294 Bacteria 146058
167 Ga0209025_1000580 3300025294 Bacteria 66332
168 Ga0209025_1001754 3300025294 Bacteria 26007
169 Ga0209025_1008148 3300025294 Bacteria 7601
170 Ga0209025_1014633 3300025294 Bacteria 4803
171 Ga0209025_1080515 3300025294 Bacteria 1108
172 Ga0209025_1082706 3300025294 Bacteria 1083
173 Ga0209564_1000330 3300025295 Bacteria 92033
174 Ga0209564_1000425 3300025295 Bacteria 74279
175 Ga0209564_1000431 3300025295 Bacteria 72866
176 Ga0209564_1001106 3300025295 Bacteria 31905
177 Ga0209564_1010463 3300025295 Bacteria 4268
178 Ga0209564_1010632 3300025295 Bacteria 4214
179 Ga0209564_1046144 3300025295 Bacteria 1113
180 Ga0209758_1000081 3300025297 Bacteria 261181
181 Ga0209758_1000333 3300025297 Bacteria 88318
182 Ga0209758_1000890 3300025297 Bacteria 40935
183 Ga0209758_1002059 3300025297 Bacteria 21481
184 Ga0209758_1002402 3300025297 Bacteria 19217
185 Ga0209758_1002927 3300025297 Bacteria 16450
186 Ga0209758_1007332 3300025297 Bacteria 7551
187 Ga0209758_1008991 3300025297 Bacteria 6316
188 Ga0209758_1027802 3300025297 Bacteria 2409
189 Ga0209050_1008722 3300025298 Bacteria 5344
190 Ga0209050_1011419 3300025298 Bacteria 4215
191 Ga0209256_1000877 3300025299 Bacteria 37183
192 Ga0209256_1001695 3300025299 Bacteria 21274
193 Ga0209256_1002866 3300025299 Bacteria 13104
194 Ga0209256_1008034 3300025299 Bacteria 4998
195 Ga0209256_1009074 3300025299 Bacteria 4439
196 Ga0209256_1011652 3300025299 Bacteria 3484
197 Ga0209256_1026291 3300025299 Bacteria 1679
198 Ga0209256_1028526 3300025299 Bacteria 1572
199 Ga0209256_1029895 3300025299 Bacteria 1511
200 Ga0207426_1000044 3300025302 Bacteria 428043
201 Ga0207426_1000064 3300025302 Bacteria 358276
202 Ga0207426_1000106 3300025302 Bacteria 244368
203 Ga0207426_1000119 3300025302 Bacteria 221800
204 Ga0207426_1007834 3300025302 Bacteria 4415
205 Ga0209051_1000198 3300025303 Bacteria 106688
206 Ga0209051_1001443 3300025303 Bacteria 20239
207 Ga0209051_1001611 3300025303 Bacteria 18403
208 Ga0209051_1002094 3300025303 Bacteria 15026
209 Ga0209051_1002200 3300025303 Bacteria 14404
210 Ga0209051_1012227 3300025303 Bacteria 4163
211 Ga0209051_1017935 3300025303 Bacteria 3150
212 Ga0209051_1064595 3300025303 Bacteria 1133
213 Ga0209257_1001713 3300025304 Bacteria 24577
214 Ga0209257_1002246 3300025304 Bacteria 19809
215 Ga0209257_1004254 3300025304 Bacteria 11304
216 Ga0207696_1052960 3300025711 Bacteria 1156
217 Ga0207695_10000024 3300025913 Bacteria 632311
218 Ga0207671_10000718 3300025914 Bacteria 42274
219 Ga0207681_10132609 3300025923 Bacteria 1844
220 Ga0207644_10081513 3300025931 Bacteria 2391
221 Ga0207711_10281284 3300025941 Bacteria 1532
222 Ga0207667_10256933 3300025949 Bacteria 1787
223 Ga0207668_10731214 3300025972 Bacteria 872
224 Ga0207658_10400265 3300025986 Bacteria 1207
225 Ga0207658_10464945 3300025986 Bacteria 1122
226 Ga0207702_10069827 3300026078 Bacteria 3021
227 Ga0209281_1000053 3300027111 Bacteria 309587
228 Ga0209281_1000236 3300027111 Bacteria 113362
229 Ga0209281_1000266 3300027111 Bacteria 100574
230 Ga0209371_1001236 3300027312 Bacteria 18342
231 Ga0209282_1000007 3300027666 Bacteria 254917
232 Ga0268266_10034684 3300028379 Bacteria 4292
233 Ga0268266_10082429 3300028379 Bacteria 2806
234 Ga0307515_10000070 3300028794 Bacteria 239322
235 Ga0307515_10009393 3300028794 Bacteria 18922
236 Ga0307515_10010607 3300028794 Bacteria 17629
237 Ga0268256_1000846 3300030500 Bacteria 21690
238 Ga0307513_10017679 3300031456 Bacteria 8541
239 Ga0307513_10158861 3300031456 Bacteria 2156
240 Ga0307408_100076443 3300031548 Bacteria 2491
241 Ga0307408_100180951 3300031548 Bacteria 1690
242 Ga0307405_10001075 3300031731 Bacteria 11115
243 Ga0315914_1000027 3300031967 Bacteria 106536
244 Ga0307416_100403817 3300032002 Bacteria 1405
245 Ga0307414_10050768 3300032004 Bacteria 2875
246 Ga0307414_10271099 3300032004 Bacteria 1421
247 Ga0315913_1007081 3300033430 Bacteria 13516
248 Ga0315915_1000001 3300033464 Bacteria 481518
249 Ga0395898_0001330 3300037466 Bacteria 35820
250 Ga0395898_0231514 3300037466 Bacteria 1762
251 Ga0439436_0023455 3300041404 Bacteria 1825
252 Ga0439465_0011488 3300041413 Bacteria 2779
253 Ga0439465_0029101 3300041413 Bacteria 1754
254 Ga0451789_1302009 3300041443 Bacteria 878
255 Ga0451804_0002771 3300041463 Bacteria 1090
256 Ga0451837_0064596 3300041494 Bacteria 1211
257 Ga0451851_0918442 3300041507 Bacteria 1889
258 Ga0439431_0019365 3300041997 Bacteria 1618
259 Ga0439449_0006294 3300042007 Bacteria 4538
260 Ga0439462_0080216 3300042015 Bacteria 891
261 Ga0450920_032091 3300042122 Bacteria 1036
262 Ga0450918_010688 3300042531 Bacteria 1602
263 Ga0466965_0252102 3300044683 Bacteria 947
264 Ga0466966_0178973 3300044684 Bacteria 1287
265 Ga0466971_0125591 3300044719 Bacteria 1189
266 Ga0466970_0024461 3300044765 Bacteria 3158
267 Ga0466957_0155377 3300044842 Bacteria 1482
268 Ga0495592_0144181 3300046454 Bacteria 1653
269 Ga0495638_0003817 3300046460 Bacteria 11698
270 Ga0495638_0125108 3300046460 Bacteria 1516
271 Ga0495605_0012582 3300046474 Bacteria 4686
272 Ga0495605_0023575 3300046474 Bacteria 3233
273 Ga0495662_0081522 3300046476 Bacteria 1573
274 Ga0495585_0011550 3300046492 Bacteria 5226
275 Ga0495585_0034909 3300046492 Bacteria 2843
276 Ga0495585_0117381 3300046492 Bacteria 1410
277 Ga0495585_0199681 3300046492 Bacteria 1019
278 Ga0495596_0077456 3300046500 Bacteria 1291
279 Ga0495596_0090392 3300046500 Bacteria 1188
280 Ga0495607_0145948 3300046501 Bacteria 1216
281 Ga0495583_0004596 3300046506 Bacteria 9785
282 Ga0495583_0072744 3300046506 Bacteria 1508
283 Ga0495583_0090837 3300046506 Bacteria 1315
284 Ga0495583_0168006 3300046506 Bacteria 902
285 Ga0495606_0007105 3300046507 Bacteria 10123
286 Ga0495606_0057661 3300046507 Bacteria 2500
287 Ga0495606_0064261 3300046507 Bacteria 2336
288 Ga0495606_0240582 3300046507 Bacteria 1010
289 Ga0495610_0006488 3300046512 Bacteria 8037
290 Ga0495610_0052755 3300046512 Bacteria 1973
291 Ga0495616_0051421 3300046513 Bacteria 2055
292 Ga0495616_0156439 3300046513 Bacteria 1028
293 Ga0495620_0027499 3300046515 Bacteria 2660
294 Ga0495620_0123860 3300046515 Bacteria 1017
295 Ga0495631_0003953 3300046518 Bacteria 8006
296 Ga0495632_0047588 3300046519 Bacteria 2126
297 Ga0495632_0054258 3300046519 Bacteria 1965
298 Ga0495632_0097236 3300046519 Bacteria 1390
299 Ga0495632_0208775 3300046519 Bacteria 886
300 Ga0495643_0007584 3300046522 Bacteria 6977
301 Ga0495643_0144093 3300046522 Bacteria 1185
302 Ga0495643_0182879 3300046522 Bacteria 1017
303 Ga0495648_0113621 3300046524 Bacteria 1468
304 Ga0495648_0156448 3300046524 Bacteria 1183
305 Ga0495654_0000092 3300046530 Bacteria 101504
306 Ga0495640_0229714 3300046533 Bacteria 1167
307 Ga0495597_0020363 3300046542 Bacteria 3091
308 Ga0495622_0023797 3300046557 Bacteria 2857
309 Ga0495633_0030286 3300046558 Bacteria 2629
310 Ga0495668_0004226 3300046616 Bacteria 10340
311 Ga0495611_0005820 3300046648 Bacteria 5263
312 Ga0495625_0000883 3300046660 Bacteria 40600
313 Ga0495625_0059900 3300046660 Bacteria 2699
314 Ga0495625_0089923 3300046660 Bacteria 2125
315 Ga0495625_0094275 3300046660 Bacteria 2066
316 Ga0495588_0007417 3300046674 Bacteria 4991
317 Ga0495657_0072547 3300046675 Bacteria 2245
318 Ga0495658_0031269 3300046683 Bacteria 2898
319 Ga0495670_0027972 3300046691 Bacteria 2795
320 Ga0495670_0034596 3300046691 Bacteria 2517
321 Ga0495671_0070913 3300046692 Bacteria 1712
322 Ga0495649_0146708 3300046694 Bacteria 1240
323 Ga0495660_0054059 3300046810 Bacteria 2177
324 Ga0495604_0091348 3300047317 Bacteria 2258
325 Ga0495676_0259054 3300047321 Bacteria 1184
326 Ga0495683_0114332 3300047323 Bacteria 1286
327 Ga0495687_075633 3300047443 Bacteria 1335
328 Ga0495687_105200 3300047443 Bacteria 1050
329 Ga0495686_0001036 3300047472 Bacteria 33364
330 Ga0495686_0051972 3300047472 Bacteria 2570
331 Ga0495686_0057032 3300047472 Bacteria 2439
332 Ga0495686_0064874 3300047472 Bacteria 2259
333 Ga0495686_0124044 3300047472 Bacteria 1537
334 Ga0495686_0167874 3300047472 Bacteria 1278
335 Ga0495602_0301252 3300048088 Bacteria 1173
336 Ga0496100_0133374 3300048903 Bacteria 1752
337 Ga0496101_0240218 3300048904 Bacteria 1409
338 Ga0496101_0281805 3300048904 Bacteria 1299
339 Ga0496102_0054748 3300048905 Bacteria 3638
340 Ga0496102_0333112 3300048905 Bacteria 1429
341 Ga0496104_0334753 3300048907 Bacteria 1427
342 Ga0496105_0253413 3300048908 Bacteria 1425
343 Ga0496106_0002977 3300048909 Bacteria 12613
344 Ga0496106_0252502 3300048909 Bacteria 1410
345 Ga0496110_0188438 3300048913 Bacteria 1873
346 Ga0496110_0270374 3300048913 Bacteria 1547
347 Ga0496111_0002706 3300048914 Bacteria 10766
348 Ga0496111_0071455 3300048914 Bacteria 2526
349 Ga0496114_0218178 3300048917 Bacteria 1674
350 Ga0496114_0286362 3300048917 Bacteria 1453
351 Ga0496116_0000026 3300048919 Bacteria 450803
352 Ga0496116_0010291 3300048919 Bacteria 7856
353 Ga0496116_0041340 3300048919 Bacteria 3163
354 Ga0496116_0045458 3300048919 Bacteria 2972
355 Ga0496116_0064541 3300048919 Bacteria 2353
356 Ga0496116_0151311 3300048919 Bacteria 1288
357 Ga0496116_0177001 3300048919 Bacteria 1147
358 Ga0496117_0001867 3300048920 Bacteria 28420
359 Ga0496117_0026098 3300048920 Bacteria 4576
360 Ga0496117_0027157 3300048920 Bacteria 4466
361 Ga0496117_0064728 3300048920 Bacteria 2490
362 Ga0496117_0118530 3300048920 Bacteria 1631
363 Ga0496117_0317604 3300048920 Bacteria 817
364 Ga0496118_0012870 3300048921 Bacteria 7974
365 Ga0496118_0075238 3300048921 Bacteria 2409
366 Ga0496118_0076515 3300048921 Bacteria 2379
367 Ga0496118_0077503 3300048921 Bacteria 2357
368 Ga0496118_0189393 3300048921 Bacteria 1232
369 Ga0496119_0046197 3300048922 Bacteria 2722
370 Ga0496119_0056778 3300048922 Bacteria 2370
371 Ga0496119_0253603 3300048922 Bacteria 886
372 Ga0496120_0058615 3300048923 Bacteria 2162
373 Ga0496120_0088341 3300048923 Bacteria 1661
374 Ga0496120_0090609 3300048923 Bacteria 1634
375 Ga0496120_0094175 3300048923 Bacteria 1595
376 Ga0496120_0181335 3300048923 Bacteria 1033
377 Ga0496120_0201343 3300048923 Bacteria 964
378 Ga0496121_0000001 3300048924 Bacteria 1830318
379 Ga0496121_0003347 3300048924 Bacteria 22997
380 Ga0496121_0005117 3300048924 Bacteria 17088
381 Ga0496121_0012537 3300048924 Bacteria 9225
382 Ga0496121_0048389 3300048924 Bacteria 3617
383 Ga0496121_0171180 3300048924 Bacteria 1577
384 Ga0496121_0221843 3300048924 Bacteria 1331
385 Ga0496121_0292677 3300048924 Bacteria 1108
386 Ga0496121_0366396 3300048924 Bacteria 955
387 Ga0496122_0000160 3300048925 Bacteria 159236
388 Ga0496122_0000604 3300048925 Bacteria 73844
389 Ga0496122_0011685 3300048925 Bacteria 8849
390 Ga0496122_0012377 3300048925 Bacteria 8508
391 Ga0496122_0021819 3300048925 Bacteria 5715
392 Ga0496122_0052823 3300048925 Bacteria 3070
393 Ga0496122_0066147 3300048925 Bacteria 2614
394 Ga0496122_0074595 3300048925 Bacteria 2399
395 Ga0496122_0076327 3300048925 Bacteria 2358
396 Ga0496122_0077456 3300048925 Bacteria 2334
397 Ga0496122_0116511 3300048925 Bacteria 1737
398 Ga0496123_0000034 3300048926 Bacteria 274836
399 Ga0496123_0000103 3300048926 Bacteria 168232
400 Ga0496123_0003820 3300048926 Bacteria 16441
401 Ga0496123_0008044 3300048926 Bacteria 9762
402 Ga0496123_0009653 3300048926 Bacteria 8658
403 Ga0496123_0035193 3300048926 Bacteria 3573
404 Ga0496123_0037959 3300048926 Bacteria 3393
405 Ga0496123_0154418 3300048926 Bacteria 1233
406 Ga0496124_0005176 3300048927 Bacteria 14827
407 Ga0496124_0026701 3300048927 Bacteria 5203
408 Ga0496124_0051147 3300048927 Bacteria 3516
409 Ga0496124_0051672 3300048927 Bacteria 3495
410 Ga0496124_0054451 3300048927 Bacteria 3386
411 Ga0496124_0089653 3300048927 Bacteria 2510
412 Ga0496124_0118710 3300048927 Bacteria 2117
413 Ga0496124_0134272 3300048927 Bacteria 1961
414 Ga0496124_0222439 3300048927 Bacteria 1418
415 Ga0496124_0223040 3300048927 Bacteria 1416
416 Ga0496124_0250781 3300048927 Bacteria 1309
417 Ga0496124_0385537 3300048927 Bacteria 978
418 Ga0496124_0385834 3300048927 Bacteria 978
419 Ga0496124_0416599 3300048927 Bacteria 927
420 Ga0496124_0452872 3300048927 Bacteria 874
421 Ga0496125_0000001 3300048928 Bacteria 1766138
422 Ga0496125_0004365 3300048928 Bacteria 16385
423 Ga0496125_0006606 3300048928 Bacteria 12489
424 Ga0496125_0009397 3300048928 Bacteria 10056
425 Ga0496125_0060415 3300048928 Bacteria 3046
426 Ga0496125_0083000 3300048928 Bacteria 2440
427 Ga0496126_0000069 3300048929 Bacteria 246935
428 Ga0496126_0001336 3300048929 Bacteria 39105
429 Ga0496126_0006321 3300048929 Bacteria 13225
430 Ga0496126_0120569 3300048929 Bacteria 2275
431 Ga0496126_0134875 3300048929 Bacteria 2130
432 Ga0495678_013296 3300049459 Bacteria 3871
433 Ga0495678_032777 3300049459 Bacteria 2150
434 Ga0495682_0053778 3300049460 Bacteria 1462
435 Ga0501032_0083184 3300049569 Bacteria 2129
436 Ga0501033_0001329 3300049570 Bacteria 21992
437 Ga0501033_0295749 3300049570 Bacteria 1141
438 Ga0501038_0071732 3300049574 Bacteria 2937
439 Ga0501043_0188819 3300049579 Bacteria 1603
440 Ga0501083_0028579 3300049744 Bacteria 3842
441 Ga0501035_0056360 3300049822 Bacteria 3507
442 Ga0501035_0234835 3300049822 Bacteria 1562
443 nmdc:mga03683_32817_c1 3300050489 Bacteria 2091
444 nmdc:mga00v17_115_c2 3300050491 Bacteria 47780
445 nmdc:mga00v17_213458_c1 3300050491 Bacteria 1249
446 nmdc:mga0yw44_13140_c1 3300050492 Bacteria 3539
447 nmdc:mga0yw44_1335_c1 3300050492 Bacteria 9762
448 nmdc:mga07m45_68151_c1 3300050496 Bacteria 2023
449 Ga0495601_0363105 3300053077 Bacteria 941
450 Ga0495619_0115713 3300053085 Bacteria 1835
451 Ga0500578_0147691 3300053086 Bacteria 1466
452 Ga0500643_035618 3300053087 Bacteria 1491
453 Ga0500569_004058 3300053109 Bacteria 3049
454 Ga0500572_008961 3300053111 Bacteria 2353
455 Ga0500594_0005380 3300053118 Bacteria 2838
456 Ga0500618_000575 3300053125 Bacteria 22683
457 Ga0500618_000896 3300053125 Bacteria 15698
458 Ga0500618_022804 3300053125 Bacteria 1518
459 Ga0500618_030371 3300053125 Bacteria 1271
460 Ga0500658_0006339 3300053134 Bacteria 4388
461 Ga0500658_0017189 3300053134 Bacteria 2699
462 Ga0500659_0051243 3300053135 Bacteria 2223
463 Ga0500568_0002529 3300053139 Bacteria 10682
464 Ga0500568_0008441 3300053139 Bacteria 4960
465 Ga0500590_001191 3300053148 Bacteria 10331
466 Ga0500616_0001190 3300053153 Bacteria 26447
467 Ga0500616_0001711 3300053153 Bacteria 20169
468 Ga0500622_0016729 3300053156 Bacteria 3915
469 Ga0500627_0066768 3300053158 Bacteria 1589
470 Ga0500627_0179684 3300053158 Bacteria 952
471 Ga0500633_0011594 3300053160 Bacteria 2403
472 Ga0500636_0002064 3300053177 Bacteria 11084
473 Ga0500636_0264859 3300053177 Bacteria 868
474 Ga0501082_0311353 3300060353 Bacteria 1371
475 Ga0501082_0321361 3300060353 Bacteria 1348
476 2819684062 2818991461 Bacteria 7026071
477 2509108572 2508501122 Bacteria 6292184
478 2509374401 2509276019 Bacteria 6802256
479 2509387669 2509276021 Bacteria 7634384
480 2509443027 2509276033 Bacteria 7180565
481 2510132345 2510065019 Bacteria 6903379
482 2510305107 2510065057 Bacteria 6649661
483 2510898682 2510461076 Bacteria 8618824
484 2511137078 2510917022 Bacteria 6504556
485 2511172939 2510917026 Bacteria 7046020
486 2511186410 2510917028 Bacteria 6185411
487 2511197149 2510917030 Bacteria 7460662
488 2511501073 2511231052 Bacteria 6974333
489 2512532481 2512047086 Bacteria 6850303
490 2512972182 2512875026 Bacteria 6861065
491 2513569184 2513237084 Bacteria 7231967
492 2513578857 2513237085 Bacteria 7695351
493 2513582848 2513237086 Bacteria 7265287
494 2513596296 2513237088 Bacteria 6927906
495 2513603261 2513237089 Bacteria 6553624
496 2513616237 2513237091 Bacteria 6900273
497 2513632711 2513237093 Bacteria 7545552
498 2513709163 2513237103 Bacteria 7647401
499 2513871247 2513237138 Bacteria 7368160
500 2513881040 2513237140 Bacteria 7076289
501 2513902276 2513237143 Bacteria 6664116
502 2513908888 2513237144 Bacteria 7530820
503 2513925749 2513237146 Bacteria 7166346
504 2513983867 2513237156 Bacteria 6402557
505 2514001934 2513237159 Bacteria 6810126
506 2514004716 2513237160 Bacteria 6650282
507 2514020705 2513237162 Bacteria 7468464
508 2515111329 2515075009 Bacteria 7288508
509 2515608183 2515154107 Bacteria 6795637
510 2515638472 2515154113 Bacteria 7807172
511 2515644358 2515154114 Bacteria 7848616
512 2515659146 2515154116 Bacteria 7552979
513 2515740516 2515154134 Bacteria 7220242
514 2516208934 2516143018 Bacteria 6951533
515 2516892354 2516653046 Bacteria 6989037
516 2517039970 2516653077 Bacteria 7555578
517 2517075522 2516653085 Bacteria 7346596
518 2517094103 2517093000 Bacteria 7412387
519 2517405922 2517287029 Bacteria 6905599
520 2517569152 2517487022 Bacteria 7227575
521 2520378725 2519899620 Bacteria 6499161
522 2524451078 2524023207 Bacteria 6813453
523 2524460598 2524023209 Bacteria 6679728
524 2530643841 2529292951 Bacteria 6916614
525 2535515766 2534681796 Bacteria 7146037
526 2551680462 2551306084 Bacteria 8942552
527 2551683849 2551306085 Bacteria 7347181
528 2551695757 2551306086 Bacteria 6843938
529 2551698111 2551306087 Bacteria 7351905
530 2551713128 2551306089 Bacteria 7162724
531 2551721357 2551306090 Bacteria 7953713
532 2551745191 2551306093 Bacteria 7064773
533 2558863428 2558860100 Bacteria 8458965
534 2585165617 2582581283 Bacteria 6030556
535 2585203129 2582581294 Bacteria 6626667
536 2585221041 2582581298 Bacteria 7315509
537 2585231444 2582581299 Bacteria 6518058
538 2585256563 2582581304 Bacteria 5831370
539 2585266109 2582581306 Bacteria 6450535
540 2585273212 2582581307 Bacteria 6597605
541 2585278955 2582581308 Bacteria 7413247
542 2585325430 2582581315 Bacteria 7318924
543 2585329592 2582581316 Bacteria 7774528
544 2585387110 2582581865 Bacteria 6644329
545 2585392770 2582581866 Bacteria 6859583
546 2585400074 2582581867 Bacteria 7184437
547 2585528019 2585427526 Bacteria 7258840
548 2585530751 2585427527 Bacteria 7273426
549 2585541379 2585427528 Bacteria 6842387
550 2585549243 2585427529 Bacteria 7395659
551 2585554932 2585427530 Bacteria 7383882
552 2585559488 2585427531 Bacteria 6992870
553 2585822633 2585427590 Bacteria 6824633
554 2585839489 2585427593 Bacteria 7141551
555 2585847164 2585427594 Bacteria 6180594
556 2585902159 2585427608 Bacteria 6544331
557 2585905136 2585427609 Bacteria 6667127
558 2585995167 2585427633 Bacteria 6413184
559 2585999714 2585427634 Bacteria 6455027
560 2587979749 2585428125 Bacteria 6662905
561 2599333702 2599185156 Bacteria 5403036
562 2599418546 2599185170 Bacteria 7295545
563 2599722063 2599185236 Bacteria 6875203
564 2600191991 2599185352 Bacteria 7228948
565 2600375318 2600254933 Bacteria 4750527
566 2616296168 2615840624 Bacteria 6557588
567 2616305772 2615840626 Bacteria 7921970
568 2616553988 2615840698 Bacteria 7319877
569 2617384178 2617270742 Bacteria 6808054
570 2643807143 2643221557 Bacteria 7184309
571 2643809957 2643221558 Bacteria 5460675
572 2643857871 2643221568 Bacteria 5187270
573 2644007973 2643221599 Bacteria 6292121
574 2644046506 2643221607 Bacteria 6314006
575 2644069591 2643221610 Bacteria 7480339
576 2644108934 2643221618 Bacteria 7717186
577 2644151456 2643221626 Bacteria 8069654
578 2644196562 2643221634 Bacteria 6705461
579 2644200859 2643221636 Bacteria 6583769
580 2644206144 2643221637 Bacteria 5345260
581 2644239053 2643221643 Bacteria 5749658
582 2644311590 2643221655 Bacteria 7722067
583 2644329848 2643221659 Bacteria 7890716
584 2644380525 2643221668 Bacteria 7306521
585 2644420745 2643221675 Bacteria 7473456
586 2644454270 2643221680 Bacteria 7473610
587 2644479296 2643221686 Bacteria 6310811
588 2644493346 2643221688 Bacteria 5260751
589 2644502343 2643221689 Bacteria 6042950
590 2644546522 2643221698 Bacteria 7756764
591 2644617389 2643221712 Bacteria 7729434
592 2644649791 2643221718 Bacteria 5345506
593 2644675591 2643221723 Bacteria 7095460
594 2644689607 2643221726 Bacteria 7455827
595 2657683210 2657244999 Bacteria 5946535
596 2671115258 2667528174 Bacteria 6435400
597 2692316770 2690316117 Bacteria 6800650
598 2719180337 2718217882 Bacteria 6556348
599 2719384914 2718217927 Bacteria 6972593
600 2719664659 2718217997 Bacteria 6740740
601 2719731086 2718218009 Bacteria 6478651
602 2720491079 2718218199 Bacteria 6740745
603 2720612448 2718218232 Bacteria 6720332
604 2720619287 2718218233 Bacteria 6662049
605 2720630687 2718218235 Bacteria 6630699
606 2720774380 2718218269 Bacteria 6906114
607 2721146431 2718218363 Bacteria 6524337
608 2721157952 2718218365 Bacteria 6274507
609 2721163310 2718218366 Bacteria 6425255
610 2721398634 2718218423 Bacteria 6438183
611 2722839480 2721755514 Bacteria 6424414
612 2723026108 2721755556 Bacteria 6745503
613 2723559652 2721755684 Bacteria 6859907
614 2723566268 2721755685 Bacteria 6704835
615 2724037447 2721755809 Bacteria 6438790
616 2724043842 2721755810 Bacteria 6479005
617 2724088987 2721755819 Bacteria 6906405
618 2724103533 2721755822 Bacteria 6726041
619 2724109372 2721755823 Bacteria 6752556
620 2725946771 2724679232 Bacteria 7646494
621 2730107044 2728369352 Bacteria 6745171
622 2730163574 2728369365 Bacteria 6555560
623 2730297584 2728369397 Bacteria 6274511
624 2738802212 2738541293 Bacteria 7065685
625 2738946498 2738541317 Bacteria 5340176
626 2739035949 2738541333 Bacteria 7106503
627 2753460862 2751185821 Bacteria 6189929
628 2766067558 2765235942 Bacteria 7445910
629 2778177534 2775507266 Bacteria 7392367
630 2792584217 2791355082 Bacteria 5973319
631 2792622629 2791355091 Bacteria 6135441
632 2792628450 2791355092 Bacteria 6248105
633 2792638291 2791355094 Bacteria 7011481
634 2793296244 2791355256 Bacteria 6798008
635 2793317570 2791355259 Bacteria 7254731
636 2793321054 2791355260 Bacteria 6598818
637 2793327086 2791355261 Bacteria 6661293
638 2793333661 2791355262 Bacteria 6774204
639 2793339745 2791355263 Bacteria 6872478
640 2793347978 2791355264 Bacteria 6429314
641 2793357413 2791355265 Bacteria 6539969
642 2793358964 2791355266 Bacteria 7116587
643 2793367894 2791355267 Bacteria 7222458
644 2802717796 2802428858 Bacteria 6636079
645 2802723275 2802428859 Bacteria 6667919
646 2802733138 2802428860 Bacteria 6525526
647 2802736280 2802428861 Bacteria 6534206
648 2802743510 2802428862 Bacteria 6633353
649 2802750777 2802428863 Bacteria 6410669
650 2804751402 2802429268 Bacteria 6094027
651 2805926535 2802429605 Bacteria 6875453
652 2805933334 2802429606 Bacteria 6346811
653 2806046872 2802429633 Bacteria 7341974
654 2806052455 2802429634 Bacteria 7083200
655 2806058774 2802429635 Bacteria 7650140
656 2806067458 2802429636 Bacteria 7597525
657 2806074037 2802429637 Bacteria 7067217
658 2819611548 2818991448 Bacteria 6772224
659 2819639201 2818991453 Bacteria 7181617
660 2821124332 2821123053 Bacteria 7836056
661 2838017331 2838016132 Bacteria 6577831
662 2838023100 2838022645 Bacteria 6494267
663 2838031476 2838029111 Bacteria 6603031
664 2838037757 2838035591 Bacteria 7166484
665 2838048871 2838042994 Bacteria 6046894
666 2838049187 2838048938 Bacteria 6044578
667 2838063367 2838061910 Bacteria 6794874
668 2838074200 2838068647 Bacteria 6208656
669 2838076497 2838074704 Bacteria 6785777
670 2838662770 2838661181 Bacteria 7385261
671 2838670890 2838668709 Bacteria 6671819
672 2838681386 2838680041 Bacteria 6545511
673 2838688563 2838686498 Bacteria 7807632
674 2838694579 2838694306 Bacteria 6853137
675 2838703261 2838701080 Bacteria 6669771
676 2838707957 2838707686 Bacteria 6619912
677 2838730858 2838729681 Bacteria 7400765
678 2838741173 2838736955 Bacteria 5760694
679 2838744248 2838742623 Bacteria 7396178
680 2841844930 2841840854 Bacteria 5761912
681 2841856929 2841851746 Bacteria 7532261
682 2841865427 2841864319 Bacteria 6742987
683 2842080812 2842077413 Bacteria 6508645
684 2842115021 2842110456 Bacteria 7656360
685 2842121431 2842118031 Bacteria 7033875
686 2842144652 2842140634 Bacteria 5759631
687 2842147515 2842146304 Bacteria 5957337
688 2842160099 2842156927 Bacteria 6894975
689 2842168342 2842163707 Bacteria 6916235
690 2842183284 2842180545 Bacteria 6888678
691 2842197992 2842192696 Bacteria 6147454
692 2842199528 2842198810 Bacteria 6608673
693 2842207654 2842205361 Bacteria 6340321
694 2842221246 2842217011 Bacteria 7497767
695 2842235115 2842229732 Bacteria 7475766
696 2842237368 2842237096 Bacteria 6620661
697 2842245712 2842243621 Bacteria 7421798
698 2842252581 2842250916 Bacteria 6579627
699 2842259638 2842257432 Bacteria 7401195
700 2842266879 2842264693 Bacteria 6472963
701 2842274477 2842271015 Bacteria 7807131
702 2842281551 2842278818 Bacteria 6340002
703 2842287075 2842285085 Bacteria 6011953
704 2842294468 2842291075 Bacteria 7076806
705 2842302402 2842298080 Bacteria 6123127
706 2842306720 2842304105 Bacteria 7023636
707 2842314788 2842311132 Bacteria 6616990
708 2842318609 2842317721 Bacteria 6793725
709 2842343549 2842341865 Bacteria 7003929
710 2842360865 2842357229 Bacteria 6485165
711 2842365294 2842363717 Bacteria 6844742
712 2842371849 2842370503 Bacteria 7038661
713 2842380866 2842377471 Bacteria 7140707
714 2842387937 2842384541 Bacteria 7057858
715 2842398212 2842395702 Bacteria 6780583
716 2842404343 2842402390 Bacteria 6681310
717 2842410972 2842409023 Bacteria 6687331
718 2842417572 2842415677 Bacteria 6596907
719 2842427405 2842422224 Bacteria 6239196
720 2842431010 2842428310 Bacteria 6767288
721 2842436992 2842434925 Bacteria 6502746
722 2842443070 2842441272 Bacteria 6769273
723 2842453292 2842447887 Bacteria 6754142
724 2842465081 2842462802 Bacteria 6588055
725 2842471693 2842469257 Bacteria 6752936
726 2842477929 2842475841 Bacteria 6603183
727 2842482897 2842482326 Bacteria 7212537
728 2842493800 2842489311 Bacteria 6620893
729 2842497244 2842495871 Bacteria 6820686
730 2842504738 2842502639 Bacteria 6604161
731 2842509773 2842509118 Bacteria 6850950
732 2842526293 2842521101 Bacteria 6569494
733 2842924860 2842922631 Bacteria 5824079
734 2844168457 2844163670 Bacteria 7266046
735 2844455079 2844454524 Bacteria 7952546
736 2847418164 2847417321 Bacteria 6913799
737 2850080533 2850079185 Bacteria 6848280
738 2854897231 2854896431 Bacteria 5869725
739 2854922139 2854916844 Bacteria 5725939
740 2855831426 2855825444 Bacteria 6785811
741 2855840550 2855839649 Bacteria 7135830
742 2855878882 2855872281 Bacteria 6964271
743 2857520247 2857516855 Bacteria 7787325
744 2857531912 2857531043 Bacteria 6754041
745 2858801078 2858800743 Bacteria 6603254
746 2891376458 2891373044 Bacteria 5202277
747 2896386697 2896384573 Bacteria 7700774
748 2913297391 2913295892 Bacteria 6333755
749 2913310913 2913308742 Bacteria 5350706
750 2915986276 2915980308 Bacteria 6624279
751 2915988311 2915986958 Bacteria 6739310
752 2915996157 2915993759 Bacteria 7016183
753 2916001172 2916000859 Bacteria 6865702
754 2916014003 2916007675 Bacteria 6898660
755 2916020246 2916014648 Bacteria 6946486
756 2916025155 2916021584 Bacteria 6854472
757 2916032640 2916028427 Bacteria 6748433
758 2916040280 2916035215 Bacteria 6755766
759 2916044480 2916041962 Bacteria 6820487
760 2916049612 2916048683 Bacteria 6543552
761 2916055256 2916055098 Bacteria 6758838
762 2916062221 2916061851 Bacteria 6737736
763 2916070924 2916068649 Bacteria 6943657
764 2916076780 2916076590 Bacteria 6596108
765 2919103875 2919100787 Bacteria 7710546
766 2919168435 2919166419 Bacteria 4952238
767 2919171368 2919171160 Bacteria 6499771
768 2919409359 2919408235 Bacteria 6149349
769 2920762819 2920760137 Bacteria 7427611
770 2920823901 2920822456 Bacteria 6897201
771 2921204369 2921201388 Bacteria 6926299
772 2921210053 2921208531 Bacteria 6745326
773 2921240042 2921237296 Bacteria 6876710
774 2921246198 2921244191 Bacteria 6568419
775 2921251057 2921250672 Bacteria 6677771
776 2921257888 2921257292 Bacteria 6808382
777 2921264133 2921263974 Bacteria 6864552
778 2921286251 2921282425 Bacteria 6826397
779 2921294828 2921289301 Bacteria 7316391
780 2921299629 2921296804 Bacteria 7176999
781 2923557521 2923556063 Bacteria 6793593
782 2924146583 2924144063 Bacteria 6883928
783 2924151200 2924150972 Bacteria 7169444
784 2924160677 2924158325 Bacteria 7188855
785 2924171715 2924165586 Bacteria 7260590
786 2924177522 2924172951 Bacteria 6749356
787 2924185888 2924179722 Bacteria 6843264
788 2924188722 2924186466 Bacteria 6876637
789 2924198166 2924193448 Bacteria 6955718
790 2924203024 2924200457 Bacteria 6757188
791 2924212630 2924207177 Bacteria 6917007
792 2924220462 2924214083 Bacteria 7080103
793 2924226764 2924221636 Bacteria 7113495
794 2924230293 2924228884 Bacteria 6633132
795 2929139568 2929138655 Bacteria 5810547
796 2933019567 2933016740 Bacteria 6355406
797 2933573166 2933570622 Bacteria 7023390
798 2933591420 2933586486 Bacteria 7667493
799 2933604654 2933599457 Bacteria 5858799
800 2935895101 2935894831 Bacteria 6620579
801 2935904085 2935901341 Bacteria 7341747
802 2936368077 2936367885 Bacteria 7324495
803 2936381529 2936375103 Bacteria 6652732
804 2936384900 2936381700 Bacteria 7006523
805 2937000999 2936996657 Bacteria 6298727
806 2937004319 2937002841 Bacteria 6934057
807 2937011072 2937009748 Bacteria 6746052
808 2937019404 2937016420 Bacteria 6782579
809 2937028504 2937023124 Bacteria 6815156
810 2937029763 2937029754 Bacteria 6424026
811 2937036789 2937036028 Bacteria 6846469
812 2937048315 2937042894 Bacteria 6741576
813 2937056086 2937049772 Bacteria 6757901
814 2937059175 2937056579 Bacteria 7107896
815 2937067837 2937063883 Bacteria 7199456
816 2937073940 2937071275 Bacteria 6984483
817 2937082869 2937078374 Bacteria 6610289
818 2937090527 2937084907 Bacteria 6618516
819 2937095693 2937091812 Bacteria 6979387
820 2937104114 2937098957 Bacteria 7249374
821 2937110731 2937106411 Bacteria 6947143
822 2937113970 2937113482 Bacteria 6505872
823 2937125467 2937119839 Bacteria 6597547
824 2937129035 2937126314 Bacteria 6771275
825 2941500157 2941499720 Bacteria 7599444
826 2957379922 2957375807 Bacteria 6425588
827 2957382750 2957382221 Bacteria 6737050
828 2957389028 2957388812 Bacteria 6778072
829 2957398332 2957395598 Bacteria 6822399
830 2957407537 2957402308 Bacteria 6741770
831 2957411611 2957408893 Bacteria 6558585
832 2957418880 2957415311 Bacteria 6991633
833 2957429863 2957422303 Bacteria 7172205
834 2957432542 2957430029 Bacteria 7022557
835 2957438990 2957437181 Bacteria 6568994
836 2957446524 2957443900 Bacteria 6869977
837 2957456584 2957450854 Bacteria 6765715
838 2957463342 2957457609 Bacteria 6967680
839 2957466628 2957464669 Bacteria 6568877
840 2957473176 2957471148 Bacteria 6797643
841 2957479916 2957478035 Bacteria 6756658
842 2957486105 2957484790 Bacteria 6703082
843 2957496258 2957491536 Bacteria 6695180
844 2957503557 2957498199 Bacteria 7126688
845 2957509251 2957505466 Bacteria 7253085
846 2960588730 2960584000 Bacteria 6864594
847 2960595676 2960591022 Bacteria 6622873
848 2960601603 2960597568 Bacteria 6550735
849 2960608559 2960603979 Bacteria 6898737
850 2960611906 2960610863 Bacteria 6691244
851 2960617805 2960617483 Bacteria 6727748
852 2960630673 2960624210 Bacteria 6875384
853 2960633122 2960631154 Bacteria 6732508
854 2960643193 2960637947 Bacteria 7296468
855 2960645789 2960645483 Bacteria 7211087
856 2960658007 2960652885 Bacteria 7083688
857 2960666508 2960660292 Bacteria 7041660
858 2960668695 2960667422 Bacteria 6763020
859 2960675888 2960674078 Bacteria 6609048
860 2960684265 2960680706 Bacteria 6624464
861 2960689072 2960687367 Bacteria 6535474
862 2960696793 2960693952 Bacteria 6749742
863 2964609489 2964607997 Bacteria 7101408
864 2964616024 2964615318 Bacteria 6809089
865 2964625076 2964621998 Bacteria 6834995
866 2964635380 2964628898 Bacteria 7083044
867 2964642536 2964636051 Bacteria 7091832
868 2964646922 2964643177 Bacteria 6820887
869 2964656339 2964649959 Bacteria 6675118
870 2964659731 2964656573 Bacteria 7100150
871 2964665579 2964663802 Bacteria 7019362
872 2964672025 2964670856 Bacteria 6851364
873 2964679414 2964678106 Bacteria 6792020
874 2964688252 2964685014 Bacteria 6839111
875 2964692142 2964691889 Bacteria 6802758
876 2964703521 2964698721 Bacteria 6765331
877 2964708593 2964705432 Bacteria 7114648
878 2964718659 2964712639 Bacteria 6695970
879 2964722297 2964719344 Bacteria 7286602
880 2967668676 2967664464 Bacteria 6948836
881 2967677142 2967671571 Bacteria 7021409
882 2967681625 2967678726 Bacteria 7264382
883 2967687137 2967686174 Bacteria 6678622
884 2967693349 2967693043 Bacteria 6804451
885 2967702568 2967699805 Bacteria 6854538
886 2967707815 2967706974 Bacteria 7186053
887 2967716425 2967714385 Bacteria 7000047
888 2967723325 2967721400 Bacteria 7073753
889 2967734631 2967728569 Bacteria 6641507
890 2967735547 2967735183 Bacteria 6827012
891 2967745775 2967742019 Bacteria 6794534
892 2967754502 2967748971 Bacteria 6733771
893 2967756998 2967755722 Bacteria 6814706
894 2967763900 2967762386 Bacteria 6923502
895 2967771676 2967769361 Bacteria 6587838
896 2967776698 2967775926 Bacteria 6738189
897 2970020542 2970019648 Bacteria 7072033
898 2970032652 2970026789 Bacteria 6785236
899 2970035729 2970033650 Bacteria 7118744
900 2970045418 2970040964 Bacteria 6731123
901 2970050478 2970047711 Bacteria 7088379
902 2970057923 2970054988 Bacteria 6611507
903 2970067789 2970061556 Bacteria 7099761
904 2970072003 2970068827 Bacteria 7123112
905 2970081398 2970076120 Bacteria 6697332
906 2970088307 2970082768 Bacteria 6183754
907 2970091610 2970088815 Bacteria 6933825
908 2970100958 2970095765 Bacteria 6936963
909 2970105072 2970102677 Bacteria 6812532
910 2970114590 2970109326 Bacteria 6863976
911 2970117823 2970116247 Bacteria 6501857
912 2970124355 2970122695 Bacteria 6625855
913 2970129621 2970129317 Bacteria 6806560
914 2970136503 2970136068 Bacteria 7207982
915 2970144476 2970143518 Bacteria 6446480
916 2970155830 2970149975 Bacteria 6779706
917 2970162891 2970156795 Bacteria 7168044
918 2970166852 2970164137 Bacteria 6861252
919 2970176029 2970170962 Bacteria 6876229
920 2970178477 2970177841 Bacteria 6768001
921 2970187389 2970184632 Bacteria 7054431
922 2970194277 2970191845 Bacteria 7032787
923 2977517872 2977516862 Bacteria 6940108
924 2977529807 2977523885 Bacteria 6960446
925 2977536956 2977530762 Bacteria 6951399
926 2977538091 2977537788 Bacteria 6929320
927 2977545990 2977544691 Bacteria 6875412
928 2977552091 2977551784 Bacteria 7125765
929 2977562813 2977558990 Bacteria 6863948
930 2977566316 2977565890 Bacteria 6901543
931 2977576536 2977572785 Bacteria 6763888
932 2977581196 2977579622 Bacteria 6772100
933 2978971104 2978969890 Bacteria 5400756
934 2984588266 2984587000 Bacteria 5263363
935 2989354104 2989349275 Bacteria 6349068
936 2989772118 2989771324 Bacteria 5605128
937 2996888733 2996887358 Bacteria 5795980
938 2996895130 2996893221 Bacteria 5823108
939 3005412492 3005409236 Bacteria 7188837
940 3005417188 3005416602 Bacteria 7064308
941 3005446802 3005445848 Bacteria 6906074
942 3005453497 3005452660 Bacteria 5889319
943 639647475 639633055 Bacteria 7751309
944 643825140 643692032 Bacteria 6891900
945 648736468 648276728 Bacteria 6968865
946 8003993050 8003992118 Bacteria 7266902
947 8004000286 8003999396 Bacteria 7063185
948 8005260005 8005258706 Bacteria 6184835
949 8005279634 8005275841 Bacteria 6929066
950 8005284733 8005282627 Bacteria 6675747
951 8005292835 8005289223 Bacteria 6634003
952 8005304641 8005301065 Bacteria 6614431
953 8005311139 8005307578 Bacteria 7395396
954 8005315249 8005314921 Bacteria 7072929
955 8005323260 8005321885 Bacteria 5795980
956 8005376564 8005376324 Bacteria 6590079
957 8005385953 8005382845 Bacteria 6732062
958 8005400264 8005395548 Bacteria 6806915
959 8005437124 8005430974 Bacteria 6689030
960 8005461973 8005460587 Bacteria 7157962
961 8005485580 8005484373 Bacteria 6297373
962 8005499381 8005497431 Bacteria 6477605
963 8005544400 8005542996 Bacteria 7077758
964 8005558884 8005556819 Bacteria 6908598
965 8005570479 8005563573 Bacteria 7153261
966 8005572736 8005570704 Bacteria 6957481
967 8005620571 8005619151 Bacteria 7030230
968 8005627466 8005626139 Bacteria 6534237
969 8005649896 8005645114 Bacteria 6950293
970 8005659927 8005658619 Bacteria 4500593
971 8005670797 8005668836 Bacteria 6953162
972 8005684519 8005682033 Bacteria 6726518
973 8005691066 8005688590 Bacteria 6610080
974 8005698735 8005695170 Bacteria 6912330
975 8018131377 8018127388 Bacteria 7351159
976 8018169466 8018163183 Bacteria 7277977
977 8018182553 8018176218 Bacteria 6896178
978 8023686904 8023680758 Bacteria 7729763
979 8024481149 8024479707 Bacteria 6954785
980 8024489711 8024486573 Bacteria 6540512
981 8024503209 8024501048 Bacteria 6427847
982 8046767725 8046767195 Bacteria 7547379
983 8049293975 8049293176 Bacteria 6128433
984 8055434240 8055431914 Bacteria 4551896
985 8056380774 8056375014 Bacteria 7006639
986 8056384703 8056382006 Bacteria 6408074
987 8056876535 8056875544 Bacteria 4355797
988 8057582149 8057575449 Bacteria 7367519
989 8057879912 8057874678 Bacteria 7494653
990 RicEn_C8180
991 JGI25155J39150_1000032
992 JGI25156J39149_1000129
993 JGI25162J39368_1000663
994 JGI25154J39366_1000393
995 JGI25158J39367_1004696
996 JGI25157J39369_1000061
997 JGI25152J39213_1000780
998 JGI25152J39213_1001828
999 JGI25152J39213_1005400
1000 JGI25152J39213_1006674
1001 JGI25150J39212_1000033
1002 JGI25150J39212_1005579
1003 JGI25150J39212_1007494
1004 JGI25159J45721_1000002
1005 JGI25159J45721_1000539
1006 JGI25151J46595_10000108
1007 JGI25151J46595_10000591
1008 JGI25151J46595_10001664
1009 JGI25151J46595_10004059
1010 JGI25151J46595_10026643
1011 JGI25165J46597_1000887
1012 JGI25165J46597_1001344
1013 JGI25165J46597_1009603
1014 JGI25153J46596_10000780
1015 JGI25153J46596_10025870
1016 JGI25153J46596_10026083
1017 JGI25153J46596_10047530
1018 rootL2_10016212
1019 rootL2_10087531
1020 JGI25160J50197_1000008
1021 JGI25160J50197_1000015
1022 JGI25160J50197_1000191
1023 JGI25160J50197_1011039
1024 JGI25161J50226_1000005
1025 JGI25161J50226_1000051
1026 JGI25161J50226_1000645
1027 JGI25161J50226_1002162
1028 Ga0055539_1002106
1029 Ga0055526_1006943
1030 Ga0055526_1007111
1031 Ga0055526_1030599
1032 Ga0055526_1046772
1033 Ga0055526_1048253
1034 Ga0055524_1001028
1035 Ga0055524_1038465
1036 Ga0055528_1000201
1037 Ga0055528_1005168
1038 Ga0055528_1006194
1039 Ga0055528_1014920
1040 Ga0055528_1016650
1041 Ga0055528_1029202
1042 Ga0055530_10006713
1043 Ga0055540_1000220
1044 Ga0055540_1003015
1045 Ga0055540_1008253
1046 Ga0055540_1010689
1047 Ga0055531_10002199
1048 Ga0055531_10011531
1049 Ga0055531_10025012
1050 Ga0055543_1000012
1051 Ga0055543_1000040
1052 Ga0055543_1000258
1053 Ga0055543_1001853
1054 Ga0065165_1000015
1055 Ga0065165_1000125
1056 Ga0065165_1007789
1057 Ga0065165_1007971
1058 Ga0065165_1014790
1059 Ga0070668_100049726
1060 Ga0070669_100154288
1061 Ga0070671_100048227
1062 Ga0070667_100137138
1063 Ga0070667_100411523
1064 Ga0070662_100143598
1065 Ga0070665_100020587
1066 Ga0070665_100436866
1067 Ga0068855_100270219
1068 Ga0068856_100188527
1069 Ga0075365_10000858
1070 Ga0075365_10001303
1071 Ga0075365_10002765
1072 Ga0075364_10002314
1073 Ga0075364_10080742
1074 Ga0075362_10001499
1075 Ga0075367_10002234
1076 Ga0075367_10026454
1077 Ga0075367_10094480
1078 Ga0075369_10000760
1079 Ga0075369_10107671
1080 Ga0075370_10011081
1081 Ga0075370_10052058
1082 Ga0075370_10145295
1083 Ga0079104_1000032
1084 Ga0079104_1003297
1085 Ga0079104_1006476
1086 Ga0105250_10054287
1087 Ga0105240_10000032
1088 Ga0105248_10545507
1089 Ga0105237_10002365
1090 Ga0105237_10941201
1091 Ga0123341_1008630
1092 Ga0123341_1056455
1093 Ga0123342_1042580
1094 Ga0123342_1064466
1095 Ga0105239_10012679
1096 Ga0157373_10155408
1097 Ga0157371_10010008
1098 Ga0157371_10170756
1099 Ga0157370_10006055
1100 Ga0171463_1001
1101 Ga0182007_10000460
1102 Ga0182005_1001195
1103 Ga0183363_1174
1104 Ga0214544_1000017
1105 Ga0214542_1000006
1106 Ga0214542_1023682
1107 Ga0214543_1000003
1108 Ga0214543_1000014
1109 Ga0228711_1000001
1110 Ga0228710_1009445
1111 Ga0209435_100042
1112 Ga0209436_102619
1113 Ga0209436_111258
1114 Ga0209563_109026
1115 Ga0209437_100033
1116 Ga0209437_100075
1117 Ga0207425_1000031
1118 Ga0207425_1002025
1119 Ga0207425_1005375
1120 Ga0207425_1019359
1121 Ga0209646_1000145
1122 Ga0209026_1000160
1123 Ga0209677_101318
1124 Ga0209148_1006231
1125 Ga0209759_1000177
1126 Ga0209129_1000053
1127 Ga0209129_1000137
1128 Ga0209129_1001658
1129 Ga0209129_1003401
1130 Ga0209129_1003754
1131 Ga0209129_1004220
1132 Ga0209233_1000056
1133 Ga0209233_1000064
1134 Ga0209233_1000209
1135 Ga0209455_1022909
1136 Ga0209673_1000041
1137 Ga0209673_1000319
1138 Ga0209673_1000603
1139 Ga0209673_1001904
1140 Ga0209673_1002052
1141 Ga0209673_1005246
1142 Ga0209673_1009732
1143 Ga0209673_1023011
1144 Ga0209673_1032712
1145 Ga0209673_1047185
1146 Ga0209130_1000006
1147 Ga0209130_1000007
1148 Ga0209130_1000018
1149 Ga0209130_1017462
1150 Ga0209676_1003604
1151 Ga0209676_1005303
1152 Ga0209676_1044856
1153 Ga0209025_1000087
1154 Ga0209025_1000165
1155 Ga0209025_1000199
1156 Ga0209025_1000580
1157 Ga0209025_1001754
1158 Ga0209025_1008148
1159 Ga0209025_1014633
1160 Ga0209025_1080515
1161 Ga0209025_1082706
1162 Ga0209564_1000330
1163 Ga0209564_1000425
1164 Ga0209564_1000431
1165 Ga0209564_1001106
1166 Ga0209564_1010463
1167 Ga0209564_1010632
1168 Ga0209564_1046144
1169 Ga0209758_1000081
1170 Ga0209758_1000333
1171 Ga0209758_1000890
1172 Ga0209758_1002059
1173 Ga0209758_1002402
1174 Ga0209758_1002927
1175 Ga0209758_1007332
1176 Ga0209758_1008991
1177 Ga0209758_1027802
1178 Ga0209050_1008722
1179 Ga0209050_1011419
1180 Ga0209256_1000877
1181 Ga0209256_1001695
1182 Ga0209256_1002866
1183 Ga0209256_1008034
1184 Ga0209256_1009074
1185 Ga0209256_1011652
1186 Ga0209256_1026291
1187 Ga0209256_1028526
1188 Ga0209256_1029895
1189 Ga0207426_1000044
1190 Ga0207426_1000064
1191 Ga0207426_1000106
1192 Ga0207426_1000119
1193 Ga0207426_1007834
1194 Ga0209051_1000198
1195 Ga0209051_1001443
1196 Ga0209051_1001611
1197 Ga0209051_1002094
1198 Ga0209051_1002200
1199 Ga0209051_1012227
1200 Ga0209051_1017935
1201 Ga0209051_1064595
1202 Ga0209257_1001713
1203 Ga0209257_1002246
1204 Ga0209257_1004254
1205 Ga0207696_1052960
1206 Ga0207695_10000024
1207 Ga0207671_10000718
1208 Ga0207681_10132609
1209 Ga0207644_10081513
1210 Ga0207711_10281284
1211 Ga0207667_10256933
1212 Ga0207668_10731214
1213 Ga0207658_10400265
1214 Ga0207658_10464945
1215 Ga0207702_10069827
1216 Ga0209281_1000053
1217 Ga0209281_1000236
1218 Ga0209281_1000266
1219 Ga0209371_1001236
1220 Ga0209282_1000007
1221 Ga0268266_10034684
1222 Ga0268266_10082429
1223 Ga0307515_10000070
1224 Ga0307515_10009393
1225 Ga0307515_10010607
1226 Ga0268256_1000846
1227 Ga0307513_10017679
1228 Ga0307513_10158861
1229 Ga0307408_100076443
1230 Ga0307408_100180951
1231 Ga0307405_10001075
1232 Ga0315914_1000027
1233 Ga0307416_100403817
1234 Ga0307414_10050768
1235 Ga0307414_10271099
1236 Ga0315913_1007081
1237 Ga0315915_1000001
1238 Ga0395898_0001330
1239 Ga0395898_0231514
1240 Ga0439436_0023455
1241 Ga0439465_0011488
1242 Ga0439465_0029101
1243 Ga0451789_1302009
1244 Ga0451804_0002771
1245 Ga0451837_0064596
1246 Ga0451851_0918442
1247 Ga0439431_0019365
1248 Ga0439449_0006294
1249 Ga0439462_0080216
1250 Ga0450920_032091
1251 Ga0450918_010688
1252 Ga0466965_0252102
1253 Ga0466966_0178973
1254 Ga0466971_0125591
1255 Ga0466970_0024461
1256 Ga0466957_0155377
1257 Ga0495592_0144181
1258 Ga0495638_0003817
1259 Ga0495638_0125108
1260 Ga0495605_0012582
1261 Ga0495605_0023575
1262 Ga0495662_0081522
1263 Ga0495585_0011550
1264 Ga0495585_0034909
1265 Ga0495585_0117381
1266 Ga0495585_0199681
1267 Ga0495596_0077456
1268 Ga0495596_0090392
1269 Ga0495607_0145948
1270 Ga0495583_0004596
1271 Ga0495583_0072744
1272 Ga0495583_0090837
1273 Ga0495583_0168006
1274 Ga0495606_0007105
1275 Ga0495606_0057661
1276 Ga0495606_0064261
1277 Ga0495606_0240582
1278 Ga0495610_0006488
1279 Ga0495610_0052755
1280 Ga0495616_0051421
1281 Ga0495616_0156439
1282 Ga0495620_0027499
1283 Ga0495620_0123860
1284 Ga0495631_0003953
1285 Ga0495632_0047588
1286 Ga0495632_0054258
1287 Ga0495632_0097236
1288 Ga0495632_0208775
1289 Ga0495643_0007584
1290 Ga0495643_0144093
1291 Ga0495643_0182879
1292 Ga0495648_0113621
1293 Ga0495648_0156448
1294 Ga0495654_0000092
1295 Ga0495640_0229714
1296 Ga0495597_0020363
1297 Ga0495622_0023797
1298 Ga0495633_0030286
1299 Ga0495668_0004226
1300 Ga0495611_0005820
1301 Ga0495625_0000883
1302 Ga0495625_0059900
1303 Ga0495625_0089923
1304 Ga0495625_0094275
1305 Ga0495588_0007417
1306 Ga0495657_0072547
1307 Ga0495658_0031269
1308 Ga0495670_0027972
1309 Ga0495670_0034596
1310 Ga0495671_0070913
1311 Ga0495649_0146708
1312 Ga0495660_0054059
1313 Ga0495604_0091348
1314 Ga0495676_0259054
1315 Ga0495683_0114332
1316 Ga0495687_075633
1317 Ga0495687_105200
1318 Ga0495686_0001036
1319 Ga0495686_0051972
1320 Ga0495686_0057032
1321 Ga0495686_0064874
1322 Ga0495686_0124044
1323 Ga0495686_0167874
1324 Ga0495602_0301252
1325 Ga0496100_0133374
1326 Ga0496101_0240218
1327 Ga0496101_0281805
1328 Ga0496102_0054748
1329 Ga0496102_0333112
1330 Ga0496104_0334753
1331 Ga0496105_0253413
1332 Ga0496106_0002977
1333 Ga0496106_0252502
1334 Ga0496110_0188438
1335 Ga0496110_0270374
1336 Ga0496111_0002706
1337 Ga0496111_0071455
1338 Ga0496114_0218178
1339 Ga0496114_0286362
1340 Ga0496116_0000026
1341 Ga0496116_0010291
1342 Ga0496116_0041340
1343 Ga0496116_0045458
1344 Ga0496116_0064541
1345 Ga0496116_0151311
1346 Ga0496116_0177001
1347 Ga0496117_0001867
1348 Ga0496117_0026098
1349 Ga0496117_0027157
1350 Ga0496117_0064728
1351 Ga0496117_0118530
1352 Ga0496117_0317604
1353 Ga0496118_0012870
1354 Ga0496118_0075238
1355 Ga0496118_0076515
1356 Ga0496118_0077503
1357 Ga0496118_0189393
1358 Ga0496119_0046197
1359 Ga0496119_0056778
1360 Ga0496119_0253603
1361 Ga0496120_0058615
1362 Ga0496120_0088341
1363 Ga0496120_0090609
1364 Ga0496120_0094175
1365 Ga0496120_0181335
1366 Ga0496120_0201343
1367 Ga0496121_0000001
1368 Ga0496121_0003347
1369 Ga0496121_0005117
1370 Ga0496121_0012537
1371 Ga0496121_0048389
1372 Ga0496121_0171180
1373 Ga0496121_0221843
1374 Ga0496121_0292677
1375 Ga0496121_0366396
1376 Ga0496122_0000160
1377 Ga0496122_0000604
1378 Ga0496122_0011685
1379 Ga0496122_0012377
1380 Ga0496122_0021819
1381 Ga0496122_0052823
1382 Ga0496122_0066147
1383 Ga0496122_0074595
1384 Ga0496122_0076327
1385 Ga0496122_0077456
1386 Ga0496122_0116511
1387 Ga0496123_0000034
1388 Ga0496123_0000103
1389 Ga0496123_0003820
1390 Ga0496123_0008044
1391 Ga0496123_0009653
1392 Ga0496123_0035193
1393 Ga0496123_0037959
1394 Ga0496123_0154418
1395 Ga0496124_0005176
1396 Ga0496124_0026701
1397 Ga0496124_0051147
1398 Ga0496124_0051672
1399 Ga0496124_0054451
1400 Ga0496124_0089653
1401 Ga0496124_0118710
1402 Ga0496124_0134272
1403 Ga0496124_0222439
1404 Ga0496124_0223040
1405 Ga0496124_0250781
1406 Ga0496124_0385537
1407 Ga0496124_0385834
1408 Ga0496124_0416599
1409 Ga0496124_0452872
1410 Ga0496125_0000001
1411 Ga0496125_0004365
1412 Ga0496125_0006606
1413 Ga0496125_0009397
1414 Ga0496125_0060415
1415 Ga0496125_0083000
1416 Ga0496126_0000069
1417 Ga0496126_0001336
1418 Ga0496126_0006321
1419 Ga0496126_0120569
1420 Ga0496126_0134875
1421 Ga0495678_013296
1422 Ga0495678_032777
1423 Ga0495682_0053778
1424 Ga0501032_0083184
1425 Ga0501033_0001329
1426 Ga0501033_0295749
1427 Ga0501038_0071732
1428 Ga0501043_0188819
1429 Ga0501083_0028579
1430 Ga0501035_0056360
1431 Ga0501035_0234835
1432 nmdc:mga03683_32817_c1
1433 nmdc:mga00v17_115_c2
1434 nmdc:mga00v17_213458_c1
1435 nmdc:mga0yw44_13140_c1
1436 nmdc:mga0yw44_1335_c1
1437 nmdc:mga07m45_68151_c1
1438 Ga0495601_0363105
1439 Ga0495619_0115713
1440 Ga0500578_0147691
1441 Ga0500643_035618
1442 Ga0500569_004058
1443 Ga0500572_008961
1444 Ga0500594_0005380
1445 Ga0500618_000575
1446 Ga0500618_000896
1447 Ga0500618_022804
1448 Ga0500618_030371
1449 Ga0500658_0006339
1450 Ga0500658_0017189
1451 Ga0500659_0051243
1452 Ga0500568_0002529
1453 Ga0500568_0008441
1454 Ga0500590_001191
1455 Ga0500616_0001190
1456 Ga0500616_0001711
1457 Ga0500622_0016729
1458 Ga0500627_0066768
1459 Ga0500627_0179684
1460 Ga0500633_0011594
1461 Ga0500636_0002064
1462 Ga0500636_0264859
1463 Ga0501082_0311353
1464 Ga0501082_0321361
1465 2819684062
1466 2509108572
1467 2509374401
1468 2509387669
1469 2509443027
1470 2510132345
1471 2510305107
1472 2510898682
1473 2511137078
1474 2511172939
1475 2511186410
1476 2511197149
1477 2511501073
1478 2512532481
1479 2512972182
1480 2513569184
1481 2513578857
1482 2513582848
1483 2513596296
1484 2513603261
1485 2513616237
1486 2513632711
1487 2513709163
1488 2513871247
1489 2513881040
1490 2513902276
1491 2513908888
1492 2513925749
1493 2513983867
1494 2514001934
1495 2514004716
1496 2514020705
1497 2515111329
1498 2515608183
1499 2515638472
1500 2515644358
1501 2515659146
1502 2515740516
1503 2516208934
1504 2516892354
1505 2517039970
1506 2517075522
1507 2517094103
1508 2517405922
1509 2517569152
1510 2520378725
1511 2524451078
1512 2524460598
1513 2530643841
1514 2535515766
1515 2551680462
1516 2551683849
1517 2551695757
1518 2551698111
1519 2551713128
1520 2551721357
1521 2551745191
1522 2558863428
1523 2585165617
1524 2585203129
1525 2585221041
1526 2585231444
1527 2585256563
1528 2585266109
1529 2585273212
1530 2585278955
1531 2585325430
1532 2585329592
1533 2585387110
1534 2585392770
1535 2585400074
1536 2585528019
1537 2585530751
1538 2585541379
1539 2585549243
1540 2585554932
1541 2585559488
1542 2585822633
1543 2585839489
1544 2585847164
1545 2585902159
1546 2585905136
1547 2585995167
1548 2585999714
1549 2587979749
1550 2599333702
1551 2599418546
1552 2599722063
1553 2600191991
1554 2600375318
1555 2616296168
1556 2616305772
1557 2616553988
1558 2617384178
1559 2643807143
1560 2643809957
1561 2643857871
1562 2644007973
1563 2644046506
1564 2644069591
1565 2644108934
1566 2644151456
1567 2644196562
1568 2644200859
1569 2644206144
1570 2644239053
1571 2644311590
1572 2644329848
1573 2644380525
1574 2644420745
1575 2644454270
1576 2644479296
1577 2644493346
1578 2644502343
1579 2644546522
1580 2644617389
1581 2644649791
1582 2644675591
1583 2644689607
1584 2657683210
1585 2671115258
1586 2692316770
1587 2719180337
1588 2719384914
1589 2719664659
1590 2719731086
1591 2720491079
1592 2720612448
1593 2720619287
1594 2720630687
1595 2720774380
1596 2721146431
1597 2721157952
1598 2721163310
1599 2721398634
1600 2722839480
1601 2723026108
1602 2723559652
1603 2723566268
1604 2724037447
1605 2724043842
1606 2724088987
1607 2724103533
1608 2724109372
1609 2725946771
1610 2730107044
1611 2730163574
1612 2730297584
1613 2738802212
1614 2738946498
1615 2739035949
1616 2753460862
1617 2766067558
1618 2778177534
1619 2792584217
1620 2792622629
1621 2792628450
1622 2792638291
1623 2793296244
1624 2793317570
1625 2793321054
1626 2793327086
1627 2793333661
1628 2793339745
1629 2793347978
1630 2793357413
1631 2793358964
1632 2793367894
1633 2802717796
1634 2802723275
1635 2802733138
1636 2802736280
1637 2802743510
1638 2802750777
1639 2804751402
1640 2805926535
1641 2805933334
1642 2806046872
1643 2806052455
1644 2806058774
1645 2806067458
1646 2806074037
1647 2819611548
1648 2819639201
1649 2821124332
1650 2838017331
1651 2838023100
1652 2838031476
1653 2838037757
1654 2838048871
1655 2838049187
1656 2838063367
1657 2838074200
1658 2838076497
1659 2838662770
1660 2838670890
1661 2838681386
1662 2838688563
1663 2838694579
1664 2838703261
1665 2838707957
1666 2838730858
1667 2838741173
1668 2838744248
1669 2841844930
1670 2841856929
1671 2841865427
1672 2842080812
1673 2842115021
1674 2842121431
1675 2842144652
1676 2842147515
1677 2842160099
1678 2842168342
1679 2842183284
1680 2842197992
1681 2842199528
1682 2842207654
1683 2842221246
1684 2842235115
1685 2842237368
1686 2842245712
1687 2842252581
1688 2842259638
1689 2842266879
1690 2842274477
1691 2842281551
1692 2842287075
1693 2842294468
1694 2842302402
1695 2842306720
1696 2842314788
1697 2842318609
1698 2842343549
1699 2842360865
1700 2842365294
1701 2842371849
1702 2842380866
1703 2842387937
1704 2842398212
1705 2842404343
1706 2842410972
1707 2842417572
1708 2842427405
1709 2842431010
1710 2842436992
1711 2842443070
1712 2842453292
1713 2842465081
1714 2842471693
1715 2842477929
1716 2842482897
1717 2842493800
1718 2842497244
1719 2842504738
1720 2842509773
1721 2842526293
1722 2842924860
1723 2844168457
1724 2844455079
1725 2847418164
1726 2850080533
1727 2854897231
1728 2854922139
1729 2855831426
1730 2855840550
1731 2855878882
1732 2857520247
1733 2857531912
1734 2858801078
1735 2891376458
1736 2896386697
1737 2913297391
1738 2913310913
1739 2915986276
1740 2915988311
1741 2915996157
1742 2916001172
1743 2916014003
1744 2916020246
1745 2916025155
1746 2916032640
1747 2916040280
1748 2916044480
1749 2916049612
1750 2916055256
1751 2916062221
1752 2916070924
1753 2916076780
1754 2919103875
1755 2919168435
1756 2919171368
1757 2919409359
1758 2920762819
1759 2920823901
1760 2921204369
1761 2921210053
1762 2921240042
1763 2921246198
1764 2921251057
1765 2921257888
1766 2921264133
1767 2921286251
1768 2921294828
1769 2921299629
1770 2923557521
1771 2924146583
1772 2924151200
1773 2924160677
1774 2924171715
1775 2924177522
1776 2924185888
1777 2924188722
1778 2924198166
1779 2924203024
1780 2924212630
1781 2924220462
1782 2924226764
1783 2924230293
1784 2929139568
1785 2933019567
1786 2933573166
1787 2933591420
1788 2933604654
1789 2935895101
1790 2935904085
1791 2936368077
1792 2936381529
1793 2936384900
1794 2937000999
1795 2937004319
1796 2937011072
1797 2937019404
1798 2937028504
1799 2937029763
1800 2937036789
1801 2937048315
1802 2937056086
1803 2937059175
1804 2937067837
1805 2937073940
1806 2937082869
1807 2937090527
1808 2937095693
1809 2937104114
1810 2937110731
1811 2937113970
1812 2937125467
1813 2937129035
1814 2941500157
1815 2957379922
1816 2957382750
1817 2957389028
1818 2957398332
1819 2957407537
1820 2957411611
1821 2957418880
1822 2957429863
1823 2957432542
1824 2957438990
1825 2957446524
1826 2957456584
1827 2957463342
1828 2957466628
1829 2957473176
1830 2957479916
1831 2957486105
1832 2957496258
1833 2957503557
1834 2957509251
1835 2960588730
1836 2960595676
1837 2960601603
1838 2960608559
1839 2960611906
1840 2960617805
1841 2960630673
1842 2960633122
1843 2960643193
1844 2960645789
1845 2960658007
1846 2960666508
1847 2960668695
1848 2960675888
1849 2960684265
1850 2960689072
1851 2960696793
1852 2964609489
1853 2964616024
1854 2964625076
1855 2964635380
1856 2964642536
1857 2964646922
1858 2964656339
1859 2964659731
1860 2964665579
1861 2964672025
1862 2964679414
1863 2964688252
1864 2964692142
1865 2964703521
1866 2964708593
1867 2964718659
1868 2964722297
1869 2967668676
1870 2967677142
1871 2967681625
1872 2967687137
1873 2967693349
1874 2967702568
1875 2967707815
1876 2967716425
1877 2967723325
1878 2967734631
1879 2967735547
1880 2967745775
1881 2967754502
1882 2967756998
1883 2967763900
1884 2967771676
1885 2967776698
1886 2970020542
1887 2970032652
1888 2970035729
1889 2970045418
1890 2970050478
1891 2970057923
1892 2970067789
1893 2970072003
1894 2970081398
1895 2970088307
1896 2970091610
1897 2970100958
1898 2970105072
1899 2970114590
1900 2970117823
1901 2970124355
1902 2970129621
1903 2970136503
1904 2970144476
1905 2970155830
1906 2970162891
1907 2970166852
1908 2970176029
1909 2970178477
1910 2970187389
1911 2970194277
1912 2977517872
1913 2977529807
1914 2977536956
1915 2977538091
1916 2977545990
1917 2977552091
1918 2977562813
1919 2977566316
1920 2977576536
1921 2977581196
1922 2978971104
1923 2984588266
1924 2989354104
1925 2989772118
1926 2996888733
1927 2996895130
1928 3005412492
1929 3005417188
1930 3005446802
1931 3005453497
1932 639647475
1933 643825140
1934 648736468
1935 8003993050
1936 8004000286
1937 8005260005
1938 8005279634
1939 8005284733
1940 8005292835
1941 8005304641
1942 8005311139
1943 8005315249
1944 8005323260
1945 8005376564
1946 8005385953
1947 8005400264
1948 8005437124
1949 8005461973
1950 8005485580
1951 8005499381
1952 8005544400
1953 8005558884
1954 8005570479
1955 8005572736
1956 8005620571
1957 8005627466
1958 8005649896
1959 8005659927
1960 8005670797
1961 8005684519
1962 8005691066
1963 8005698735
1964 8018131377
1965 8018169466
1966 8018182553
1967 8023686904
1968 8024481149
1969 8024489711
1970 8024503209
1971 8046767725
1972 8049293975
1973 8055434240
1974 8056380774
1975 8056384703
1976 8056876535
1977 8057582149
1978 8057879912

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bv3-assembly1.cif.gz_E bacillus subtilis dnaa domain iii structure 0.8614 27 228
2z4r-assembly2.cif.gz_B crystal structure of domain iii from the thermotoga maritima replication initiation protein dnaa 0.8179 27 230
3r8f-assembly1.cif.gz_D replication initiator dnaa bound to amppcp and single-stranded dna 0.8155 30 208
2hcb-assembly1.cif.gz_C structure of amppcp-bound dnaa from aquifex aeolicus 0.8084 30 208
1l8q-assembly1.cif.gz_A crystal structure of dna replication initiation factor 0.7993 30 215
ID Description Score Start End Superfamily
af_Q9U9Q1_188_246_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.88 162 210 1.10.8.60
af_Q58817_1690_1755_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8709 161 228 1.10.8.60
1in4A03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8647 162 231 1.10.8.60
af_A0A1D6E842_267_330_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8551 161 227 1.10.8.60
af_F4KEM0_516_577_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8537 166 227 1.10.8.60
ID Description Score Start End GO Terms
AF-A0A526V786-F1-model_v4 Hda lid domain-containing protein 0.9417 23 236 GO:0003688
GO:0005886
GO:0006270
AF-A0A149V159-F1-model_v4 Chromosomal replication initiator protein DnaA 0.9303 98 237
AF-A0A257PBK4-F1-model_v4 Hda lid domain-containing protein 0.9296 96 231
AF-A0A527YR21-F1-model_v4 Chromosomal replication initiator protein DnaA domain-containing protein 0.9264 52 158
AF-A0A526V786-F1-model_v4 Hda lid domain-containing protein 0.9251 23 236 GO:0003688
GO:0005886
GO:0006270

Map