F487597
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 989 | 725 | 1978 | 232 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2818991461|2819684062 |
| Length | 255 |
| Sequence | RCSGSMLPTAKIRKAEVRKKTPMTETDERRKTEQLPLQFTHDAARGRDDLLVSERLAAAVSIVDEWPAWPSPVVILAGPVGSGKSHLAHIWQERAAARDIHPLAGSEAAVIAASGPVLFEDADRRGFDETELFHVINSVRENGHSLLMTSRLWPASWSVTLPDLKSRLKAATVVEIGEPDEELLAQVIVKLFSDRQLYIDDKLVAYIVARMERSLGAAQAIVDRLDRLALSRGTKINRVLAAEVLSDFGNAGTGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 46 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 52 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 55 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 56 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 57 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 58 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 59 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 60 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 95 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 107 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 108 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 109 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 110 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 111 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 112 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 113 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 114 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 115 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 116 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 117 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 118 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 119 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 120 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 121 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 122 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 123 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 124 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 165 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 169 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 172 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 173 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 174 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 175 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 176 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 177 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 178 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 179 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 180 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 181 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 182 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 191 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 193 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 194 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 197 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 198 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 199 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 200 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 201 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 202 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 203 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 204 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 205 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 206 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 207 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 208 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 210 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 211 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 213 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 214 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 215 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 216 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 217 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 218 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 219 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 220 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 221 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 222 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 223 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 224 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 225 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 226 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 227 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 228 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 229 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 230 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 231 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 232 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 233 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 234 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 235 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 236 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 237 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 238 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 239 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 240 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 241 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 242 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 243 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 244 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 245 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 246 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 247 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 248 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 249 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 250 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 251 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 252 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 253 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 254 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 255 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 256 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 257 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 258 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 259 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 260 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 261 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 262 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 263 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 264 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 265 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 266 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 267 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 268 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 269 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 270 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 271 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 272 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 273 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 274 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 275 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 276 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 277 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 278 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 279 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 280 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 281 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 282 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 283 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 284 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 285 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 286 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 287 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 288 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 289 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 290 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 291 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 292 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 293 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 294 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 295 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 296 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 297 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 298 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 299 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 300 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 301 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 302 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 303 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 304 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 305 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 306 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 307 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 308 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 309 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 310 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 311 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 312 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 313 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 314 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 315 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 316 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 317 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 318 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 319 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 320 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 321 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 322 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 323 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 324 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 325 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 326 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 327 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 328 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 329 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 330 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 331 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 332 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 333 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 334 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 335 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 336 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 337 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 338 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 339 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 340 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 341 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 342 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 343 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 344 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 345 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 346 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 347 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 348 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 349 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 350 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 351 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 352 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 353 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 354 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 355 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 356 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 357 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 358 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 359 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 360 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 361 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 362 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 363 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 364 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 365 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 366 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 367 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 368 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 369 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 370 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 371 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 372 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 373 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 374 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 375 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 376 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 377 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 378 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 379 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 380 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 381 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 382 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 383 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 384 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 385 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 386 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 387 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 388 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 389 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 390 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 391 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 392 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 393 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 394 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 395 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 396 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 397 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 398 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 399 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 400 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 401 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 402 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 403 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 404 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 405 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 406 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 407 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 408 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 409 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 410 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 411 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 412 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 413 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 414 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 415 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 416 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 417 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 418 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 419 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 420 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 421 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 422 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 423 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 424 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 425 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 426 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 427 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 428 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 429 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 430 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 431 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 432 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 433 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 434 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 435 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 436 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 437 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 438 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 439 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 440 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 441 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 442 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 443 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 444 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 445 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 446 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 447 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 448 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 449 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 450 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 451 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 452 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 453 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 454 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 455 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 456 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 457 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 458 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 459 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 460 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 461 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 462 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 463 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 464 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 465 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 466 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 467 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 468 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 469 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 470 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 471 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 472 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 473 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 474 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 475 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 476 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 477 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 478 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 479 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 480 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 481 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 482 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 483 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 484 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 485 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 486 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 487 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 488 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 489 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 490 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 491 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 492 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 493 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 494 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 495 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 496 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 497 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 498 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 499 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 500 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 501 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 502 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 503 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 504 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 505 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 506 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 507 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 508 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 509 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 510 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 511 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 512 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 513 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 514 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 515 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 516 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 517 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 518 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 519 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 520 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 521 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 522 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 523 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 524 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 525 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 526 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 527 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 528 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 529 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 530 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 531 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 532 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 533 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 534 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 535 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 536 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 537 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 538 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 539 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 540 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 541 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 542 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 543 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 544 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 545 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 546 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 547 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 548 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 549 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 550 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 551 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 552 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 553 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 554 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 555 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 556 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 557 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 558 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 559 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 560 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 561 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 562 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 563 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 564 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 565 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 566 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 567 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 568 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 569 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 570 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 571 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 572 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 573 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 574 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 575 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 576 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 577 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 578 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 579 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 580 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 581 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 582 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 583 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 584 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 585 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 586 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 587 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 588 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 589 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 590 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 591 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 592 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 593 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 594 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 595 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 596 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 597 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 598 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 599 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 600 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 601 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 602 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 603 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 604 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 605 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 606 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 607 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 608 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 609 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 610 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 611 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 612 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 613 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 614 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 615 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 616 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 617 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 618 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 619 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 620 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 621 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 622 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 623 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 624 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 625 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 626 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 627 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 628 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 629 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 630 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 631 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 632 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 633 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 634 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 635 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 636 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 637 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 638 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 639 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 640 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 641 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 642 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 643 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 644 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 645 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 646 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 647 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 648 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 649 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 650 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 651 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 652 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 653 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 654 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 655 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 656 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 657 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 658 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 659 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 660 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 661 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 662 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 663 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 664 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 665 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 666 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 667 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 668 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 669 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 670 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 671 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 672 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 673 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 674 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 675 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 676 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 677 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 678 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 679 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 680 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 681 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 682 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 683 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 684 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 685 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 686 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 687 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 688 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 689 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 690 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 691 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 692 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 693 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 694 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 695 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 696 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 697 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 698 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 699 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 700 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 701 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 702 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 703 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 704 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 705 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 706 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 707 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 708 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 709 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 710 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 711 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 712 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 713 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 714 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 715 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 716 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 717 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 718 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 719 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 720 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 721 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 722 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 723 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 724 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 725 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 48.03 |
| Metatranscriptomes | 0 |
| Isolates | 51.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 19.82 |
| Nodule | 42.26 |
| Rhizoplane | 2.22 |
| Rhizosphere | 18.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C8180 | 2010549000 | Bacteria | 1863 |
| 2 | JGI25155J39150_1000032 | 3300002704 | Bacteria | 105511 |
| 3 | JGI25156J39149_1000129 | 3300002705 | Bacteria | 54812 |
| 4 | JGI25162J39368_1000663 | 3300002737 | Bacteria | 24312 |
| 5 | JGI25154J39366_1000393 | 3300002738 | Bacteria | 23858 |
| 6 | JGI25158J39367_1004696 | 3300002739 | Bacteria | 2040 |
| 7 | JGI25157J39369_1000061 | 3300002741 | Bacteria | 105511 |
| 8 | JGI25152J39213_1000780 | 3300002773 | Bacteria | 16053 |
| 9 | JGI25152J39213_1001828 | 3300002773 | Bacteria | 8589 |
| 10 | JGI25152J39213_1005400 | 3300002773 | Bacteria | 3737 |
| 11 | JGI25152J39213_1006674 | 3300002773 | Bacteria | 3088 |
| 12 | JGI25150J39212_1000033 | 3300002774 | Bacteria | 96269 |
| 13 | JGI25150J39212_1005579 | 3300002774 | Bacteria | 2673 |
| 14 | JGI25150J39212_1007494 | 3300002774 | Bacteria | 2187 |
| 15 | JGI25159J45721_1000002 | 3300002987 | Bacteria | 289163 |
| 16 | JGI25159J45721_1000539 | 3300002987 | Bacteria | 17199 |
| 17 | JGI25151J46595_10000108 | 3300003187 | Bacteria | 112874 |
| 18 | JGI25151J46595_10000591 | 3300003187 | Bacteria | 32186 |
| 19 | JGI25151J46595_10001664 | 3300003187 | Bacteria | 14579 |
| 20 | JGI25151J46595_10004059 | 3300003187 | Bacteria | 7850 |
| 21 | JGI25151J46595_10026643 | 3300003187 | Bacteria | 2329 |
| 22 | JGI25165J46597_1000887 | 3300003214 | Bacteria | 21063 |
| 23 | JGI25165J46597_1001344 | 3300003214 | Bacteria | 13749 |
| 24 | JGI25165J46597_1009603 | 3300003214 | Bacteria | 1448 |
| 25 | JGI25153J46596_10000780 | 3300003215 | Bacteria | 19521 |
| 26 | JGI25153J46596_10025870 | 3300003215 | Bacteria | 2088 |
| 27 | JGI25153J46596_10026083 | 3300003215 | Bacteria | 2076 |
| 28 | JGI25153J46596_10047530 | 3300003215 | Bacteria | 1262 |
| 29 | rootL2_10016212 | 3300003322 | Bacteria | 1524 |
| 30 | rootL2_10087531 | 3300003322 | Bacteria | 3733 |
| 31 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 32 | JGI25160J50197_1000015 | 3300003354 | Bacteria | 250902 |
| 33 | JGI25160J50197_1000191 | 3300003354 | Bacteria | 51959 |
| 34 | JGI25160J50197_1011039 | 3300003354 | Bacteria | 3228 |
| 35 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 36 | JGI25161J50226_1000051 | 3300003374 | Bacteria | 110051 |
| 37 | JGI25161J50226_1000645 | 3300003374 | Bacteria | 14023 |
| 38 | JGI25161J50226_1002162 | 3300003374 | Bacteria | 5251 |
| 39 | Ga0055539_1002106 | 3300003752 | Bacteria | 3232 |
| 40 | Ga0055526_1006943 | 3300003771 | Bacteria | 6017 |
| 41 | Ga0055526_1007111 | 3300003771 | Bacteria | 5904 |
| 42 | Ga0055526_1030599 | 3300003771 | Bacteria | 1566 |
| 43 | Ga0055526_1046772 | 3300003771 | Bacteria | 1022 |
| 44 | Ga0055526_1048253 | 3300003771 | Bacteria | 992 |
| 45 | Ga0055524_1001028 | 3300003775 | Bacteria | 17224 |
| 46 | Ga0055524_1038465 | 3300003775 | Bacteria | 1251 |
| 47 | Ga0055528_1000201 | 3300003790 | Bacteria | 50283 |
| 48 | Ga0055528_1005168 | 3300003790 | Bacteria | 6135 |
| 49 | Ga0055528_1006194 | 3300003790 | Bacteria | 5450 |
| 50 | Ga0055528_1014920 | 3300003790 | Bacteria | 2838 |
| 51 | Ga0055528_1016650 | 3300003790 | Bacteria | 2588 |
| 52 | Ga0055528_1029202 | 3300003790 | Bacteria | 1499 |
| 53 | Ga0055530_10006713 | 3300003791 | Bacteria | 5046 |
| 54 | Ga0055540_1000220 | 3300003792 | Bacteria | 53660 |
| 55 | Ga0055540_1003015 | 3300003792 | Bacteria | 8420 |
| 56 | Ga0055540_1008253 | 3300003792 | Bacteria | 3777 |
| 57 | Ga0055540_1010689 | 3300003792 | Bacteria | 3033 |
| 58 | Ga0055531_10002199 | 3300003794 | Bacteria | 13276 |
| 59 | Ga0055531_10011531 | 3300003794 | Bacteria | 4248 |
| 60 | Ga0055531_10025012 | 3300003794 | Bacteria | 2183 |
| 61 | Ga0055543_1000012 | 3300004625 | Bacteria | 186581 |
| 62 | Ga0055543_1000040 | 3300004625 | Bacteria | 122485 |
| 63 | Ga0055543_1000258 | 3300004625 | Bacteria | 39859 |
| 64 | Ga0055543_1001853 | 3300004625 | Bacteria | 7713 |
| 65 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 66 | Ga0065165_1000125 | 3300005262 | Bacteria | 130283 |
| 67 | Ga0065165_1007789 | 3300005262 | Bacteria | 5168 |
| 68 | Ga0065165_1007971 | 3300005262 | Bacteria | 5070 |
| 69 | Ga0065165_1014790 | 3300005262 | Bacteria | 3012 |
| 70 | Ga0070668_100049726 | 3300005347 | Bacteria | 3226 |
| 71 | Ga0070669_100154288 | 3300005353 | Bacteria | 1780 |
| 72 | Ga0070671_100048227 | 3300005355 | Bacteria | 3542 |
| 73 | Ga0070667_100137138 | 3300005367 | Bacteria | 2140 |
| 74 | Ga0070667_100411523 | 3300005367 | Bacteria | 1232 |
| 75 | Ga0070662_100143598 | 3300005457 | Bacteria | 1852 |
| 76 | Ga0070665_100020587 | 3300005548 | Bacteria | 6628 |
| 77 | Ga0070665_100436866 | 3300005548 | Bacteria | 1318 |
| 78 | Ga0068855_100270219 | 3300005563 | Bacteria | 1891 |
| 79 | Ga0068856_100188527 | 3300005614 | Bacteria | 2076 |
| 80 | Ga0075365_10000858 | 3300006038 | Bacteria | 12642 |
| 81 | Ga0075365_10001303 | 3300006038 | Bacteria | 11124 |
| 82 | Ga0075365_10002765 | 3300006038 | Bacteria | 8765 |
| 83 | Ga0075364_10002314 | 3300006051 | Bacteria | 10683 |
| 84 | Ga0075364_10080742 | 3300006051 | Bacteria | 2150 |
| 85 | Ga0075362_10001499 | 3300006177 | Bacteria | 7503 |
| 86 | Ga0075367_10002234 | 3300006178 | Bacteria | 8746 |
| 87 | Ga0075367_10026454 | 3300006178 | Bacteria | 3291 |
| 88 | Ga0075367_10094480 | 3300006178 | Bacteria | 1823 |
| 89 | Ga0075369_10000760 | 3300006186 | Bacteria | 10508 |
| 90 | Ga0075369_10107671 | 3300006186 | Bacteria | 1255 |
| 91 | Ga0075370_10011081 | 3300006353 | Bacteria | 4729 |
| 92 | Ga0075370_10052058 | 3300006353 | Bacteria | 2322 |
| 93 | Ga0075370_10145295 | 3300006353 | Bacteria | 1388 |
| 94 | Ga0079104_1000032 | 3300006946 | Bacteria | 203094 |
| 95 | Ga0079104_1003297 | 3300006946 | Bacteria | 7679 |
| 96 | Ga0079104_1006476 | 3300006946 | Bacteria | 4423 |
| 97 | Ga0105250_10054287 | 3300009092 | Bacteria | 1607 |
| 98 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 99 | Ga0105248_10545507 | 3300009177 | Bacteria | 1308 |
| 100 | Ga0105237_10002365 | 3300009545 | Bacteria | 23399 |
| 101 | Ga0105237_10941201 | 3300009545 | Bacteria | 871 |
| 102 | Ga0123341_1008630 | 3300009765 | Bacteria | 9310 |
| 103 | Ga0123341_1056455 | 3300009765 | Bacteria | 2050 |
| 104 | Ga0123342_1042580 | 3300009766 | Bacteria | 1596 |
| 105 | Ga0123342_1064466 | 3300009766 | Bacteria | 931 |
| 106 | Ga0105239_10012679 | 3300010375 | Bacteria | 9377 |
| 107 | Ga0157373_10155408 | 3300013100 | Bacteria | 1609 |
| 108 | Ga0157371_10010008 | 3300013102 | Bacteria | 7419 |
| 109 | Ga0157371_10170756 | 3300013102 | Bacteria | 1554 |
| 110 | Ga0157370_10006055 | 3300013104 | Bacteria | 13428 |
| 111 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 112 | Ga0182007_10000460 | 3300015262 | Bacteria | 24598 |
| 113 | Ga0182005_1001195 | 3300015265 | Bacteria | 10741 |
| 114 | Ga0183363_1174 | 3300015690 | Bacteria | 14284 |
| 115 | Ga0214544_1000017 | 3300021320 | Bacteria | 193638 |
| 116 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 117 | Ga0214542_1023682 | 3300021321 | Bacteria | 3614 |
| 118 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 119 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 120 | Ga0228711_1000001 | 3300022739 | Bacteria | 357377 |
| 121 | Ga0228710_1009445 | 3300022740 | Bacteria | 13516 |
| 122 | Ga0209435_100042 | 3300025206 | Bacteria | 105563 |
| 123 | Ga0209436_102619 | 3300025208 | Bacteria | 5272 |
| 124 | Ga0209436_111258 | 3300025208 | Bacteria | 1582 |
| 125 | Ga0209563_109026 | 3300025230 | Bacteria | 1534 |
| 126 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 127 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 128 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 129 | Ga0207425_1002025 | 3300025245 | Bacteria | 7551 |
| 130 | Ga0207425_1005375 | 3300025245 | Bacteria | 3661 |
| 131 | Ga0207425_1019359 | 3300025245 | Bacteria | 1466 |
| 132 | Ga0209646_1000145 | 3300025246 | Bacteria | 105563 |
| 133 | Ga0209026_1000160 | 3300025250 | Bacteria | 105563 |
| 134 | Ga0209677_101318 | 3300025253 | Bacteria | 10964 |
| 135 | Ga0209148_1006231 | 3300025254 | Bacteria | 2608 |
| 136 | Ga0209759_1000177 | 3300025256 | Bacteria | 105563 |
| 137 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 138 | Ga0209129_1000137 | 3300025258 | Bacteria | 123213 |
| 139 | Ga0209129_1001658 | 3300025258 | Bacteria | 12046 |
| 140 | Ga0209129_1003401 | 3300025258 | Bacteria | 6972 |
| 141 | Ga0209129_1003754 | 3300025258 | Bacteria | 6413 |
| 142 | Ga0209129_1004220 | 3300025258 | Bacteria | 5759 |
| 143 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 144 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 145 | Ga0209233_1000209 | 3300025261 | Bacteria | 115124 |
| 146 | Ga0209455_1022909 | 3300025272 | Bacteria | 1181 |
| 147 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 148 | Ga0209673_1000319 | 3300025273 | Bacteria | 88129 |
| 149 | Ga0209673_1000603 | 3300025273 | Bacteria | 55646 |
| 150 | Ga0209673_1001904 | 3300025273 | Bacteria | 16728 |
| 151 | Ga0209673_1002052 | 3300025273 | Bacteria | 15245 |
| 152 | Ga0209673_1005246 | 3300025273 | Bacteria | 6593 |
| 153 | Ga0209673_1009732 | 3300025273 | Bacteria | 4127 |
| 154 | Ga0209673_1023011 | 3300025273 | Bacteria | 2133 |
| 155 | Ga0209673_1032712 | 3300025273 | Bacteria | 1598 |
| 156 | Ga0209673_1047185 | 3300025273 | Bacteria | 1170 |
| 157 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 158 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 159 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 160 | Ga0209130_1017462 | 3300025284 | Bacteria | 1708 |
| 161 | Ga0209676_1003604 | 3300025292 | Bacteria | 9324 |
| 162 | Ga0209676_1005303 | 3300025292 | Bacteria | 6793 |
| 163 | Ga0209676_1044856 | 3300025292 | Bacteria | 1208 |
| 164 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 165 | Ga0209025_1000165 | 3300025294 | Bacteria | 164692 |
| 166 | Ga0209025_1000199 | 3300025294 | Bacteria | 146058 |
| 167 | Ga0209025_1000580 | 3300025294 | Bacteria | 66332 |
| 168 | Ga0209025_1001754 | 3300025294 | Bacteria | 26007 |
| 169 | Ga0209025_1008148 | 3300025294 | Bacteria | 7601 |
| 170 | Ga0209025_1014633 | 3300025294 | Bacteria | 4803 |
| 171 | Ga0209025_1080515 | 3300025294 | Bacteria | 1108 |
| 172 | Ga0209025_1082706 | 3300025294 | Bacteria | 1083 |
| 173 | Ga0209564_1000330 | 3300025295 | Bacteria | 92033 |
| 174 | Ga0209564_1000425 | 3300025295 | Bacteria | 74279 |
| 175 | Ga0209564_1000431 | 3300025295 | Bacteria | 72866 |
| 176 | Ga0209564_1001106 | 3300025295 | Bacteria | 31905 |
| 177 | Ga0209564_1010463 | 3300025295 | Bacteria | 4268 |
| 178 | Ga0209564_1010632 | 3300025295 | Bacteria | 4214 |
| 179 | Ga0209564_1046144 | 3300025295 | Bacteria | 1113 |
| 180 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 181 | Ga0209758_1000333 | 3300025297 | Bacteria | 88318 |
| 182 | Ga0209758_1000890 | 3300025297 | Bacteria | 40935 |
| 183 | Ga0209758_1002059 | 3300025297 | Bacteria | 21481 |
| 184 | Ga0209758_1002402 | 3300025297 | Bacteria | 19217 |
| 185 | Ga0209758_1002927 | 3300025297 | Bacteria | 16450 |
| 186 | Ga0209758_1007332 | 3300025297 | Bacteria | 7551 |
| 187 | Ga0209758_1008991 | 3300025297 | Bacteria | 6316 |
| 188 | Ga0209758_1027802 | 3300025297 | Bacteria | 2409 |
| 189 | Ga0209050_1008722 | 3300025298 | Bacteria | 5344 |
| 190 | Ga0209050_1011419 | 3300025298 | Bacteria | 4215 |
| 191 | Ga0209256_1000877 | 3300025299 | Bacteria | 37183 |
| 192 | Ga0209256_1001695 | 3300025299 | Bacteria | 21274 |
| 193 | Ga0209256_1002866 | 3300025299 | Bacteria | 13104 |
| 194 | Ga0209256_1008034 | 3300025299 | Bacteria | 4998 |
| 195 | Ga0209256_1009074 | 3300025299 | Bacteria | 4439 |
| 196 | Ga0209256_1011652 | 3300025299 | Bacteria | 3484 |
| 197 | Ga0209256_1026291 | 3300025299 | Bacteria | 1679 |
| 198 | Ga0209256_1028526 | 3300025299 | Bacteria | 1572 |
| 199 | Ga0209256_1029895 | 3300025299 | Bacteria | 1511 |
| 200 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 201 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 202 | Ga0207426_1000106 | 3300025302 | Bacteria | 244368 |
| 203 | Ga0207426_1000119 | 3300025302 | Bacteria | 221800 |
| 204 | Ga0207426_1007834 | 3300025302 | Bacteria | 4415 |
| 205 | Ga0209051_1000198 | 3300025303 | Bacteria | 106688 |
| 206 | Ga0209051_1001443 | 3300025303 | Bacteria | 20239 |
| 207 | Ga0209051_1001611 | 3300025303 | Bacteria | 18403 |
| 208 | Ga0209051_1002094 | 3300025303 | Bacteria | 15026 |
| 209 | Ga0209051_1002200 | 3300025303 | Bacteria | 14404 |
| 210 | Ga0209051_1012227 | 3300025303 | Bacteria | 4163 |
| 211 | Ga0209051_1017935 | 3300025303 | Bacteria | 3150 |
| 212 | Ga0209051_1064595 | 3300025303 | Bacteria | 1133 |
| 213 | Ga0209257_1001713 | 3300025304 | Bacteria | 24577 |
| 214 | Ga0209257_1002246 | 3300025304 | Bacteria | 19809 |
| 215 | Ga0209257_1004254 | 3300025304 | Bacteria | 11304 |
| 216 | Ga0207696_1052960 | 3300025711 | Bacteria | 1156 |
| 217 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 218 | Ga0207671_10000718 | 3300025914 | Bacteria | 42274 |
| 219 | Ga0207681_10132609 | 3300025923 | Bacteria | 1844 |
| 220 | Ga0207644_10081513 | 3300025931 | Bacteria | 2391 |
| 221 | Ga0207711_10281284 | 3300025941 | Bacteria | 1532 |
| 222 | Ga0207667_10256933 | 3300025949 | Bacteria | 1787 |
| 223 | Ga0207668_10731214 | 3300025972 | Bacteria | 872 |
| 224 | Ga0207658_10400265 | 3300025986 | Bacteria | 1207 |
| 225 | Ga0207658_10464945 | 3300025986 | Bacteria | 1122 |
| 226 | Ga0207702_10069827 | 3300026078 | Bacteria | 3021 |
| 227 | Ga0209281_1000053 | 3300027111 | Bacteria | 309587 |
| 228 | Ga0209281_1000236 | 3300027111 | Bacteria | 113362 |
| 229 | Ga0209281_1000266 | 3300027111 | Bacteria | 100574 |
| 230 | Ga0209371_1001236 | 3300027312 | Bacteria | 18342 |
| 231 | Ga0209282_1000007 | 3300027666 | Bacteria | 254917 |
| 232 | Ga0268266_10034684 | 3300028379 | Bacteria | 4292 |
| 233 | Ga0268266_10082429 | 3300028379 | Bacteria | 2806 |
| 234 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 235 | Ga0307515_10009393 | 3300028794 | Bacteria | 18922 |
| 236 | Ga0307515_10010607 | 3300028794 | Bacteria | 17629 |
| 237 | Ga0268256_1000846 | 3300030500 | Bacteria | 21690 |
| 238 | Ga0307513_10017679 | 3300031456 | Bacteria | 8541 |
| 239 | Ga0307513_10158861 | 3300031456 | Bacteria | 2156 |
| 240 | Ga0307408_100076443 | 3300031548 | Bacteria | 2491 |
| 241 | Ga0307408_100180951 | 3300031548 | Bacteria | 1690 |
| 242 | Ga0307405_10001075 | 3300031731 | Bacteria | 11115 |
| 243 | Ga0315914_1000027 | 3300031967 | Bacteria | 106536 |
| 244 | Ga0307416_100403817 | 3300032002 | Bacteria | 1405 |
| 245 | Ga0307414_10050768 | 3300032004 | Bacteria | 2875 |
| 246 | Ga0307414_10271099 | 3300032004 | Bacteria | 1421 |
| 247 | Ga0315913_1007081 | 3300033430 | Bacteria | 13516 |
| 248 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 249 | Ga0395898_0001330 | 3300037466 | Bacteria | 35820 |
| 250 | Ga0395898_0231514 | 3300037466 | Bacteria | 1762 |
| 251 | Ga0439436_0023455 | 3300041404 | Bacteria | 1825 |
| 252 | Ga0439465_0011488 | 3300041413 | Bacteria | 2779 |
| 253 | Ga0439465_0029101 | 3300041413 | Bacteria | 1754 |
| 254 | Ga0451789_1302009 | 3300041443 | Bacteria | 878 |
| 255 | Ga0451804_0002771 | 3300041463 | Bacteria | 1090 |
| 256 | Ga0451837_0064596 | 3300041494 | Bacteria | 1211 |
| 257 | Ga0451851_0918442 | 3300041507 | Bacteria | 1889 |
| 258 | Ga0439431_0019365 | 3300041997 | Bacteria | 1618 |
| 259 | Ga0439449_0006294 | 3300042007 | Bacteria | 4538 |
| 260 | Ga0439462_0080216 | 3300042015 | Bacteria | 891 |
| 261 | Ga0450920_032091 | 3300042122 | Bacteria | 1036 |
| 262 | Ga0450918_010688 | 3300042531 | Bacteria | 1602 |
| 263 | Ga0466965_0252102 | 3300044683 | Bacteria | 947 |
| 264 | Ga0466966_0178973 | 3300044684 | Bacteria | 1287 |
| 265 | Ga0466971_0125591 | 3300044719 | Bacteria | 1189 |
| 266 | Ga0466970_0024461 | 3300044765 | Bacteria | 3158 |
| 267 | Ga0466957_0155377 | 3300044842 | Bacteria | 1482 |
| 268 | Ga0495592_0144181 | 3300046454 | Bacteria | 1653 |
| 269 | Ga0495638_0003817 | 3300046460 | Bacteria | 11698 |
| 270 | Ga0495638_0125108 | 3300046460 | Bacteria | 1516 |
| 271 | Ga0495605_0012582 | 3300046474 | Bacteria | 4686 |
| 272 | Ga0495605_0023575 | 3300046474 | Bacteria | 3233 |
| 273 | Ga0495662_0081522 | 3300046476 | Bacteria | 1573 |
| 274 | Ga0495585_0011550 | 3300046492 | Bacteria | 5226 |
| 275 | Ga0495585_0034909 | 3300046492 | Bacteria | 2843 |
| 276 | Ga0495585_0117381 | 3300046492 | Bacteria | 1410 |
| 277 | Ga0495585_0199681 | 3300046492 | Bacteria | 1019 |
| 278 | Ga0495596_0077456 | 3300046500 | Bacteria | 1291 |
| 279 | Ga0495596_0090392 | 3300046500 | Bacteria | 1188 |
| 280 | Ga0495607_0145948 | 3300046501 | Bacteria | 1216 |
| 281 | Ga0495583_0004596 | 3300046506 | Bacteria | 9785 |
| 282 | Ga0495583_0072744 | 3300046506 | Bacteria | 1508 |
| 283 | Ga0495583_0090837 | 3300046506 | Bacteria | 1315 |
| 284 | Ga0495583_0168006 | 3300046506 | Bacteria | 902 |
| 285 | Ga0495606_0007105 | 3300046507 | Bacteria | 10123 |
| 286 | Ga0495606_0057661 | 3300046507 | Bacteria | 2500 |
| 287 | Ga0495606_0064261 | 3300046507 | Bacteria | 2336 |
| 288 | Ga0495606_0240582 | 3300046507 | Bacteria | 1010 |
| 289 | Ga0495610_0006488 | 3300046512 | Bacteria | 8037 |
| 290 | Ga0495610_0052755 | 3300046512 | Bacteria | 1973 |
| 291 | Ga0495616_0051421 | 3300046513 | Bacteria | 2055 |
| 292 | Ga0495616_0156439 | 3300046513 | Bacteria | 1028 |
| 293 | Ga0495620_0027499 | 3300046515 | Bacteria | 2660 |
| 294 | Ga0495620_0123860 | 3300046515 | Bacteria | 1017 |
| 295 | Ga0495631_0003953 | 3300046518 | Bacteria | 8006 |
| 296 | Ga0495632_0047588 | 3300046519 | Bacteria | 2126 |
| 297 | Ga0495632_0054258 | 3300046519 | Bacteria | 1965 |
| 298 | Ga0495632_0097236 | 3300046519 | Bacteria | 1390 |
| 299 | Ga0495632_0208775 | 3300046519 | Bacteria | 886 |
| 300 | Ga0495643_0007584 | 3300046522 | Bacteria | 6977 |
| 301 | Ga0495643_0144093 | 3300046522 | Bacteria | 1185 |
| 302 | Ga0495643_0182879 | 3300046522 | Bacteria | 1017 |
| 303 | Ga0495648_0113621 | 3300046524 | Bacteria | 1468 |
| 304 | Ga0495648_0156448 | 3300046524 | Bacteria | 1183 |
| 305 | Ga0495654_0000092 | 3300046530 | Bacteria | 101504 |
| 306 | Ga0495640_0229714 | 3300046533 | Bacteria | 1167 |
| 307 | Ga0495597_0020363 | 3300046542 | Bacteria | 3091 |
| 308 | Ga0495622_0023797 | 3300046557 | Bacteria | 2857 |
| 309 | Ga0495633_0030286 | 3300046558 | Bacteria | 2629 |
| 310 | Ga0495668_0004226 | 3300046616 | Bacteria | 10340 |
| 311 | Ga0495611_0005820 | 3300046648 | Bacteria | 5263 |
| 312 | Ga0495625_0000883 | 3300046660 | Bacteria | 40600 |
| 313 | Ga0495625_0059900 | 3300046660 | Bacteria | 2699 |
| 314 | Ga0495625_0089923 | 3300046660 | Bacteria | 2125 |
| 315 | Ga0495625_0094275 | 3300046660 | Bacteria | 2066 |
| 316 | Ga0495588_0007417 | 3300046674 | Bacteria | 4991 |
| 317 | Ga0495657_0072547 | 3300046675 | Bacteria | 2245 |
| 318 | Ga0495658_0031269 | 3300046683 | Bacteria | 2898 |
| 319 | Ga0495670_0027972 | 3300046691 | Bacteria | 2795 |
| 320 | Ga0495670_0034596 | 3300046691 | Bacteria | 2517 |
| 321 | Ga0495671_0070913 | 3300046692 | Bacteria | 1712 |
| 322 | Ga0495649_0146708 | 3300046694 | Bacteria | 1240 |
| 323 | Ga0495660_0054059 | 3300046810 | Bacteria | 2177 |
| 324 | Ga0495604_0091348 | 3300047317 | Bacteria | 2258 |
| 325 | Ga0495676_0259054 | 3300047321 | Bacteria | 1184 |
| 326 | Ga0495683_0114332 | 3300047323 | Bacteria | 1286 |
| 327 | Ga0495687_075633 | 3300047443 | Bacteria | 1335 |
| 328 | Ga0495687_105200 | 3300047443 | Bacteria | 1050 |
| 329 | Ga0495686_0001036 | 3300047472 | Bacteria | 33364 |
| 330 | Ga0495686_0051972 | 3300047472 | Bacteria | 2570 |
| 331 | Ga0495686_0057032 | 3300047472 | Bacteria | 2439 |
| 332 | Ga0495686_0064874 | 3300047472 | Bacteria | 2259 |
| 333 | Ga0495686_0124044 | 3300047472 | Bacteria | 1537 |
| 334 | Ga0495686_0167874 | 3300047472 | Bacteria | 1278 |
| 335 | Ga0495602_0301252 | 3300048088 | Bacteria | 1173 |
| 336 | Ga0496100_0133374 | 3300048903 | Bacteria | 1752 |
| 337 | Ga0496101_0240218 | 3300048904 | Bacteria | 1409 |
| 338 | Ga0496101_0281805 | 3300048904 | Bacteria | 1299 |
| 339 | Ga0496102_0054748 | 3300048905 | Bacteria | 3638 |
| 340 | Ga0496102_0333112 | 3300048905 | Bacteria | 1429 |
| 341 | Ga0496104_0334753 | 3300048907 | Bacteria | 1427 |
| 342 | Ga0496105_0253413 | 3300048908 | Bacteria | 1425 |
| 343 | Ga0496106_0002977 | 3300048909 | Bacteria | 12613 |
| 344 | Ga0496106_0252502 | 3300048909 | Bacteria | 1410 |
| 345 | Ga0496110_0188438 | 3300048913 | Bacteria | 1873 |
| 346 | Ga0496110_0270374 | 3300048913 | Bacteria | 1547 |
| 347 | Ga0496111_0002706 | 3300048914 | Bacteria | 10766 |
| 348 | Ga0496111_0071455 | 3300048914 | Bacteria | 2526 |
| 349 | Ga0496114_0218178 | 3300048917 | Bacteria | 1674 |
| 350 | Ga0496114_0286362 | 3300048917 | Bacteria | 1453 |
| 351 | Ga0496116_0000026 | 3300048919 | Bacteria | 450803 |
| 352 | Ga0496116_0010291 | 3300048919 | Bacteria | 7856 |
| 353 | Ga0496116_0041340 | 3300048919 | Bacteria | 3163 |
| 354 | Ga0496116_0045458 | 3300048919 | Bacteria | 2972 |
| 355 | Ga0496116_0064541 | 3300048919 | Bacteria | 2353 |
| 356 | Ga0496116_0151311 | 3300048919 | Bacteria | 1288 |
| 357 | Ga0496116_0177001 | 3300048919 | Bacteria | 1147 |
| 358 | Ga0496117_0001867 | 3300048920 | Bacteria | 28420 |
| 359 | Ga0496117_0026098 | 3300048920 | Bacteria | 4576 |
| 360 | Ga0496117_0027157 | 3300048920 | Bacteria | 4466 |
| 361 | Ga0496117_0064728 | 3300048920 | Bacteria | 2490 |
| 362 | Ga0496117_0118530 | 3300048920 | Bacteria | 1631 |
| 363 | Ga0496117_0317604 | 3300048920 | Bacteria | 817 |
| 364 | Ga0496118_0012870 | 3300048921 | Bacteria | 7974 |
| 365 | Ga0496118_0075238 | 3300048921 | Bacteria | 2409 |
| 366 | Ga0496118_0076515 | 3300048921 | Bacteria | 2379 |
| 367 | Ga0496118_0077503 | 3300048921 | Bacteria | 2357 |
| 368 | Ga0496118_0189393 | 3300048921 | Bacteria | 1232 |
| 369 | Ga0496119_0046197 | 3300048922 | Bacteria | 2722 |
| 370 | Ga0496119_0056778 | 3300048922 | Bacteria | 2370 |
| 371 | Ga0496119_0253603 | 3300048922 | Bacteria | 886 |
| 372 | Ga0496120_0058615 | 3300048923 | Bacteria | 2162 |
| 373 | Ga0496120_0088341 | 3300048923 | Bacteria | 1661 |
| 374 | Ga0496120_0090609 | 3300048923 | Bacteria | 1634 |
| 375 | Ga0496120_0094175 | 3300048923 | Bacteria | 1595 |
| 376 | Ga0496120_0181335 | 3300048923 | Bacteria | 1033 |
| 377 | Ga0496120_0201343 | 3300048923 | Bacteria | 964 |
| 378 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 379 | Ga0496121_0003347 | 3300048924 | Bacteria | 22997 |
| 380 | Ga0496121_0005117 | 3300048924 | Bacteria | 17088 |
| 381 | Ga0496121_0012537 | 3300048924 | Bacteria | 9225 |
| 382 | Ga0496121_0048389 | 3300048924 | Bacteria | 3617 |
| 383 | Ga0496121_0171180 | 3300048924 | Bacteria | 1577 |
| 384 | Ga0496121_0221843 | 3300048924 | Bacteria | 1331 |
| 385 | Ga0496121_0292677 | 3300048924 | Bacteria | 1108 |
| 386 | Ga0496121_0366396 | 3300048924 | Bacteria | 955 |
| 387 | Ga0496122_0000160 | 3300048925 | Bacteria | 159236 |
| 388 | Ga0496122_0000604 | 3300048925 | Bacteria | 73844 |
| 389 | Ga0496122_0011685 | 3300048925 | Bacteria | 8849 |
| 390 | Ga0496122_0012377 | 3300048925 | Bacteria | 8508 |
| 391 | Ga0496122_0021819 | 3300048925 | Bacteria | 5715 |
| 392 | Ga0496122_0052823 | 3300048925 | Bacteria | 3070 |
| 393 | Ga0496122_0066147 | 3300048925 | Bacteria | 2614 |
| 394 | Ga0496122_0074595 | 3300048925 | Bacteria | 2399 |
| 395 | Ga0496122_0076327 | 3300048925 | Bacteria | 2358 |
| 396 | Ga0496122_0077456 | 3300048925 | Bacteria | 2334 |
| 397 | Ga0496122_0116511 | 3300048925 | Bacteria | 1737 |
| 398 | Ga0496123_0000034 | 3300048926 | Bacteria | 274836 |
| 399 | Ga0496123_0000103 | 3300048926 | Bacteria | 168232 |
| 400 | Ga0496123_0003820 | 3300048926 | Bacteria | 16441 |
| 401 | Ga0496123_0008044 | 3300048926 | Bacteria | 9762 |
| 402 | Ga0496123_0009653 | 3300048926 | Bacteria | 8658 |
| 403 | Ga0496123_0035193 | 3300048926 | Bacteria | 3573 |
| 404 | Ga0496123_0037959 | 3300048926 | Bacteria | 3393 |
| 405 | Ga0496123_0154418 | 3300048926 | Bacteria | 1233 |
| 406 | Ga0496124_0005176 | 3300048927 | Bacteria | 14827 |
| 407 | Ga0496124_0026701 | 3300048927 | Bacteria | 5203 |
| 408 | Ga0496124_0051147 | 3300048927 | Bacteria | 3516 |
| 409 | Ga0496124_0051672 | 3300048927 | Bacteria | 3495 |
| 410 | Ga0496124_0054451 | 3300048927 | Bacteria | 3386 |
| 411 | Ga0496124_0089653 | 3300048927 | Bacteria | 2510 |
| 412 | Ga0496124_0118710 | 3300048927 | Bacteria | 2117 |
| 413 | Ga0496124_0134272 | 3300048927 | Bacteria | 1961 |
| 414 | Ga0496124_0222439 | 3300048927 | Bacteria | 1418 |
| 415 | Ga0496124_0223040 | 3300048927 | Bacteria | 1416 |
| 416 | Ga0496124_0250781 | 3300048927 | Bacteria | 1309 |
| 417 | Ga0496124_0385537 | 3300048927 | Bacteria | 978 |
| 418 | Ga0496124_0385834 | 3300048927 | Bacteria | 978 |
| 419 | Ga0496124_0416599 | 3300048927 | Bacteria | 927 |
| 420 | Ga0496124_0452872 | 3300048927 | Bacteria | 874 |
| 421 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 422 | Ga0496125_0004365 | 3300048928 | Bacteria | 16385 |
| 423 | Ga0496125_0006606 | 3300048928 | Bacteria | 12489 |
| 424 | Ga0496125_0009397 | 3300048928 | Bacteria | 10056 |
| 425 | Ga0496125_0060415 | 3300048928 | Bacteria | 3046 |
| 426 | Ga0496125_0083000 | 3300048928 | Bacteria | 2440 |
| 427 | Ga0496126_0000069 | 3300048929 | Bacteria | 246935 |
| 428 | Ga0496126_0001336 | 3300048929 | Bacteria | 39105 |
| 429 | Ga0496126_0006321 | 3300048929 | Bacteria | 13225 |
| 430 | Ga0496126_0120569 | 3300048929 | Bacteria | 2275 |
| 431 | Ga0496126_0134875 | 3300048929 | Bacteria | 2130 |
| 432 | Ga0495678_013296 | 3300049459 | Bacteria | 3871 |
| 433 | Ga0495678_032777 | 3300049459 | Bacteria | 2150 |
| 434 | Ga0495682_0053778 | 3300049460 | Bacteria | 1462 |
| 435 | Ga0501032_0083184 | 3300049569 | Bacteria | 2129 |
| 436 | Ga0501033_0001329 | 3300049570 | Bacteria | 21992 |
| 437 | Ga0501033_0295749 | 3300049570 | Bacteria | 1141 |
| 438 | Ga0501038_0071732 | 3300049574 | Bacteria | 2937 |
| 439 | Ga0501043_0188819 | 3300049579 | Bacteria | 1603 |
| 440 | Ga0501083_0028579 | 3300049744 | Bacteria | 3842 |
| 441 | Ga0501035_0056360 | 3300049822 | Bacteria | 3507 |
| 442 | Ga0501035_0234835 | 3300049822 | Bacteria | 1562 |
| 443 | nmdc:mga03683_32817_c1 | 3300050489 | Bacteria | 2091 |
| 444 | nmdc:mga00v17_115_c2 | 3300050491 | Bacteria | 47780 |
| 445 | nmdc:mga00v17_213458_c1 | 3300050491 | Bacteria | 1249 |
| 446 | nmdc:mga0yw44_13140_c1 | 3300050492 | Bacteria | 3539 |
| 447 | nmdc:mga0yw44_1335_c1 | 3300050492 | Bacteria | 9762 |
| 448 | nmdc:mga07m45_68151_c1 | 3300050496 | Bacteria | 2023 |
| 449 | Ga0495601_0363105 | 3300053077 | Bacteria | 941 |
| 450 | Ga0495619_0115713 | 3300053085 | Bacteria | 1835 |
| 451 | Ga0500578_0147691 | 3300053086 | Bacteria | 1466 |
| 452 | Ga0500643_035618 | 3300053087 | Bacteria | 1491 |
| 453 | Ga0500569_004058 | 3300053109 | Bacteria | 3049 |
| 454 | Ga0500572_008961 | 3300053111 | Bacteria | 2353 |
| 455 | Ga0500594_0005380 | 3300053118 | Bacteria | 2838 |
| 456 | Ga0500618_000575 | 3300053125 | Bacteria | 22683 |
| 457 | Ga0500618_000896 | 3300053125 | Bacteria | 15698 |
| 458 | Ga0500618_022804 | 3300053125 | Bacteria | 1518 |
| 459 | Ga0500618_030371 | 3300053125 | Bacteria | 1271 |
| 460 | Ga0500658_0006339 | 3300053134 | Bacteria | 4388 |
| 461 | Ga0500658_0017189 | 3300053134 | Bacteria | 2699 |
| 462 | Ga0500659_0051243 | 3300053135 | Bacteria | 2223 |
| 463 | Ga0500568_0002529 | 3300053139 | Bacteria | 10682 |
| 464 | Ga0500568_0008441 | 3300053139 | Bacteria | 4960 |
| 465 | Ga0500590_001191 | 3300053148 | Bacteria | 10331 |
| 466 | Ga0500616_0001190 | 3300053153 | Bacteria | 26447 |
| 467 | Ga0500616_0001711 | 3300053153 | Bacteria | 20169 |
| 468 | Ga0500622_0016729 | 3300053156 | Bacteria | 3915 |
| 469 | Ga0500627_0066768 | 3300053158 | Bacteria | 1589 |
| 470 | Ga0500627_0179684 | 3300053158 | Bacteria | 952 |
| 471 | Ga0500633_0011594 | 3300053160 | Bacteria | 2403 |
| 472 | Ga0500636_0002064 | 3300053177 | Bacteria | 11084 |
| 473 | Ga0500636_0264859 | 3300053177 | Bacteria | 868 |
| 474 | Ga0501082_0311353 | 3300060353 | Bacteria | 1371 |
| 475 | Ga0501082_0321361 | 3300060353 | Bacteria | 1348 |
| 476 | 2819684062 | 2818991461 | Bacteria | 7026071 |
| 477 | 2509108572 | 2508501122 | Bacteria | 6292184 |
| 478 | 2509374401 | 2509276019 | Bacteria | 6802256 |
| 479 | 2509387669 | 2509276021 | Bacteria | 7634384 |
| 480 | 2509443027 | 2509276033 | Bacteria | 7180565 |
| 481 | 2510132345 | 2510065019 | Bacteria | 6903379 |
| 482 | 2510305107 | 2510065057 | Bacteria | 6649661 |
| 483 | 2510898682 | 2510461076 | Bacteria | 8618824 |
| 484 | 2511137078 | 2510917022 | Bacteria | 6504556 |
| 485 | 2511172939 | 2510917026 | Bacteria | 7046020 |
| 486 | 2511186410 | 2510917028 | Bacteria | 6185411 |
| 487 | 2511197149 | 2510917030 | Bacteria | 7460662 |
| 488 | 2511501073 | 2511231052 | Bacteria | 6974333 |
| 489 | 2512532481 | 2512047086 | Bacteria | 6850303 |
| 490 | 2512972182 | 2512875026 | Bacteria | 6861065 |
| 491 | 2513569184 | 2513237084 | Bacteria | 7231967 |
| 492 | 2513578857 | 2513237085 | Bacteria | 7695351 |
| 493 | 2513582848 | 2513237086 | Bacteria | 7265287 |
| 494 | 2513596296 | 2513237088 | Bacteria | 6927906 |
| 495 | 2513603261 | 2513237089 | Bacteria | 6553624 |
| 496 | 2513616237 | 2513237091 | Bacteria | 6900273 |
| 497 | 2513632711 | 2513237093 | Bacteria | 7545552 |
| 498 | 2513709163 | 2513237103 | Bacteria | 7647401 |
| 499 | 2513871247 | 2513237138 | Bacteria | 7368160 |
| 500 | 2513881040 | 2513237140 | Bacteria | 7076289 |
| 501 | 2513902276 | 2513237143 | Bacteria | 6664116 |
| 502 | 2513908888 | 2513237144 | Bacteria | 7530820 |
| 503 | 2513925749 | 2513237146 | Bacteria | 7166346 |
| 504 | 2513983867 | 2513237156 | Bacteria | 6402557 |
| 505 | 2514001934 | 2513237159 | Bacteria | 6810126 |
| 506 | 2514004716 | 2513237160 | Bacteria | 6650282 |
| 507 | 2514020705 | 2513237162 | Bacteria | 7468464 |
| 508 | 2515111329 | 2515075009 | Bacteria | 7288508 |
| 509 | 2515608183 | 2515154107 | Bacteria | 6795637 |
| 510 | 2515638472 | 2515154113 | Bacteria | 7807172 |
| 511 | 2515644358 | 2515154114 | Bacteria | 7848616 |
| 512 | 2515659146 | 2515154116 | Bacteria | 7552979 |
| 513 | 2515740516 | 2515154134 | Bacteria | 7220242 |
| 514 | 2516208934 | 2516143018 | Bacteria | 6951533 |
| 515 | 2516892354 | 2516653046 | Bacteria | 6989037 |
| 516 | 2517039970 | 2516653077 | Bacteria | 7555578 |
| 517 | 2517075522 | 2516653085 | Bacteria | 7346596 |
| 518 | 2517094103 | 2517093000 | Bacteria | 7412387 |
| 519 | 2517405922 | 2517287029 | Bacteria | 6905599 |
| 520 | 2517569152 | 2517487022 | Bacteria | 7227575 |
| 521 | 2520378725 | 2519899620 | Bacteria | 6499161 |
| 522 | 2524451078 | 2524023207 | Bacteria | 6813453 |
| 523 | 2524460598 | 2524023209 | Bacteria | 6679728 |
| 524 | 2530643841 | 2529292951 | Bacteria | 6916614 |
| 525 | 2535515766 | 2534681796 | Bacteria | 7146037 |
| 526 | 2551680462 | 2551306084 | Bacteria | 8942552 |
| 527 | 2551683849 | 2551306085 | Bacteria | 7347181 |
| 528 | 2551695757 | 2551306086 | Bacteria | 6843938 |
| 529 | 2551698111 | 2551306087 | Bacteria | 7351905 |
| 530 | 2551713128 | 2551306089 | Bacteria | 7162724 |
| 531 | 2551721357 | 2551306090 | Bacteria | 7953713 |
| 532 | 2551745191 | 2551306093 | Bacteria | 7064773 |
| 533 | 2558863428 | 2558860100 | Bacteria | 8458965 |
| 534 | 2585165617 | 2582581283 | Bacteria | 6030556 |
| 535 | 2585203129 | 2582581294 | Bacteria | 6626667 |
| 536 | 2585221041 | 2582581298 | Bacteria | 7315509 |
| 537 | 2585231444 | 2582581299 | Bacteria | 6518058 |
| 538 | 2585256563 | 2582581304 | Bacteria | 5831370 |
| 539 | 2585266109 | 2582581306 | Bacteria | 6450535 |
| 540 | 2585273212 | 2582581307 | Bacteria | 6597605 |
| 541 | 2585278955 | 2582581308 | Bacteria | 7413247 |
| 542 | 2585325430 | 2582581315 | Bacteria | 7318924 |
| 543 | 2585329592 | 2582581316 | Bacteria | 7774528 |
| 544 | 2585387110 | 2582581865 | Bacteria | 6644329 |
| 545 | 2585392770 | 2582581866 | Bacteria | 6859583 |
| 546 | 2585400074 | 2582581867 | Bacteria | 7184437 |
| 547 | 2585528019 | 2585427526 | Bacteria | 7258840 |
| 548 | 2585530751 | 2585427527 | Bacteria | 7273426 |
| 549 | 2585541379 | 2585427528 | Bacteria | 6842387 |
| 550 | 2585549243 | 2585427529 | Bacteria | 7395659 |
| 551 | 2585554932 | 2585427530 | Bacteria | 7383882 |
| 552 | 2585559488 | 2585427531 | Bacteria | 6992870 |
| 553 | 2585822633 | 2585427590 | Bacteria | 6824633 |
| 554 | 2585839489 | 2585427593 | Bacteria | 7141551 |
| 555 | 2585847164 | 2585427594 | Bacteria | 6180594 |
| 556 | 2585902159 | 2585427608 | Bacteria | 6544331 |
| 557 | 2585905136 | 2585427609 | Bacteria | 6667127 |
| 558 | 2585995167 | 2585427633 | Bacteria | 6413184 |
| 559 | 2585999714 | 2585427634 | Bacteria | 6455027 |
| 560 | 2587979749 | 2585428125 | Bacteria | 6662905 |
| 561 | 2599333702 | 2599185156 | Bacteria | 5403036 |
| 562 | 2599418546 | 2599185170 | Bacteria | 7295545 |
| 563 | 2599722063 | 2599185236 | Bacteria | 6875203 |
| 564 | 2600191991 | 2599185352 | Bacteria | 7228948 |
| 565 | 2600375318 | 2600254933 | Bacteria | 4750527 |
| 566 | 2616296168 | 2615840624 | Bacteria | 6557588 |
| 567 | 2616305772 | 2615840626 | Bacteria | 7921970 |
| 568 | 2616553988 | 2615840698 | Bacteria | 7319877 |
| 569 | 2617384178 | 2617270742 | Bacteria | 6808054 |
| 570 | 2643807143 | 2643221557 | Bacteria | 7184309 |
| 571 | 2643809957 | 2643221558 | Bacteria | 5460675 |
| 572 | 2643857871 | 2643221568 | Bacteria | 5187270 |
| 573 | 2644007973 | 2643221599 | Bacteria | 6292121 |
| 574 | 2644046506 | 2643221607 | Bacteria | 6314006 |
| 575 | 2644069591 | 2643221610 | Bacteria | 7480339 |
| 576 | 2644108934 | 2643221618 | Bacteria | 7717186 |
| 577 | 2644151456 | 2643221626 | Bacteria | 8069654 |
| 578 | 2644196562 | 2643221634 | Bacteria | 6705461 |
| 579 | 2644200859 | 2643221636 | Bacteria | 6583769 |
| 580 | 2644206144 | 2643221637 | Bacteria | 5345260 |
| 581 | 2644239053 | 2643221643 | Bacteria | 5749658 |
| 582 | 2644311590 | 2643221655 | Bacteria | 7722067 |
| 583 | 2644329848 | 2643221659 | Bacteria | 7890716 |
| 584 | 2644380525 | 2643221668 | Bacteria | 7306521 |
| 585 | 2644420745 | 2643221675 | Bacteria | 7473456 |
| 586 | 2644454270 | 2643221680 | Bacteria | 7473610 |
| 587 | 2644479296 | 2643221686 | Bacteria | 6310811 |
| 588 | 2644493346 | 2643221688 | Bacteria | 5260751 |
| 589 | 2644502343 | 2643221689 | Bacteria | 6042950 |
| 590 | 2644546522 | 2643221698 | Bacteria | 7756764 |
| 591 | 2644617389 | 2643221712 | Bacteria | 7729434 |
| 592 | 2644649791 | 2643221718 | Bacteria | 5345506 |
| 593 | 2644675591 | 2643221723 | Bacteria | 7095460 |
| 594 | 2644689607 | 2643221726 | Bacteria | 7455827 |
| 595 | 2657683210 | 2657244999 | Bacteria | 5946535 |
| 596 | 2671115258 | 2667528174 | Bacteria | 6435400 |
| 597 | 2692316770 | 2690316117 | Bacteria | 6800650 |
| 598 | 2719180337 | 2718217882 | Bacteria | 6556348 |
| 599 | 2719384914 | 2718217927 | Bacteria | 6972593 |
| 600 | 2719664659 | 2718217997 | Bacteria | 6740740 |
| 601 | 2719731086 | 2718218009 | Bacteria | 6478651 |
| 602 | 2720491079 | 2718218199 | Bacteria | 6740745 |
| 603 | 2720612448 | 2718218232 | Bacteria | 6720332 |
| 604 | 2720619287 | 2718218233 | Bacteria | 6662049 |
| 605 | 2720630687 | 2718218235 | Bacteria | 6630699 |
| 606 | 2720774380 | 2718218269 | Bacteria | 6906114 |
| 607 | 2721146431 | 2718218363 | Bacteria | 6524337 |
| 608 | 2721157952 | 2718218365 | Bacteria | 6274507 |
| 609 | 2721163310 | 2718218366 | Bacteria | 6425255 |
| 610 | 2721398634 | 2718218423 | Bacteria | 6438183 |
| 611 | 2722839480 | 2721755514 | Bacteria | 6424414 |
| 612 | 2723026108 | 2721755556 | Bacteria | 6745503 |
| 613 | 2723559652 | 2721755684 | Bacteria | 6859907 |
| 614 | 2723566268 | 2721755685 | Bacteria | 6704835 |
| 615 | 2724037447 | 2721755809 | Bacteria | 6438790 |
| 616 | 2724043842 | 2721755810 | Bacteria | 6479005 |
| 617 | 2724088987 | 2721755819 | Bacteria | 6906405 |
| 618 | 2724103533 | 2721755822 | Bacteria | 6726041 |
| 619 | 2724109372 | 2721755823 | Bacteria | 6752556 |
| 620 | 2725946771 | 2724679232 | Bacteria | 7646494 |
| 621 | 2730107044 | 2728369352 | Bacteria | 6745171 |
| 622 | 2730163574 | 2728369365 | Bacteria | 6555560 |
| 623 | 2730297584 | 2728369397 | Bacteria | 6274511 |
| 624 | 2738802212 | 2738541293 | Bacteria | 7065685 |
| 625 | 2738946498 | 2738541317 | Bacteria | 5340176 |
| 626 | 2739035949 | 2738541333 | Bacteria | 7106503 |
| 627 | 2753460862 | 2751185821 | Bacteria | 6189929 |
| 628 | 2766067558 | 2765235942 | Bacteria | 7445910 |
| 629 | 2778177534 | 2775507266 | Bacteria | 7392367 |
| 630 | 2792584217 | 2791355082 | Bacteria | 5973319 |
| 631 | 2792622629 | 2791355091 | Bacteria | 6135441 |
| 632 | 2792628450 | 2791355092 | Bacteria | 6248105 |
| 633 | 2792638291 | 2791355094 | Bacteria | 7011481 |
| 634 | 2793296244 | 2791355256 | Bacteria | 6798008 |
| 635 | 2793317570 | 2791355259 | Bacteria | 7254731 |
| 636 | 2793321054 | 2791355260 | Bacteria | 6598818 |
| 637 | 2793327086 | 2791355261 | Bacteria | 6661293 |
| 638 | 2793333661 | 2791355262 | Bacteria | 6774204 |
| 639 | 2793339745 | 2791355263 | Bacteria | 6872478 |
| 640 | 2793347978 | 2791355264 | Bacteria | 6429314 |
| 641 | 2793357413 | 2791355265 | Bacteria | 6539969 |
| 642 | 2793358964 | 2791355266 | Bacteria | 7116587 |
| 643 | 2793367894 | 2791355267 | Bacteria | 7222458 |
| 644 | 2802717796 | 2802428858 | Bacteria | 6636079 |
| 645 | 2802723275 | 2802428859 | Bacteria | 6667919 |
| 646 | 2802733138 | 2802428860 | Bacteria | 6525526 |
| 647 | 2802736280 | 2802428861 | Bacteria | 6534206 |
| 648 | 2802743510 | 2802428862 | Bacteria | 6633353 |
| 649 | 2802750777 | 2802428863 | Bacteria | 6410669 |
| 650 | 2804751402 | 2802429268 | Bacteria | 6094027 |
| 651 | 2805926535 | 2802429605 | Bacteria | 6875453 |
| 652 | 2805933334 | 2802429606 | Bacteria | 6346811 |
| 653 | 2806046872 | 2802429633 | Bacteria | 7341974 |
| 654 | 2806052455 | 2802429634 | Bacteria | 7083200 |
| 655 | 2806058774 | 2802429635 | Bacteria | 7650140 |
| 656 | 2806067458 | 2802429636 | Bacteria | 7597525 |
| 657 | 2806074037 | 2802429637 | Bacteria | 7067217 |
| 658 | 2819611548 | 2818991448 | Bacteria | 6772224 |
| 659 | 2819639201 | 2818991453 | Bacteria | 7181617 |
| 660 | 2821124332 | 2821123053 | Bacteria | 7836056 |
| 661 | 2838017331 | 2838016132 | Bacteria | 6577831 |
| 662 | 2838023100 | 2838022645 | Bacteria | 6494267 |
| 663 | 2838031476 | 2838029111 | Bacteria | 6603031 |
| 664 | 2838037757 | 2838035591 | Bacteria | 7166484 |
| 665 | 2838048871 | 2838042994 | Bacteria | 6046894 |
| 666 | 2838049187 | 2838048938 | Bacteria | 6044578 |
| 667 | 2838063367 | 2838061910 | Bacteria | 6794874 |
| 668 | 2838074200 | 2838068647 | Bacteria | 6208656 |
| 669 | 2838076497 | 2838074704 | Bacteria | 6785777 |
| 670 | 2838662770 | 2838661181 | Bacteria | 7385261 |
| 671 | 2838670890 | 2838668709 | Bacteria | 6671819 |
| 672 | 2838681386 | 2838680041 | Bacteria | 6545511 |
| 673 | 2838688563 | 2838686498 | Bacteria | 7807632 |
| 674 | 2838694579 | 2838694306 | Bacteria | 6853137 |
| 675 | 2838703261 | 2838701080 | Bacteria | 6669771 |
| 676 | 2838707957 | 2838707686 | Bacteria | 6619912 |
| 677 | 2838730858 | 2838729681 | Bacteria | 7400765 |
| 678 | 2838741173 | 2838736955 | Bacteria | 5760694 |
| 679 | 2838744248 | 2838742623 | Bacteria | 7396178 |
| 680 | 2841844930 | 2841840854 | Bacteria | 5761912 |
| 681 | 2841856929 | 2841851746 | Bacteria | 7532261 |
| 682 | 2841865427 | 2841864319 | Bacteria | 6742987 |
| 683 | 2842080812 | 2842077413 | Bacteria | 6508645 |
| 684 | 2842115021 | 2842110456 | Bacteria | 7656360 |
| 685 | 2842121431 | 2842118031 | Bacteria | 7033875 |
| 686 | 2842144652 | 2842140634 | Bacteria | 5759631 |
| 687 | 2842147515 | 2842146304 | Bacteria | 5957337 |
| 688 | 2842160099 | 2842156927 | Bacteria | 6894975 |
| 689 | 2842168342 | 2842163707 | Bacteria | 6916235 |
| 690 | 2842183284 | 2842180545 | Bacteria | 6888678 |
| 691 | 2842197992 | 2842192696 | Bacteria | 6147454 |
| 692 | 2842199528 | 2842198810 | Bacteria | 6608673 |
| 693 | 2842207654 | 2842205361 | Bacteria | 6340321 |
| 694 | 2842221246 | 2842217011 | Bacteria | 7497767 |
| 695 | 2842235115 | 2842229732 | Bacteria | 7475766 |
| 696 | 2842237368 | 2842237096 | Bacteria | 6620661 |
| 697 | 2842245712 | 2842243621 | Bacteria | 7421798 |
| 698 | 2842252581 | 2842250916 | Bacteria | 6579627 |
| 699 | 2842259638 | 2842257432 | Bacteria | 7401195 |
| 700 | 2842266879 | 2842264693 | Bacteria | 6472963 |
| 701 | 2842274477 | 2842271015 | Bacteria | 7807131 |
| 702 | 2842281551 | 2842278818 | Bacteria | 6340002 |
| 703 | 2842287075 | 2842285085 | Bacteria | 6011953 |
| 704 | 2842294468 | 2842291075 | Bacteria | 7076806 |
| 705 | 2842302402 | 2842298080 | Bacteria | 6123127 |
| 706 | 2842306720 | 2842304105 | Bacteria | 7023636 |
| 707 | 2842314788 | 2842311132 | Bacteria | 6616990 |
| 708 | 2842318609 | 2842317721 | Bacteria | 6793725 |
| 709 | 2842343549 | 2842341865 | Bacteria | 7003929 |
| 710 | 2842360865 | 2842357229 | Bacteria | 6485165 |
| 711 | 2842365294 | 2842363717 | Bacteria | 6844742 |
| 712 | 2842371849 | 2842370503 | Bacteria | 7038661 |
| 713 | 2842380866 | 2842377471 | Bacteria | 7140707 |
| 714 | 2842387937 | 2842384541 | Bacteria | 7057858 |
| 715 | 2842398212 | 2842395702 | Bacteria | 6780583 |
| 716 | 2842404343 | 2842402390 | Bacteria | 6681310 |
| 717 | 2842410972 | 2842409023 | Bacteria | 6687331 |
| 718 | 2842417572 | 2842415677 | Bacteria | 6596907 |
| 719 | 2842427405 | 2842422224 | Bacteria | 6239196 |
| 720 | 2842431010 | 2842428310 | Bacteria | 6767288 |
| 721 | 2842436992 | 2842434925 | Bacteria | 6502746 |
| 722 | 2842443070 | 2842441272 | Bacteria | 6769273 |
| 723 | 2842453292 | 2842447887 | Bacteria | 6754142 |
| 724 | 2842465081 | 2842462802 | Bacteria | 6588055 |
| 725 | 2842471693 | 2842469257 | Bacteria | 6752936 |
| 726 | 2842477929 | 2842475841 | Bacteria | 6603183 |
| 727 | 2842482897 | 2842482326 | Bacteria | 7212537 |
| 728 | 2842493800 | 2842489311 | Bacteria | 6620893 |
| 729 | 2842497244 | 2842495871 | Bacteria | 6820686 |
| 730 | 2842504738 | 2842502639 | Bacteria | 6604161 |
| 731 | 2842509773 | 2842509118 | Bacteria | 6850950 |
| 732 | 2842526293 | 2842521101 | Bacteria | 6569494 |
| 733 | 2842924860 | 2842922631 | Bacteria | 5824079 |
| 734 | 2844168457 | 2844163670 | Bacteria | 7266046 |
| 735 | 2844455079 | 2844454524 | Bacteria | 7952546 |
| 736 | 2847418164 | 2847417321 | Bacteria | 6913799 |
| 737 | 2850080533 | 2850079185 | Bacteria | 6848280 |
| 738 | 2854897231 | 2854896431 | Bacteria | 5869725 |
| 739 | 2854922139 | 2854916844 | Bacteria | 5725939 |
| 740 | 2855831426 | 2855825444 | Bacteria | 6785811 |
| 741 | 2855840550 | 2855839649 | Bacteria | 7135830 |
| 742 | 2855878882 | 2855872281 | Bacteria | 6964271 |
| 743 | 2857520247 | 2857516855 | Bacteria | 7787325 |
| 744 | 2857531912 | 2857531043 | Bacteria | 6754041 |
| 745 | 2858801078 | 2858800743 | Bacteria | 6603254 |
| 746 | 2891376458 | 2891373044 | Bacteria | 5202277 |
| 747 | 2896386697 | 2896384573 | Bacteria | 7700774 |
| 748 | 2913297391 | 2913295892 | Bacteria | 6333755 |
| 749 | 2913310913 | 2913308742 | Bacteria | 5350706 |
| 750 | 2915986276 | 2915980308 | Bacteria | 6624279 |
| 751 | 2915988311 | 2915986958 | Bacteria | 6739310 |
| 752 | 2915996157 | 2915993759 | Bacteria | 7016183 |
| 753 | 2916001172 | 2916000859 | Bacteria | 6865702 |
| 754 | 2916014003 | 2916007675 | Bacteria | 6898660 |
| 755 | 2916020246 | 2916014648 | Bacteria | 6946486 |
| 756 | 2916025155 | 2916021584 | Bacteria | 6854472 |
| 757 | 2916032640 | 2916028427 | Bacteria | 6748433 |
| 758 | 2916040280 | 2916035215 | Bacteria | 6755766 |
| 759 | 2916044480 | 2916041962 | Bacteria | 6820487 |
| 760 | 2916049612 | 2916048683 | Bacteria | 6543552 |
| 761 | 2916055256 | 2916055098 | Bacteria | 6758838 |
| 762 | 2916062221 | 2916061851 | Bacteria | 6737736 |
| 763 | 2916070924 | 2916068649 | Bacteria | 6943657 |
| 764 | 2916076780 | 2916076590 | Bacteria | 6596108 |
| 765 | 2919103875 | 2919100787 | Bacteria | 7710546 |
| 766 | 2919168435 | 2919166419 | Bacteria | 4952238 |
| 767 | 2919171368 | 2919171160 | Bacteria | 6499771 |
| 768 | 2919409359 | 2919408235 | Bacteria | 6149349 |
| 769 | 2920762819 | 2920760137 | Bacteria | 7427611 |
| 770 | 2920823901 | 2920822456 | Bacteria | 6897201 |
| 771 | 2921204369 | 2921201388 | Bacteria | 6926299 |
| 772 | 2921210053 | 2921208531 | Bacteria | 6745326 |
| 773 | 2921240042 | 2921237296 | Bacteria | 6876710 |
| 774 | 2921246198 | 2921244191 | Bacteria | 6568419 |
| 775 | 2921251057 | 2921250672 | Bacteria | 6677771 |
| 776 | 2921257888 | 2921257292 | Bacteria | 6808382 |
| 777 | 2921264133 | 2921263974 | Bacteria | 6864552 |
| 778 | 2921286251 | 2921282425 | Bacteria | 6826397 |
| 779 | 2921294828 | 2921289301 | Bacteria | 7316391 |
| 780 | 2921299629 | 2921296804 | Bacteria | 7176999 |
| 781 | 2923557521 | 2923556063 | Bacteria | 6793593 |
| 782 | 2924146583 | 2924144063 | Bacteria | 6883928 |
| 783 | 2924151200 | 2924150972 | Bacteria | 7169444 |
| 784 | 2924160677 | 2924158325 | Bacteria | 7188855 |
| 785 | 2924171715 | 2924165586 | Bacteria | 7260590 |
| 786 | 2924177522 | 2924172951 | Bacteria | 6749356 |
| 787 | 2924185888 | 2924179722 | Bacteria | 6843264 |
| 788 | 2924188722 | 2924186466 | Bacteria | 6876637 |
| 789 | 2924198166 | 2924193448 | Bacteria | 6955718 |
| 790 | 2924203024 | 2924200457 | Bacteria | 6757188 |
| 791 | 2924212630 | 2924207177 | Bacteria | 6917007 |
| 792 | 2924220462 | 2924214083 | Bacteria | 7080103 |
| 793 | 2924226764 | 2924221636 | Bacteria | 7113495 |
| 794 | 2924230293 | 2924228884 | Bacteria | 6633132 |
| 795 | 2929139568 | 2929138655 | Bacteria | 5810547 |
| 796 | 2933019567 | 2933016740 | Bacteria | 6355406 |
| 797 | 2933573166 | 2933570622 | Bacteria | 7023390 |
| 798 | 2933591420 | 2933586486 | Bacteria | 7667493 |
| 799 | 2933604654 | 2933599457 | Bacteria | 5858799 |
| 800 | 2935895101 | 2935894831 | Bacteria | 6620579 |
| 801 | 2935904085 | 2935901341 | Bacteria | 7341747 |
| 802 | 2936368077 | 2936367885 | Bacteria | 7324495 |
| 803 | 2936381529 | 2936375103 | Bacteria | 6652732 |
| 804 | 2936384900 | 2936381700 | Bacteria | 7006523 |
| 805 | 2937000999 | 2936996657 | Bacteria | 6298727 |
| 806 | 2937004319 | 2937002841 | Bacteria | 6934057 |
| 807 | 2937011072 | 2937009748 | Bacteria | 6746052 |
| 808 | 2937019404 | 2937016420 | Bacteria | 6782579 |
| 809 | 2937028504 | 2937023124 | Bacteria | 6815156 |
| 810 | 2937029763 | 2937029754 | Bacteria | 6424026 |
| 811 | 2937036789 | 2937036028 | Bacteria | 6846469 |
| 812 | 2937048315 | 2937042894 | Bacteria | 6741576 |
| 813 | 2937056086 | 2937049772 | Bacteria | 6757901 |
| 814 | 2937059175 | 2937056579 | Bacteria | 7107896 |
| 815 | 2937067837 | 2937063883 | Bacteria | 7199456 |
| 816 | 2937073940 | 2937071275 | Bacteria | 6984483 |
| 817 | 2937082869 | 2937078374 | Bacteria | 6610289 |
| 818 | 2937090527 | 2937084907 | Bacteria | 6618516 |
| 819 | 2937095693 | 2937091812 | Bacteria | 6979387 |
| 820 | 2937104114 | 2937098957 | Bacteria | 7249374 |
| 821 | 2937110731 | 2937106411 | Bacteria | 6947143 |
| 822 | 2937113970 | 2937113482 | Bacteria | 6505872 |
| 823 | 2937125467 | 2937119839 | Bacteria | 6597547 |
| 824 | 2937129035 | 2937126314 | Bacteria | 6771275 |
| 825 | 2941500157 | 2941499720 | Bacteria | 7599444 |
| 826 | 2957379922 | 2957375807 | Bacteria | 6425588 |
| 827 | 2957382750 | 2957382221 | Bacteria | 6737050 |
| 828 | 2957389028 | 2957388812 | Bacteria | 6778072 |
| 829 | 2957398332 | 2957395598 | Bacteria | 6822399 |
| 830 | 2957407537 | 2957402308 | Bacteria | 6741770 |
| 831 | 2957411611 | 2957408893 | Bacteria | 6558585 |
| 832 | 2957418880 | 2957415311 | Bacteria | 6991633 |
| 833 | 2957429863 | 2957422303 | Bacteria | 7172205 |
| 834 | 2957432542 | 2957430029 | Bacteria | 7022557 |
| 835 | 2957438990 | 2957437181 | Bacteria | 6568994 |
| 836 | 2957446524 | 2957443900 | Bacteria | 6869977 |
| 837 | 2957456584 | 2957450854 | Bacteria | 6765715 |
| 838 | 2957463342 | 2957457609 | Bacteria | 6967680 |
| 839 | 2957466628 | 2957464669 | Bacteria | 6568877 |
| 840 | 2957473176 | 2957471148 | Bacteria | 6797643 |
| 841 | 2957479916 | 2957478035 | Bacteria | 6756658 |
| 842 | 2957486105 | 2957484790 | Bacteria | 6703082 |
| 843 | 2957496258 | 2957491536 | Bacteria | 6695180 |
| 844 | 2957503557 | 2957498199 | Bacteria | 7126688 |
| 845 | 2957509251 | 2957505466 | Bacteria | 7253085 |
| 846 | 2960588730 | 2960584000 | Bacteria | 6864594 |
| 847 | 2960595676 | 2960591022 | Bacteria | 6622873 |
| 848 | 2960601603 | 2960597568 | Bacteria | 6550735 |
| 849 | 2960608559 | 2960603979 | Bacteria | 6898737 |
| 850 | 2960611906 | 2960610863 | Bacteria | 6691244 |
| 851 | 2960617805 | 2960617483 | Bacteria | 6727748 |
| 852 | 2960630673 | 2960624210 | Bacteria | 6875384 |
| 853 | 2960633122 | 2960631154 | Bacteria | 6732508 |
| 854 | 2960643193 | 2960637947 | Bacteria | 7296468 |
| 855 | 2960645789 | 2960645483 | Bacteria | 7211087 |
| 856 | 2960658007 | 2960652885 | Bacteria | 7083688 |
| 857 | 2960666508 | 2960660292 | Bacteria | 7041660 |
| 858 | 2960668695 | 2960667422 | Bacteria | 6763020 |
| 859 | 2960675888 | 2960674078 | Bacteria | 6609048 |
| 860 | 2960684265 | 2960680706 | Bacteria | 6624464 |
| 861 | 2960689072 | 2960687367 | Bacteria | 6535474 |
| 862 | 2960696793 | 2960693952 | Bacteria | 6749742 |
| 863 | 2964609489 | 2964607997 | Bacteria | 7101408 |
| 864 | 2964616024 | 2964615318 | Bacteria | 6809089 |
| 865 | 2964625076 | 2964621998 | Bacteria | 6834995 |
| 866 | 2964635380 | 2964628898 | Bacteria | 7083044 |
| 867 | 2964642536 | 2964636051 | Bacteria | 7091832 |
| 868 | 2964646922 | 2964643177 | Bacteria | 6820887 |
| 869 | 2964656339 | 2964649959 | Bacteria | 6675118 |
| 870 | 2964659731 | 2964656573 | Bacteria | 7100150 |
| 871 | 2964665579 | 2964663802 | Bacteria | 7019362 |
| 872 | 2964672025 | 2964670856 | Bacteria | 6851364 |
| 873 | 2964679414 | 2964678106 | Bacteria | 6792020 |
| 874 | 2964688252 | 2964685014 | Bacteria | 6839111 |
| 875 | 2964692142 | 2964691889 | Bacteria | 6802758 |
| 876 | 2964703521 | 2964698721 | Bacteria | 6765331 |
| 877 | 2964708593 | 2964705432 | Bacteria | 7114648 |
| 878 | 2964718659 | 2964712639 | Bacteria | 6695970 |
| 879 | 2964722297 | 2964719344 | Bacteria | 7286602 |
| 880 | 2967668676 | 2967664464 | Bacteria | 6948836 |
| 881 | 2967677142 | 2967671571 | Bacteria | 7021409 |
| 882 | 2967681625 | 2967678726 | Bacteria | 7264382 |
| 883 | 2967687137 | 2967686174 | Bacteria | 6678622 |
| 884 | 2967693349 | 2967693043 | Bacteria | 6804451 |
| 885 | 2967702568 | 2967699805 | Bacteria | 6854538 |
| 886 | 2967707815 | 2967706974 | Bacteria | 7186053 |
| 887 | 2967716425 | 2967714385 | Bacteria | 7000047 |
| 888 | 2967723325 | 2967721400 | Bacteria | 7073753 |
| 889 | 2967734631 | 2967728569 | Bacteria | 6641507 |
| 890 | 2967735547 | 2967735183 | Bacteria | 6827012 |
| 891 | 2967745775 | 2967742019 | Bacteria | 6794534 |
| 892 | 2967754502 | 2967748971 | Bacteria | 6733771 |
| 893 | 2967756998 | 2967755722 | Bacteria | 6814706 |
| 894 | 2967763900 | 2967762386 | Bacteria | 6923502 |
| 895 | 2967771676 | 2967769361 | Bacteria | 6587838 |
| 896 | 2967776698 | 2967775926 | Bacteria | 6738189 |
| 897 | 2970020542 | 2970019648 | Bacteria | 7072033 |
| 898 | 2970032652 | 2970026789 | Bacteria | 6785236 |
| 899 | 2970035729 | 2970033650 | Bacteria | 7118744 |
| 900 | 2970045418 | 2970040964 | Bacteria | 6731123 |
| 901 | 2970050478 | 2970047711 | Bacteria | 7088379 |
| 902 | 2970057923 | 2970054988 | Bacteria | 6611507 |
| 903 | 2970067789 | 2970061556 | Bacteria | 7099761 |
| 904 | 2970072003 | 2970068827 | Bacteria | 7123112 |
| 905 | 2970081398 | 2970076120 | Bacteria | 6697332 |
| 906 | 2970088307 | 2970082768 | Bacteria | 6183754 |
| 907 | 2970091610 | 2970088815 | Bacteria | 6933825 |
| 908 | 2970100958 | 2970095765 | Bacteria | 6936963 |
| 909 | 2970105072 | 2970102677 | Bacteria | 6812532 |
| 910 | 2970114590 | 2970109326 | Bacteria | 6863976 |
| 911 | 2970117823 | 2970116247 | Bacteria | 6501857 |
| 912 | 2970124355 | 2970122695 | Bacteria | 6625855 |
| 913 | 2970129621 | 2970129317 | Bacteria | 6806560 |
| 914 | 2970136503 | 2970136068 | Bacteria | 7207982 |
| 915 | 2970144476 | 2970143518 | Bacteria | 6446480 |
| 916 | 2970155830 | 2970149975 | Bacteria | 6779706 |
| 917 | 2970162891 | 2970156795 | Bacteria | 7168044 |
| 918 | 2970166852 | 2970164137 | Bacteria | 6861252 |
| 919 | 2970176029 | 2970170962 | Bacteria | 6876229 |
| 920 | 2970178477 | 2970177841 | Bacteria | 6768001 |
| 921 | 2970187389 | 2970184632 | Bacteria | 7054431 |
| 922 | 2970194277 | 2970191845 | Bacteria | 7032787 |
| 923 | 2977517872 | 2977516862 | Bacteria | 6940108 |
| 924 | 2977529807 | 2977523885 | Bacteria | 6960446 |
| 925 | 2977536956 | 2977530762 | Bacteria | 6951399 |
| 926 | 2977538091 | 2977537788 | Bacteria | 6929320 |
| 927 | 2977545990 | 2977544691 | Bacteria | 6875412 |
| 928 | 2977552091 | 2977551784 | Bacteria | 7125765 |
| 929 | 2977562813 | 2977558990 | Bacteria | 6863948 |
| 930 | 2977566316 | 2977565890 | Bacteria | 6901543 |
| 931 | 2977576536 | 2977572785 | Bacteria | 6763888 |
| 932 | 2977581196 | 2977579622 | Bacteria | 6772100 |
| 933 | 2978971104 | 2978969890 | Bacteria | 5400756 |
| 934 | 2984588266 | 2984587000 | Bacteria | 5263363 |
| 935 | 2989354104 | 2989349275 | Bacteria | 6349068 |
| 936 | 2989772118 | 2989771324 | Bacteria | 5605128 |
| 937 | 2996888733 | 2996887358 | Bacteria | 5795980 |
| 938 | 2996895130 | 2996893221 | Bacteria | 5823108 |
| 939 | 3005412492 | 3005409236 | Bacteria | 7188837 |
| 940 | 3005417188 | 3005416602 | Bacteria | 7064308 |
| 941 | 3005446802 | 3005445848 | Bacteria | 6906074 |
| 942 | 3005453497 | 3005452660 | Bacteria | 5889319 |
| 943 | 639647475 | 639633055 | Bacteria | 7751309 |
| 944 | 643825140 | 643692032 | Bacteria | 6891900 |
| 945 | 648736468 | 648276728 | Bacteria | 6968865 |
| 946 | 8003993050 | 8003992118 | Bacteria | 7266902 |
| 947 | 8004000286 | 8003999396 | Bacteria | 7063185 |
| 948 | 8005260005 | 8005258706 | Bacteria | 6184835 |
| 949 | 8005279634 | 8005275841 | Bacteria | 6929066 |
| 950 | 8005284733 | 8005282627 | Bacteria | 6675747 |
| 951 | 8005292835 | 8005289223 | Bacteria | 6634003 |
| 952 | 8005304641 | 8005301065 | Bacteria | 6614431 |
| 953 | 8005311139 | 8005307578 | Bacteria | 7395396 |
| 954 | 8005315249 | 8005314921 | Bacteria | 7072929 |
| 955 | 8005323260 | 8005321885 | Bacteria | 5795980 |
| 956 | 8005376564 | 8005376324 | Bacteria | 6590079 |
| 957 | 8005385953 | 8005382845 | Bacteria | 6732062 |
| 958 | 8005400264 | 8005395548 | Bacteria | 6806915 |
| 959 | 8005437124 | 8005430974 | Bacteria | 6689030 |
| 960 | 8005461973 | 8005460587 | Bacteria | 7157962 |
| 961 | 8005485580 | 8005484373 | Bacteria | 6297373 |
| 962 | 8005499381 | 8005497431 | Bacteria | 6477605 |
| 963 | 8005544400 | 8005542996 | Bacteria | 7077758 |
| 964 | 8005558884 | 8005556819 | Bacteria | 6908598 |
| 965 | 8005570479 | 8005563573 | Bacteria | 7153261 |
| 966 | 8005572736 | 8005570704 | Bacteria | 6957481 |
| 967 | 8005620571 | 8005619151 | Bacteria | 7030230 |
| 968 | 8005627466 | 8005626139 | Bacteria | 6534237 |
| 969 | 8005649896 | 8005645114 | Bacteria | 6950293 |
| 970 | 8005659927 | 8005658619 | Bacteria | 4500593 |
| 971 | 8005670797 | 8005668836 | Bacteria | 6953162 |
| 972 | 8005684519 | 8005682033 | Bacteria | 6726518 |
| 973 | 8005691066 | 8005688590 | Bacteria | 6610080 |
| 974 | 8005698735 | 8005695170 | Bacteria | 6912330 |
| 975 | 8018131377 | 8018127388 | Bacteria | 7351159 |
| 976 | 8018169466 | 8018163183 | Bacteria | 7277977 |
| 977 | 8018182553 | 8018176218 | Bacteria | 6896178 |
| 978 | 8023686904 | 8023680758 | Bacteria | 7729763 |
| 979 | 8024481149 | 8024479707 | Bacteria | 6954785 |
| 980 | 8024489711 | 8024486573 | Bacteria | 6540512 |
| 981 | 8024503209 | 8024501048 | Bacteria | 6427847 |
| 982 | 8046767725 | 8046767195 | Bacteria | 7547379 |
| 983 | 8049293975 | 8049293176 | Bacteria | 6128433 |
| 984 | 8055434240 | 8055431914 | Bacteria | 4551896 |
| 985 | 8056380774 | 8056375014 | Bacteria | 7006639 |
| 986 | 8056384703 | 8056382006 | Bacteria | 6408074 |
| 987 | 8056876535 | 8056875544 | Bacteria | 4355797 |
| 988 | 8057582149 | 8057575449 | Bacteria | 7367519 |
| 989 | 8057879912 | 8057874678 | Bacteria | 7494653 |
| 990 | RicEn_C8180 | |||
| 991 | JGI25155J39150_1000032 | |||
| 992 | JGI25156J39149_1000129 | |||
| 993 | JGI25162J39368_1000663 | |||
| 994 | JGI25154J39366_1000393 | |||
| 995 | JGI25158J39367_1004696 | |||
| 996 | JGI25157J39369_1000061 | |||
| 997 | JGI25152J39213_1000780 | |||
| 998 | JGI25152J39213_1001828 | |||
| 999 | JGI25152J39213_1005400 | |||
| 1000 | JGI25152J39213_1006674 | |||
| 1001 | JGI25150J39212_1000033 | |||
| 1002 | JGI25150J39212_1005579 | |||
| 1003 | JGI25150J39212_1007494 | |||
| 1004 | JGI25159J45721_1000002 | |||
| 1005 | JGI25159J45721_1000539 | |||
| 1006 | JGI25151J46595_10000108 | |||
| 1007 | JGI25151J46595_10000591 | |||
| 1008 | JGI25151J46595_10001664 | |||
| 1009 | JGI25151J46595_10004059 | |||
| 1010 | JGI25151J46595_10026643 | |||
| 1011 | JGI25165J46597_1000887 | |||
| 1012 | JGI25165J46597_1001344 | |||
| 1013 | JGI25165J46597_1009603 | |||
| 1014 | JGI25153J46596_10000780 | |||
| 1015 | JGI25153J46596_10025870 | |||
| 1016 | JGI25153J46596_10026083 | |||
| 1017 | JGI25153J46596_10047530 | |||
| 1018 | rootL2_10016212 | |||
| 1019 | rootL2_10087531 | |||
| 1020 | JGI25160J50197_1000008 | |||
| 1021 | JGI25160J50197_1000015 | |||
| 1022 | JGI25160J50197_1000191 | |||
| 1023 | JGI25160J50197_1011039 | |||
| 1024 | JGI25161J50226_1000005 | |||
| 1025 | JGI25161J50226_1000051 | |||
| 1026 | JGI25161J50226_1000645 | |||
| 1027 | JGI25161J50226_1002162 | |||
| 1028 | Ga0055539_1002106 | |||
| 1029 | Ga0055526_1006943 | |||
| 1030 | Ga0055526_1007111 | |||
| 1031 | Ga0055526_1030599 | |||
| 1032 | Ga0055526_1046772 | |||
| 1033 | Ga0055526_1048253 | |||
| 1034 | Ga0055524_1001028 | |||
| 1035 | Ga0055524_1038465 | |||
| 1036 | Ga0055528_1000201 | |||
| 1037 | Ga0055528_1005168 | |||
| 1038 | Ga0055528_1006194 | |||
| 1039 | Ga0055528_1014920 | |||
| 1040 | Ga0055528_1016650 | |||
| 1041 | Ga0055528_1029202 | |||
| 1042 | Ga0055530_10006713 | |||
| 1043 | Ga0055540_1000220 | |||
| 1044 | Ga0055540_1003015 | |||
| 1045 | Ga0055540_1008253 | |||
| 1046 | Ga0055540_1010689 | |||
| 1047 | Ga0055531_10002199 | |||
| 1048 | Ga0055531_10011531 | |||
| 1049 | Ga0055531_10025012 | |||
| 1050 | Ga0055543_1000012 | |||
| 1051 | Ga0055543_1000040 | |||
| 1052 | Ga0055543_1000258 | |||
| 1053 | Ga0055543_1001853 | |||
| 1054 | Ga0065165_1000015 | |||
| 1055 | Ga0065165_1000125 | |||
| 1056 | Ga0065165_1007789 | |||
| 1057 | Ga0065165_1007971 | |||
| 1058 | Ga0065165_1014790 | |||
| 1059 | Ga0070668_100049726 | |||
| 1060 | Ga0070669_100154288 | |||
| 1061 | Ga0070671_100048227 | |||
| 1062 | Ga0070667_100137138 | |||
| 1063 | Ga0070667_100411523 | |||
| 1064 | Ga0070662_100143598 | |||
| 1065 | Ga0070665_100020587 | |||
| 1066 | Ga0070665_100436866 | |||
| 1067 | Ga0068855_100270219 | |||
| 1068 | Ga0068856_100188527 | |||
| 1069 | Ga0075365_10000858 | |||
| 1070 | Ga0075365_10001303 | |||
| 1071 | Ga0075365_10002765 | |||
| 1072 | Ga0075364_10002314 | |||
| 1073 | Ga0075364_10080742 | |||
| 1074 | Ga0075362_10001499 | |||
| 1075 | Ga0075367_10002234 | |||
| 1076 | Ga0075367_10026454 | |||
| 1077 | Ga0075367_10094480 | |||
| 1078 | Ga0075369_10000760 | |||
| 1079 | Ga0075369_10107671 | |||
| 1080 | Ga0075370_10011081 | |||
| 1081 | Ga0075370_10052058 | |||
| 1082 | Ga0075370_10145295 | |||
| 1083 | Ga0079104_1000032 | |||
| 1084 | Ga0079104_1003297 | |||
| 1085 | Ga0079104_1006476 | |||
| 1086 | Ga0105250_10054287 | |||
| 1087 | Ga0105240_10000032 | |||
| 1088 | Ga0105248_10545507 | |||
| 1089 | Ga0105237_10002365 | |||
| 1090 | Ga0105237_10941201 | |||
| 1091 | Ga0123341_1008630 | |||
| 1092 | Ga0123341_1056455 | |||
| 1093 | Ga0123342_1042580 | |||
| 1094 | Ga0123342_1064466 | |||
| 1095 | Ga0105239_10012679 | |||
| 1096 | Ga0157373_10155408 | |||
| 1097 | Ga0157371_10010008 | |||
| 1098 | Ga0157371_10170756 | |||
| 1099 | Ga0157370_10006055 | |||
| 1100 | Ga0171463_1001 | |||
| 1101 | Ga0182007_10000460 | |||
| 1102 | Ga0182005_1001195 | |||
| 1103 | Ga0183363_1174 | |||
| 1104 | Ga0214544_1000017 | |||
| 1105 | Ga0214542_1000006 | |||
| 1106 | Ga0214542_1023682 | |||
| 1107 | Ga0214543_1000003 | |||
| 1108 | Ga0214543_1000014 | |||
| 1109 | Ga0228711_1000001 | |||
| 1110 | Ga0228710_1009445 | |||
| 1111 | Ga0209435_100042 | |||
| 1112 | Ga0209436_102619 | |||
| 1113 | Ga0209436_111258 | |||
| 1114 | Ga0209563_109026 | |||
| 1115 | Ga0209437_100033 | |||
| 1116 | Ga0209437_100075 | |||
| 1117 | Ga0207425_1000031 | |||
| 1118 | Ga0207425_1002025 | |||
| 1119 | Ga0207425_1005375 | |||
| 1120 | Ga0207425_1019359 | |||
| 1121 | Ga0209646_1000145 | |||
| 1122 | Ga0209026_1000160 | |||
| 1123 | Ga0209677_101318 | |||
| 1124 | Ga0209148_1006231 | |||
| 1125 | Ga0209759_1000177 | |||
| 1126 | Ga0209129_1000053 | |||
| 1127 | Ga0209129_1000137 | |||
| 1128 | Ga0209129_1001658 | |||
| 1129 | Ga0209129_1003401 | |||
| 1130 | Ga0209129_1003754 | |||
| 1131 | Ga0209129_1004220 | |||
| 1132 | Ga0209233_1000056 | |||
| 1133 | Ga0209233_1000064 | |||
| 1134 | Ga0209233_1000209 | |||
| 1135 | Ga0209455_1022909 | |||
| 1136 | Ga0209673_1000041 | |||
| 1137 | Ga0209673_1000319 | |||
| 1138 | Ga0209673_1000603 | |||
| 1139 | Ga0209673_1001904 | |||
| 1140 | Ga0209673_1002052 | |||
| 1141 | Ga0209673_1005246 | |||
| 1142 | Ga0209673_1009732 | |||
| 1143 | Ga0209673_1023011 | |||
| 1144 | Ga0209673_1032712 | |||
| 1145 | Ga0209673_1047185 | |||
| 1146 | Ga0209130_1000006 | |||
| 1147 | Ga0209130_1000007 | |||
| 1148 | Ga0209130_1000018 | |||
| 1149 | Ga0209130_1017462 | |||
| 1150 | Ga0209676_1003604 | |||
| 1151 | Ga0209676_1005303 | |||
| 1152 | Ga0209676_1044856 | |||
| 1153 | Ga0209025_1000087 | |||
| 1154 | Ga0209025_1000165 | |||
| 1155 | Ga0209025_1000199 | |||
| 1156 | Ga0209025_1000580 | |||
| 1157 | Ga0209025_1001754 | |||
| 1158 | Ga0209025_1008148 | |||
| 1159 | Ga0209025_1014633 | |||
| 1160 | Ga0209025_1080515 | |||
| 1161 | Ga0209025_1082706 | |||
| 1162 | Ga0209564_1000330 | |||
| 1163 | Ga0209564_1000425 | |||
| 1164 | Ga0209564_1000431 | |||
| 1165 | Ga0209564_1001106 | |||
| 1166 | Ga0209564_1010463 | |||
| 1167 | Ga0209564_1010632 | |||
| 1168 | Ga0209564_1046144 | |||
| 1169 | Ga0209758_1000081 | |||
| 1170 | Ga0209758_1000333 | |||
| 1171 | Ga0209758_1000890 | |||
| 1172 | Ga0209758_1002059 | |||
| 1173 | Ga0209758_1002402 | |||
| 1174 | Ga0209758_1002927 | |||
| 1175 | Ga0209758_1007332 | |||
| 1176 | Ga0209758_1008991 | |||
| 1177 | Ga0209758_1027802 | |||
| 1178 | Ga0209050_1008722 | |||
| 1179 | Ga0209050_1011419 | |||
| 1180 | Ga0209256_1000877 | |||
| 1181 | Ga0209256_1001695 | |||
| 1182 | Ga0209256_1002866 | |||
| 1183 | Ga0209256_1008034 | |||
| 1184 | Ga0209256_1009074 | |||
| 1185 | Ga0209256_1011652 | |||
| 1186 | Ga0209256_1026291 | |||
| 1187 | Ga0209256_1028526 | |||
| 1188 | Ga0209256_1029895 | |||
| 1189 | Ga0207426_1000044 | |||
| 1190 | Ga0207426_1000064 | |||
| 1191 | Ga0207426_1000106 | |||
| 1192 | Ga0207426_1000119 | |||
| 1193 | Ga0207426_1007834 | |||
| 1194 | Ga0209051_1000198 | |||
| 1195 | Ga0209051_1001443 | |||
| 1196 | Ga0209051_1001611 | |||
| 1197 | Ga0209051_1002094 | |||
| 1198 | Ga0209051_1002200 | |||
| 1199 | Ga0209051_1012227 | |||
| 1200 | Ga0209051_1017935 | |||
| 1201 | Ga0209051_1064595 | |||
| 1202 | Ga0209257_1001713 | |||
| 1203 | Ga0209257_1002246 | |||
| 1204 | Ga0209257_1004254 | |||
| 1205 | Ga0207696_1052960 | |||
| 1206 | Ga0207695_10000024 | |||
| 1207 | Ga0207671_10000718 | |||
| 1208 | Ga0207681_10132609 | |||
| 1209 | Ga0207644_10081513 | |||
| 1210 | Ga0207711_10281284 | |||
| 1211 | Ga0207667_10256933 | |||
| 1212 | Ga0207668_10731214 | |||
| 1213 | Ga0207658_10400265 | |||
| 1214 | Ga0207658_10464945 | |||
| 1215 | Ga0207702_10069827 | |||
| 1216 | Ga0209281_1000053 | |||
| 1217 | Ga0209281_1000236 | |||
| 1218 | Ga0209281_1000266 | |||
| 1219 | Ga0209371_1001236 | |||
| 1220 | Ga0209282_1000007 | |||
| 1221 | Ga0268266_10034684 | |||
| 1222 | Ga0268266_10082429 | |||
| 1223 | Ga0307515_10000070 | |||
| 1224 | Ga0307515_10009393 | |||
| 1225 | Ga0307515_10010607 | |||
| 1226 | Ga0268256_1000846 | |||
| 1227 | Ga0307513_10017679 | |||
| 1228 | Ga0307513_10158861 | |||
| 1229 | Ga0307408_100076443 | |||
| 1230 | Ga0307408_100180951 | |||
| 1231 | Ga0307405_10001075 | |||
| 1232 | Ga0315914_1000027 | |||
| 1233 | Ga0307416_100403817 | |||
| 1234 | Ga0307414_10050768 | |||
| 1235 | Ga0307414_10271099 | |||
| 1236 | Ga0315913_1007081 | |||
| 1237 | Ga0315915_1000001 | |||
| 1238 | Ga0395898_0001330 | |||
| 1239 | Ga0395898_0231514 | |||
| 1240 | Ga0439436_0023455 | |||
| 1241 | Ga0439465_0011488 | |||
| 1242 | Ga0439465_0029101 | |||
| 1243 | Ga0451789_1302009 | |||
| 1244 | Ga0451804_0002771 | |||
| 1245 | Ga0451837_0064596 | |||
| 1246 | Ga0451851_0918442 | |||
| 1247 | Ga0439431_0019365 | |||
| 1248 | Ga0439449_0006294 | |||
| 1249 | Ga0439462_0080216 | |||
| 1250 | Ga0450920_032091 | |||
| 1251 | Ga0450918_010688 | |||
| 1252 | Ga0466965_0252102 | |||
| 1253 | Ga0466966_0178973 | |||
| 1254 | Ga0466971_0125591 | |||
| 1255 | Ga0466970_0024461 | |||
| 1256 | Ga0466957_0155377 | |||
| 1257 | Ga0495592_0144181 | |||
| 1258 | Ga0495638_0003817 | |||
| 1259 | Ga0495638_0125108 | |||
| 1260 | Ga0495605_0012582 | |||
| 1261 | Ga0495605_0023575 | |||
| 1262 | Ga0495662_0081522 | |||
| 1263 | Ga0495585_0011550 | |||
| 1264 | Ga0495585_0034909 | |||
| 1265 | Ga0495585_0117381 | |||
| 1266 | Ga0495585_0199681 | |||
| 1267 | Ga0495596_0077456 | |||
| 1268 | Ga0495596_0090392 | |||
| 1269 | Ga0495607_0145948 | |||
| 1270 | Ga0495583_0004596 | |||
| 1271 | Ga0495583_0072744 | |||
| 1272 | Ga0495583_0090837 | |||
| 1273 | Ga0495583_0168006 | |||
| 1274 | Ga0495606_0007105 | |||
| 1275 | Ga0495606_0057661 | |||
| 1276 | Ga0495606_0064261 | |||
| 1277 | Ga0495606_0240582 | |||
| 1278 | Ga0495610_0006488 | |||
| 1279 | Ga0495610_0052755 | |||
| 1280 | Ga0495616_0051421 | |||
| 1281 | Ga0495616_0156439 | |||
| 1282 | Ga0495620_0027499 | |||
| 1283 | Ga0495620_0123860 | |||
| 1284 | Ga0495631_0003953 | |||
| 1285 | Ga0495632_0047588 | |||
| 1286 | Ga0495632_0054258 | |||
| 1287 | Ga0495632_0097236 | |||
| 1288 | Ga0495632_0208775 | |||
| 1289 | Ga0495643_0007584 | |||
| 1290 | Ga0495643_0144093 | |||
| 1291 | Ga0495643_0182879 | |||
| 1292 | Ga0495648_0113621 | |||
| 1293 | Ga0495648_0156448 | |||
| 1294 | Ga0495654_0000092 | |||
| 1295 | Ga0495640_0229714 | |||
| 1296 | Ga0495597_0020363 | |||
| 1297 | Ga0495622_0023797 | |||
| 1298 | Ga0495633_0030286 | |||
| 1299 | Ga0495668_0004226 | |||
| 1300 | Ga0495611_0005820 | |||
| 1301 | Ga0495625_0000883 | |||
| 1302 | Ga0495625_0059900 | |||
| 1303 | Ga0495625_0089923 | |||
| 1304 | Ga0495625_0094275 | |||
| 1305 | Ga0495588_0007417 | |||
| 1306 | Ga0495657_0072547 | |||
| 1307 | Ga0495658_0031269 | |||
| 1308 | Ga0495670_0027972 | |||
| 1309 | Ga0495670_0034596 | |||
| 1310 | Ga0495671_0070913 | |||
| 1311 | Ga0495649_0146708 | |||
| 1312 | Ga0495660_0054059 | |||
| 1313 | Ga0495604_0091348 | |||
| 1314 | Ga0495676_0259054 | |||
| 1315 | Ga0495683_0114332 | |||
| 1316 | Ga0495687_075633 | |||
| 1317 | Ga0495687_105200 | |||
| 1318 | Ga0495686_0001036 | |||
| 1319 | Ga0495686_0051972 | |||
| 1320 | Ga0495686_0057032 | |||
| 1321 | Ga0495686_0064874 | |||
| 1322 | Ga0495686_0124044 | |||
| 1323 | Ga0495686_0167874 | |||
| 1324 | Ga0495602_0301252 | |||
| 1325 | Ga0496100_0133374 | |||
| 1326 | Ga0496101_0240218 | |||
| 1327 | Ga0496101_0281805 | |||
| 1328 | Ga0496102_0054748 | |||
| 1329 | Ga0496102_0333112 | |||
| 1330 | Ga0496104_0334753 | |||
| 1331 | Ga0496105_0253413 | |||
| 1332 | Ga0496106_0002977 | |||
| 1333 | Ga0496106_0252502 | |||
| 1334 | Ga0496110_0188438 | |||
| 1335 | Ga0496110_0270374 | |||
| 1336 | Ga0496111_0002706 | |||
| 1337 | Ga0496111_0071455 | |||
| 1338 | Ga0496114_0218178 | |||
| 1339 | Ga0496114_0286362 | |||
| 1340 | Ga0496116_0000026 | |||
| 1341 | Ga0496116_0010291 | |||
| 1342 | Ga0496116_0041340 | |||
| 1343 | Ga0496116_0045458 | |||
| 1344 | Ga0496116_0064541 | |||
| 1345 | Ga0496116_0151311 | |||
| 1346 | Ga0496116_0177001 | |||
| 1347 | Ga0496117_0001867 | |||
| 1348 | Ga0496117_0026098 | |||
| 1349 | Ga0496117_0027157 | |||
| 1350 | Ga0496117_0064728 | |||
| 1351 | Ga0496117_0118530 | |||
| 1352 | Ga0496117_0317604 | |||
| 1353 | Ga0496118_0012870 | |||
| 1354 | Ga0496118_0075238 | |||
| 1355 | Ga0496118_0076515 | |||
| 1356 | Ga0496118_0077503 | |||
| 1357 | Ga0496118_0189393 | |||
| 1358 | Ga0496119_0046197 | |||
| 1359 | Ga0496119_0056778 | |||
| 1360 | Ga0496119_0253603 | |||
| 1361 | Ga0496120_0058615 | |||
| 1362 | Ga0496120_0088341 | |||
| 1363 | Ga0496120_0090609 | |||
| 1364 | Ga0496120_0094175 | |||
| 1365 | Ga0496120_0181335 | |||
| 1366 | Ga0496120_0201343 | |||
| 1367 | Ga0496121_0000001 | |||
| 1368 | Ga0496121_0003347 | |||
| 1369 | Ga0496121_0005117 | |||
| 1370 | Ga0496121_0012537 | |||
| 1371 | Ga0496121_0048389 | |||
| 1372 | Ga0496121_0171180 | |||
| 1373 | Ga0496121_0221843 | |||
| 1374 | Ga0496121_0292677 | |||
| 1375 | Ga0496121_0366396 | |||
| 1376 | Ga0496122_0000160 | |||
| 1377 | Ga0496122_0000604 | |||
| 1378 | Ga0496122_0011685 | |||
| 1379 | Ga0496122_0012377 | |||
| 1380 | Ga0496122_0021819 | |||
| 1381 | Ga0496122_0052823 | |||
| 1382 | Ga0496122_0066147 | |||
| 1383 | Ga0496122_0074595 | |||
| 1384 | Ga0496122_0076327 | |||
| 1385 | Ga0496122_0077456 | |||
| 1386 | Ga0496122_0116511 | |||
| 1387 | Ga0496123_0000034 | |||
| 1388 | Ga0496123_0000103 | |||
| 1389 | Ga0496123_0003820 | |||
| 1390 | Ga0496123_0008044 | |||
| 1391 | Ga0496123_0009653 | |||
| 1392 | Ga0496123_0035193 | |||
| 1393 | Ga0496123_0037959 | |||
| 1394 | Ga0496123_0154418 | |||
| 1395 | Ga0496124_0005176 | |||
| 1396 | Ga0496124_0026701 | |||
| 1397 | Ga0496124_0051147 | |||
| 1398 | Ga0496124_0051672 | |||
| 1399 | Ga0496124_0054451 | |||
| 1400 | Ga0496124_0089653 | |||
| 1401 | Ga0496124_0118710 | |||
| 1402 | Ga0496124_0134272 | |||
| 1403 | Ga0496124_0222439 | |||
| 1404 | Ga0496124_0223040 | |||
| 1405 | Ga0496124_0250781 | |||
| 1406 | Ga0496124_0385537 | |||
| 1407 | Ga0496124_0385834 | |||
| 1408 | Ga0496124_0416599 | |||
| 1409 | Ga0496124_0452872 | |||
| 1410 | Ga0496125_0000001 | |||
| 1411 | Ga0496125_0004365 | |||
| 1412 | Ga0496125_0006606 | |||
| 1413 | Ga0496125_0009397 | |||
| 1414 | Ga0496125_0060415 | |||
| 1415 | Ga0496125_0083000 | |||
| 1416 | Ga0496126_0000069 | |||
| 1417 | Ga0496126_0001336 | |||
| 1418 | Ga0496126_0006321 | |||
| 1419 | Ga0496126_0120569 | |||
| 1420 | Ga0496126_0134875 | |||
| 1421 | Ga0495678_013296 | |||
| 1422 | Ga0495678_032777 | |||
| 1423 | Ga0495682_0053778 | |||
| 1424 | Ga0501032_0083184 | |||
| 1425 | Ga0501033_0001329 | |||
| 1426 | Ga0501033_0295749 | |||
| 1427 | Ga0501038_0071732 | |||
| 1428 | Ga0501043_0188819 | |||
| 1429 | Ga0501083_0028579 | |||
| 1430 | Ga0501035_0056360 | |||
| 1431 | Ga0501035_0234835 | |||
| 1432 | nmdc:mga03683_32817_c1 | |||
| 1433 | nmdc:mga00v17_115_c2 | |||
| 1434 | nmdc:mga00v17_213458_c1 | |||
| 1435 | nmdc:mga0yw44_13140_c1 | |||
| 1436 | nmdc:mga0yw44_1335_c1 | |||
| 1437 | nmdc:mga07m45_68151_c1 | |||
| 1438 | Ga0495601_0363105 | |||
| 1439 | Ga0495619_0115713 | |||
| 1440 | Ga0500578_0147691 | |||
| 1441 | Ga0500643_035618 | |||
| 1442 | Ga0500569_004058 | |||
| 1443 | Ga0500572_008961 | |||
| 1444 | Ga0500594_0005380 | |||
| 1445 | Ga0500618_000575 | |||
| 1446 | Ga0500618_000896 | |||
| 1447 | Ga0500618_022804 | |||
| 1448 | Ga0500618_030371 | |||
| 1449 | Ga0500658_0006339 | |||
| 1450 | Ga0500658_0017189 | |||
| 1451 | Ga0500659_0051243 | |||
| 1452 | Ga0500568_0002529 | |||
| 1453 | Ga0500568_0008441 | |||
| 1454 | Ga0500590_001191 | |||
| 1455 | Ga0500616_0001190 | |||
| 1456 | Ga0500616_0001711 | |||
| 1457 | Ga0500622_0016729 | |||
| 1458 | Ga0500627_0066768 | |||
| 1459 | Ga0500627_0179684 | |||
| 1460 | Ga0500633_0011594 | |||
| 1461 | Ga0500636_0002064 | |||
| 1462 | Ga0500636_0264859 | |||
| 1463 | Ga0501082_0311353 | |||
| 1464 | Ga0501082_0321361 | |||
| 1465 | 2819684062 | |||
| 1466 | 2509108572 | |||
| 1467 | 2509374401 | |||
| 1468 | 2509387669 | |||
| 1469 | 2509443027 | |||
| 1470 | 2510132345 | |||
| 1471 | 2510305107 | |||
| 1472 | 2510898682 | |||
| 1473 | 2511137078 | |||
| 1474 | 2511172939 | |||
| 1475 | 2511186410 | |||
| 1476 | 2511197149 | |||
| 1477 | 2511501073 | |||
| 1478 | 2512532481 | |||
| 1479 | 2512972182 | |||
| 1480 | 2513569184 | |||
| 1481 | 2513578857 | |||
| 1482 | 2513582848 | |||
| 1483 | 2513596296 | |||
| 1484 | 2513603261 | |||
| 1485 | 2513616237 | |||
| 1486 | 2513632711 | |||
| 1487 | 2513709163 | |||
| 1488 | 2513871247 | |||
| 1489 | 2513881040 | |||
| 1490 | 2513902276 | |||
| 1491 | 2513908888 | |||
| 1492 | 2513925749 | |||
| 1493 | 2513983867 | |||
| 1494 | 2514001934 | |||
| 1495 | 2514004716 | |||
| 1496 | 2514020705 | |||
| 1497 | 2515111329 | |||
| 1498 | 2515608183 | |||
| 1499 | 2515638472 | |||
| 1500 | 2515644358 | |||
| 1501 | 2515659146 | |||
| 1502 | 2515740516 | |||
| 1503 | 2516208934 | |||
| 1504 | 2516892354 | |||
| 1505 | 2517039970 | |||
| 1506 | 2517075522 | |||
| 1507 | 2517094103 | |||
| 1508 | 2517405922 | |||
| 1509 | 2517569152 | |||
| 1510 | 2520378725 | |||
| 1511 | 2524451078 | |||
| 1512 | 2524460598 | |||
| 1513 | 2530643841 | |||
| 1514 | 2535515766 | |||
| 1515 | 2551680462 | |||
| 1516 | 2551683849 | |||
| 1517 | 2551695757 | |||
| 1518 | 2551698111 | |||
| 1519 | 2551713128 | |||
| 1520 | 2551721357 | |||
| 1521 | 2551745191 | |||
| 1522 | 2558863428 | |||
| 1523 | 2585165617 | |||
| 1524 | 2585203129 | |||
| 1525 | 2585221041 | |||
| 1526 | 2585231444 | |||
| 1527 | 2585256563 | |||
| 1528 | 2585266109 | |||
| 1529 | 2585273212 | |||
| 1530 | 2585278955 | |||
| 1531 | 2585325430 | |||
| 1532 | 2585329592 | |||
| 1533 | 2585387110 | |||
| 1534 | 2585392770 | |||
| 1535 | 2585400074 | |||
| 1536 | 2585528019 | |||
| 1537 | 2585530751 | |||
| 1538 | 2585541379 | |||
| 1539 | 2585549243 | |||
| 1540 | 2585554932 | |||
| 1541 | 2585559488 | |||
| 1542 | 2585822633 | |||
| 1543 | 2585839489 | |||
| 1544 | 2585847164 | |||
| 1545 | 2585902159 | |||
| 1546 | 2585905136 | |||
| 1547 | 2585995167 | |||
| 1548 | 2585999714 | |||
| 1549 | 2587979749 | |||
| 1550 | 2599333702 | |||
| 1551 | 2599418546 | |||
| 1552 | 2599722063 | |||
| 1553 | 2600191991 | |||
| 1554 | 2600375318 | |||
| 1555 | 2616296168 | |||
| 1556 | 2616305772 | |||
| 1557 | 2616553988 | |||
| 1558 | 2617384178 | |||
| 1559 | 2643807143 | |||
| 1560 | 2643809957 | |||
| 1561 | 2643857871 | |||
| 1562 | 2644007973 | |||
| 1563 | 2644046506 | |||
| 1564 | 2644069591 | |||
| 1565 | 2644108934 | |||
| 1566 | 2644151456 | |||
| 1567 | 2644196562 | |||
| 1568 | 2644200859 | |||
| 1569 | 2644206144 | |||
| 1570 | 2644239053 | |||
| 1571 | 2644311590 | |||
| 1572 | 2644329848 | |||
| 1573 | 2644380525 | |||
| 1574 | 2644420745 | |||
| 1575 | 2644454270 | |||
| 1576 | 2644479296 | |||
| 1577 | 2644493346 | |||
| 1578 | 2644502343 | |||
| 1579 | 2644546522 | |||
| 1580 | 2644617389 | |||
| 1581 | 2644649791 | |||
| 1582 | 2644675591 | |||
| 1583 | 2644689607 | |||
| 1584 | 2657683210 | |||
| 1585 | 2671115258 | |||
| 1586 | 2692316770 | |||
| 1587 | 2719180337 | |||
| 1588 | 2719384914 | |||
| 1589 | 2719664659 | |||
| 1590 | 2719731086 | |||
| 1591 | 2720491079 | |||
| 1592 | 2720612448 | |||
| 1593 | 2720619287 | |||
| 1594 | 2720630687 | |||
| 1595 | 2720774380 | |||
| 1596 | 2721146431 | |||
| 1597 | 2721157952 | |||
| 1598 | 2721163310 | |||
| 1599 | 2721398634 | |||
| 1600 | 2722839480 | |||
| 1601 | 2723026108 | |||
| 1602 | 2723559652 | |||
| 1603 | 2723566268 | |||
| 1604 | 2724037447 | |||
| 1605 | 2724043842 | |||
| 1606 | 2724088987 | |||
| 1607 | 2724103533 | |||
| 1608 | 2724109372 | |||
| 1609 | 2725946771 | |||
| 1610 | 2730107044 | |||
| 1611 | 2730163574 | |||
| 1612 | 2730297584 | |||
| 1613 | 2738802212 | |||
| 1614 | 2738946498 | |||
| 1615 | 2739035949 | |||
| 1616 | 2753460862 | |||
| 1617 | 2766067558 | |||
| 1618 | 2778177534 | |||
| 1619 | 2792584217 | |||
| 1620 | 2792622629 | |||
| 1621 | 2792628450 | |||
| 1622 | 2792638291 | |||
| 1623 | 2793296244 | |||
| 1624 | 2793317570 | |||
| 1625 | 2793321054 | |||
| 1626 | 2793327086 | |||
| 1627 | 2793333661 | |||
| 1628 | 2793339745 | |||
| 1629 | 2793347978 | |||
| 1630 | 2793357413 | |||
| 1631 | 2793358964 | |||
| 1632 | 2793367894 | |||
| 1633 | 2802717796 | |||
| 1634 | 2802723275 | |||
| 1635 | 2802733138 | |||
| 1636 | 2802736280 | |||
| 1637 | 2802743510 | |||
| 1638 | 2802750777 | |||
| 1639 | 2804751402 | |||
| 1640 | 2805926535 | |||
| 1641 | 2805933334 | |||
| 1642 | 2806046872 | |||
| 1643 | 2806052455 | |||
| 1644 | 2806058774 | |||
| 1645 | 2806067458 | |||
| 1646 | 2806074037 | |||
| 1647 | 2819611548 | |||
| 1648 | 2819639201 | |||
| 1649 | 2821124332 | |||
| 1650 | 2838017331 | |||
| 1651 | 2838023100 | |||
| 1652 | 2838031476 | |||
| 1653 | 2838037757 | |||
| 1654 | 2838048871 | |||
| 1655 | 2838049187 | |||
| 1656 | 2838063367 | |||
| 1657 | 2838074200 | |||
| 1658 | 2838076497 | |||
| 1659 | 2838662770 | |||
| 1660 | 2838670890 | |||
| 1661 | 2838681386 | |||
| 1662 | 2838688563 | |||
| 1663 | 2838694579 | |||
| 1664 | 2838703261 | |||
| 1665 | 2838707957 | |||
| 1666 | 2838730858 | |||
| 1667 | 2838741173 | |||
| 1668 | 2838744248 | |||
| 1669 | 2841844930 | |||
| 1670 | 2841856929 | |||
| 1671 | 2841865427 | |||
| 1672 | 2842080812 | |||
| 1673 | 2842115021 | |||
| 1674 | 2842121431 | |||
| 1675 | 2842144652 | |||
| 1676 | 2842147515 | |||
| 1677 | 2842160099 | |||
| 1678 | 2842168342 | |||
| 1679 | 2842183284 | |||
| 1680 | 2842197992 | |||
| 1681 | 2842199528 | |||
| 1682 | 2842207654 | |||
| 1683 | 2842221246 | |||
| 1684 | 2842235115 | |||
| 1685 | 2842237368 | |||
| 1686 | 2842245712 | |||
| 1687 | 2842252581 | |||
| 1688 | 2842259638 | |||
| 1689 | 2842266879 | |||
| 1690 | 2842274477 | |||
| 1691 | 2842281551 | |||
| 1692 | 2842287075 | |||
| 1693 | 2842294468 | |||
| 1694 | 2842302402 | |||
| 1695 | 2842306720 | |||
| 1696 | 2842314788 | |||
| 1697 | 2842318609 | |||
| 1698 | 2842343549 | |||
| 1699 | 2842360865 | |||
| 1700 | 2842365294 | |||
| 1701 | 2842371849 | |||
| 1702 | 2842380866 | |||
| 1703 | 2842387937 | |||
| 1704 | 2842398212 | |||
| 1705 | 2842404343 | |||
| 1706 | 2842410972 | |||
| 1707 | 2842417572 | |||
| 1708 | 2842427405 | |||
| 1709 | 2842431010 | |||
| 1710 | 2842436992 | |||
| 1711 | 2842443070 | |||
| 1712 | 2842453292 | |||
| 1713 | 2842465081 | |||
| 1714 | 2842471693 | |||
| 1715 | 2842477929 | |||
| 1716 | 2842482897 | |||
| 1717 | 2842493800 | |||
| 1718 | 2842497244 | |||
| 1719 | 2842504738 | |||
| 1720 | 2842509773 | |||
| 1721 | 2842526293 | |||
| 1722 | 2842924860 | |||
| 1723 | 2844168457 | |||
| 1724 | 2844455079 | |||
| 1725 | 2847418164 | |||
| 1726 | 2850080533 | |||
| 1727 | 2854897231 | |||
| 1728 | 2854922139 | |||
| 1729 | 2855831426 | |||
| 1730 | 2855840550 | |||
| 1731 | 2855878882 | |||
| 1732 | 2857520247 | |||
| 1733 | 2857531912 | |||
| 1734 | 2858801078 | |||
| 1735 | 2891376458 | |||
| 1736 | 2896386697 | |||
| 1737 | 2913297391 | |||
| 1738 | 2913310913 | |||
| 1739 | 2915986276 | |||
| 1740 | 2915988311 | |||
| 1741 | 2915996157 | |||
| 1742 | 2916001172 | |||
| 1743 | 2916014003 | |||
| 1744 | 2916020246 | |||
| 1745 | 2916025155 | |||
| 1746 | 2916032640 | |||
| 1747 | 2916040280 | |||
| 1748 | 2916044480 | |||
| 1749 | 2916049612 | |||
| 1750 | 2916055256 | |||
| 1751 | 2916062221 | |||
| 1752 | 2916070924 | |||
| 1753 | 2916076780 | |||
| 1754 | 2919103875 | |||
| 1755 | 2919168435 | |||
| 1756 | 2919171368 | |||
| 1757 | 2919409359 | |||
| 1758 | 2920762819 | |||
| 1759 | 2920823901 | |||
| 1760 | 2921204369 | |||
| 1761 | 2921210053 | |||
| 1762 | 2921240042 | |||
| 1763 | 2921246198 | |||
| 1764 | 2921251057 | |||
| 1765 | 2921257888 | |||
| 1766 | 2921264133 | |||
| 1767 | 2921286251 | |||
| 1768 | 2921294828 | |||
| 1769 | 2921299629 | |||
| 1770 | 2923557521 | |||
| 1771 | 2924146583 | |||
| 1772 | 2924151200 | |||
| 1773 | 2924160677 | |||
| 1774 | 2924171715 | |||
| 1775 | 2924177522 | |||
| 1776 | 2924185888 | |||
| 1777 | 2924188722 | |||
| 1778 | 2924198166 | |||
| 1779 | 2924203024 | |||
| 1780 | 2924212630 | |||
| 1781 | 2924220462 | |||
| 1782 | 2924226764 | |||
| 1783 | 2924230293 | |||
| 1784 | 2929139568 | |||
| 1785 | 2933019567 | |||
| 1786 | 2933573166 | |||
| 1787 | 2933591420 | |||
| 1788 | 2933604654 | |||
| 1789 | 2935895101 | |||
| 1790 | 2935904085 | |||
| 1791 | 2936368077 | |||
| 1792 | 2936381529 | |||
| 1793 | 2936384900 | |||
| 1794 | 2937000999 | |||
| 1795 | 2937004319 | |||
| 1796 | 2937011072 | |||
| 1797 | 2937019404 | |||
| 1798 | 2937028504 | |||
| 1799 | 2937029763 | |||
| 1800 | 2937036789 | |||
| 1801 | 2937048315 | |||
| 1802 | 2937056086 | |||
| 1803 | 2937059175 | |||
| 1804 | 2937067837 | |||
| 1805 | 2937073940 | |||
| 1806 | 2937082869 | |||
| 1807 | 2937090527 | |||
| 1808 | 2937095693 | |||
| 1809 | 2937104114 | |||
| 1810 | 2937110731 | |||
| 1811 | 2937113970 | |||
| 1812 | 2937125467 | |||
| 1813 | 2937129035 | |||
| 1814 | 2941500157 | |||
| 1815 | 2957379922 | |||
| 1816 | 2957382750 | |||
| 1817 | 2957389028 | |||
| 1818 | 2957398332 | |||
| 1819 | 2957407537 | |||
| 1820 | 2957411611 | |||
| 1821 | 2957418880 | |||
| 1822 | 2957429863 | |||
| 1823 | 2957432542 | |||
| 1824 | 2957438990 | |||
| 1825 | 2957446524 | |||
| 1826 | 2957456584 | |||
| 1827 | 2957463342 | |||
| 1828 | 2957466628 | |||
| 1829 | 2957473176 | |||
| 1830 | 2957479916 | |||
| 1831 | 2957486105 | |||
| 1832 | 2957496258 | |||
| 1833 | 2957503557 | |||
| 1834 | 2957509251 | |||
| 1835 | 2960588730 | |||
| 1836 | 2960595676 | |||
| 1837 | 2960601603 | |||
| 1838 | 2960608559 | |||
| 1839 | 2960611906 | |||
| 1840 | 2960617805 | |||
| 1841 | 2960630673 | |||
| 1842 | 2960633122 | |||
| 1843 | 2960643193 | |||
| 1844 | 2960645789 | |||
| 1845 | 2960658007 | |||
| 1846 | 2960666508 | |||
| 1847 | 2960668695 | |||
| 1848 | 2960675888 | |||
| 1849 | 2960684265 | |||
| 1850 | 2960689072 | |||
| 1851 | 2960696793 | |||
| 1852 | 2964609489 | |||
| 1853 | 2964616024 | |||
| 1854 | 2964625076 | |||
| 1855 | 2964635380 | |||
| 1856 | 2964642536 | |||
| 1857 | 2964646922 | |||
| 1858 | 2964656339 | |||
| 1859 | 2964659731 | |||
| 1860 | 2964665579 | |||
| 1861 | 2964672025 | |||
| 1862 | 2964679414 | |||
| 1863 | 2964688252 | |||
| 1864 | 2964692142 | |||
| 1865 | 2964703521 | |||
| 1866 | 2964708593 | |||
| 1867 | 2964718659 | |||
| 1868 | 2964722297 | |||
| 1869 | 2967668676 | |||
| 1870 | 2967677142 | |||
| 1871 | 2967681625 | |||
| 1872 | 2967687137 | |||
| 1873 | 2967693349 | |||
| 1874 | 2967702568 | |||
| 1875 | 2967707815 | |||
| 1876 | 2967716425 | |||
| 1877 | 2967723325 | |||
| 1878 | 2967734631 | |||
| 1879 | 2967735547 | |||
| 1880 | 2967745775 | |||
| 1881 | 2967754502 | |||
| 1882 | 2967756998 | |||
| 1883 | 2967763900 | |||
| 1884 | 2967771676 | |||
| 1885 | 2967776698 | |||
| 1886 | 2970020542 | |||
| 1887 | 2970032652 | |||
| 1888 | 2970035729 | |||
| 1889 | 2970045418 | |||
| 1890 | 2970050478 | |||
| 1891 | 2970057923 | |||
| 1892 | 2970067789 | |||
| 1893 | 2970072003 | |||
| 1894 | 2970081398 | |||
| 1895 | 2970088307 | |||
| 1896 | 2970091610 | |||
| 1897 | 2970100958 | |||
| 1898 | 2970105072 | |||
| 1899 | 2970114590 | |||
| 1900 | 2970117823 | |||
| 1901 | 2970124355 | |||
| 1902 | 2970129621 | |||
| 1903 | 2970136503 | |||
| 1904 | 2970144476 | |||
| 1905 | 2970155830 | |||
| 1906 | 2970162891 | |||
| 1907 | 2970166852 | |||
| 1908 | 2970176029 | |||
| 1909 | 2970178477 | |||
| 1910 | 2970187389 | |||
| 1911 | 2970194277 | |||
| 1912 | 2977517872 | |||
| 1913 | 2977529807 | |||
| 1914 | 2977536956 | |||
| 1915 | 2977538091 | |||
| 1916 | 2977545990 | |||
| 1917 | 2977552091 | |||
| 1918 | 2977562813 | |||
| 1919 | 2977566316 | |||
| 1920 | 2977576536 | |||
| 1921 | 2977581196 | |||
| 1922 | 2978971104 | |||
| 1923 | 2984588266 | |||
| 1924 | 2989354104 | |||
| 1925 | 2989772118 | |||
| 1926 | 2996888733 | |||
| 1927 | 2996895130 | |||
| 1928 | 3005412492 | |||
| 1929 | 3005417188 | |||
| 1930 | 3005446802 | |||
| 1931 | 3005453497 | |||
| 1932 | 639647475 | |||
| 1933 | 643825140 | |||
| 1934 | 648736468 | |||
| 1935 | 8003993050 | |||
| 1936 | 8004000286 | |||
| 1937 | 8005260005 | |||
| 1938 | 8005279634 | |||
| 1939 | 8005284733 | |||
| 1940 | 8005292835 | |||
| 1941 | 8005304641 | |||
| 1942 | 8005311139 | |||
| 1943 | 8005315249 | |||
| 1944 | 8005323260 | |||
| 1945 | 8005376564 | |||
| 1946 | 8005385953 | |||
| 1947 | 8005400264 | |||
| 1948 | 8005437124 | |||
| 1949 | 8005461973 | |||
| 1950 | 8005485580 | |||
| 1951 | 8005499381 | |||
| 1952 | 8005544400 | |||
| 1953 | 8005558884 | |||
| 1954 | 8005570479 | |||
| 1955 | 8005572736 | |||
| 1956 | 8005620571 | |||
| 1957 | 8005627466 | |||
| 1958 | 8005649896 | |||
| 1959 | 8005659927 | |||
| 1960 | 8005670797 | |||
| 1961 | 8005684519 | |||
| 1962 | 8005691066 | |||
| 1963 | 8005698735 | |||
| 1964 | 8018131377 | |||
| 1965 | 8018169466 | |||
| 1966 | 8018182553 | |||
| 1967 | 8023686904 | |||
| 1968 | 8024481149 | |||
| 1969 | 8024489711 | |||
| 1970 | 8024503209 | |||
| 1971 | 8046767725 | |||
| 1972 | 8049293975 | |||
| 1973 | 8055434240 | |||
| 1974 | 8056380774 | |||
| 1975 | 8056384703 | |||
| 1976 | 8056876535 | |||
| 1977 | 8057582149 | |||
| 1978 | 8057879912 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bv3-assembly1.cif.gz_E | bacillus subtilis dnaa domain iii structure | 0.8614 | 27 | 228 |
| 2z4r-assembly2.cif.gz_B | crystal structure of domain iii from the thermotoga maritima replication initiation protein dnaa | 0.8179 | 27 | 230 |
| 3r8f-assembly1.cif.gz_D | replication initiator dnaa bound to amppcp and single-stranded dna | 0.8155 | 30 | 208 |
| 2hcb-assembly1.cif.gz_C | structure of amppcp-bound dnaa from aquifex aeolicus | 0.8084 | 30 | 208 |
| 1l8q-assembly1.cif.gz_A | crystal structure of dna replication initiation factor | 0.7993 | 30 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9U9Q1_188_246_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.88 | 162 | 210 | 1.10.8.60 |
| af_Q58817_1690_1755_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8709 | 161 | 228 | 1.10.8.60 |
| 1in4A03 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8647 | 162 | 231 | 1.10.8.60 |
| af_A0A1D6E842_267_330_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8551 | 161 | 227 | 1.10.8.60 |
| af_F4KEM0_516_577_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8537 | 166 | 227 | 1.10.8.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526V786-F1-model_v4 | Hda lid domain-containing protein | 0.9417 | 23 | 236 |
GO:0003688
GO:0005886 GO:0006270 |
| AF-A0A149V159-F1-model_v4 | Chromosomal replication initiator protein DnaA | 0.9303 | 98 | 237 |
|
| AF-A0A257PBK4-F1-model_v4 | Hda lid domain-containing protein | 0.9296 | 96 | 231 |
|
| AF-A0A527YR21-F1-model_v4 | Chromosomal replication initiator protein DnaA domain-containing protein | 0.9264 | 52 | 158 |
|
| AF-A0A526V786-F1-model_v4 | Hda lid domain-containing protein | 0.9251 | 23 | 236 |
GO:0003688
GO:0005886 GO:0006270 |