F487614

General Info

Members Datasets Scaffolds Average Seq Length
990 503 1980 131

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0854883|Ga0436363_0854883_267_680
Length 137
Sequence VKESRISDNDPFGDMRARIRNAAMRKRGKVTSPGSSLRGRVLDVLQSEGYIRGYSTTEFDNGRTEFEIELKYFDNEPVIRRIDRVSKPGRRVYVAVDAMPRVANGLGVSILSTPKGVMADHDAREQNVGGEVLCTVF

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
116 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
117 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
118 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
182 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
183 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
184 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
185 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
205 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
224 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
225 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
226 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
227 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
228 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
233 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
234 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
235 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
241 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
242 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
249 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
260 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
261 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
262 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
263 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
264 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
265 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
268 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
269 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
270 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
271 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
272 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
273 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
274 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
295 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
326 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
327 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
379 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
380 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
383 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
384 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
385 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
386 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
387 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
388 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
389 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
390 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
391 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
392 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
393 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
394 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
395 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
396 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
397 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
398 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
399 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
400 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
401 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
402 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
403 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
404 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
405 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
406 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
407 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
408 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
411 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
412 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
413 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
414 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
415 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
416 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
417 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
418 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
419 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
420 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
421 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
422 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
423 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
424 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
425 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
426 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
427 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
428 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
429 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
430 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
431 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
432 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
433 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
434 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
435 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
436 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
437 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
438 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
439 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
440 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
441 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
442 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
443 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
444 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
445 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
446 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
447 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
448 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
449 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
475 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
476 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
477 2508501050 Microvirga lupini Lut6 Isolate Nodule
478 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
479 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
480 2643221733 Bosea sp. Root381 Isolate Unclassified
481 2643221734 Bosea sp. Root670 Isolate Unclassified
482 2643221736 Bosea sp. Root483D1 Isolate Unclassified
483 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
484 2773857925 Microvirga vignae BR3299 Isolate Unclassified
485 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
486 2818991467 Bosea vestrisii 3192 Isolate Unclassified
487 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
488 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
489 2841760612 Bosea sp. Tri-49 Isolate Nodule
490 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
491 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
492 2844104063 Bosea sp. Tri-39 Isolate Nodule
493 2851182111 Bosea sp. Tri-44 Isolate Nodule
494 2851246043 Bosea sp. Tri-54 Isolate Nodule
495 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
496 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
497 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
498 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
499 2909042592 Labrys sp. LIt4 Isolate Nodule
500 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
501 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
502 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
503 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.33
Metatranscriptomes 13.94
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.78
Nodule 1.31
Rhizoplane 4.95
Rhizosphere 79.39
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0854883 3300039450 Bacteria 828
2 JGI25151J46595_10000038 3300003187 Bacteria 180430
3 JGI25151J46595_10029400 3300003187 Bacteria 2176
4 JGI25165J46597_1000961 3300003214 Bacteria 19619
5 Ga0007410J51695_1051312 3300003574 Bacteria 950
6 Ga0007409J51694_1066553 3300003575 Bacteria 1490
7 Ga0007409J51694_1099358 3300003575 Bacteria 877
8 Ga0007429J51699_1060640 3300003579 Bacteria 1671
9 JGI25404J52841_10003344 3300003659 Bacteria 3159
10 Ga0032354_1108669 3300003693 Bacteria 872
11 Ga0032354_1120138 3300003693 Bacteria 731
12 Ga0055526_1007926 3300003771 Bacteria 5404
13 Ga0055526_1011996 3300003771 Bacteria 3831
14 Ga0055526_1012008 3300003771 Bacteria 3828
15 Ga0055524_1006440 3300003775 Bacteria 5089
16 Ga0055524_1017171 3300003775 Bacteria 2563
17 Ga0065165_1000631 3300005262 Bacteria 51108
18 Ga0070658_10015385 3300005327 Bacteria 6123
19 Ga0070658_10025403 3300005327 Bacteria 4749
20 Ga0070658_10040606 3300005327 Bacteria 3754
21 Ga0070658_10543772 3300005327 Bacteria 1005
22 Ga0070658_10934740 3300005327 Bacteria 754
23 Ga0070676_10549892 3300005328 Bacteria 826
24 Ga0070670_100651452 3300005331 Bacteria 945
25 Ga0068869_100549502 3300005334 Bacteria 970
26 Ga0068868_100515613 3300005338 Bacteria 1049
27 Ga0070660_100004846 3300005339 Bacteria 9293
28 Ga0070660_100011745 3300005339 Bacteria 6236
29 Ga0070660_100062412 3300005339 Bacteria 2894
30 Ga0070660_100383367 3300005339 Bacteria 1161
31 Ga0070660_101904245 3300005339 Bacteria 507
32 Ga0070689_101171007 3300005340 Bacteria 689
33 Ga0070691_10182111 3300005341 Bacteria 1094
34 Ga0070687_100449453 3300005343 Bacteria 857
35 Ga0070661_100010348 3300005344 Bacteria 6484
36 Ga0070661_100021704 3300005344 Bacteria 4590
37 Ga0070692_10335754 3300005345 Bacteria 934
38 Ga0070668_100070464 3300005347 Bacteria 2722
39 Ga0070668_100267353 3300005347 Bacteria 1424
40 Ga0070668_100556489 3300005347 Bacteria 999
41 Ga0070668_100996861 3300005347 Bacteria 753
42 Ga0070669_100776251 3300005353 Bacteria 813
43 Ga0070671_100785994 3300005355 Bacteria 828
44 Ga0070674_100022024 3300005356 Bacteria 4104
45 Ga0070674_100814071 3300005356 Bacteria 807
46 Ga0070673_100171656 3300005364 Bacteria 1851
47 Ga0070673_100320084 3300005364 Bacteria 1370
48 Ga0070673_100366749 3300005364 Bacteria 1281
49 Ga0070659_100048719 3300005366 Bacteria 3329
50 Ga0070659_100774510 3300005366 Bacteria 833
51 Ga0070709_10641614 3300005434 Bacteria 821
52 Ga0070714_100109782 3300005435 Bacteria 2441
53 Ga0070714_100971260 3300005435 Bacteria 826
54 Ga0070714_101364993 3300005435 Bacteria 692
55 Ga0070711_100568848 3300005439 Bacteria 942
56 Ga0070711_100689944 3300005439 Bacteria 859
57 Ga0070705_100613714 3300005440 Bacteria 843
58 Ga0070700_100063876 3300005441 Bacteria 2330
59 Ga0070694_100392764 3300005444 Bacteria 1084
60 Ga0070663_100263402 3300005455 Bacteria 1368
61 Ga0070663_100519849 3300005455 Bacteria 991
62 Ga0070663_101416177 3300005455 Bacteria 616
63 Ga0070678_100462878 3300005456 Bacteria 1113
64 Ga0070678_100961738 3300005456 Bacteria 783
65 Ga0070662_100952996 3300005457 Bacteria 734
66 Ga0070681_11031567 3300005458 Bacteria 743
67 Ga0068867_100133734 3300005459 Bacteria 1930
68 Ga0068867_100254901 3300005459 Bacteria 1428
69 Ga0070679_100048764 3300005530 Bacteria 4218
70 Ga0070679_100590914 3300005530 Bacteria 1053
71 Ga0070684_100219672 3300005535 Bacteria 1734
72 Ga0070697_100005582 3300005536 Bacteria 9698
73 Ga0068853_101027538 3300005539 Bacteria 794
74 Ga0070672_100153763 3300005543 Bacteria 1904
75 Ga0070695_100007388 3300005545 Bacteria 6517
76 Ga0070693_100593988 3300005547 Bacteria 798
77 Ga0070665_100212441 3300005548 Bacteria 1935
78 Ga0070665_100421454 3300005548 Bacteria 1343
79 Ga0070665_100639456 3300005548 Bacteria 1077
80 Ga0070665_100936261 3300005548 Bacteria 879
81 Ga0068855_100018562 3300005563 Bacteria 8363
82 Ga0068855_100034672 3300005563 Bacteria 6015
83 Ga0070664_100181128 3300005564 Bacteria 1872
84 Ga0068857_100071599 3300005577 Bacteria 3088
85 Ga0068857_100547441 3300005577 Bacteria 1090
86 Ga0068854_100008442 3300005578 Bacteria 6621
87 Ga0068854_101588108 3300005578 Bacteria 596
88 Ga0068856_100068108 3300005614 Bacteria 3518
89 Ga0068856_100283714 3300005614 Bacteria 1673
90 Ga0068856_100384103 3300005614 Bacteria 1424
91 Ga0070702_100133794 3300005615 Bacteria 1570
92 Ga0068852_100009612 3300005616 Bacteria 7185
93 Ga0068852_100023465 3300005616 Bacteria 4966
94 Ga0068852_100984811 3300005616 Bacteria 862
95 Ga0068859_101925387 3300005617 Bacteria 653
96 Ga0068866_10304780 3300005718 Bacteria 996
97 Ga0068866_10470237 3300005718 Bacteria 826
98 Ga0068861_100214013 3300005719 Bacteria 1625
99 Ga0068851_10120448 3300005834 Bacteria 1410
100 Ga0068870_10529583 3300005840 Bacteria 790
101 Ga0068862_100691568 3300005844 Bacteria 987
102 Ga0081455_10001008 3300005937 Bacteria 35646
103 Ga0081538_10368833 3300005981 Bacteria 518
104 Ga0081540_1000645 3300005983 Bacteria 33098
105 Ga0075365_10442619 3300006038 Bacteria 918
106 Ga0075365_10662485 3300006038 Bacteria 738
107 Ga0075368_10066230 3300006042 Bacteria 1452
108 Ga0075363_100049305 3300006048 Bacteria 2242
109 Ga0075363_100387290 3300006048 Bacteria 820
110 Ga0075364_10299311 3300006051 Bacteria 1095
111 Ga0070716_100894376 3300006173 Bacteria 695
112 Ga0070712_100393545 3300006175 Bacteria 1143
113 Ga0075362_10244512 3300006177 Bacteria 882
114 Ga0075367_10075360 3300006178 Bacteria 2035
115 Ga0075369_10014440 3300006186 Bacteria 3154
116 Ga0075369_10194209 3300006186 Bacteria 936
117 Ga0075369_10234943 3300006186 Bacteria 850
118 Ga0075366_10132234 3300006195 Bacteria 1506
119 Ga0075366_10696681 3300006195 Bacteria 631
120 Ga0097621_100176251 3300006237 Bacteria 1845
121 Ga0075370_10277672 3300006353 Bacteria 995
122 Ga0068871_100584219 3300006358 Bacteria 1014
123 Ga0068871_100624673 3300006358 Bacteria 981
124 Ga0075428_100717334 3300006844 Bacteria 1065
125 Ga0075433_10001194 3300006852 Bacteria 18909
126 Ga0075434_100004950 3300006871 Bacteria 12081
127 Ga0075429_100661389 3300006880 Bacteria 915
128 Ga0068865_100185308 3300006881 Bacteria 1605
129 Ga0068865_101377807 3300006881 Bacteria 629
130 Ga0068865_101389042 3300006881 Bacteria 627
131 Ga0075436_100014756 3300006914 Bacteria 5354
132 Ga0075436_100997377 3300006914 Bacteria 628
133 Ga0097620_101925399 3300006931 Bacteria 653
134 Ga0075435_100018035 3300007076 Bacteria 5355
135 Ga0075435_100026460 3300007076 Bacteria 4526
136 Ga0105240_10038434 3300009093 Bacteria 6139
137 Ga0105240_10141214 3300009093 Bacteria 2879
138 Ga0105240_10662586 3300009093 Bacteria 1143
139 Ga0105240_12407093 3300009093 Bacteria 545
140 Ga0111539_10023484 3300009094 Bacteria 7576
141 Ga0111539_11073743 3300009094 Bacteria 936
142 Ga0105245_10243528 3300009098 Bacteria 1744
143 Ga0105247_11130999 3300009101 Bacteria 619
144 Ga0105243_10200032 3300009148 Bacteria 1751
145 Ga0105243_10996934 3300009148 Bacteria 840
146 Ga0105241_11196004 3300009174 Bacteria 720
147 Ga0105237_10268995 3300009545 Bacteria 1707
148 Ga0105238_10164963 3300009551 Bacteria 2190
149 Ga0105238_10224998 3300009551 Bacteria 1853
150 Ga0105238_10969946 3300009551 Bacteria 870
151 Ga0105238_11589277 3300009551 Bacteria 684
152 Ga0105249_10154860 3300009553 Bacteria 2209
153 Ga0105239_10067735 3300010375 Bacteria 3922
154 Ga0105239_10373217 3300010375 Bacteria 1612
155 Ga0105239_10484555 3300010375 Bacteria 1405
156 Ga0105239_10861177 3300010375 Bacteria 1039
157 Ga0157370_10089218 3300013104 Bacteria 2896
158 Ga0157370_10390973 3300013104 Bacteria 1280
159 Ga0157370_10667392 3300013104 Bacteria 950
160 Ga0157370_10955547 3300013104 Bacteria 777
161 Ga0157369_10038065 3300013105 Bacteria 5262
162 Ga0171462_1042 3300013250 Bacteria 66199
163 Ga0157374_10335720 3300013296 Bacteria 1500
164 Ga0157378_10621501 3300013297 Bacteria 1093
165 Ga0163162_10498696 3300013306 Bacteria 1348
166 Ga0157372_10692730 3300013307 Bacteria 1186
167 Ga0157372_10700197 3300013307 Bacteria 1179
168 Ga0157372_12249984 3300013307 Bacteria 626
169 Ga0157375_10285686 3300013308 Bacteria 1813
170 Ga0157375_13024890 3300013308 Bacteria 561
171 Ga0163163_13035012 3300014325 Bacteria 524
172 Ga0157380_10008515 3300014326 Bacteria 7329
173 Ga0182008_10552102 3300014497 Bacteria 640
174 Ga0182008_10769198 3300014497 Bacteria 556
175 Ga0157377_10105601 3300014745 Bacteria 1686
176 Ga0157379_10158245 3300014968 Bacteria 2044
177 Ga0206356_10625610 3300020070 Bacteria 979
178 Ga0213873_10042510 3300021358 Bacteria 1175
179 Ga0213872_10006909 3300021361 Bacteria 5647
180 Ga0213872_10012804 3300021361 Bacteria 3938
181 Ga0213872_10021018 3300021361 Bacteria 3005
182 Ga0213872_10077193 3300021361 Bacteria 1498
183 Ga0213872_10086084 3300021361 Bacteria 1408
184 Ga0213872_10111276 3300021361 Bacteria 1216
185 Ga0213872_10356256 3300021361 Bacteria 599
186 Ga0213874_10030386 3300021377 Bacteria 1556
187 Ga0213874_10089747 3300021377 Bacteria 1008
188 Ga0213876_10003867 3300021384 Bacteria 8462
189 Ga0213876_10016751 3300021384 Bacteria 3872
190 Ga0213876_10017136 3300021384 Bacteria 3825
191 Ga0213875_10008348 3300021388 Bacteria 5309
192 Ga0213871_10027257 3300021441 Bacteria 1466
193 Ga0213871_10102972 3300021441 Bacteria 837
194 Ga0256744_103834 3300023309 Bacteria 772
195 Ga0256743_116418 3300023436 Bacteria 615
196 Ga0256720_144321 3300023438 Bacteria 722
197 Ga0207427_105022 3300025231 Bacteria 1988
198 Ga0209233_1000293 3300025261 Bacteria 63470
199 Ga0209130_1001794 3300025284 Bacteria 12605
200 Ga0209675_1002527 3300025291 Bacteria 9311
201 Ga0209676_1111893 3300025292 Bacteria 562
202 Ga0209025_1000014 3300025294 Bacteria 865448
203 Ga0209025_1012375 3300025294 Bacteria 5477
204 Ga0209025_1083054 3300025294 Bacteria 1079
205 Ga0209564_1002872 3300025295 Bacteria 12632
206 Ga0209564_1003215 3300025295 Bacteria 11464
207 Ga0209256_1000108 3300025299 Bacteria 185884
208 Ga0209256_1000540 3300025299 Bacteria 54759
209 Ga0207426_1004654 3300025302 Bacteria 6596
210 Ga0209257_1025525 3300025304 Bacteria 2016
211 Ga0207656_10070969 3300025321 Bacteria 1547
212 Ga0207642_10228685 3300025899 Bacteria 1044
213 Ga0207688_10011717 3300025901 Bacteria 4770
214 Ga0207688_10177527 3300025901 Bacteria 1269
215 Ga0207688_10310436 3300025901 Bacteria 966
216 Ga0207647_10047848 3300025904 Bacteria 2658
217 Ga0207647_10121245 3300025904 Bacteria 1542
218 Ga0207645_10035969 3300025907 Bacteria 3179
219 Ga0207645_10291700 3300025907 Bacteria 1085
220 Ga0207643_10552321 3300025908 Bacteria 739
221 Ga0207643_10766157 3300025908 Bacteria 625
222 Ga0207705_10001453 3300025909 Bacteria 18913
223 Ga0207705_10070578 3300025909 Bacteria 2532
224 Ga0207705_10891694 3300025909 Bacteria 689
225 Ga0207684_10499689 3300025910 Bacteria 1042
226 Ga0207654_10179626 3300025911 Bacteria 1380
227 Ga0207654_10229343 3300025911 Bacteria 1236
228 Ga0207707_10877950 3300025912 Bacteria 743
229 Ga0207695_10002347 3300025913 Bacteria 28115
230 Ga0207695_10058589 3300025913 Bacteria 3997
231 Ga0207695_10125896 3300025913 Bacteria 2524
232 Ga0207671_10610727 3300025914 Bacteria 869
233 Ga0207671_11120025 3300025914 Bacteria 618
234 Ga0207663_11339655 3300025916 Unclassified 576
235 Ga0207657_10008060 3300025919 Bacteria 10742
236 Ga0207657_10043012 3300025919 Bacteria 3982
237 Ga0207657_10054867 3300025919 Bacteria 3444
238 Ga0207657_10887479 3300025919 Bacteria 687
239 Ga0207649_10057628 3300025920 Bacteria 2430
240 Ga0207649_10123886 3300025920 Bacteria 1746
241 Ga0207652_10485160 3300025921 Bacteria 1113
242 Ga0207694_10072325 3300025924 Bacteria 2696
243 Ga0207694_10161581 3300025924 Bacteria 1809
244 Ga0207694_10692700 3300025924 Bacteria 859
245 Ga0207694_11038132 3300025924 Bacteria 694
246 Ga0207650_10929033 3300025925 Bacteria 739
247 Ga0207659_10167580 3300025926 Bacteria 1730
248 Ga0207700_10618288 3300025928 Bacteria 965
249 Ga0207664_10073108 3300025929 Bacteria 2766
250 Ga0207664_10177988 3300025929 Bacteria 1825
251 Ga0207690_10039549 3300025932 Bacteria 3078
252 Ga0207690_10146492 3300025932 Bacteria 1746
253 Ga0207706_10017594 3300025933 Bacteria 6440
254 Ga0207706_10542975 3300025933 Bacteria 1001
255 Ga0207709_10362890 3300025935 Bacteria 1097
256 Ga0207670_10658740 3300025936 Bacteria 864
257 Ga0207669_10040699 3300025937 Bacteria 2698
258 Ga0207669_10618331 3300025937 Bacteria 882
259 Ga0207704_11029964 3300025938 Bacteria 697
260 Ga0207704_11094741 3300025938 Bacteria 677
261 Ga0207691_10003340 3300025940 Bacteria 15620
262 Ga0207691_10995317 3300025940 Bacteria 700
263 Ga0207689_10975916 3300025942 Bacteria 715
264 Ga0207689_11214199 3300025942 Bacteria 635
265 Ga0207679_10039615 3300025945 Bacteria 3367
266 Ga0207667_10000877 3300025949 Bacteria 38435
267 Ga0207667_10002756 3300025949 Bacteria 21724
268 Ga0207667_10019501 3300025949 Bacteria 7568
269 Ga0207651_10311804 3300025960 Bacteria 1312
270 Ga0207651_11069737 3300025960 Bacteria 722
271 Ga0207668_10546949 3300025972 Bacteria 1002
272 Ga0207668_10967315 3300025972 Bacteria 760
273 Ga0207668_11034164 3300025972 Bacteria 735
274 Ga0207640_10023318 3300025981 Bacteria 3717
275 Ga0207640_11395091 3300025981 Bacteria 627
276 Ga0207677_10468229 3300026023 Bacteria 1083
277 Ga0207677_11095957 3300026023 Bacteria 726
278 Ga0207703_11987339 3300026035 Bacteria 558
279 Ga0207639_10151732 3300026041 Bacteria 1941
280 Ga0207639_10196410 3300026041 Bacteria 1727
281 Ga0207678_10022593 3300026067 Bacteria 5509
282 Ga0207678_10298726 3300026067 Bacteria 1384
283 Ga0207678_10522609 3300026067 Bacteria 1036
284 Ga0207678_10693957 3300026067 Bacteria 896
285 Ga0207708_10112333 3300026075 Bacteria 2116
286 Ga0207702_10167468 3300026078 Bacteria 2011
287 Ga0207702_10193787 3300026078 Bacteria 1880
288 Ga0207648_10105542 3300026089 Bacteria 2472
289 Ga0207648_10299667 3300026089 Bacteria 1441
290 Ga0207674_10065457 3300026116 Bacteria 3663
291 Ga0207674_10955653 3300026116 Bacteria 825
292 Ga0207675_100229874 3300026118 Bacteria 1789
293 Ga0207675_100412225 3300026118 Bacteria 1333
294 Ga0207675_100951766 3300026118 Bacteria 876
295 Ga0207683_10359400 3300026121 Bacteria 1337
296 Ga0207683_10398170 3300026121 Bacteria 1266
297 Ga0207698_10009953 3300026142 Bacteria 6083
298 Ga0207698_10084824 3300026142 Bacteria 2569
299 Ga0207698_12272721 3300026142 Bacteria 554
300 Ga0209813_10088547 3300027866 Bacteria 1035
301 Ga0207428_10371812 3300027907 Bacteria 1050
302 Ga0268266_10085002 3300028379 Bacteria 2764
303 Ga0268266_10187330 3300028379 Bacteria 1888
304 Ga0268266_10519989 3300028379 Bacteria 1138
305 Ga0268266_10774341 3300028379 Bacteria 926
306 Ga0268265_10989906 3300028380 Bacteria 830
307 Ga0265318_10015702 3300028577 Bacteria 3142
308 Ga0265318_10102029 3300028577 Bacteria 1055
309 Ga0307517_10174085 3300028786 Bacteria 1407
310 Ga0307515_10099360 3300028794 Bacteria 3534
311 Ga0265338_10005387 3300028800 Bacteria 16717
312 Ga0265338_10069087 3300028800 Bacteria 3038
313 Ga0311000_107819 3300029272 Bacteria 758
314 Ga0311004_158584 3300029276 Bacteria 776
315 Ga0311001_1103890 3300029277 Bacteria 1796
316 Ga0310981_1004097 3300029285 Bacteria 1425
317 Ga0265762_1030167 3300030760 Bacteria 1028
318 Ga0265762_1115148 3300030760 Bacteria 610
319 Ga0265330_10006774 3300031235 Bacteria 5647
320 Ga0265330_10046222 3300031235 Bacteria 1918
321 Ga0265330_10149118 3300031235 Bacteria 994
322 Ga0265330_10156425 3300031235 Bacteria 968
323 Ga0265330_10179775 3300031235 Bacteria 896
324 Ga0265330_10180753 3300031235 Bacteria 893
325 Ga0265330_10211989 3300031235 Bacteria 818
326 Ga0265330_10280996 3300031235 Bacteria 701
327 Ga0265330_10348479 3300031235 Bacteria 625
328 Ga0265330_10350569 3300031235 Bacteria 623
329 Ga0265330_10354749 3300031235 Bacteria 619
330 Ga0265332_10012013 3300031238 Bacteria 3845
331 Ga0265332_10117030 3300031238 Bacteria 1120
332 Ga0265332_10270892 3300031238 Bacteria 702
333 Ga0265328_10000041 3300031239 Bacteria 89398
334 Ga0265328_10000129 3300031239 Bacteria 36422
335 Ga0265328_10002900 3300031239 Bacteria 7646
336 Ga0265328_10002943 3300031239 Bacteria 7603
337 Ga0265328_10021114 3300031239 Bacteria 2488
338 Ga0265328_10031155 3300031239 Bacteria 1983
339 Ga0265328_10031723 3300031239 Bacteria 1963
340 Ga0265328_10034301 3300031239 Bacteria 1879
341 Ga0265328_10047389 3300031239 Bacteria 1580
342 Ga0265325_10001732 3300031241 Bacteria 15146
343 Ga0265325_10045461 3300031241 Bacteria 2281
344 Ga0265325_10072848 3300031241 Bacteria 1721
345 Ga0265325_10079474 3300031241 Bacteria 1632
346 Ga0265325_10150945 3300031241 Bacteria 1099
347 Ga0265329_10125809 3300031242 Bacteria 823
348 Ga0265340_10001159 3300031247 Bacteria 15088
349 Ga0265340_10007526 3300031247 Bacteria 5912
350 Ga0265340_10010398 3300031247 Bacteria 4978
351 Ga0265340_10021947 3300031247 Bacteria 3269
352 Ga0265340_10092888 3300031247 Bacteria 1409
353 Ga0265340_10148320 3300031247 Bacteria 1070
354 Ga0265340_10166397 3300031247 Bacteria 1000
355 Ga0265339_10002105 3300031249 Bacteria 14517
356 Ga0265339_10008522 3300031249 Bacteria 6519
357 Ga0265339_10042300 3300031249 Bacteria 2522
358 Ga0265339_10057240 3300031249 Bacteria 2108
359 Ga0265339_10065467 3300031249 Bacteria 1948
360 Ga0265339_10081034 3300031249 Bacteria 1716
361 Ga0265339_10392194 3300031249 Bacteria 650
362 Ga0265339_10527566 3300031249 Bacteria 544
363 Ga0265331_10000090 3300031250 Bacteria 123628
364 Ga0265331_10000186 3300031250 Bacteria 76149
365 Ga0265331_10001125 3300031250 Bacteria 20459
366 Ga0265331_10016732 3300031250 Bacteria 3843
367 Ga0265331_10017155 3300031250 Bacteria 3782
368 Ga0265331_10056585 3300031250 Bacteria 1861
369 Ga0265331_10076846 3300031250 Bacteria 1556
370 Ga0265331_10418434 3300031250 Bacteria 601
371 Ga0265327_10000381 3300031251 Bacteria 83617
372 Ga0265327_10007046 3300031251 Bacteria 8808
373 Ga0265327_10028470 3300031251 Bacteria 3196
374 Ga0265327_10371914 3300031251 Bacteria 623
375 Ga0265316_10015933 3300031344 Bacteria 6544
376 Ga0265316_10039265 3300031344 Bacteria 3802
377 Ga0265316_10188596 3300031344 Bacteria 1532
378 Ga0265316_10507656 3300031344 Bacteria 861
379 Ga0265316_10711285 3300031344 Bacteria 707
380 Ga0265316_11116696 3300031344 Bacteria 546
381 Ga0265316_11279725 3300031344 Bacteria 507
382 Ga0307513_10110246 3300031456 Bacteria 2748
383 Ga0307513_10354100 3300031456 Bacteria 1215
384 Ga0307408_100011406 3300031548 Bacteria 5871
385 Ga0307408_100741874 3300031548 Bacteria 886
386 Ga0265313_10000031 3300031595 Bacteria 128981
387 Ga0265313_10004521 3300031595 Bacteria 10621
388 Ga0265313_10019748 3300031595 Bacteria 3739
389 Ga0265313_10053277 3300031595 Bacteria 1926
390 Ga0265313_10100614 3300031595 Bacteria 1284
391 Ga0265313_10124296 3300031595 Bacteria 1123
392 Ga0307508_10155372 3300031616 Bacteria 1891
393 Ga0307514_10098619 3300031649 Bacteria 2105
394 Ga0316575_10514375 3300031665 Bacteria 520
395 Ga0265314_10000963 3300031711 Bacteria 33816
396 Ga0265314_10008857 3300031711 Bacteria 8590
397 Ga0265314_10028299 3300031711 Bacteria 4180
398 Ga0265314_10072853 3300031711 Bacteria 2293
399 Ga0265314_10095028 3300031711 Bacteria 1930
400 Ga0265314_10107669 3300031711 Bacteria 1778
401 Ga0265314_10461989 3300031711 Bacteria 674
402 Ga0265342_10004137 3300031712 Bacteria 11550
403 Ga0265342_10006333 3300031712 Bacteria 8824
404 Ga0265342_10182071 3300031712 Bacteria 1150
405 Ga0265342_10598166 3300031712 Bacteria 556
406 Ga0316576_10114488 3300031727 Bacteria 2023
407 Ga0316578_10748690 3300031728 Bacteria 568
408 Ga0307405_10055833 3300031731 Bacteria 2474
409 Ga0307405_10104855 3300031731 Bacteria 1903
410 Ga0316577_10407604 3300031733 Bacteria 772
411 Ga0307413_10782991 3300031824 Bacteria 800
412 Ga0307410_10007156 3300031852 Bacteria 6085
413 Ga0307410_11051262 3300031852 Bacteria 704
414 Ga0307410_11084306 3300031852 Bacteria 694
415 Ga0326468_10002218 3300031889 Bacteria 1623
416 Ga0307406_10036624 3300031901 Bacteria 3024
417 Ga0307406_10090266 3300031901 Bacteria 2061
418 Ga0307406_11605471 3300031901 Bacteria 574
419 Ga0307407_10011518 3300031903 Bacteria 4213
420 Ga0307407_10820445 3300031903 Bacteria 709
421 Ga0307412_10053732 3300031911 Bacteria 2671
422 Ga0307412_10262248 3300031911 Bacteria 1348
423 Ga0307409_100004876 3300031995 Bacteria 7628
424 Ga0307409_100286660 3300031995 Bacteria 1525
425 Ga0307409_102919525 3300031995 Bacteria 505
426 Ga0307416_100047875 3300032002 Bacteria 3388
427 Ga0307416_100221340 3300032002 Bacteria 1815
428 Ga0307416_102381471 3300032002 Bacteria 629
429 Ga0307416_102510348 3300032002 Bacteria 614
430 Ga0307414_10075716 3300032004 Bacteria 2443
431 Ga0307414_10287420 3300032004 Bacteria 1385
432 Ga0307411_10091338 3300032005 Bacteria 2126
433 Ga0307411_10479497 3300032005 Bacteria 1047
434 Ga0307411_10995046 3300032005 Bacteria 750
435 Ga0307415_100010922 3300032126 Bacteria 5167
436 Ga0316593_10012327 3300032168 Bacteria 2507
437 Ga0316593_10315192 3300032168 Bacteria 594
438 Ga0307510_10114264 3300033180 Bacteria 2429
439 Ga0316592_1009885 3300033524 Bacteria 1914
440 Ga0316596_1006578 3300033541 Bacteria 2708
441 Ga0373948_0011793 3300034817 Bacteria 1552
442 Ga0373948_0160036 3300034817 Bacteria 567
443 Ga0373948_0170624 3300034817 Bacteria 553
444 Ga0373950_0054200 3300034818 Bacteria 793
445 Ga0373959_0121796 3300034820 Bacteria 638
446 Ga0373959_0142571 3300034820 Bacteria 601
447 Ga0373928_0005729 3300035084 Bacteria 2376
448 Ga0373928_0027736 3300035084 Bacteria 1234
449 Ga0373940_0027123 3300035088 Bacteria 1503
450 Ga0373944_0067559 3300035089 Bacteria 1158
451 Ga0373944_0345386 3300035089 Bacteria 565
452 Ga0373923_0415822 3300035111 Bacteria 649
453 Ga0373932_0084558 3300035112 Bacteria 1008
454 Ga0373936_0008097 3300035113 Bacteria 3952
455 Ga0373939_0068612 3300035114 Bacteria 1148
456 Ga0373939_0320690 3300035114 Bacteria 623
457 Ga0373941_0015050 3300035115 Bacteria 2078
458 Ga0373941_0137975 3300035115 Bacteria 884
459 Ga0373941_0420359 3300035115 Bacteria 556
460 Ga0373945_0006653 3300035116 Bacteria 3735
461 Ga0373960_0016768 3300035121 Bacteria 1889
462 Ga0373943_0007235 3300035170 Bacteria 4980
463 Ga0373943_0080948 3300035170 Bacteria 1665
464 Ga0373946_0602606 3300035171 Unclassified 570
465 Ga0373955_0036549 3300035172 Bacteria 2607
466 Ga0373955_0739722 3300035172 Bacteria 604
467 Ga0373955_0759412 3300035172 Bacteria 596
468 Ga0373942_0039087 3300035207 Bacteria 1289
469 Ga0373942_0106190 3300035207 Bacteria 863
470 Ga0373961_0002931 3300035241 Bacteria 4320
471 Ga0373961_0017564 3300035241 Bacteria 1858
472 Ga0373962_0004285 3300035242 Bacteria 3446
473 Ga0373962_0018033 3300035242 Bacteria 1833
474 Ga0373962_0141061 3300035242 Bacteria 783
475 Ga0316574_0164763 3300035398 Bacteria 1427
476 Ga0373931_0001781 3300035691 Bacteria 9363
477 Ga0373931_0037853 3300035691 Bacteria 2520
478 Ga0373931_0057013 3300035691 Bacteria 2094
479 Ga0373931_0437656 3300035691 Bacteria 834
480 Ga0373935_0003403 3300035692 Bacteria 9238
481 Ga0373935_0026109 3300035692 Bacteria 3602
482 Ga0373935_1341243 3300035692 Bacteria 534
483 Ga0373927_0000971 3300035695 Bacteria 21800
484 Ga0373927_0064151 3300035695 Bacteria 2376
485 Ga0373927_0167531 3300035695 Bacteria 1440
486 Ga0373933_0510491 3300035724 Bacteria 788
487 Ga0373947_0011709 3300035725 Bacteria 5027
488 Ga0373947_0124556 3300035725 Bacteria 1640
489 Ga0316582_0356473 3300036647 Bacteria 1006
490 Ga0316584_0029457 3300036712 Bacteria 4052
491 Ga0373925_0002443 3300037068 Bacteria 14891
492 Ga0373925_0002514 3300037068 Bacteria 14651
493 Ga0395905_0057227 3300037471 Bacteria 3647
494 Ga0395905_0816249 3300037471 Bacteria 836
495 Ga0436364_0438482 3300037853 Bacteria 1655
496 Ga0436364_0743164 3300037853 Bacteria 9802
497 Ga0436364_1420929 3300037853 Bacteria 1199
498 Ga0237816_04840 3300039145 Bacteria 922
499 Ga0436365_0047289 3300039437 Bacteria 7014
500 Ga0436365_0075962 3300039437 Bacteria 769
501 Ga0436365_1136540 3300039437 Bacteria 40433
502 Ga0436365_1253031 3300039437 Bacteria 47093
503 Ga0436365_1706336 3300039437 Bacteria 3761
504 Ga0436360_0051477 3300039438 Bacteria 587
505 Ga0436360_0140907 3300039438 Bacteria 1583
506 Ga0436360_0259420 3300039438 Bacteria 1483
507 Ga0436360_0321131 3300039438 Bacteria 1021
508 Ga0436360_0355448 3300039438 Bacteria 2358
509 Ga0436360_0454769 3300039438 Bacteria 2380
510 Ga0436360_0537617 3300039438 Bacteria 7493
511 Ga0436360_0773833 3300039438 Bacteria 748
512 Ga0436360_0820186 3300039438 Bacteria 854
513 Ga0436360_0900938 3300039438 Bacteria 595
514 Ga0436360_1057566 3300039438 Bacteria 1008
515 Ga0436360_1065206 3300039438 Bacteria 2112
516 Ga0436360_1154925 3300039438 Bacteria 775
517 Ga0436360_1290282 3300039438 Bacteria 1299
518 Ga0436361_0014203 3300039447 Bacteria 1592
519 Ga0436361_0016113 3300039447 Bacteria 2363
520 Ga0436361_0074846 3300039447 Bacteria 692
521 Ga0436361_0226768 3300039447 Bacteria 973
522 Ga0436361_0240768 3300039447 Bacteria 945
523 Ga0436361_0257678 3300039447 Bacteria 1959
524 Ga0436361_0291348 3300039447 Bacteria 1687
525 Ga0436361_0315369 3300039447 Bacteria 539
526 Ga0436361_0330189 3300039447 Bacteria 1200
527 Ga0436361_0381254 3300039447 Bacteria 562
528 Ga0436361_0415437 3300039447 Bacteria 1404
529 Ga0436361_0658663 3300039447 Bacteria 1210
530 Ga0436361_0710155 3300039447 Bacteria 505
531 Ga0436361_0714783 3300039447 Bacteria 615
532 Ga0436361_0765661 3300039447 Bacteria 1143
533 Ga0436361_0866004 3300039447 Bacteria 1371
534 Ga0436361_0878406 3300039447 Bacteria 2465
535 Ga0436361_0942051 3300039447 Bacteria 681
536 Ga0436361_1025029 3300039447 Bacteria 3243
537 Ga0436361_1184215 3300039447 Bacteria 1021
538 Ga0436363_0272908 3300039450 Bacteria 1128
539 Ga0436363_0323271 3300039450 Bacteria 5181
540 Ga0436363_0746062 3300039450 Bacteria 9943
541 Ga0436363_0858619 3300039450 Bacteria 1652
542 Ga0436363_0875430 3300039450 Bacteria 1677
543 Ga0436363_1182780 3300039450 Bacteria 947
544 Ga0436362_0006092 3300039453 Bacteria 689
545 Ga0436362_0133577 3300039453 Bacteria 1337
546 Ga0436362_0374465 3300039453 Bacteria 536
547 Ga0436362_0531292 3300039453 Bacteria 592
548 Ga0436362_0839400 3300039453 Bacteria 807
549 Ga0436362_0976116 3300039453 Bacteria 8152
550 Ga0436362_1087862 3300039453 Bacteria 1420
551 Ga0439436_0104056 3300041404 Bacteria 792
552 Ga0439453_0005235 3300041408 Bacteria 1968
553 Ga0439466_0111000 3300041411 Bacteria 851
554 Ga0439465_0027934 3300041413 Bacteria 1788
555 Ga0451789_0503154 3300041443 Bacteria 1003
556 Ga0451791_0574419 3300041451 Bacteria 973
557 Ga0451793_1391501 3300041452 Bacteria 735
558 Ga0451807_0874557 3300041486 Bacteria 555
559 Ga0451807_1450153 3300041486 Bacteria 641
560 Ga0451807_2360578 3300041486 Bacteria 703
561 Ga0451853_1126604 3300041512 Bacteria 630
562 Ga0439431_0026550 3300041997 Bacteria 1420
563 Ga0439431_0052962 3300041997 Bacteria 1056
564 Ga0439445_0033332 3300042004 Bacteria 1345
565 Ga0439445_0107527 3300042004 Bacteria 794
566 Ga0439432_101817 3300042006 Bacteria 858
567 Ga0439449_0340077 3300042007 Bacteria 568
568 Ga0439452_119086 3300042010 Bacteria 562
569 Ga0439454_035442 3300042011 Bacteria 799
570 Ga0439456_118164 3300042013 Bacteria 607
571 Ga0439446_0178018 3300042156 Bacteria 710
572 Ga0466972_0009543 3300044658 Bacteria 4874
573 Ga0466966_0064041 3300044684 Bacteria 2316
574 Ga0466966_0166692 3300044684 Bacteria 1340
575 Ga0466964_0912549 3300044706 Bacteria 503
576 Ga0466971_0032824 3300044719 Bacteria 2326
577 Ga0466957_0082727 3300044842 Bacteria 2001
578 Ga0466957_0101786 3300044842 Bacteria 1812
579 Ga0466957_0919939 3300044842 Bacteria 626
580 Ga0466960_0128857 3300044901 Bacteria 1333
581 Ga0466960_0214495 3300044901 Bacteria 1057
582 Ga0466959_0160457 3300045049 Bacteria 1581
583 Ga0466959_0416124 3300045049 Bacteria 913
584 Ga0466959_0985704 3300045049 Bacteria 561
585 Ga0451576_0168990 3300045051 Bacteria 2282
586 Ga0451576_0794393 3300045051 Bacteria 994
587 Ga0451576_1431832 3300045051 Bacteria 719
588 Ga0451576_2682197 3300045051 Bacteria 507
589 Ga0466958_0000676 3300045836 Bacteria 14782
590 Ga0495580_0003736 3300046472 Bacteria 12895
591 Ga0495580_0525162 3300046472 Bacteria 788
592 Ga0495582_0043074 3300046473 Bacteria 2486
593 Ga0495585_0493876 3300046492 Bacteria 582
594 Ga0495606_0540266 3300046507 Bacteria 582
595 Ga0495610_0018183 3300046512 Bacteria 3978
596 Ga0495620_0037558 3300046515 Bacteria 2156
597 Ga0495630_0245501 3300046517 Bacteria 1368
598 Ga0495643_0433413 3300046522 Bacteria 575
599 Ga0495586_0405127 3300046535 Bacteria 785
600 Ga0495587_0162159 3300046536 Bacteria 1272
601 Ga0495598_0115737 3300046537 Bacteria 904
602 Ga0495597_0179175 3300046542 Bacteria 857
603 Ga0495645_0086993 3300046543 Bacteria 2236
604 Ga0495645_0503183 3300046543 Bacteria 757
605 Ga0495622_0085278 3300046557 Bacteria 1453
606 Ga0495667_0950970 3300046559 Bacteria 525
607 Ga0495656_0088344 3300046615 Bacteria 1413
608 Ga0495656_0556043 3300046615 Bacteria 612
609 Ga0495668_0032584 3300046616 Bacteria 2931
610 Ga0495668_0112676 3300046616 Bacteria 1488
611 Ga0495625_0225794 3300046660 Bacteria 1225
612 Ga0495625_0315915 3300046660 Bacteria 996
613 Ga0495658_0001492 3300046683 Bacteria 12268
614 Ga0495613_0000576 3300046689 Bacteria 29823
615 Ga0495670_0145421 3300046691 Bacteria 1242
616 Ga0495670_0828002 3300046691 Bacteria 505
617 Ga0495671_0245556 3300046692 Bacteria 864
618 Ga0495589_0426502 3300046794 Bacteria 608
619 Ga0495581_0457221 3300047315 Bacteria 743
620 Ga0495685_119544 3300047447 Bacteria 865
621 Ga0496100_0070642 3300048903 Bacteria 2329
622 Ga0496100_0401356 3300048903 Bacteria 1044
623 Ga0496100_0959993 3300048903 Bacteria 672
624 Ga0496101_0031523 3300048904 Bacteria 3727
625 Ga0496101_0498506 3300048904 Bacteria 962
626 Ga0496102_0783859 3300048905 Bacteria 876
627 Ga0496102_0949578 3300048905 Bacteria 781
628 Ga0496102_1056612 3300048905 Bacteria 732
629 Ga0496102_1308374 3300048905 Bacteria 644
630 Ga0496103_0639786 3300048906 Bacteria 676
631 Ga0496104_0050054 3300048907 Bacteria 3942
632 Ga0496104_0070384 3300048907 Bacteria 3325
633 Ga0496104_0822420 3300048907 Bacteria 835
634 Ga0496104_0873644 3300048907 Bacteria 804
635 Ga0496104_1240668 3300048907 Bacteria 649
636 Ga0496105_0005504 3300048908 Bacteria 9611
637 Ga0496105_0360202 3300048908 Bacteria 1160
638 Ga0496105_0940634 3300048908 Bacteria 649
639 Ga0496106_0186897 3300048909 Bacteria 1646
640 Ga0496107_0632702 3300048910 Bacteria 789
641 Ga0496108_0137085 3300048911 Bacteria 2106
642 Ga0496108_0873310 3300048911 Bacteria 773
643 Ga0496108_1114354 3300048911 Bacteria 670
644 Ga0496108_1326975 3300048911 Bacteria 604
645 Ga0496109_1360813 3300048912 Bacteria 646
646 Ga0496110_0008141 3300048913 Bacteria 8422
647 Ga0496110_0213506 3300048913 Bacteria 1754
648 Ga0496110_0784872 3300048913 Bacteria 857
649 Ga0496110_1080030 3300048913 Bacteria 710
650 Ga0496111_0092518 3300048914 Bacteria 2217
651 Ga0496112_0034695 3300048915 Bacteria 4910
652 Ga0496112_0572117 3300048915 Bacteria 1063
653 Ga0496112_0850217 3300048915 Bacteria 836
654 Ga0496113_0004259 3300048916 Bacteria 8765
655 Ga0496114_0019003 3300048917 Bacteria 5566
656 Ga0496114_0108545 3300048917 Bacteria 2376
657 Ga0496114_0180419 3300048917 Bacteria 1844
658 Ga0496114_0447658 3300048917 Bacteria 1144
659 Ga0496115_0009751 3300048918 Bacteria 7152
660 Ga0496115_0189171 3300048918 Bacteria 1701
661 Ga0496115_0190979 3300048918 Bacteria 1692
662 Ga0496115_0361216 3300048918 Bacteria 1183
663 Ga0496115_0570404 3300048918 Bacteria 902
664 Ga0496116_0092732 3300048919 Bacteria 1831
665 Ga0496117_0085746 3300048920 Bacteria 2049
666 Ga0496117_0115792 3300048920 Bacteria 1658
667 Ga0496117_0487386 3300048920 Bacteria 601
668 Ga0496118_0101757 3300048921 Bacteria 1939
669 Ga0496118_0182585 3300048921 Bacteria 1266
670 Ga0496119_0004353 3300048922 Bacteria 14129
671 Ga0496119_0201215 3300048922 Bacteria 1031
672 Ga0496121_0082395 3300048924 Bacteria 2543
673 Ga0496121_0857690 3300048924 Bacteria 527
674 Ga0496122_0019871 3300048925 Bacteria 6109
675 Ga0496123_0008564 3300048926 Bacteria 9374
676 Ga0496123_0073670 3300048926 Bacteria 2117
677 Ga0496124_0378537 3300048927 Bacteria 991
678 Ga0496124_0536873 3300048927 Bacteria 775
679 Ga0496125_0017448 3300048928 Bacteria 6842
680 Ga0496125_0259025 3300048928 Bacteria 1091
681 Ga0496126_0036822 3300048929 Bacteria 4572
682 Ga0496126_0365140 3300048929 Bacteria 1178
683 Ga0496126_0492443 3300048929 Bacteria 981
684 Ga0496126_0496478 3300048929 Bacteria 976
685 Ga0496126_0567956 3300048929 Bacteria 898
686 Ga0496126_0667863 3300048929 Bacteria 811
687 Ga0496126_0895552 3300048929 Bacteria 673
688 Ga0496126_1203842 3300048929 Bacteria 557
689 Ga0501306_000743 3300049127 Bacteria 2709
690 Ga0501306_004507 3300049127 Bacteria 1563
691 Ga0501306_023656 3300049127 Bacteria 874
692 Ga0501306_033987 3300049127 Bacteria 769
693 Ga0501308_002370 3300049128 Bacteria 1648
694 Ga0501308_020408 3300049128 Bacteria 825
695 Ga0501308_023831 3300049128 Bacteria 783
696 Ga0501308_025413 3300049128 Bacteria 767
697 Ga0501309_000912 3300049129 Bacteria 2663
698 Ga0501310_001976 3300049130 Bacteria 1910
699 Ga0501310_007310 3300049130 Bacteria 1178
700 Ga0501310_039434 3300049130 Bacteria 653
701 Ga0501310_040407 3300049130 Bacteria 648
702 Ga0501343_005978 3300049132 Bacteria 943
703 Ga0501304_010671 3300049160 Bacteria 806
704 Ga0501305_000622 3300049161 Bacteria 3012
705 Ga0501305_003020 3300049161 Bacteria 1871
706 Ga0501305_003176 3300049161 Bacteria 1843
707 Ga0501305_033118 3300049161 Bacteria 814
708 Ga0501305_079125 3300049161 Bacteria 588
709 Ga0501307_007552 3300049162 Bacteria 1202
710 Ga0501307_017811 3300049162 Bacteria 898
711 Ga0501307_059868 3300049162 Bacteria 589
712 Ga0501307_094337 3300049162 Bacteria 503
713 Ga0501311_000194 3300049527 Bacteria 3556
714 Ga0501311_025983 3300049527 Bacteria 823
715 Ga0501312_014537 3300049528 Bacteria 1107
716 Ga0501312_042385 3300049528 Bacteria 747
717 Ga0501312_051210 3300049528 Bacteria 697
718 Ga0501312_059336 3300049528 Bacteria 660
719 Ga0501313_002464 3300049529 Bacteria 1757
720 Ga0501313_010854 3300049529 Bacteria 1044
721 Ga0501313_038902 3300049529 Bacteria 635
722 Ga0501314_004204 3300049530 Bacteria 1187
723 Ga0501314_007586 3300049530 Bacteria 965
724 Ga0501314_029389 3300049530 Bacteria 605
725 Ga0501315_004037 3300049531 Bacteria 1509
726 Ga0501315_006592 3300049531 Bacteria 1297
727 Ga0501315_017497 3300049531 Bacteria 938
728 Ga0501315_085083 3300049531 Bacteria 542
729 Ga0501316_001097 3300049532 Bacteria 2191
730 Ga0501316_032792 3300049532 Bacteria 701
731 Ga0501316_044798 3300049532 Bacteria 625
732 Ga0501316_047918 3300049532 Bacteria 609
733 Ga0501316_049401 3300049532 Bacteria 603
734 Ga0501317_000409 3300049533 Bacteria 2945
735 Ga0501317_026802 3300049533 Bacteria 815
736 Ga0501317_039867 3300049533 Bacteria 713
737 Ga0501317_065175 3300049533 Bacteria 605
738 Ga0501317_097195 3300049533 Bacteria 528
739 Ga0501318_000193 3300049534 Bacteria 3208
740 Ga0501318_012450 3300049534 Bacteria 975
741 Ga0501318_027008 3300049534 Bacteria 761
742 Ga0501318_041516 3300049534 Bacteria 659
743 Ga0501318_059951 3300049534 Bacteria 582
744 Ga0501318_060544 3300049534 Bacteria 580
745 Ga0501318_088202 3300049534 Bacteria 511
746 Ga0501319_004701 3300049535 Bacteria 957
747 Ga0501320_034956 3300049536 Bacteria 639
748 Ga0501320_067016 3300049536 Bacteria 514
749 Ga0501321_003508 3300049537 Bacteria 1441
750 Ga0501321_021272 3300049537 Bacteria 808
751 Ga0501322_000140 3300049538 Bacteria 2796
752 Ga0501323_001515 3300049539 Bacteria 2084
753 Ga0501323_003359 3300049539 Bacteria 1632
754 Ga0501323_006869 3300049539 Bacteria 1283
755 Ga0501323_039089 3300049539 Bacteria 690
756 Ga0501323_088333 3300049539 Bacteria 514
757 Ga0501324_046535 3300049540 Bacteria 506
758 Ga0501325_002382 3300049541 Bacteria 1279
759 Ga0501325_028200 3300049541 Bacteria 630
760 Ga0501325_030217 3300049541 Bacteria 617
761 Ga0501325_060190 3300049541 Bacteria 500
762 Ga0501328_08460 3300049544 Bacteria 560
763 Ga0501329_05604 3300049545 Bacteria 699
764 Ga0501329_13713 3300049545 Bacteria 536
765 Ga0501332_04824 3300049548 Bacteria 814
766 Ga0501332_06926 3300049548 Bacteria 716
767 Ga0501334_16931 3300049550 Bacteria 566
768 Ga0501338_03296 3300049554 Bacteria 950
769 Ga0501340_005181 3300049556 Bacteria 842
770 Ga0501031_0133346 3300049568 Bacteria 1623
771 Ga0501032_0287810 3300049569 Bacteria 1063
772 Ga0501032_0466394 3300049569 Bacteria 808
773 Ga0501033_0112292 3300049570 Bacteria 1982
774 Ga0501033_0438034 3300049570 Bacteria 909
775 Ga0501033_0442771 3300049570 Bacteria 903
776 Ga0501034_0014987 3300049571 Bacteria 7973
777 Ga0501034_0069393 3300049571 Bacteria 3535
778 Ga0501034_0162397 3300049571 Bacteria 2204
779 Ga0501034_0427362 3300049571 Bacteria 1245
780 Ga0501034_0432130 3300049571 Bacteria 1236
781 Ga0501034_0929568 3300049571 Bacteria 756
782 Ga0501034_0992470 3300049571 Bacteria 724
783 Ga0501034_1023422 3300049571 Bacteria 709
784 Ga0501034_1094454 3300049571 Bacteria 678
785 Ga0501036_0027081 3300049572 Bacteria 4844
786 Ga0501036_0134365 3300049572 Bacteria 2088
787 Ga0501036_0827783 3300049572 Bacteria 762
788 Ga0501037_0069329 3300049573 Bacteria 2567
789 Ga0501037_0140866 3300049573 Bacteria 1726
790 Ga0501037_0218316 3300049573 Bacteria 1342
791 Ga0501037_0267468 3300049573 Bacteria 1194
792 Ga0501038_0164752 3300049574 Bacteria 1799
793 Ga0501038_0250905 3300049574 Bacteria 1402
794 Ga0501038_0357450 3300049574 Bacteria 1136
795 Ga0501039_0388403 3300049575 Bacteria 1096
796 Ga0501041_0270794 3300049577 Bacteria 1068
797 Ga0501041_1057593 3300049577 Bacteria 523
798 Ga0501042_0069464 3300049578 Bacteria 2519
799 Ga0501042_0483421 3300049578 Bacteria 899
800 Ga0501043_0247928 3300049579 Bacteria 1372
801 Ga0501043_0292729 3300049579 Bacteria 1246
802 Ga0501043_0594668 3300049579 Bacteria 818
803 Ga0501043_0648365 3300049579 Bacteria 776
804 Ga0501046_0496547 3300049580 Bacteria 874
805 Ga0501047_0023054 3300049581 Bacteria 5976
806 Ga0501047_0120081 3300049581 Bacteria 2511
807 Ga0501047_0573237 3300049581 Bacteria 952
808 Ga0501047_0944058 3300049581 Bacteria 676
809 Ga0501047_1161746 3300049581 Bacteria 585
810 Ga0501048_0093666 3300049582 Bacteria 2119
811 Ga0501048_1103829 3300049582 Bacteria 571
812 Ga0501067_0017088 3300049583 Bacteria 4009
813 Ga0501067_0066298 3300049583 Bacteria 1998
814 Ga0501067_0561634 3300049583 Bacteria 639
815 Ga0501068_0012735 3300049584 Bacteria 4774
816 Ga0501069_0004928 3300049585 Bacteria 6923
817 Ga0501069_0742325 3300049585 Bacteria 593
818 Ga0501070_0017027 3300049586 Bacteria 6099
819 Ga0501070_0031071 3300049586 Bacteria 4473
820 Ga0501071_0136426 3300049587 Bacteria 1826
821 Ga0501073_0043526 3300049589 Bacteria 3166
822 Ga0501073_0069855 3300049589 Bacteria 2447
823 Ga0501073_0095338 3300049589 Bacteria 2066
824 Ga0501073_0663828 3300049589 Bacteria 719
825 Ga0501074_0057091 3300049590 Bacteria 2812
826 Ga0501074_0424223 3300049590 Bacteria 943
827 Ga0501076_0043955 3300049592 Bacteria 3522
828 Ga0501077_0270029 3300049593 Bacteria 1082
829 Ga0501077_0750432 3300049593 Bacteria 627
830 Ga0501077_0755255 3300049593 Bacteria 625
831 Ga0501206_081328 3300049653 Bacteria 563
832 Ga0501211_031963 3300049658 Bacteria 597
833 Ga0501216_077159 3300049660 Bacteria 699
834 Ga0501217_332455 3300049661 Bacteria 508
835 Ga0501238_016664 3300049671 Bacteria 1020
836 Ga0501242_011424 3300049674 Bacteria 1072
837 Ga0501249_079202 3300049679 Bacteria 772
838 Ga0501250_014795 3300049680 Bacteria 951
839 Ga0501252_051456 3300049682 Bacteria 622
840 Ga0501253_103672 3300049683 Bacteria 670
841 Ga0501258_030700 3300049687 Bacteria 678
842 Ga0501225_0077455 3300049705 Bacteria 951
843 Ga0501245_066611 3300049708 Bacteria 670
844 Ga0501079_0193013 3300049741 Bacteria 1590
845 Ga0501079_0378369 3300049741 Bacteria 1110
846 Ga0501079_0436045 3300049741 Bacteria 1029
847 Ga0501080_0009625 3300049742 Bacteria 8822
848 Ga0501081_0174979 3300049743 Bacteria 1551
849 Ga0501083_0086253 3300049744 Bacteria 2076
850 Ga0501083_0263204 3300049744 Bacteria 1122
851 Ga0501083_0842544 3300049744 Bacteria 597
852 Ga0501083_0900677 3300049744 Bacteria 576
853 Ga0501241_024401 3300049758 Bacteria 1123
854 Ga0501241_064591 3300049758 Bacteria 740
855 Ga0501265_076490 3300049762 Bacteria 575
856 Ga0501266_004246 3300049763 Bacteria 1773
857 Ga0501270_084109 3300049767 Bacteria 638
858 Ga0501035_0091548 3300049822 Bacteria 2676
859 Ga0501035_0216953 3300049822 Bacteria 1635
860 Ga0501044_0073393 3300049823 Bacteria 3478
861 Ga0501044_0220649 3300049823 Bacteria 1846
862 Ga0501044_0254098 3300049823 Bacteria 1697
863 Ga0501044_0852389 3300049823 Bacteria 788
864 Ga0501045_0528708 3300049824 Bacteria 875
865 nmdc:mga03683_134374_c1 3300050489 Bacteria 1109
866 nmdc:mga00v17_533473_c1 3300050491 Bacteria 759
867 nmdc:mga00v17_98396_c1 3300050491 Bacteria 1844
868 nmdc:mga0yw44_342159_c1 3300050492 Bacteria 1006
869 nmdc:mga0yw44_373623_c1 3300050492 Bacteria 962
870 nmdc:mga0k408_20070_c1 3300050493 Bacteria 3739
871 nmdc:mga0k408_404010_c1 3300050493 Bacteria 813
872 nmdc:mga06z11_8708_c1 3300050494 Bacteria 4247
873 nmdc:mga04h51_87027_c1 3300050495 Bacteria 1118
874 nmdc:mga07m45_111300_c1 3300050496 Bacteria 1577
875 nmdc:mga07m45_69479_c1 3300050496 Bacteria 2002
876 nmdc:mga09592_293602_c1 3300050508 Bacteria 1409
877 nmdc:mga08y16_200519_c1 3300050511 Bacteria 2068
878 nmdc:mga08y16_273468_c1 3300050511 Bacteria 1743
879 nmdc:mga08y16_56413_c1 3300050511 Bacteria 4106
880 nmdc:mga0n895_2833_c1 3300050512 Bacteria 13734
881 nmdc:mga0n895_954971_c1 3300050512 Bacteria 840
882 nmdc:mga0rr50_349300_c1 3300050513 Bacteria 1244
883 nmdc:mga0rr50_34938_c1 3300050513 Bacteria 3605
884 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
885 nmdc:mga08x19_853330_c1 3300050514 Bacteria 647
886 nmdc:mga0a205_2479_c1 3300050515 Bacteria 16274
887 nmdc:mga0sz30_13902_c1 3300050516 Bacteria 3160
888 nmdc:mga0sz30_217246_c1 3300050516 Bacteria 850
889 nmdc:mga0sz30_322906_c1 3300050516 Bacteria 689
890 nmdc:mga0sz30_49277_c1 3300050516 Bacteria 1784
891 nmdc:mga0sz30_513372_c1 3300050516 Bacteria 539
892 Ga0495601_0370475 3300053077 Bacteria 930
893 Ga0495601_0722566 3300053077 Bacteria 635
894 Ga0495655_0232202 3300053083 Bacteria 614
895 Ga0495619_0157287 3300053085 Bacteria 1569
896 Ga0500578_0201179 3300053086 Bacteria 1219
897 Ga0500651_0183418 3300053093 Bacteria 1242
898 Ga0500569_018737 3300053109 Bacteria 1792
899 Ga0500572_163444 3300053111 Bacteria 729
900 Ga0500594_0063508 3300053118 Bacteria 1070
901 Ga0500595_026114 3300053119 Bacteria 2016
902 Ga0500595_038381 3300053119 Bacteria 1557
903 Ga0500597_069668 3300053120 Bacteria 1520
904 Ga0500608_041046 3300053122 Bacteria 2218
905 Ga0500608_271920 3300053122 Bacteria 647
906 Ga0500608_341468 3300053122 Bacteria 535
907 Ga0500618_007381 3300053125 Bacteria 3141
908 Ga0500652_178320 3300053131 Bacteria 872
909 Ga0500559_0000113 3300053136 Bacteria 63512
910 Ga0500561_0022440 3300053137 Bacteria 1500
911 Ga0500568_0000001 3300053139 Bacteria 988705
912 Ga0500577_0040810 3300053142 Bacteria 1689
913 Ga0500588_0090884 3300053146 Bacteria 1037
914 Ga0500616_0192271 3300053153 Bacteria 910
915 Ga0500622_0041650 3300053156 Bacteria 2389
916 Ga0500627_0371094 3300053158 Bacteria 614
917 Ga0500634_0254815 3300053161 Bacteria 726
918 Ga0500636_0029625 3300053177 Bacteria 3234
919 Ga0501084_0039158 3300054114 Bacteria 3965
920 Ga0501084_0071192 3300054114 Bacteria 2912
921 Ga0587084_004230 3300059477 Bacteria 1631
922 Ga0587093_070248 3300059478 Bacteria 587
923 Ga0587066_032047 3300059490 Bacteria 943
924 Ga0587070_164868 3300059491 Bacteria 566
925 Ga0587070_195014 3300059491 Bacteria 535
926 Ga0587073_0066125 3300059492 Bacteria 861
927 Ga0587073_0098652 3300059492 Bacteria 755
928 Ga0587077_026408 3300059493 Bacteria 1072
929 Ga0587077_029785 3300059493 Bacteria 1031
930 Ga0587077_078087 3300059493 Bacteria 754
931 Ga0587080_175963 3300059503 Bacteria 510
932 Ga0587083_0040993 3300059505 Bacteria 970
933 Ga0587086_098783 3300059507 Bacteria 536
934 Ga0587088_006338 3300059508 Bacteria 1593
935 Ga0587094_075067 3300059513 Bacteria 616
936 Ga0587125_015896 3300059607 Bacteria 839
937 Ga0587109_062772 3300059624 Bacteria 786
938 Ga0587109_072081 3300059624 Bacteria 749
939 Ga0587067_100553 3300059640 Bacteria 669
940 Ga0587068_000630 3300059641 Bacteria 3390
941 Ga0587068_004293 3300059641 Bacteria 1877
942 Ga0587068_081954 3300059641 Bacteria 652
943 Ga0587069_011022 3300059642 Bacteria 1201
944 Ga0587069_052056 3300059642 Bacteria 732
945 Ga0587069_107552 3300059642 Bacteria 577
946 Ga0587072_115279 3300059643 Bacteria 617
947 Ga0587072_148066 3300059643 Bacteria 565
948 Ga0587075_026000 3300059644 Bacteria 903
949 Ga0587076_004307 3300059645 Bacteria 1768
950 Ga0587079_002261 3300059647 Bacteria 2329
951 Ga0587079_039403 3300059647 Bacteria 948
952 Ga0587102_064664 3300059649 Bacteria 516
953 Ga0587105_005731 3300059651 Bacteria 834
954 Ga0587107_076157 3300059652 Bacteria 622
955 Ga0587120_009008 3300059659 Bacteria 826
956 Ga0587111_0027932 3300060346 Bacteria 1133
957 Ga0587111_0153195 3300060346 Bacteria 621
958 Ga0501082_0169846 3300060353 Bacteria 1896
959 Ga0501082_0656848 3300060353 Bacteria 918
960 Ga0466962_0020301 3300061719 Bacteria 3193
961 Ga0466962_0527708 3300061719 Bacteria 599
962 Ga0466962_0742836 3300061719 Bacteria 505
963 Ga0530510_0283408 3300061734 Bacteria 1238
964 2508735875 2508501050 Bacteria 9633614
965 2509078199 2508501114 Bacteria 7082538
966 2513594038 2513237087 Bacteria 5817514
967 2644729065 2643221733 Bacteria 5690728
968 2644735421 2643221734 Bacteria 5365412
969 2644747744 2643221736 Bacteria 6608466
970 2671694494 2671180139 Bacteria 4196045
971 2774868367 2773857925 Bacteria 6472445
972 2776259149 2775506901 Bacteria 9631051
973 2819720934 2818991467 Bacteria 5893227
974 2828310160 2828305725 Bacteria 4916900
975 2835318461 2835312727 Bacteria 7413381
976 2841761390 2841760612 Bacteria 6454112
977 2841913393 2841911363 Bacteria 6173697
978 2841919140 2841917233 Bacteria 6173500
979 2844104415 2844104063 Bacteria 6440972
980 2851184462 2851182111 Bacteria 6047226
981 2851247403 2851246043 Bacteria 6439203
982 2882459690 2882456835 Bacteria 6863978
983 2884300440 2884298095 Bacteria 3823049
984 2891092903 2891088606 Bacteria 4762464
985 2894240756 2894232714 Bacteria 8834183
986 2909043610 2909042592 Bacteria 6499737
987 2917555113 2917554339 Bacteria 4987857
988 2917699279 2917699015 Bacteria 7043791
989 8002061411 8002060224 Bacteria 4026565
990 8057530427 8057529695 Bacteria 6306553
991 Ga0436363_0854883
992 JGI25151J46595_10000038
993 JGI25151J46595_10029400
994 JGI25165J46597_1000961
995 Ga0007410J51695_1051312
996 Ga0007409J51694_1066553
997 Ga0007409J51694_1099358
998 Ga0007429J51699_1060640
999 JGI25404J52841_10003344
1000 Ga0032354_1108669
1001 Ga0032354_1120138
1002 Ga0055526_1007926
1003 Ga0055526_1011996
1004 Ga0055526_1012008
1005 Ga0055524_1006440
1006 Ga0055524_1017171
1007 Ga0065165_1000631
1008 Ga0070658_10015385
1009 Ga0070658_10025403
1010 Ga0070658_10040606
1011 Ga0070658_10543772
1012 Ga0070658_10934740
1013 Ga0070676_10549892
1014 Ga0070670_100651452
1015 Ga0068869_100549502
1016 Ga0068868_100515613
1017 Ga0070660_100004846
1018 Ga0070660_100011745
1019 Ga0070660_100062412
1020 Ga0070660_100383367
1021 Ga0070660_101904245
1022 Ga0070689_101171007
1023 Ga0070691_10182111
1024 Ga0070687_100449453
1025 Ga0070661_100010348
1026 Ga0070661_100021704
1027 Ga0070692_10335754
1028 Ga0070668_100070464
1029 Ga0070668_100267353
1030 Ga0070668_100556489
1031 Ga0070668_100996861
1032 Ga0070669_100776251
1033 Ga0070671_100785994
1034 Ga0070674_100022024
1035 Ga0070674_100814071
1036 Ga0070673_100171656
1037 Ga0070673_100320084
1038 Ga0070673_100366749
1039 Ga0070659_100048719
1040 Ga0070659_100774510
1041 Ga0070709_10641614
1042 Ga0070714_100109782
1043 Ga0070714_100971260
1044 Ga0070714_101364993
1045 Ga0070711_100568848
1046 Ga0070711_100689944
1047 Ga0070705_100613714
1048 Ga0070700_100063876
1049 Ga0070694_100392764
1050 Ga0070663_100263402
1051 Ga0070663_100519849
1052 Ga0070663_101416177
1053 Ga0070678_100462878
1054 Ga0070678_100961738
1055 Ga0070662_100952996
1056 Ga0070681_11031567
1057 Ga0068867_100133734
1058 Ga0068867_100254901
1059 Ga0070679_100048764
1060 Ga0070679_100590914
1061 Ga0070684_100219672
1062 Ga0070697_100005582
1063 Ga0068853_101027538
1064 Ga0070672_100153763
1065 Ga0070695_100007388
1066 Ga0070693_100593988
1067 Ga0070665_100212441
1068 Ga0070665_100421454
1069 Ga0070665_100639456
1070 Ga0070665_100936261
1071 Ga0068855_100018562
1072 Ga0068855_100034672
1073 Ga0070664_100181128
1074 Ga0068857_100071599
1075 Ga0068857_100547441
1076 Ga0068854_100008442
1077 Ga0068854_101588108
1078 Ga0068856_100068108
1079 Ga0068856_100283714
1080 Ga0068856_100384103
1081 Ga0070702_100133794
1082 Ga0068852_100009612
1083 Ga0068852_100023465
1084 Ga0068852_100984811
1085 Ga0068859_101925387
1086 Ga0068866_10304780
1087 Ga0068866_10470237
1088 Ga0068861_100214013
1089 Ga0068851_10120448
1090 Ga0068870_10529583
1091 Ga0068862_100691568
1092 Ga0081455_10001008
1093 Ga0081538_10368833
1094 Ga0081540_1000645
1095 Ga0075365_10442619
1096 Ga0075365_10662485
1097 Ga0075368_10066230
1098 Ga0075363_100049305
1099 Ga0075363_100387290
1100 Ga0075364_10299311
1101 Ga0070716_100894376
1102 Ga0070712_100393545
1103 Ga0075362_10244512
1104 Ga0075367_10075360
1105 Ga0075369_10014440
1106 Ga0075369_10194209
1107 Ga0075369_10234943
1108 Ga0075366_10132234
1109 Ga0075366_10696681
1110 Ga0097621_100176251
1111 Ga0075370_10277672
1112 Ga0068871_100584219
1113 Ga0068871_100624673
1114 Ga0075428_100717334
1115 Ga0075433_10001194
1116 Ga0075434_100004950
1117 Ga0075429_100661389
1118 Ga0068865_100185308
1119 Ga0068865_101377807
1120 Ga0068865_101389042
1121 Ga0075436_100014756
1122 Ga0075436_100997377
1123 Ga0097620_101925399
1124 Ga0075435_100018035
1125 Ga0075435_100026460
1126 Ga0105240_10038434
1127 Ga0105240_10141214
1128 Ga0105240_10662586
1129 Ga0105240_12407093
1130 Ga0111539_10023484
1131 Ga0111539_11073743
1132 Ga0105245_10243528
1133 Ga0105247_11130999
1134 Ga0105243_10200032
1135 Ga0105243_10996934
1136 Ga0105241_11196004
1137 Ga0105237_10268995
1138 Ga0105238_10164963
1139 Ga0105238_10224998
1140 Ga0105238_10969946
1141 Ga0105238_11589277
1142 Ga0105249_10154860
1143 Ga0105239_10067735
1144 Ga0105239_10373217
1145 Ga0105239_10484555
1146 Ga0105239_10861177
1147 Ga0157370_10089218
1148 Ga0157370_10390973
1149 Ga0157370_10667392
1150 Ga0157370_10955547
1151 Ga0157369_10038065
1152 Ga0171462_1042
1153 Ga0157374_10335720
1154 Ga0157378_10621501
1155 Ga0163162_10498696
1156 Ga0157372_10692730
1157 Ga0157372_10700197
1158 Ga0157372_12249984
1159 Ga0157375_10285686
1160 Ga0157375_13024890
1161 Ga0163163_13035012
1162 Ga0157380_10008515
1163 Ga0182008_10552102
1164 Ga0182008_10769198
1165 Ga0157377_10105601
1166 Ga0157379_10158245
1167 Ga0206356_10625610
1168 Ga0213873_10042510
1169 Ga0213872_10006909
1170 Ga0213872_10012804
1171 Ga0213872_10021018
1172 Ga0213872_10077193
1173 Ga0213872_10086084
1174 Ga0213872_10111276
1175 Ga0213872_10356256
1176 Ga0213874_10030386
1177 Ga0213874_10089747
1178 Ga0213876_10003867
1179 Ga0213876_10016751
1180 Ga0213876_10017136
1181 Ga0213875_10008348
1182 Ga0213871_10027257
1183 Ga0213871_10102972
1184 Ga0256744_103834
1185 Ga0256743_116418
1186 Ga0256720_144321
1187 Ga0207427_105022
1188 Ga0209233_1000293
1189 Ga0209130_1001794
1190 Ga0209675_1002527
1191 Ga0209676_1111893
1192 Ga0209025_1000014
1193 Ga0209025_1012375
1194 Ga0209025_1083054
1195 Ga0209564_1002872
1196 Ga0209564_1003215
1197 Ga0209256_1000108
1198 Ga0209256_1000540
1199 Ga0207426_1004654
1200 Ga0209257_1025525
1201 Ga0207656_10070969
1202 Ga0207642_10228685
1203 Ga0207688_10011717
1204 Ga0207688_10177527
1205 Ga0207688_10310436
1206 Ga0207647_10047848
1207 Ga0207647_10121245
1208 Ga0207645_10035969
1209 Ga0207645_10291700
1210 Ga0207643_10552321
1211 Ga0207643_10766157
1212 Ga0207705_10001453
1213 Ga0207705_10070578
1214 Ga0207705_10891694
1215 Ga0207684_10499689
1216 Ga0207654_10179626
1217 Ga0207654_10229343
1218 Ga0207707_10877950
1219 Ga0207695_10002347
1220 Ga0207695_10058589
1221 Ga0207695_10125896
1222 Ga0207671_10610727
1223 Ga0207671_11120025
1224 Ga0207663_11339655
1225 Ga0207657_10008060
1226 Ga0207657_10043012
1227 Ga0207657_10054867
1228 Ga0207657_10887479
1229 Ga0207649_10057628
1230 Ga0207649_10123886
1231 Ga0207652_10485160
1232 Ga0207694_10072325
1233 Ga0207694_10161581
1234 Ga0207694_10692700
1235 Ga0207694_11038132
1236 Ga0207650_10929033
1237 Ga0207659_10167580
1238 Ga0207700_10618288
1239 Ga0207664_10073108
1240 Ga0207664_10177988
1241 Ga0207690_10039549
1242 Ga0207690_10146492
1243 Ga0207706_10017594
1244 Ga0207706_10542975
1245 Ga0207709_10362890
1246 Ga0207670_10658740
1247 Ga0207669_10040699
1248 Ga0207669_10618331
1249 Ga0207704_11029964
1250 Ga0207704_11094741
1251 Ga0207691_10003340
1252 Ga0207691_10995317
1253 Ga0207689_10975916
1254 Ga0207689_11214199
1255 Ga0207679_10039615
1256 Ga0207667_10000877
1257 Ga0207667_10002756
1258 Ga0207667_10019501
1259 Ga0207651_10311804
1260 Ga0207651_11069737
1261 Ga0207668_10546949
1262 Ga0207668_10967315
1263 Ga0207668_11034164
1264 Ga0207640_10023318
1265 Ga0207640_11395091
1266 Ga0207677_10468229
1267 Ga0207677_11095957
1268 Ga0207703_11987339
1269 Ga0207639_10151732
1270 Ga0207639_10196410
1271 Ga0207678_10022593
1272 Ga0207678_10298726
1273 Ga0207678_10522609
1274 Ga0207678_10693957
1275 Ga0207708_10112333
1276 Ga0207702_10167468
1277 Ga0207702_10193787
1278 Ga0207648_10105542
1279 Ga0207648_10299667
1280 Ga0207674_10065457
1281 Ga0207674_10955653
1282 Ga0207675_100229874
1283 Ga0207675_100412225
1284 Ga0207675_100951766
1285 Ga0207683_10359400
1286 Ga0207683_10398170
1287 Ga0207698_10009953
1288 Ga0207698_10084824
1289 Ga0207698_12272721
1290 Ga0209813_10088547
1291 Ga0207428_10371812
1292 Ga0268266_10085002
1293 Ga0268266_10187330
1294 Ga0268266_10519989
1295 Ga0268266_10774341
1296 Ga0268265_10989906
1297 Ga0265318_10015702
1298 Ga0265318_10102029
1299 Ga0307517_10174085
1300 Ga0307515_10099360
1301 Ga0265338_10005387
1302 Ga0265338_10069087
1303 Ga0311000_107819
1304 Ga0311004_158584
1305 Ga0311001_1103890
1306 Ga0310981_1004097
1307 Ga0265762_1030167
1308 Ga0265762_1115148
1309 Ga0265330_10006774
1310 Ga0265330_10046222
1311 Ga0265330_10149118
1312 Ga0265330_10156425
1313 Ga0265330_10179775
1314 Ga0265330_10180753
1315 Ga0265330_10211989
1316 Ga0265330_10280996
1317 Ga0265330_10348479
1318 Ga0265330_10350569
1319 Ga0265330_10354749
1320 Ga0265332_10012013
1321 Ga0265332_10117030
1322 Ga0265332_10270892
1323 Ga0265328_10000041
1324 Ga0265328_10000129
1325 Ga0265328_10002900
1326 Ga0265328_10002943
1327 Ga0265328_10021114
1328 Ga0265328_10031155
1329 Ga0265328_10031723
1330 Ga0265328_10034301
1331 Ga0265328_10047389
1332 Ga0265325_10001732
1333 Ga0265325_10045461
1334 Ga0265325_10072848
1335 Ga0265325_10079474
1336 Ga0265325_10150945
1337 Ga0265329_10125809
1338 Ga0265340_10001159
1339 Ga0265340_10007526
1340 Ga0265340_10010398
1341 Ga0265340_10021947
1342 Ga0265340_10092888
1343 Ga0265340_10148320
1344 Ga0265340_10166397
1345 Ga0265339_10002105
1346 Ga0265339_10008522
1347 Ga0265339_10042300
1348 Ga0265339_10057240
1349 Ga0265339_10065467
1350 Ga0265339_10081034
1351 Ga0265339_10392194
1352 Ga0265339_10527566
1353 Ga0265331_10000090
1354 Ga0265331_10000186
1355 Ga0265331_10001125
1356 Ga0265331_10016732
1357 Ga0265331_10017155
1358 Ga0265331_10056585
1359 Ga0265331_10076846
1360 Ga0265331_10418434
1361 Ga0265327_10000381
1362 Ga0265327_10007046
1363 Ga0265327_10028470
1364 Ga0265327_10371914
1365 Ga0265316_10015933
1366 Ga0265316_10039265
1367 Ga0265316_10188596
1368 Ga0265316_10507656
1369 Ga0265316_10711285
1370 Ga0265316_11116696
1371 Ga0265316_11279725
1372 Ga0307513_10110246
1373 Ga0307513_10354100
1374 Ga0307408_100011406
1375 Ga0307408_100741874
1376 Ga0265313_10000031
1377 Ga0265313_10004521
1378 Ga0265313_10019748
1379 Ga0265313_10053277
1380 Ga0265313_10100614
1381 Ga0265313_10124296
1382 Ga0307508_10155372
1383 Ga0307514_10098619
1384 Ga0316575_10514375
1385 Ga0265314_10000963
1386 Ga0265314_10008857
1387 Ga0265314_10028299
1388 Ga0265314_10072853
1389 Ga0265314_10095028
1390 Ga0265314_10107669
1391 Ga0265314_10461989
1392 Ga0265342_10004137
1393 Ga0265342_10006333
1394 Ga0265342_10182071
1395 Ga0265342_10598166
1396 Ga0316576_10114488
1397 Ga0316578_10748690
1398 Ga0307405_10055833
1399 Ga0307405_10104855
1400 Ga0316577_10407604
1401 Ga0307413_10782991
1402 Ga0307410_10007156
1403 Ga0307410_11051262
1404 Ga0307410_11084306
1405 Ga0326468_10002218
1406 Ga0307406_10036624
1407 Ga0307406_10090266
1408 Ga0307406_11605471
1409 Ga0307407_10011518
1410 Ga0307407_10820445
1411 Ga0307412_10053732
1412 Ga0307412_10262248
1413 Ga0307409_100004876
1414 Ga0307409_100286660
1415 Ga0307409_102919525
1416 Ga0307416_100047875
1417 Ga0307416_100221340
1418 Ga0307416_102381471
1419 Ga0307416_102510348
1420 Ga0307414_10075716
1421 Ga0307414_10287420
1422 Ga0307411_10091338
1423 Ga0307411_10479497
1424 Ga0307411_10995046
1425 Ga0307415_100010922
1426 Ga0316593_10012327
1427 Ga0316593_10315192
1428 Ga0307510_10114264
1429 Ga0316592_1009885
1430 Ga0316596_1006578
1431 Ga0373948_0011793
1432 Ga0373948_0160036
1433 Ga0373948_0170624
1434 Ga0373950_0054200
1435 Ga0373959_0121796
1436 Ga0373959_0142571
1437 Ga0373928_0005729
1438 Ga0373928_0027736
1439 Ga0373940_0027123
1440 Ga0373944_0067559
1441 Ga0373944_0345386
1442 Ga0373923_0415822
1443 Ga0373932_0084558
1444 Ga0373936_0008097
1445 Ga0373939_0068612
1446 Ga0373939_0320690
1447 Ga0373941_0015050
1448 Ga0373941_0137975
1449 Ga0373941_0420359
1450 Ga0373945_0006653
1451 Ga0373960_0016768
1452 Ga0373943_0007235
1453 Ga0373943_0080948
1454 Ga0373946_0602606
1455 Ga0373955_0036549
1456 Ga0373955_0739722
1457 Ga0373955_0759412
1458 Ga0373942_0039087
1459 Ga0373942_0106190
1460 Ga0373961_0002931
1461 Ga0373961_0017564
1462 Ga0373962_0004285
1463 Ga0373962_0018033
1464 Ga0373962_0141061
1465 Ga0316574_0164763
1466 Ga0373931_0001781
1467 Ga0373931_0037853
1468 Ga0373931_0057013
1469 Ga0373931_0437656
1470 Ga0373935_0003403
1471 Ga0373935_0026109
1472 Ga0373935_1341243
1473 Ga0373927_0000971
1474 Ga0373927_0064151
1475 Ga0373927_0167531
1476 Ga0373933_0510491
1477 Ga0373947_0011709
1478 Ga0373947_0124556
1479 Ga0316582_0356473
1480 Ga0316584_0029457
1481 Ga0373925_0002443
1482 Ga0373925_0002514
1483 Ga0395905_0057227
1484 Ga0395905_0816249
1485 Ga0436364_0438482
1486 Ga0436364_0743164
1487 Ga0436364_1420929
1488 Ga0237816_04840
1489 Ga0436365_0047289
1490 Ga0436365_0075962
1491 Ga0436365_1136540
1492 Ga0436365_1253031
1493 Ga0436365_1706336
1494 Ga0436360_0051477
1495 Ga0436360_0140907
1496 Ga0436360_0259420
1497 Ga0436360_0321131
1498 Ga0436360_0355448
1499 Ga0436360_0454769
1500 Ga0436360_0537617
1501 Ga0436360_0773833
1502 Ga0436360_0820186
1503 Ga0436360_0900938
1504 Ga0436360_1057566
1505 Ga0436360_1065206
1506 Ga0436360_1154925
1507 Ga0436360_1290282
1508 Ga0436361_0014203
1509 Ga0436361_0016113
1510 Ga0436361_0074846
1511 Ga0436361_0226768
1512 Ga0436361_0240768
1513 Ga0436361_0257678
1514 Ga0436361_0291348
1515 Ga0436361_0315369
1516 Ga0436361_0330189
1517 Ga0436361_0381254
1518 Ga0436361_0415437
1519 Ga0436361_0658663
1520 Ga0436361_0710155
1521 Ga0436361_0714783
1522 Ga0436361_0765661
1523 Ga0436361_0866004
1524 Ga0436361_0878406
1525 Ga0436361_0942051
1526 Ga0436361_1025029
1527 Ga0436361_1184215
1528 Ga0436363_0272908
1529 Ga0436363_0323271
1530 Ga0436363_0746062
1531 Ga0436363_0858619
1532 Ga0436363_0875430
1533 Ga0436363_1182780
1534 Ga0436362_0006092
1535 Ga0436362_0133577
1536 Ga0436362_0374465
1537 Ga0436362_0531292
1538 Ga0436362_0839400
1539 Ga0436362_0976116
1540 Ga0436362_1087862
1541 Ga0439436_0104056
1542 Ga0439453_0005235
1543 Ga0439466_0111000
1544 Ga0439465_0027934
1545 Ga0451789_0503154
1546 Ga0451791_0574419
1547 Ga0451793_1391501
1548 Ga0451807_0874557
1549 Ga0451807_1450153
1550 Ga0451807_2360578
1551 Ga0451853_1126604
1552 Ga0439431_0026550
1553 Ga0439431_0052962
1554 Ga0439445_0033332
1555 Ga0439445_0107527
1556 Ga0439432_101817
1557 Ga0439449_0340077
1558 Ga0439452_119086
1559 Ga0439454_035442
1560 Ga0439456_118164
1561 Ga0439446_0178018
1562 Ga0466972_0009543
1563 Ga0466966_0064041
1564 Ga0466966_0166692
1565 Ga0466964_0912549
1566 Ga0466971_0032824
1567 Ga0466957_0082727
1568 Ga0466957_0101786
1569 Ga0466957_0919939
1570 Ga0466960_0128857
1571 Ga0466960_0214495
1572 Ga0466959_0160457
1573 Ga0466959_0416124
1574 Ga0466959_0985704
1575 Ga0451576_0168990
1576 Ga0451576_0794393
1577 Ga0451576_1431832
1578 Ga0451576_2682197
1579 Ga0466958_0000676
1580 Ga0495580_0003736
1581 Ga0495580_0525162
1582 Ga0495582_0043074
1583 Ga0495585_0493876
1584 Ga0495606_0540266
1585 Ga0495610_0018183
1586 Ga0495620_0037558
1587 Ga0495630_0245501
1588 Ga0495643_0433413
1589 Ga0495586_0405127
1590 Ga0495587_0162159
1591 Ga0495598_0115737
1592 Ga0495597_0179175
1593 Ga0495645_0086993
1594 Ga0495645_0503183
1595 Ga0495622_0085278
1596 Ga0495667_0950970
1597 Ga0495656_0088344
1598 Ga0495656_0556043
1599 Ga0495668_0032584
1600 Ga0495668_0112676
1601 Ga0495625_0225794
1602 Ga0495625_0315915
1603 Ga0495658_0001492
1604 Ga0495613_0000576
1605 Ga0495670_0145421
1606 Ga0495670_0828002
1607 Ga0495671_0245556
1608 Ga0495589_0426502
1609 Ga0495581_0457221
1610 Ga0495685_119544
1611 Ga0496100_0070642
1612 Ga0496100_0401356
1613 Ga0496100_0959993
1614 Ga0496101_0031523
1615 Ga0496101_0498506
1616 Ga0496102_0783859
1617 Ga0496102_0949578
1618 Ga0496102_1056612
1619 Ga0496102_1308374
1620 Ga0496103_0639786
1621 Ga0496104_0050054
1622 Ga0496104_0070384
1623 Ga0496104_0822420
1624 Ga0496104_0873644
1625 Ga0496104_1240668
1626 Ga0496105_0005504
1627 Ga0496105_0360202
1628 Ga0496105_0940634
1629 Ga0496106_0186897
1630 Ga0496107_0632702
1631 Ga0496108_0137085
1632 Ga0496108_0873310
1633 Ga0496108_1114354
1634 Ga0496108_1326975
1635 Ga0496109_1360813
1636 Ga0496110_0008141
1637 Ga0496110_0213506
1638 Ga0496110_0784872
1639 Ga0496110_1080030
1640 Ga0496111_0092518
1641 Ga0496112_0034695
1642 Ga0496112_0572117
1643 Ga0496112_0850217
1644 Ga0496113_0004259
1645 Ga0496114_0019003
1646 Ga0496114_0108545
1647 Ga0496114_0180419
1648 Ga0496114_0447658
1649 Ga0496115_0009751
1650 Ga0496115_0189171
1651 Ga0496115_0190979
1652 Ga0496115_0361216
1653 Ga0496115_0570404
1654 Ga0496116_0092732
1655 Ga0496117_0085746
1656 Ga0496117_0115792
1657 Ga0496117_0487386
1658 Ga0496118_0101757
1659 Ga0496118_0182585
1660 Ga0496119_0004353
1661 Ga0496119_0201215
1662 Ga0496121_0082395
1663 Ga0496121_0857690
1664 Ga0496122_0019871
1665 Ga0496123_0008564
1666 Ga0496123_0073670
1667 Ga0496124_0378537
1668 Ga0496124_0536873
1669 Ga0496125_0017448
1670 Ga0496125_0259025
1671 Ga0496126_0036822
1672 Ga0496126_0365140
1673 Ga0496126_0492443
1674 Ga0496126_0496478
1675 Ga0496126_0567956
1676 Ga0496126_0667863
1677 Ga0496126_0895552
1678 Ga0496126_1203842
1679 Ga0501306_000743
1680 Ga0501306_004507
1681 Ga0501306_023656
1682 Ga0501306_033987
1683 Ga0501308_002370
1684 Ga0501308_020408
1685 Ga0501308_023831
1686 Ga0501308_025413
1687 Ga0501309_000912
1688 Ga0501310_001976
1689 Ga0501310_007310
1690 Ga0501310_039434
1691 Ga0501310_040407
1692 Ga0501343_005978
1693 Ga0501304_010671
1694 Ga0501305_000622
1695 Ga0501305_003020
1696 Ga0501305_003176
1697 Ga0501305_033118
1698 Ga0501305_079125
1699 Ga0501307_007552
1700 Ga0501307_017811
1701 Ga0501307_059868
1702 Ga0501307_094337
1703 Ga0501311_000194
1704 Ga0501311_025983
1705 Ga0501312_014537
1706 Ga0501312_042385
1707 Ga0501312_051210
1708 Ga0501312_059336
1709 Ga0501313_002464
1710 Ga0501313_010854
1711 Ga0501313_038902
1712 Ga0501314_004204
1713 Ga0501314_007586
1714 Ga0501314_029389
1715 Ga0501315_004037
1716 Ga0501315_006592
1717 Ga0501315_017497
1718 Ga0501315_085083
1719 Ga0501316_001097
1720 Ga0501316_032792
1721 Ga0501316_044798
1722 Ga0501316_047918
1723 Ga0501316_049401
1724 Ga0501317_000409
1725 Ga0501317_026802
1726 Ga0501317_039867
1727 Ga0501317_065175
1728 Ga0501317_097195
1729 Ga0501318_000193
1730 Ga0501318_012450
1731 Ga0501318_027008
1732 Ga0501318_041516
1733 Ga0501318_059951
1734 Ga0501318_060544
1735 Ga0501318_088202
1736 Ga0501319_004701
1737 Ga0501320_034956
1738 Ga0501320_067016
1739 Ga0501321_003508
1740 Ga0501321_021272
1741 Ga0501322_000140
1742 Ga0501323_001515
1743 Ga0501323_003359
1744 Ga0501323_006869
1745 Ga0501323_039089
1746 Ga0501323_088333
1747 Ga0501324_046535
1748 Ga0501325_002382
1749 Ga0501325_028200
1750 Ga0501325_030217
1751 Ga0501325_060190
1752 Ga0501328_08460
1753 Ga0501329_05604
1754 Ga0501329_13713
1755 Ga0501332_04824
1756 Ga0501332_06926
1757 Ga0501334_16931
1758 Ga0501338_03296
1759 Ga0501340_005181
1760 Ga0501031_0133346
1761 Ga0501032_0287810
1762 Ga0501032_0466394
1763 Ga0501033_0112292
1764 Ga0501033_0438034
1765 Ga0501033_0442771
1766 Ga0501034_0014987
1767 Ga0501034_0069393
1768 Ga0501034_0162397
1769 Ga0501034_0427362
1770 Ga0501034_0432130
1771 Ga0501034_0929568
1772 Ga0501034_0992470
1773 Ga0501034_1023422
1774 Ga0501034_1094454
1775 Ga0501036_0027081
1776 Ga0501036_0134365
1777 Ga0501036_0827783
1778 Ga0501037_0069329
1779 Ga0501037_0140866
1780 Ga0501037_0218316
1781 Ga0501037_0267468
1782 Ga0501038_0164752
1783 Ga0501038_0250905
1784 Ga0501038_0357450
1785 Ga0501039_0388403
1786 Ga0501041_0270794
1787 Ga0501041_1057593
1788 Ga0501042_0069464
1789 Ga0501042_0483421
1790 Ga0501043_0247928
1791 Ga0501043_0292729
1792 Ga0501043_0594668
1793 Ga0501043_0648365
1794 Ga0501046_0496547
1795 Ga0501047_0023054
1796 Ga0501047_0120081
1797 Ga0501047_0573237
1798 Ga0501047_0944058
1799 Ga0501047_1161746
1800 Ga0501048_0093666
1801 Ga0501048_1103829
1802 Ga0501067_0017088
1803 Ga0501067_0066298
1804 Ga0501067_0561634
1805 Ga0501068_0012735
1806 Ga0501069_0004928
1807 Ga0501069_0742325
1808 Ga0501070_0017027
1809 Ga0501070_0031071
1810 Ga0501071_0136426
1811 Ga0501073_0043526
1812 Ga0501073_0069855
1813 Ga0501073_0095338
1814 Ga0501073_0663828
1815 Ga0501074_0057091
1816 Ga0501074_0424223
1817 Ga0501076_0043955
1818 Ga0501077_0270029
1819 Ga0501077_0750432
1820 Ga0501077_0755255
1821 Ga0501206_081328
1822 Ga0501211_031963
1823 Ga0501216_077159
1824 Ga0501217_332455
1825 Ga0501238_016664
1826 Ga0501242_011424
1827 Ga0501249_079202
1828 Ga0501250_014795
1829 Ga0501252_051456
1830 Ga0501253_103672
1831 Ga0501258_030700
1832 Ga0501225_0077455
1833 Ga0501245_066611
1834 Ga0501079_0193013
1835 Ga0501079_0378369
1836 Ga0501079_0436045
1837 Ga0501080_0009625
1838 Ga0501081_0174979
1839 Ga0501083_0086253
1840 Ga0501083_0263204
1841 Ga0501083_0842544
1842 Ga0501083_0900677
1843 Ga0501241_024401
1844 Ga0501241_064591
1845 Ga0501265_076490
1846 Ga0501266_004246
1847 Ga0501270_084109
1848 Ga0501035_0091548
1849 Ga0501035_0216953
1850 Ga0501044_0073393
1851 Ga0501044_0220649
1852 Ga0501044_0254098
1853 Ga0501044_0852389
1854 Ga0501045_0528708
1855 nmdc:mga03683_134374_c1
1856 nmdc:mga00v17_533473_c1
1857 nmdc:mga00v17_98396_c1
1858 nmdc:mga0yw44_342159_c1
1859 nmdc:mga0yw44_373623_c1
1860 nmdc:mga0k408_20070_c1
1861 nmdc:mga0k408_404010_c1
1862 nmdc:mga06z11_8708_c1
1863 nmdc:mga04h51_87027_c1
1864 nmdc:mga07m45_111300_c1
1865 nmdc:mga07m45_69479_c1
1866 nmdc:mga09592_293602_c1
1867 nmdc:mga08y16_200519_c1
1868 nmdc:mga08y16_273468_c1
1869 nmdc:mga08y16_56413_c1
1870 nmdc:mga0n895_2833_c1
1871 nmdc:mga0n895_954971_c1
1872 nmdc:mga0rr50_349300_c1
1873 nmdc:mga0rr50_34938_c1
1874 nmdc:mga08x19_23_c1
1875 nmdc:mga08x19_853330_c1
1876 nmdc:mga0a205_2479_c1
1877 nmdc:mga0sz30_13902_c1
1878 nmdc:mga0sz30_217246_c1
1879 nmdc:mga0sz30_322906_c1
1880 nmdc:mga0sz30_49277_c1
1881 nmdc:mga0sz30_513372_c1
1882 Ga0495601_0370475
1883 Ga0495601_0722566
1884 Ga0495655_0232202
1885 Ga0495619_0157287
1886 Ga0500578_0201179
1887 Ga0500651_0183418
1888 Ga0500569_018737
1889 Ga0500572_163444
1890 Ga0500594_0063508
1891 Ga0500595_026114
1892 Ga0500595_038381
1893 Ga0500597_069668
1894 Ga0500608_041046
1895 Ga0500608_271920
1896 Ga0500608_341468
1897 Ga0500618_007381
1898 Ga0500652_178320
1899 Ga0500559_0000113
1900 Ga0500561_0022440
1901 Ga0500568_0000001
1902 Ga0500577_0040810
1903 Ga0500588_0090884
1904 Ga0500616_0192271
1905 Ga0500622_0041650
1906 Ga0500627_0371094
1907 Ga0500634_0254815
1908 Ga0500636_0029625
1909 Ga0501084_0039158
1910 Ga0501084_0071192
1911 Ga0587084_004230
1912 Ga0587093_070248
1913 Ga0587066_032047
1914 Ga0587070_164868
1915 Ga0587070_195014
1916 Ga0587073_0066125
1917 Ga0587073_0098652
1918 Ga0587077_026408
1919 Ga0587077_029785
1920 Ga0587077_078087
1921 Ga0587080_175963
1922 Ga0587083_0040993
1923 Ga0587086_098783
1924 Ga0587088_006338
1925 Ga0587094_075067
1926 Ga0587125_015896
1927 Ga0587109_062772
1928 Ga0587109_072081
1929 Ga0587067_100553
1930 Ga0587068_000630
1931 Ga0587068_004293
1932 Ga0587068_081954
1933 Ga0587069_011022
1934 Ga0587069_052056
1935 Ga0587069_107552
1936 Ga0587072_115279
1937 Ga0587072_148066
1938 Ga0587075_026000
1939 Ga0587076_004307
1940 Ga0587079_002261
1941 Ga0587079_039403
1942 Ga0587102_064664
1943 Ga0587105_005731
1944 Ga0587107_076157
1945 Ga0587120_009008
1946 Ga0587111_0027932
1947 Ga0587111_0153195
1948 Ga0501082_0169846
1949 Ga0501082_0656848
1950 Ga0466962_0020301
1951 Ga0466962_0527708
1952 Ga0466962_0742836
1953 Ga0530510_0283408
1954 2508735875
1955 2509078199
1956 2513594038
1957 2644729065
1958 2644735421
1959 2644747744
1960 2671694494
1961 2774868367
1962 2776259149
1963 2819720934
1964 2828310160
1965 2835318461
1966 2841761390
1967 2841913393
1968 2841919140
1969 2844104415
1970 2851184462
1971 2851247403
1972 2882459690
1973 2884300440
1974 2891092903
1975 2894240756
1976 2909043610
1977 2917555113
1978 2917699279
1979 8002061411
1980 8057530427

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00410

Ribosomal_S8

Ribosomal protein S8

10

137

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4u-assembly1.cif.gz_h a. baumannii ribosome-eravacycline complex: 30s 0.9751 2 132
7unu-assembly1.cif.gz_h pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9745 2 132
4pdb-assembly1.cif.gz_A crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer 0.9722 4 132
7nhn-assembly1.cif.gz_i vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.969 5 132
5uyl-assembly1.cif.gz_H 70s ribosome bound with cognate ternary complex base-paired to a site codon (structure ii) 0.968 2 132
ID Description Score Start End Superfamily
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9794 75 132 3.30.1490.10
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9773 75 132 3.30.1490.10
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9632 75 132 3.30.1490.10
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9611 75 132 3.30.1490.10
3ofbH01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9486 5 73 3.30.1370.30
ID Description Score Start End GO Terms
AF-A0A0S3PYM4-F1-model_v4 Small ribosomal subunit protein uS8 1.002 5 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E3V9H6-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9993 63 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1Q6ZZ57-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9975 65 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3C1PTI8-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9956 64 132 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A435JWK2-F1-model_v4 deleted 0.9953 63 132

Map