F487624
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 990 | 466 | 957 | 158 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8016557553|8016565829 |
| Length | 171 |
| Sequence | HLAASSPLPEHARLAAFAGEWNGEEVVFPSRWTEGGSATSHVVAHMDLNGFYLIQDSVQTRDGKQVFATHGIFTFDREDRTYKLFWYDSLGYTPPSPASGGWSREDPDAGARLAPRQCAPRLRNHRRRFLFVEDPVLAGRGRLGRRPHRRLPPHPLTSHTLVSRKQTSCPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 7 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 8 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 9 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 10 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 11 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 12 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 13 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 14 | 2904699407 | |||
| 15 | 2906610324 | |||
| 16 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 17 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 18 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 19 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 20 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 21 | 2922425934 | |||
| 22 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 23 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 24 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 25 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 26 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 27 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 28 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 29 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 219 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 223 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 228 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 237 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 238 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 240 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 271 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 276 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 277 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 278 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 279 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 280 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 281 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 282 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 283 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 378 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 379 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 380 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 381 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 382 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 383 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 384 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 385 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 394 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 395 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 405 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 409 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 411 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 412 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 413 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 414 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 415 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 417 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 418 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 419 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 420 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 421 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 423 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 424 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 426 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 427 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 428 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 429 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 430 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 431 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 432 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 434 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 435 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 436 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 437 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 438 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 439 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 440 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 442 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 443 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 444 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 445 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 446 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 448 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 449 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 450 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 451 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 452 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 460 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 461 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 462 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 463 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 464 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 465 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 466 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.95 |
| Metatranscriptomes | 1.01 |
| Isolates | 3.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.63 |
| Nodule | 2.42 |
| Rhizoplane | 5.96 |
| Rhizosphere | 72.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1004955 | 3300003214 | Bacteria | 2682 |
| 2 | JGI25153J46596_10030586 | 3300003215 | Bacteria | 1829 |
| 3 | JGI25404J52841_10019296 | 3300003659 | Bacteria | 1477 |
| 4 | JGI25404J52841_10035351 | 3300003659 | Bacteria | 1064 |
| 5 | Ga0055539_1020748 | 3300003752 | Bacteria | 783 |
| 6 | Ga0055542_1014646 | 3300003762 | Bacteria | 1281 |
| 7 | Ga0055543_1011352 | 3300004625 | Bacteria | 1827 |
| 8 | Ga0065704_10142844 | 3300005289 | Bacteria | 1501 |
| 9 | Ga0065712_10228589 | 3300005290 | Bacteria | 1003 |
| 10 | Ga0065707_10024212 | 3300005295 | Bacteria | 1755 |
| 11 | Ga0070676_10229590 | 3300005328 | Bacteria | 1230 |
| 12 | Ga0070676_10660950 | 3300005328 | Bacteria | 759 |
| 13 | Ga0070683_100109161 | 3300005329 | Bacteria | 2610 |
| 14 | Ga0070683_100167461 | 3300005329 | Bacteria | 2085 |
| 15 | Ga0070683_100270090 | 3300005329 | Bacteria | 1618 |
| 16 | Ga0070683_100277403 | 3300005329 | Bacteria | 1595 |
| 17 | Ga0070670_100746824 | 3300005331 | Bacteria | 881 |
| 18 | Ga0068869_100451568 | 3300005334 | Bacteria | 1065 |
| 19 | Ga0068869_101189775 | 3300005334 | Bacteria | 669 |
| 20 | Ga0070666_10947092 | 3300005335 | Bacteria | 637 |
| 21 | Ga0070680_100463354 | 3300005336 | Bacteria | 1083 |
| 22 | Ga0070680_100852515 | 3300005336 | Bacteria | 785 |
| 23 | Ga0070682_100140690 | 3300005337 | Bacteria | 1645 |
| 24 | Ga0070682_100954204 | 3300005337 | Bacteria | 708 |
| 25 | Ga0068868_100059956 | 3300005338 | Bacteria | 3011 |
| 26 | Ga0068868_101012133 | 3300005338 | Bacteria | 761 |
| 27 | Ga0068868_101458966 | 3300005338 | Bacteria | 639 |
| 28 | Ga0070660_100501648 | 3300005339 | Bacteria | 1010 |
| 29 | Ga0070691_10205067 | 3300005341 | Bacteria | 1038 |
| 30 | Ga0070661_100466437 | 3300005344 | Bacteria | 1006 |
| 31 | Ga0070661_100739494 | 3300005344 | Bacteria | 804 |
| 32 | Ga0070661_101243556 | 3300005344 | Bacteria | 623 |
| 33 | Ga0070668_100216872 | 3300005347 | Bacteria | 1576 |
| 34 | Ga0070668_100424000 | 3300005347 | Bacteria | 1139 |
| 35 | Ga0070668_100776729 | 3300005347 | Bacteria | 849 |
| 36 | Ga0070668_102037548 | 3300005347 | Bacteria | 529 |
| 37 | Ga0070668_102037549 | 3300005347 | Bacteria | 529 |
| 38 | Ga0070669_100609029 | 3300005353 | Bacteria | 916 |
| 39 | Ga0070671_101076359 | 3300005355 | Bacteria | 706 |
| 40 | Ga0070674_101290983 | 3300005356 | Bacteria | 651 |
| 41 | Ga0070673_100230498 | 3300005364 | Bacteria | 1606 |
| 42 | Ga0070673_100760705 | 3300005364 | Bacteria | 892 |
| 43 | Ga0070688_100208310 | 3300005365 | Bacteria | 1371 |
| 44 | Ga0070688_100588175 | 3300005365 | Bacteria | 850 |
| 45 | Ga0070659_101317869 | 3300005366 | Bacteria | 640 |
| 46 | Ga0070667_100271251 | 3300005367 | Bacteria | 1521 |
| 47 | Ga0070667_101493029 | 3300005367 | Bacteria | 635 |
| 48 | Ga0070667_101683202 | 3300005367 | Bacteria | 596 |
| 49 | Ga0070703_10299640 | 3300005406 | Bacteria | 670 |
| 50 | Ga0070709_10194830 | 3300005434 | Bacteria | 1432 |
| 51 | Ga0070709_10357658 | 3300005434 | Bacteria | 1080 |
| 52 | Ga0070709_10420172 | 3300005434 | Bacteria | 1002 |
| 53 | Ga0070709_10833475 | 3300005434 | Bacteria | 726 |
| 54 | Ga0070709_10905858 | 3300005434 | Bacteria | 697 |
| 55 | Ga0070714_100021967 | 3300005435 | Bacteria | 5227 |
| 56 | Ga0070714_100431950 | 3300005435 | Bacteria | 1249 |
| 57 | Ga0070714_100930256 | 3300005435 | Bacteria | 844 |
| 58 | Ga0070713_100029455 | 3300005436 | Bacteria | 4349 |
| 59 | Ga0070713_100080502 | 3300005436 | Bacteria | 2778 |
| 60 | Ga0070713_100156027 | 3300005436 | Bacteria | 2034 |
| 61 | Ga0070713_100330033 | 3300005436 | Bacteria | 1411 |
| 62 | Ga0070713_100737828 | 3300005436 | Bacteria | 942 |
| 63 | Ga0070713_101283380 | 3300005436 | Bacteria | 709 |
| 64 | Ga0070710_10041326 | 3300005437 | Bacteria | 2546 |
| 65 | Ga0070710_10055278 | 3300005437 | Bacteria | 2243 |
| 66 | Ga0070710_10297910 | 3300005437 | Bacteria | 1052 |
| 67 | Ga0070710_10336269 | 3300005437 | Bacteria | 995 |
| 68 | Ga0070710_10577282 | 3300005437 | Bacteria | 780 |
| 69 | Ga0070710_10611687 | 3300005437 | Bacteria | 760 |
| 70 | Ga0070710_10754729 | 3300005437 | Bacteria | 691 |
| 71 | Ga0070701_10194738 | 3300005438 | Bacteria | 1194 |
| 72 | Ga0070711_100005553 | 3300005439 | Bacteria | 7552 |
| 73 | Ga0070711_100194344 | 3300005439 | Bacteria | 1561 |
| 74 | Ga0070711_100268474 | 3300005439 | Bacteria | 1345 |
| 75 | Ga0070711_100315259 | 3300005439 | Bacteria | 1248 |
| 76 | Ga0070700_101071426 | 3300005441 | Bacteria | 666 |
| 77 | Ga0070700_101158779 | 3300005441 | Bacteria | 643 |
| 78 | Ga0070700_101302622 | 3300005441 | Bacteria | 611 |
| 79 | Ga0070694_100479641 | 3300005444 | Bacteria | 986 |
| 80 | Ga0070663_100718471 | 3300005455 | Bacteria | 850 |
| 81 | Ga0070663_100861160 | 3300005455 | Bacteria | 780 |
| 82 | Ga0070663_101271406 | 3300005455 | Bacteria | 648 |
| 83 | Ga0070678_100096322 | 3300005456 | Bacteria | 2282 |
| 84 | Ga0070678_100363674 | 3300005456 | Bacteria | 1247 |
| 85 | Ga0070678_100584240 | 3300005456 | Bacteria | 995 |
| 86 | Ga0070662_100289078 | 3300005457 | Bacteria | 1328 |
| 87 | Ga0070681_10017254 | 3300005458 | Bacteria | 7216 |
| 88 | Ga0070681_10037401 | 3300005458 | Bacteria | 4871 |
| 89 | Ga0070681_10075073 | 3300005458 | Bacteria | 3341 |
| 90 | Ga0070681_10436888 | 3300005458 | Bacteria | 1221 |
| 91 | Ga0068867_100630108 | 3300005459 | Bacteria | 938 |
| 92 | Ga0068867_100633022 | 3300005459 | Bacteria | 936 |
| 93 | Ga0070685_10466238 | 3300005466 | Bacteria | 888 |
| 94 | Ga0070706_100234156 | 3300005467 | Bacteria | 1714 |
| 95 | Ga0070706_100317287 | 3300005467 | Bacteria | 1454 |
| 96 | Ga0070706_100574081 | 3300005467 | Bacteria | 1048 |
| 97 | Ga0070706_100600472 | 3300005467 | Bacteria | 1023 |
| 98 | Ga0070698_100059290 | 3300005471 | Bacteria | 3866 |
| 99 | Ga0070698_100981492 | 3300005471 | Bacteria | 791 |
| 100 | Ga0070699_100681478 | 3300005518 | Bacteria | 939 |
| 101 | Ga0070699_100742484 | 3300005518 | Bacteria | 897 |
| 102 | Ga0070679_100015647 | 3300005530 | Bacteria | 7292 |
| 103 | Ga0070679_100163330 | 3300005530 | Bacteria | 2201 |
| 104 | Ga0070684_100355097 | 3300005535 | Bacteria | 1349 |
| 105 | Ga0070684_100395167 | 3300005535 | Bacteria | 1274 |
| 106 | Ga0070684_100692908 | 3300005535 | Bacteria | 950 |
| 107 | Ga0070684_100884156 | 3300005535 | Bacteria | 837 |
| 108 | Ga0070697_100201326 | 3300005536 | Bacteria | 1693 |
| 109 | Ga0068853_100390609 | 3300005539 | Bacteria | 1301 |
| 110 | Ga0068853_100442522 | 3300005539 | Bacteria | 1221 |
| 111 | Ga0068853_100484951 | 3300005539 | Bacteria | 1166 |
| 112 | Ga0068853_100695337 | 3300005539 | Bacteria | 970 |
| 113 | Ga0070672_100348785 | 3300005543 | Bacteria | 1261 |
| 114 | Ga0070693_100040796 | 3300005547 | Bacteria | 2608 |
| 115 | Ga0070693_100075050 | 3300005547 | Bacteria | 2001 |
| 116 | Ga0070693_100395572 | 3300005547 | Bacteria | 957 |
| 117 | Ga0070665_100206184 | 3300005548 | Bacteria | 1966 |
| 118 | Ga0070665_100377590 | 3300005548 | Bacteria | 1425 |
| 119 | Ga0070665_100519344 | 3300005548 | Bacteria | 1202 |
| 120 | Ga0070665_101138158 | 3300005548 | Bacteria | 792 |
| 121 | Ga0068855_100444992 | 3300005563 | Bacteria | 1414 |
| 122 | Ga0068855_100686734 | 3300005563 | Bacteria | 1097 |
| 123 | Ga0068855_101263499 | 3300005563 | Bacteria | 765 |
| 124 | Ga0070664_101140914 | 3300005564 | Bacteria | 735 |
| 125 | Ga0070664_101838180 | 3300005564 | Bacteria | 575 |
| 126 | Ga0068857_100183974 | 3300005577 | Bacteria | 1902 |
| 127 | Ga0068857_100311302 | 3300005577 | Bacteria | 1453 |
| 128 | Ga0068857_100397294 | 3300005577 | Bacteria | 1282 |
| 129 | Ga0068854_100272559 | 3300005578 | Bacteria | 1359 |
| 130 | Ga0068854_100442540 | 3300005578 | Bacteria | 1084 |
| 131 | Ga0068854_100501576 | 3300005578 | Bacteria | 1022 |
| 132 | Ga0068856_100000883 | 3300005614 | Bacteria | 32112 |
| 133 | Ga0068856_100107320 | 3300005614 | Bacteria | 2787 |
| 134 | Ga0068856_100491914 | 3300005614 | Bacteria | 1247 |
| 135 | Ga0068856_101140658 | 3300005614 | Bacteria | 796 |
| 136 | Ga0068856_101473787 | 3300005614 | Bacteria | 695 |
| 137 | Ga0068856_101840282 | 3300005614 | Bacteria | 617 |
| 138 | Ga0068852_100067130 | 3300005616 | Bacteria | 3135 |
| 139 | Ga0068852_100775901 | 3300005616 | Bacteria | 972 |
| 140 | Ga0068852_100780793 | 3300005616 | Bacteria | 969 |
| 141 | Ga0068852_101142168 | 3300005616 | Bacteria | 800 |
| 142 | Ga0068852_101700076 | 3300005616 | Bacteria | 653 |
| 143 | Ga0068859_100748173 | 3300005617 | Bacteria | 1066 |
| 144 | Ga0068859_101012421 | 3300005617 | Bacteria | 912 |
| 145 | Ga0068859_101200521 | 3300005617 | Bacteria | 835 |
| 146 | Ga0068864_100123810 | 3300005618 | Bacteria | 2314 |
| 147 | Ga0068864_100314239 | 3300005618 | Bacteria | 1470 |
| 148 | Ga0068864_100339767 | 3300005618 | Bacteria | 1415 |
| 149 | Ga0068866_10472137 | 3300005718 | Bacteria | 825 |
| 150 | Ga0068861_100413798 | 3300005719 | Bacteria | 1200 |
| 151 | Ga0068861_100541193 | 3300005719 | Bacteria | 1059 |
| 152 | Ga0068870_10062707 | 3300005840 | Bacteria | 2003 |
| 153 | Ga0068870_10415719 | 3300005840 | Bacteria | 879 |
| 154 | Ga0068870_10419108 | 3300005840 | Bacteria | 876 |
| 155 | Ga0068863_100488620 | 3300005841 | Bacteria | 1211 |
| 156 | Ga0068863_100531991 | 3300005841 | Bacteria | 1159 |
| 157 | Ga0068863_100554843 | 3300005841 | Bacteria | 1134 |
| 158 | Ga0068860_100247682 | 3300005843 | Bacteria | 1734 |
| 159 | Ga0068860_100952627 | 3300005843 | Bacteria | 875 |
| 160 | Ga0068860_100960866 | 3300005843 | Bacteria | 872 |
| 161 | Ga0068862_100148304 | 3300005844 | Bacteria | 2086 |
| 162 | Ga0068862_100358612 | 3300005844 | Bacteria | 1354 |
| 163 | Ga0068862_100632552 | 3300005844 | Bacteria | 1030 |
| 164 | Ga0081540_1020688 | 3300005983 | Bacteria | 3947 |
| 165 | Ga0081540_1020881 | 3300005983 | Bacteria | 3922 |
| 166 | Ga0081540_1035114 | 3300005983 | Bacteria | 2693 |
| 167 | Ga0081540_1055889 | 3300005983 | Bacteria | 1920 |
| 168 | Ga0081540_1118995 | 3300005983 | Bacteria | 1100 |
| 169 | Ga0070717_10123888 | 3300006028 | Bacteria | 2217 |
| 170 | Ga0070717_10242931 | 3300006028 | Bacteria | 1588 |
| 171 | Ga0070717_10549537 | 3300006028 | Bacteria | 1046 |
| 172 | Ga0075365_10247886 | 3300006038 | Bacteria | 1251 |
| 173 | Ga0075365_10344911 | 3300006038 | Bacteria | 1049 |
| 174 | Ga0075365_10434159 | 3300006038 | Bacteria | 927 |
| 175 | Ga0075365_10583859 | 3300006038 | Bacteria | 790 |
| 176 | Ga0075368_10022422 | 3300006042 | Bacteria | 2404 |
| 177 | Ga0075368_10071058 | 3300006042 | Bacteria | 1406 |
| 178 | Ga0075363_100065058 | 3300006048 | Bacteria | 1971 |
| 179 | Ga0075363_100247733 | 3300006048 | Bacteria | 1025 |
| 180 | Ga0075363_100253033 | 3300006048 | Bacteria | 1015 |
| 181 | Ga0075363_100285613 | 3300006048 | Bacteria | 955 |
| 182 | Ga0075363_100768625 | 3300006048 | Bacteria | 584 |
| 183 | Ga0075364_10102130 | 3300006051 | Bacteria | 1909 |
| 184 | Ga0070715_10104876 | 3300006163 | Bacteria | 1324 |
| 185 | Ga0070715_10194769 | 3300006163 | Bacteria | 1026 |
| 186 | Ga0070715_10256318 | 3300006163 | Bacteria | 917 |
| 187 | Ga0070716_100094913 | 3300006173 | Bacteria | 1814 |
| 188 | Ga0070716_101320005 | 3300006173 | Bacteria | 584 |
| 189 | Ga0070712_100038086 | 3300006175 | Bacteria | 3283 |
| 190 | Ga0070712_100111114 | 3300006175 | Bacteria | 2045 |
| 191 | Ga0070712_100314022 | 3300006175 | Bacteria | 1272 |
| 192 | Ga0075367_10022547 | 3300006178 | Bacteria | 3533 |
| 193 | Ga0075367_10112753 | 3300006178 | Bacteria | 1670 |
| 194 | Ga0075367_10288413 | 3300006178 | Bacteria | 1032 |
| 195 | Ga0075366_10278186 | 3300006195 | Bacteria | 1023 |
| 196 | Ga0075366_10397943 | 3300006195 | Bacteria | 848 |
| 197 | Ga0097621_100139391 | 3300006237 | Bacteria | 2071 |
| 198 | Ga0097621_100212164 | 3300006237 | Bacteria | 1684 |
| 199 | Ga0097621_100927645 | 3300006237 | Bacteria | 812 |
| 200 | Ga0097621_101706938 | 3300006237 | Bacteria | 600 |
| 201 | Ga0075370_10024394 | 3300006353 | Bacteria | 3340 |
| 202 | Ga0075370_10093373 | 3300006353 | Bacteria | 1737 |
| 203 | Ga0075370_10178205 | 3300006353 | Bacteria | 1250 |
| 204 | Ga0068871_100126029 | 3300006358 | Bacteria | 2167 |
| 205 | Ga0068871_100899132 | 3300006358 | Bacteria | 820 |
| 206 | Ga0068871_101274140 | 3300006358 | Bacteria | 691 |
| 207 | Ga0075428_100135007 | 3300006844 | Bacteria | 2683 |
| 208 | Ga0075434_100287226 | 3300006871 | Bacteria | 1665 |
| 209 | Ga0068865_100289192 | 3300006881 | Bacteria | 1308 |
| 210 | Ga0068865_100708827 | 3300006881 | Bacteria | 861 |
| 211 | Ga0097620_100748205 | 3300006931 | Bacteria | 1066 |
| 212 | Ga0097620_101012391 | 3300006931 | Bacteria | 912 |
| 213 | Ga0097620_101200522 | 3300006931 | Bacteria | 835 |
| 214 | Ga0075435_100454561 | 3300007076 | Bacteria | 1105 |
| 215 | Ga0099794_10174147 | 3300007265 | Bacteria | 1097 |
| 216 | Ga0099794_10321430 | 3300007265 | Bacteria | 803 |
| 217 | Ga0099795_10066779 | 3300007788 | Bacteria | 1348 |
| 218 | Ga0105240_10551341 | 3300009093 | Bacteria | 1275 |
| 219 | Ga0105240_10749887 | 3300009093 | Bacteria | 1061 |
| 220 | Ga0105240_10822471 | 3300009093 | Bacteria | 1005 |
| 221 | Ga0105240_11711774 | 3300009093 | Bacteria | 656 |
| 222 | Ga0111539_10530373 | 3300009094 | Bacteria | 1372 |
| 223 | Ga0111539_10932697 | 3300009094 | Bacteria | 1010 |
| 224 | Ga0105245_10405664 | 3300009098 | Bacteria | 1363 |
| 225 | Ga0105245_10645803 | 3300009098 | Bacteria | 1088 |
| 226 | Ga0105247_10130453 | 3300009101 | Bacteria | 1638 |
| 227 | Ga0105243_10393668 | 3300009148 | Bacteria | 1285 |
| 228 | Ga0105243_10507900 | 3300009148 | Bacteria | 1144 |
| 229 | Ga0105241_10153603 | 3300009174 | Bacteria | 1885 |
| 230 | Ga0105241_10441133 | 3300009174 | Bacteria | 1150 |
| 231 | Ga0105241_10503326 | 3300009174 | Bacteria | 1080 |
| 232 | Ga0105241_10691131 | 3300009174 | Bacteria | 930 |
| 233 | Ga0105242_10771784 | 3300009176 | Bacteria | 948 |
| 234 | Ga0105242_10834310 | 3300009176 | Bacteria | 916 |
| 235 | Ga0105248_10410419 | 3300009177 | Bacteria | 1525 |
| 236 | Ga0105237_10186788 | 3300009545 | Bacteria | 2072 |
| 237 | Ga0105237_10391897 | 3300009545 | Bacteria | 1394 |
| 238 | Ga0105237_11256989 | 3300009545 | Bacteria | 747 |
| 239 | Ga0105237_11267388 | 3300009545 | Bacteria | 744 |
| 240 | Ga0105237_11307060 | 3300009545 | Bacteria | 732 |
| 241 | Ga0105237_11310150 | 3300009545 | Bacteria | 731 |
| 242 | Ga0105238_10122580 | 3300009551 | Bacteria | 2579 |
| 243 | Ga0105238_10153518 | 3300009551 | Bacteria | 2277 |
| 244 | Ga0105238_10589215 | 3300009551 | Bacteria | 1119 |
| 245 | Ga0105238_10815971 | 3300009551 | Bacteria | 949 |
| 246 | Ga0105238_10899903 | 3300009551 | Bacteria | 903 |
| 247 | Ga0105238_10916090 | 3300009551 | Bacteria | 895 |
| 248 | Ga0105238_11172820 | 3300009551 | Bacteria | 792 |
| 249 | Ga0105238_11355898 | 3300009551 | Bacteria | 738 |
| 250 | Ga0105238_11573732 | 3300009551 | Bacteria | 687 |
| 251 | Ga0105249_11152751 | 3300009553 | Bacteria | 846 |
| 252 | Ga0105249_11307958 | 3300009553 | Bacteria | 796 |
| 253 | Ga0099796_10081558 | 3300010159 | Bacteria | 1187 |
| 254 | Ga0099796_10235288 | 3300010159 | Bacteria | 755 |
| 255 | Ga0105239_10325851 | 3300010375 | Bacteria | 1733 |
| 256 | Ga0105239_10526109 | 3300010375 | Bacteria | 1346 |
| 257 | Ga0105239_11237394 | 3300010375 | Bacteria | 861 |
| 258 | Ga0105239_11992100 | 3300010375 | Bacteria | 674 |
| 259 | Ga0105246_10019273 | 3300011119 | Bacteria | 4357 |
| 260 | Ga0105246_10634819 | 3300011119 | Bacteria | 927 |
| 261 | Ga0105246_11279383 | 3300011119 | Bacteria | 679 |
| 262 | Ga0157373_10675974 | 3300013100 | Bacteria | 755 |
| 263 | Ga0157370_10137726 | 3300013104 | Bacteria | 2274 |
| 264 | Ga0157369_10021333 | 3300013105 | Bacteria | 7245 |
| 265 | Ga0157369_10401604 | 3300013105 | Bacteria | 1422 |
| 266 | Ga0157374_10054089 | 3300013296 | Bacteria | 3744 |
| 267 | Ga0157374_10353683 | 3300013296 | Bacteria | 1460 |
| 268 | Ga0157374_10498604 | 3300013296 | Bacteria | 1222 |
| 269 | Ga0157374_11026557 | 3300013296 | Bacteria | 844 |
| 270 | Ga0157378_11611005 | 3300013297 | Bacteria | 695 |
| 271 | Ga0163162_10045228 | 3300013306 | Bacteria | 4411 |
| 272 | Ga0163162_11000743 | 3300013306 | Bacteria | 945 |
| 273 | Ga0163162_11590985 | 3300013306 | Bacteria | 745 |
| 274 | Ga0163162_11937813 | 3300013306 | Bacteria | 675 |
| 275 | Ga0163162_12349777 | 3300013306 | Bacteria | 613 |
| 276 | Ga0163162_12826517 | 3300013306 | Bacteria | 559 |
| 277 | Ga0157372_10201797 | 3300013307 | Bacteria | 2304 |
| 278 | Ga0157372_10579615 | 3300013307 | Bacteria | 1308 |
| 279 | Ga0157372_10940107 | 3300013307 | Bacteria | 1002 |
| 280 | Ga0157375_10624930 | 3300013308 | Bacteria | 1235 |
| 281 | Ga0157375_10691138 | 3300013308 | Bacteria | 1174 |
| 282 | Ga0157375_10747294 | 3300013308 | Bacteria | 1130 |
| 283 | Ga0163163_10127555 | 3300014325 | Bacteria | 2583 |
| 284 | Ga0163163_10370574 | 3300014325 | Bacteria | 1489 |
| 285 | Ga0163163_11096593 | 3300014325 | Bacteria | 859 |
| 286 | Ga0163163_11391692 | 3300014325 | Bacteria | 763 |
| 287 | Ga0163163_12210602 | 3300014325 | Bacteria | 609 |
| 288 | Ga0157380_10341204 | 3300014326 | Bacteria | 1397 |
| 289 | Ga0157380_10599164 | 3300014326 | Bacteria | 1090 |
| 290 | Ga0157380_12204986 | 3300014326 | Bacteria | 615 |
| 291 | Ga0157379_10209640 | 3300014968 | Bacteria | 1764 |
| 292 | Ga0157379_10568872 | 3300014968 | Bacteria | 1056 |
| 293 | Ga0157376_10620496 | 3300014969 | Bacteria | 1078 |
| 294 | Ga0157376_10804516 | 3300014969 | Bacteria | 953 |
| 295 | Ga0157376_10912082 | 3300014969 | Bacteria | 897 |
| 296 | Ga0182007_10241593 | 3300015262 | Bacteria | 645 |
| 297 | Ga0163161_10486050 | 3300017792 | Bacteria | 1003 |
| 298 | Ga0163161_10584233 | 3300017792 | Bacteria | 919 |
| 299 | Ga0163161_11136485 | 3300017792 | Bacteria | 673 |
| 300 | Ga0206356_10348709 | 3300020070 | Bacteria | 608 |
| 301 | Ga0206354_10763753 | 3300020081 | Bacteria | 726 |
| 302 | Ga0213876_10169534 | 3300021384 | Bacteria | 1161 |
| 303 | Ga0213876_10325057 | 3300021384 | Bacteria | 818 |
| 304 | Ga0213876_10467307 | 3300021384 | Bacteria | 671 |
| 305 | Ga0213875_10150372 | 3300021388 | Bacteria | 1091 |
| 306 | Ga0224712_10096101 | 3300022467 | Bacteria | 1249 |
| 307 | Ga0209563_101315 | 3300025230 | Bacteria | 6776 |
| 308 | Ga0209677_100543 | 3300025253 | Bacteria | 21018 |
| 309 | Ga0209677_100722 | 3300025253 | Bacteria | 16832 |
| 310 | Ga0209148_1000295 | 3300025254 | Bacteria | 73660 |
| 311 | Ga0209233_1002578 | 3300025261 | Bacteria | 6591 |
| 312 | Ga0209233_1006623 | 3300025261 | Bacteria | 3719 |
| 313 | Ga0209455_1003238 | 3300025272 | Bacteria | 5870 |
| 314 | Ga0209455_1004716 | 3300025272 | Bacteria | 4383 |
| 315 | Ga0209455_1021696 | 3300025272 | Bacteria | 1240 |
| 316 | Ga0209758_1001900 | 3300025297 | Bacteria | 22801 |
| 317 | Ga0209758_1013412 | 3300025297 | Bacteria | 4470 |
| 318 | Ga0209256_1052131 | 3300025299 | Bacteria | 984 |
| 319 | Ga0207697_10022598 | 3300025315 | Bacteria | 2576 |
| 320 | Ga0207697_10044238 | 3300025315 | Bacteria | 1832 |
| 321 | Ga0207697_10227280 | 3300025315 | Bacteria | 824 |
| 322 | Ga0207697_10228741 | 3300025315 | Bacteria | 821 |
| 323 | Ga0207653_10076948 | 3300025885 | Bacteria | 1149 |
| 324 | Ga0207692_10042210 | 3300025898 | Bacteria | 2263 |
| 325 | Ga0207692_10152647 | 3300025898 | Bacteria | 1324 |
| 326 | Ga0207692_10250021 | 3300025898 | Bacteria | 1062 |
| 327 | Ga0207692_10263072 | 3300025898 | Bacteria | 1038 |
| 328 | Ga0207692_10340988 | 3300025898 | Bacteria | 922 |
| 329 | Ga0207692_10616693 | 3300025898 | Bacteria | 699 |
| 330 | Ga0207642_10097318 | 3300025899 | Bacteria | 1469 |
| 331 | Ga0207642_10859819 | 3300025899 | Bacteria | 579 |
| 332 | Ga0207710_10094956 | 3300025900 | Bacteria | 1400 |
| 333 | Ga0207688_10151712 | 3300025901 | Bacteria | 1369 |
| 334 | Ga0207680_10578662 | 3300025903 | Bacteria | 802 |
| 335 | Ga0207647_10113451 | 3300025904 | Bacteria | 1602 |
| 336 | Ga0207699_10011800 | 3300025906 | Bacteria | 4427 |
| 337 | Ga0207699_10267408 | 3300025906 | Bacteria | 1184 |
| 338 | Ga0207699_10504622 | 3300025906 | Bacteria | 873 |
| 339 | Ga0207699_10586267 | 3300025906 | Bacteria | 811 |
| 340 | Ga0207643_10135707 | 3300025908 | Bacteria | 1467 |
| 341 | Ga0207643_10252516 | 3300025908 | Bacteria | 1087 |
| 342 | Ga0207684_10366162 | 3300025910 | Bacteria | 1240 |
| 343 | Ga0207654_10096920 | 3300025911 | Bacteria | 1810 |
| 344 | Ga0207654_10160018 | 3300025911 | Bacteria | 1454 |
| 345 | Ga0207654_10224647 | 3300025911 | Bacteria | 1247 |
| 346 | Ga0207707_10008183 | 3300025912 | Bacteria | 9074 |
| 347 | Ga0207707_10369948 | 3300025912 | Bacteria | 1233 |
| 348 | Ga0207707_10477221 | 3300025912 | Bacteria | 1065 |
| 349 | Ga0207707_10669777 | 3300025912 | Bacteria | 873 |
| 350 | Ga0207695_10071334 | 3300025913 | Bacteria | 3548 |
| 351 | Ga0207671_10508006 | 3300025914 | Bacteria | 961 |
| 352 | Ga0207671_10595909 | 3300025914 | Bacteria | 881 |
| 353 | Ga0207693_10045163 | 3300025915 | Bacteria | 3461 |
| 354 | Ga0207693_10055491 | 3300025915 | Bacteria | 3108 |
| 355 | Ga0207693_10263120 | 3300025915 | Bacteria | 1352 |
| 356 | Ga0207663_10002736 | 3300025916 | Bacteria | 8503 |
| 357 | Ga0207663_10409162 | 3300025916 | Bacteria | 1039 |
| 358 | Ga0207662_10335633 | 3300025918 | Bacteria | 1012 |
| 359 | Ga0207657_10173641 | 3300025919 | Bacteria | 1745 |
| 360 | Ga0207657_10907579 | 3300025919 | Bacteria | 679 |
| 361 | Ga0207649_10201576 | 3300025920 | Bacteria | 1406 |
| 362 | Ga0207649_10355147 | 3300025920 | Bacteria | 1086 |
| 363 | Ga0207649_10503760 | 3300025920 | Bacteria | 921 |
| 364 | Ga0207652_10129770 | 3300025921 | Bacteria | 2247 |
| 365 | Ga0207652_10164815 | 3300025921 | Bacteria | 1987 |
| 366 | Ga0207652_10305259 | 3300025921 | Bacteria | 1436 |
| 367 | Ga0207652_10351820 | 3300025921 | Bacteria | 1330 |
| 368 | Ga0207652_10610512 | 3300025921 | Bacteria | 978 |
| 369 | Ga0207652_11500576 | 3300025921 | Bacteria | 578 |
| 370 | Ga0207646_10369425 | 3300025922 | Bacteria | 1296 |
| 371 | Ga0207694_10206275 | 3300025924 | Bacteria | 1600 |
| 372 | Ga0207694_10266828 | 3300025924 | Bacteria | 1403 |
| 373 | Ga0207694_11040842 | 3300025924 | Bacteria | 693 |
| 374 | Ga0207694_11235147 | 3300025924 | Bacteria | 632 |
| 375 | Ga0207650_10625123 | 3300025925 | Bacteria | 907 |
| 376 | Ga0207687_10305000 | 3300025927 | Bacteria | 1284 |
| 377 | Ga0207687_10593584 | 3300025927 | Bacteria | 933 |
| 378 | Ga0207700_10010462 | 3300025928 | Bacteria | 5857 |
| 379 | Ga0207700_10012790 | 3300025928 | Bacteria | 5427 |
| 380 | Ga0207700_10029757 | 3300025928 | Bacteria | 3858 |
| 381 | Ga0207700_10378915 | 3300025928 | Bacteria | 1237 |
| 382 | Ga0207700_10400753 | 3300025928 | Bacteria | 1202 |
| 383 | Ga0207700_10684841 | 3300025928 | Bacteria | 915 |
| 384 | Ga0207700_11148398 | 3300025928 | Bacteria | 694 |
| 385 | Ga0207664_10254380 | 3300025929 | Bacteria | 1534 |
| 386 | Ga0207664_10340402 | 3300025929 | Bacteria | 1326 |
| 387 | Ga0207644_10179336 | 3300025931 | Bacteria | 1659 |
| 388 | Ga0207644_10626714 | 3300025931 | Bacteria | 894 |
| 389 | Ga0207706_10130949 | 3300025933 | Bacteria | 2206 |
| 390 | Ga0207706_10326055 | 3300025933 | Bacteria | 1336 |
| 391 | Ga0207709_10465780 | 3300025935 | Bacteria | 980 |
| 392 | Ga0207709_11359072 | 3300025935 | Bacteria | 588 |
| 393 | Ga0207670_10360927 | 3300025936 | Bacteria | 1153 |
| 394 | Ga0207669_10207027 | 3300025937 | Bacteria | 1429 |
| 395 | Ga0207669_11403328 | 3300025937 | Bacteria | 595 |
| 396 | Ga0207704_10166691 | 3300025938 | Bacteria | 1574 |
| 397 | Ga0207704_10708908 | 3300025938 | Bacteria | 834 |
| 398 | Ga0207691_10508924 | 3300025940 | Bacteria | 1022 |
| 399 | Ga0207691_10844799 | 3300025940 | Bacteria | 768 |
| 400 | Ga0207711_10140227 | 3300025941 | Bacteria | 2174 |
| 401 | Ga0207711_10300286 | 3300025941 | Bacteria | 1481 |
| 402 | Ga0207689_10975978 | 3300025942 | Bacteria | 715 |
| 403 | Ga0207661_10000878 | 3300025944 | Bacteria | 19794 |
| 404 | Ga0207661_10062380 | 3300025944 | Bacteria | 3015 |
| 405 | Ga0207661_10850753 | 3300025944 | Bacteria | 840 |
| 406 | Ga0207661_11273548 | 3300025944 | Bacteria | 676 |
| 407 | Ga0207679_10356886 | 3300025945 | Bacteria | 1276 |
| 408 | Ga0207667_10105980 | 3300025949 | Bacteria | 2900 |
| 409 | Ga0207667_10144958 | 3300025949 | Bacteria | 2445 |
| 410 | Ga0207667_10148791 | 3300025949 | Bacteria | 2410 |
| 411 | Ga0207667_11145110 | 3300025949 | Bacteria | 759 |
| 412 | Ga0207712_10857651 | 3300025961 | Bacteria | 801 |
| 413 | Ga0207712_11397532 | 3300025961 | Bacteria | 626 |
| 414 | Ga0207668_11320483 | 3300025972 | Bacteria | 649 |
| 415 | Ga0207640_10083438 | 3300025981 | Bacteria | 2191 |
| 416 | Ga0207640_10229671 | 3300025981 | Bacteria | 1427 |
| 417 | Ga0207640_10356669 | 3300025981 | Bacteria | 1177 |
| 418 | Ga0207658_10602505 | 3300025986 | Bacteria | 987 |
| 419 | Ga0207658_11332541 | 3300025986 | Bacteria | 656 |
| 420 | Ga0207677_10091376 | 3300026023 | Bacteria | 2214 |
| 421 | Ga0207677_10443850 | 3300026023 | Bacteria | 1110 |
| 422 | Ga0207703_10065112 | 3300026035 | Bacteria | 2994 |
| 423 | Ga0207703_11145258 | 3300026035 | Bacteria | 747 |
| 424 | Ga0207703_11241870 | 3300026035 | Bacteria | 716 |
| 425 | Ga0207639_10240699 | 3300026041 | Bacteria | 1573 |
| 426 | Ga0207639_10268042 | 3300026041 | Bacteria | 1497 |
| 427 | Ga0207639_10292211 | 3300026041 | Bacteria | 1437 |
| 428 | Ga0207678_10246188 | 3300026067 | Bacteria | 1531 |
| 429 | Ga0207678_10561648 | 3300026067 | Bacteria | 999 |
| 430 | Ga0207678_10786279 | 3300026067 | Bacteria | 840 |
| 431 | Ga0207678_11095558 | 3300026067 | Bacteria | 705 |
| 432 | Ga0207702_10000318 | 3300026078 | Bacteria | 55209 |
| 433 | Ga0207702_10312632 | 3300026078 | Bacteria | 1494 |
| 434 | Ga0207702_10372300 | 3300026078 | Bacteria | 1372 |
| 435 | Ga0207702_11139192 | 3300026078 | Bacteria | 774 |
| 436 | Ga0207641_10357451 | 3300026088 | Bacteria | 1393 |
| 437 | Ga0207641_10474896 | 3300026088 | Bacteria | 1211 |
| 438 | Ga0207641_10517494 | 3300026088 | Bacteria | 1160 |
| 439 | Ga0207641_12096007 | 3300026088 | Bacteria | 566 |
| 440 | Ga0207648_10402717 | 3300026089 | Bacteria | 1240 |
| 441 | Ga0207648_10499119 | 3300026089 | Bacteria | 1113 |
| 442 | Ga0207648_10534857 | 3300026089 | Bacteria | 1075 |
| 443 | Ga0207648_10706097 | 3300026089 | Bacteria | 935 |
| 444 | Ga0207676_10199904 | 3300026095 | Bacteria | 1765 |
| 445 | Ga0207674_10073988 | 3300026116 | Bacteria | 3420 |
| 446 | Ga0207674_10666112 | 3300026116 | Bacteria | 1005 |
| 447 | Ga0207674_10670582 | 3300026116 | Bacteria | 1001 |
| 448 | Ga0207675_100609178 | 3300026118 | Bacteria | 1096 |
| 449 | Ga0207675_101074709 | 3300026118 | Bacteria | 824 |
| 450 | Ga0207683_10083899 | 3300026121 | Bacteria | 2832 |
| 451 | Ga0207683_10153979 | 3300026121 | Bacteria | 2076 |
| 452 | Ga0207683_10461287 | 3300026121 | Bacteria | 1172 |
| 453 | Ga0207683_10478614 | 3300026121 | Bacteria | 1149 |
| 454 | Ga0207683_10984709 | 3300026121 | Bacteria | 783 |
| 455 | Ga0207683_11224932 | 3300026121 | Bacteria | 695 |
| 456 | Ga0207683_11652559 | 3300026121 | Bacteria | 590 |
| 457 | Ga0207683_11813868 | 3300026121 | Bacteria | 559 |
| 458 | Ga0207698_10403643 | 3300026142 | Bacteria | 1307 |
| 459 | Ga0207698_10715809 | 3300026142 | Bacteria | 997 |
| 460 | Ga0209588_1060561 | 3300027671 | Bacteria | 1224 |
| 461 | Ga0209813_10024630 | 3300027866 | Bacteria | 1723 |
| 462 | Ga0268266_10066637 | 3300028379 | Bacteria | 3114 |
| 463 | Ga0268266_10129302 | 3300028379 | Bacteria | 2257 |
| 464 | Ga0268266_10341670 | 3300028379 | Bacteria | 1405 |
| 465 | Ga0268266_10378883 | 3300028379 | Bacteria | 1334 |
| 466 | Ga0268266_10757186 | 3300028379 | Bacteria | 937 |
| 467 | Ga0268266_11222413 | 3300028379 | Bacteria | 726 |
| 468 | Ga0268266_11364934 | 3300028379 | Bacteria | 684 |
| 469 | Ga0268266_12068669 | 3300028379 | Bacteria | 542 |
| 470 | Ga0268265_10289989 | 3300028380 | Bacteria | 1468 |
| 471 | Ga0268265_10506484 | 3300028380 | Bacteria | 1138 |
| 472 | Ga0268264_10297652 | 3300028381 | Bacteria | 1518 |
| 473 | Ga0268264_11273547 | 3300028381 | Bacteria | 745 |
| 474 | Ga0307517_10000232 | 3300028786 | Bacteria | 94332 |
| 475 | Ga0307517_10469903 | 3300028786 | Bacteria | 647 |
| 476 | Ga0307515_10087102 | 3300028794 | Bacteria | 3970 |
| 477 | Ga0265332_10035231 | 3300031238 | Bacteria | 2174 |
| 478 | Ga0265340_10091462 | 3300031247 | Bacteria | 1421 |
| 479 | Ga0265340_10217072 | 3300031247 | Bacteria | 857 |
| 480 | Ga0265339_10073499 | 3300031249 | Bacteria | 1818 |
| 481 | Ga0265331_10089610 | 3300031250 | Bacteria | 1423 |
| 482 | Ga0265316_10196584 | 3300031344 | Bacteria | 1496 |
| 483 | Ga0265316_10588938 | 3300031344 | Bacteria | 789 |
| 484 | Ga0307513_10191401 | 3300031456 | Bacteria | 1897 |
| 485 | Ga0307513_10240504 | 3300031456 | Bacteria | 1615 |
| 486 | Ga0307509_10331144 | 3300031507 | Bacteria | 1254 |
| 487 | Ga0265313_10342930 | 3300031595 | Bacteria | 593 |
| 488 | Ga0307508_10126440 | 3300031616 | Bacteria | 2159 |
| 489 | Ga0307508_10328232 | 3300031616 | Bacteria | 1122 |
| 490 | Ga0307508_10665446 | 3300031616 | Bacteria | 648 |
| 491 | Ga0265314_10005054 | 3300031711 | Bacteria | 12021 |
| 492 | Ga0265314_10220531 | 3300031711 | Bacteria | 1107 |
| 493 | Ga0307516_10114956 | 3300031730 | Bacteria | 2488 |
| 494 | Ga0307516_10178300 | 3300031730 | Bacteria | 1860 |
| 495 | Ga0307516_10279702 | 3300031730 | Bacteria | 1351 |
| 496 | Ga0307405_10263134 | 3300031731 | Bacteria | 1289 |
| 497 | Ga0307413_10594532 | 3300031824 | Bacteria | 904 |
| 498 | Ga0307406_10237733 | 3300031901 | Bacteria | 1364 |
| 499 | Ga0307407_10538655 | 3300031903 | Bacteria | 861 |
| 500 | Ga0307412_10530413 | 3300031911 | Bacteria | 985 |
| 501 | Ga0307416_100460323 | 3300032002 | Bacteria | 1327 |
| 502 | Ga0307416_101970837 | 3300032002 | Bacteria | 687 |
| 503 | Ga0307416_101979258 | 3300032002 | Bacteria | 685 |
| 504 | Ga0307414_10974180 | 3300032004 | Bacteria | 780 |
| 505 | Ga0307415_100314346 | 3300032126 | Bacteria | 1303 |
| 506 | Ga0307415_100662739 | 3300032126 | Bacteria | 937 |
| 507 | Ga0307510_10072618 | 3300033180 | Bacteria | 3417 |
| 508 | Ga0307510_10089264 | 3300033180 | Bacteria | 2936 |
| 509 | Ga0307510_10121016 | 3300033180 | Bacteria | 2322 |
| 510 | Ga0307510_10301776 | 3300033180 | Bacteria | 1063 |
| 511 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 512 | Ga0373958_0165769 | 3300034819 | Bacteria | 561 |
| 513 | Ga0373958_0166297 | 3300034819 | Bacteria | 561 |
| 514 | Ga0373926_0033050 | 3300035083 | Bacteria | 1827 |
| 515 | Ga0373934_0023493 | 3300035086 | Bacteria | 2382 |
| 516 | Ga0373934_0096153 | 3300035086 | Bacteria | 1196 |
| 517 | Ga0373949_0072389 | 3300035090 | Bacteria | 905 |
| 518 | Ga0373951_0095136 | 3300035091 | Bacteria | 786 |
| 519 | Ga0373952_0253775 | 3300035092 | Bacteria | 533 |
| 520 | Ga0373923_0004936 | 3300035111 | Bacteria | 4481 |
| 521 | Ga0373923_0039874 | 3300035111 | Bacteria | 1930 |
| 522 | Ga0373923_0042855 | 3300035111 | Bacteria | 1871 |
| 523 | Ga0373936_0070753 | 3300035113 | Bacteria | 1437 |
| 524 | Ga0373939_0109740 | 3300035114 | Bacteria | 959 |
| 525 | Ga0373945_0015296 | 3300035116 | Bacteria | 2579 |
| 526 | Ga0373945_0100694 | 3300035116 | Bacteria | 1130 |
| 527 | Ga0373953_0078384 | 3300035117 | Bacteria | 1370 |
| 528 | Ga0373953_0247502 | 3300035117 | Bacteria | 774 |
| 529 | Ga0373954_0011463 | 3300035118 | Bacteria | 3929 |
| 530 | Ga0373954_0174243 | 3300035118 | Bacteria | 1054 |
| 531 | Ga0373956_0082067 | 3300035119 | Bacteria | 1480 |
| 532 | Ga0373956_0155201 | 3300035119 | Bacteria | 1077 |
| 533 | Ga0373956_0451395 | 3300035119 | Bacteria | 613 |
| 534 | Ga0373957_0120048 | 3300035120 | Bacteria | 1063 |
| 535 | Ga0373943_0141500 | 3300035170 | Bacteria | 1296 |
| 536 | Ga0373943_0463427 | 3300035170 | Bacteria | 737 |
| 537 | Ga0373946_0014322 | 3300035171 | Bacteria | 2989 |
| 538 | Ga0373946_0214788 | 3300035171 | Bacteria | 927 |
| 539 | Ga0373946_0482002 | 3300035171 | Bacteria | 634 |
| 540 | Ga0373955_0004380 | 3300035172 | Bacteria | 6246 |
| 541 | Ga0373955_0051079 | 3300035172 | Bacteria | 2251 |
| 542 | Ga0373961_0031149 | 3300035241 | Bacteria | 1488 |
| 543 | Ga0373961_0070941 | 3300035241 | Bacteria | 1077 |
| 544 | Ga0373924_0033451 | 3300035410 | Bacteria | 2075 |
| 545 | Ga0373924_0093920 | 3300035410 | Bacteria | 1285 |
| 546 | Ga0373931_0015641 | 3300035691 | Bacteria | 3723 |
| 547 | Ga0373935_0001267 | 3300035692 | Bacteria | 13929 |
| 548 | Ga0373935_0039786 | 3300035692 | Bacteria | 2948 |
| 549 | Ga0373927_0000766 | 3300035695 | Bacteria | 24573 |
| 550 | Ga0373927_0006724 | 3300035695 | Bacteria | 7827 |
| 551 | Ga0373927_0200773 | 3300035695 | Bacteria | 1309 |
| 552 | Ga0373927_0288502 | 3300035695 | Bacteria | 1080 |
| 553 | Ga0373927_0328502 | 3300035695 | Bacteria | 1007 |
| 554 | Ga0373927_0349402 | 3300035695 | Bacteria | 974 |
| 555 | Ga0373927_1123709 | 3300035695 | Bacteria | 518 |
| 556 | Ga0373933_0000218 | 3300035724 | Bacteria | 37928 |
| 557 | Ga0373933_0231444 | 3300035724 | Bacteria | 1187 |
| 558 | Ga0373933_0356576 | 3300035724 | Bacteria | 950 |
| 559 | Ga0373947_0000310 | 3300035725 | Bacteria | 27577 |
| 560 | Ga0373947_0013664 | 3300035725 | Bacteria | 4651 |
| 561 | Ga0373947_0374672 | 3300035725 | Bacteria | 957 |
| 562 | Ga0373937_0014630 | 3300036401 | Bacteria | 6929 |
| 563 | Ga0373925_0006419 | 3300037068 | Bacteria | 8654 |
| 564 | Ga0373925_0021485 | 3300037068 | Bacteria | 4702 |
| 565 | Ga0373925_0078313 | 3300037068 | Bacteria | 2510 |
| 566 | Ga0373925_0589307 | 3300037068 | Bacteria | 915 |
| 567 | Ga0373925_0654343 | 3300037068 | Bacteria | 866 |
| 568 | Ga0395900_0032832 | 3300037418 | Bacteria | 5339 |
| 569 | Ga0395900_0108628 | 3300037418 | Bacteria | 2850 |
| 570 | Ga0395900_0199177 | 3300037418 | Bacteria | 2027 |
| 571 | Ga0395900_1525769 | 3300037418 | Bacteria | 580 |
| 572 | Ga0395898_0089031 | 3300037466 | Bacteria | 2971 |
| 573 | Ga0395898_0631023 | 3300037466 | Bacteria | 1014 |
| 574 | Ga0395905_0048135 | 3300037471 | Bacteria | 3996 |
| 575 | Ga0436364_0331795 | 3300037853 | Bacteria | 1630 |
| 576 | Ga0436364_0603569 | 3300037853 | Bacteria | 1111 |
| 577 | Ga0395901_0113781 | 3300038443 | Bacteria | 2842 |
| 578 | Ga0395901_0297332 | 3300038443 | Bacteria | 1674 |
| 579 | Ga0436365_0118730 | 3300039437 | Bacteria | 842 |
| 580 | Ga0436365_0135384 | 3300039437 | Bacteria | 2104 |
| 581 | Ga0436365_0209743 | 3300039437 | Bacteria | 2892 |
| 582 | Ga0436365_0279102 | 3300039437 | Bacteria | 2928 |
| 583 | Ga0436365_0346369 | 3300039437 | Bacteria | 1174 |
| 584 | Ga0436365_1026627 | 3300039437 | Bacteria | 1239 |
| 585 | Ga0436362_0249161 | 3300039453 | Bacteria | 713 |
| 586 | Ga0436362_1201460 | 3300039453 | Bacteria | 556 |
| 587 | Ga0451789_1333214 | 3300041443 | Bacteria | 540 |
| 588 | Ga0451793_1038465 | 3300041452 | Bacteria | 1074 |
| 589 | Ga0451802_1431654 | 3300041460 | Bacteria | 677 |
| 590 | Ga0451807_0826454 | 3300041486 | Bacteria | 519 |
| 591 | Ga0451855_0143711 | 3300041511 | Bacteria | 572 |
| 592 | Ga0466969_0093259 | 3300044656 | Bacteria | 1425 |
| 593 | Ga0466972_0029548 | 3300044658 | Bacteria | 2698 |
| 594 | Ga0466966_0343263 | 3300044684 | Bacteria | 897 |
| 595 | Ga0466961_0156035 | 3300044693 | Bacteria | 1424 |
| 596 | Ga0466963_0258548 | 3300044694 | Bacteria | 1222 |
| 597 | Ga0466963_0996490 | 3300044694 | Bacteria | 590 |
| 598 | Ga0466971_0156462 | 3300044719 | Bacteria | 1065 |
| 599 | Ga0466968_0379186 | 3300044735 | Bacteria | 690 |
| 600 | Ga0466970_0260390 | 3300044765 | Bacteria | 973 |
| 601 | Ga0466957_0080078 | 3300044842 | Bacteria | 2033 |
| 602 | Ga0466957_0237937 | 3300044842 | Bacteria | 1207 |
| 603 | Ga0466957_0297429 | 3300044842 | Bacteria | 1084 |
| 604 | Ga0466957_0427749 | 3300044842 | Bacteria | 909 |
| 605 | Ga0466960_0181359 | 3300044901 | Bacteria | 1141 |
| 606 | Ga0466959_0048894 | 3300045049 | Bacteria | 3107 |
| 607 | Ga0466967_0028253 | 3300045976 | Bacteria | 4680 |
| 608 | Ga0466967_0062009 | 3300045976 | Bacteria | 3318 |
| 609 | Ga0466967_0204967 | 3300045976 | Bacteria | 1869 |
| 610 | Ga0466967_1213654 | 3300045976 | Bacteria | 751 |
| 611 | Ga0495617_107272 | 3300046452 | Bacteria | 905 |
| 612 | Ga0495592_0102991 | 3300046454 | Bacteria | 2032 |
| 613 | Ga0495592_0142617 | 3300046454 | Bacteria | 1664 |
| 614 | Ga0495603_0000936 | 3300046455 | Bacteria | 16788 |
| 615 | Ga0495603_0021318 | 3300046455 | Bacteria | 3924 |
| 616 | Ga0495603_0105542 | 3300046455 | Bacteria | 1644 |
| 617 | Ga0495603_0237833 | 3300046455 | Bacteria | 1049 |
| 618 | Ga0495603_0392356 | 3300046455 | Bacteria | 796 |
| 619 | Ga0495629_0001416 | 3300046459 | Bacteria | 18913 |
| 620 | Ga0495629_0123416 | 3300046459 | Bacteria | 1804 |
| 621 | Ga0495629_0484623 | 3300046459 | Bacteria | 835 |
| 622 | Ga0495629_0633985 | 3300046459 | Bacteria | 713 |
| 623 | Ga0495638_0139687 | 3300046460 | Bacteria | 1415 |
| 624 | Ga0495638_0317616 | 3300046460 | Bacteria | 833 |
| 625 | Ga0495641_0016464 | 3300046461 | Bacteria | 3896 |
| 626 | Ga0495641_0138934 | 3300046461 | Bacteria | 1085 |
| 627 | Ga0495651_0019880 | 3300046462 | Bacteria | 5207 |
| 628 | Ga0495651_0178579 | 3300046462 | Bacteria | 1505 |
| 629 | Ga0495653_0049261 | 3300046463 | Bacteria | 3246 |
| 630 | Ga0495653_0117625 | 3300046463 | Bacteria | 1899 |
| 631 | Ga0495650_0125333 | 3300046471 | Bacteria | 942 |
| 632 | Ga0495580_0005025 | 3300046472 | Bacteria | 11027 |
| 633 | Ga0495580_0006058 | 3300046472 | Bacteria | 9898 |
| 634 | Ga0495580_0514895 | 3300046472 | Bacteria | 798 |
| 635 | Ga0495582_0018773 | 3300046473 | Bacteria | 3780 |
| 636 | Ga0495582_0038113 | 3300046473 | Bacteria | 2644 |
| 637 | Ga0495582_0082250 | 3300046473 | Bacteria | 1789 |
| 638 | Ga0495582_0124167 | 3300046473 | Bacteria | 1456 |
| 639 | Ga0495639_0000072 | 3300046475 | Bacteria | 46904 |
| 640 | Ga0495662_0000572 | 3300046476 | Bacteria | 16948 |
| 641 | Ga0495662_0185583 | 3300046476 | Bacteria | 1025 |
| 642 | Ga0495662_0217863 | 3300046476 | Bacteria | 941 |
| 643 | Ga0495664_0014835 | 3300046477 | Bacteria | 4423 |
| 644 | Ga0495664_0045196 | 3300046477 | Bacteria | 2611 |
| 645 | Ga0495585_0586092 | 3300046492 | Bacteria | 525 |
| 646 | Ga0495594_0000046 | 3300046499 | Bacteria | 53822 |
| 647 | Ga0495594_0297721 | 3300046499 | Bacteria | 919 |
| 648 | Ga0495596_0130534 | 3300046500 | Bacteria | 975 |
| 649 | Ga0495596_0177088 | 3300046500 | Bacteria | 829 |
| 650 | Ga0495596_0195003 | 3300046500 | Bacteria | 787 |
| 651 | Ga0495606_0168025 | 3300046507 | Bacteria | 1275 |
| 652 | Ga0495608_0323669 | 3300046511 | Bacteria | 952 |
| 653 | Ga0495608_0637386 | 3300046511 | Bacteria | 638 |
| 654 | Ga0495610_0029757 | 3300046512 | Bacteria | 2871 |
| 655 | Ga0495618_0100704 | 3300046514 | Bacteria | 1849 |
| 656 | Ga0495618_0186351 | 3300046514 | Bacteria | 1317 |
| 657 | Ga0495620_0229342 | 3300046515 | Bacteria | 710 |
| 658 | Ga0495628_0018626 | 3300046516 | Bacteria | 5747 |
| 659 | Ga0495628_0033483 | 3300046516 | Bacteria | 4141 |
| 660 | Ga0495628_0327775 | 3300046516 | Bacteria | 1129 |
| 661 | Ga0495628_0517885 | 3300046516 | Bacteria | 859 |
| 662 | Ga0495630_0024634 | 3300046517 | Bacteria | 4447 |
| 663 | Ga0495630_0093534 | 3300046517 | Bacteria | 2272 |
| 664 | Ga0495630_0154765 | 3300046517 | Bacteria | 1745 |
| 665 | Ga0495630_0513814 | 3300046517 | Bacteria | 918 |
| 666 | Ga0495631_0217855 | 3300046518 | Bacteria | 815 |
| 667 | Ga0495631_0334536 | 3300046518 | Bacteria | 644 |
| 668 | Ga0495632_0063839 | 3300046519 | Bacteria | 1782 |
| 669 | Ga0495637_0100090 | 3300046520 | Bacteria | 1134 |
| 670 | Ga0495644_0153157 | 3300046523 | Bacteria | 883 |
| 671 | Ga0495644_0243040 | 3300046523 | Bacteria | 698 |
| 672 | Ga0495644_0281117 | 3300046523 | Bacteria | 649 |
| 673 | Ga0495644_0359059 | 3300046523 | Bacteria | 574 |
| 674 | Ga0495648_0249358 | 3300046524 | Bacteria | 858 |
| 675 | Ga0495648_0373903 | 3300046524 | Bacteria | 644 |
| 676 | Ga0495663_0177723 | 3300046525 | Bacteria | 736 |
| 677 | Ga0495666_0041837 | 3300046526 | Bacteria | 2217 |
| 678 | Ga0495666_0167306 | 3300046526 | Bacteria | 1018 |
| 679 | Ga0495642_0191454 | 3300046528 | Bacteria | 891 |
| 680 | Ga0495642_0198449 | 3300046528 | Bacteria | 875 |
| 681 | Ga0495665_0000335 | 3300046531 | Bacteria | 23811 |
| 682 | Ga0495640_0002138 | 3300046533 | Bacteria | 15789 |
| 683 | Ga0495640_0051516 | 3300046533 | Bacteria | 2830 |
| 684 | Ga0495640_0361314 | 3300046533 | Bacteria | 895 |
| 685 | Ga0495586_0059346 | 3300046535 | Bacteria | 2079 |
| 686 | Ga0495587_0345412 | 3300046536 | Bacteria | 830 |
| 687 | Ga0495609_0119716 | 3300046538 | Bacteria | 1133 |
| 688 | Ga0495609_0131591 | 3300046538 | Bacteria | 1071 |
| 689 | Ga0495645_0013978 | 3300046543 | Bacteria | 5689 |
| 690 | Ga0495645_0036237 | 3300046543 | Bacteria | 3596 |
| 691 | Ga0495622_0084671 | 3300046557 | Bacteria | 1458 |
| 692 | Ga0495622_0249119 | 3300046557 | Bacteria | 782 |
| 693 | Ga0495633_0312506 | 3300046558 | Bacteria | 713 |
| 694 | Ga0495667_0032717 | 3300046559 | Bacteria | 3482 |
| 695 | Ga0495667_0803522 | 3300046559 | Bacteria | 580 |
| 696 | Ga0495668_0168169 | 3300046616 | Bacteria | 1201 |
| 697 | Ga0495668_0481719 | 3300046616 | Bacteria | 683 |
| 698 | Ga0495668_0732608 | 3300046616 | Bacteria | 547 |
| 699 | Ga0495634_0003037 | 3300046642 | Bacteria | 13668 |
| 700 | Ga0495634_0044482 | 3300046642 | Bacteria | 3005 |
| 701 | Ga0495611_0066313 | 3300046648 | Bacteria | 1646 |
| 702 | Ga0495611_0300332 | 3300046648 | Bacteria | 740 |
| 703 | Ga0495625_0251011 | 3300046660 | Bacteria | 1148 |
| 704 | Ga0495635_0002038 | 3300046663 | Bacteria | 13679 |
| 705 | Ga0495635_0016231 | 3300046663 | Bacteria | 5198 |
| 706 | Ga0495635_0089467 | 3300046663 | Bacteria | 2106 |
| 707 | Ga0495635_0255921 | 3300046663 | Bacteria | 1180 |
| 708 | Ga0495588_0416881 | 3300046674 | Bacteria | 705 |
| 709 | Ga0495657_0121602 | 3300046675 | Bacteria | 1644 |
| 710 | Ga0495599_0128792 | 3300046678 | Bacteria | 1572 |
| 711 | Ga0495599_0191494 | 3300046678 | Bacteria | 1258 |
| 712 | Ga0495599_0306147 | 3300046678 | Bacteria | 958 |
| 713 | Ga0495599_0644747 | 3300046678 | Bacteria | 614 |
| 714 | Ga0495623_0075175 | 3300046679 | Bacteria | 2098 |
| 715 | Ga0495646_0066903 | 3300046680 | Bacteria | 2125 |
| 716 | Ga0495646_0081016 | 3300046680 | Bacteria | 1892 |
| 717 | Ga0495646_0119658 | 3300046680 | Bacteria | 1491 |
| 718 | Ga0495646_0481522 | 3300046680 | Bacteria | 638 |
| 719 | Ga0495647_0008783 | 3300046681 | Bacteria | 3403 |
| 720 | Ga0495647_0016367 | 3300046681 | Bacteria | 2610 |
| 721 | Ga0495658_0002742 | 3300046683 | Bacteria | 8859 |
| 722 | Ga0495658_0009522 | 3300046683 | Bacteria | 4844 |
| 723 | Ga0495658_0247379 | 3300046683 | Bacteria | 1121 |
| 724 | Ga0495669_0124118 | 3300046684 | Bacteria | 1212 |
| 725 | Ga0495669_0198256 | 3300046684 | Bacteria | 959 |
| 726 | Ga0495669_0310627 | 3300046684 | Bacteria | 760 |
| 727 | Ga0495613_0081505 | 3300046689 | Bacteria | 2351 |
| 728 | Ga0495613_0148666 | 3300046689 | Bacteria | 1672 |
| 729 | Ga0495624_0000795 | 3300046690 | Bacteria | 24919 |
| 730 | Ga0495624_0056079 | 3300046690 | Bacteria | 2480 |
| 731 | Ga0495670_0469767 | 3300046691 | Bacteria | 682 |
| 732 | Ga0495671_0091675 | 3300046692 | Bacteria | 1487 |
| 733 | Ga0495671_0437409 | 3300046692 | Bacteria | 625 |
| 734 | Ga0495649_0299125 | 3300046694 | Bacteria | 819 |
| 735 | Ga0495649_0408599 | 3300046694 | Bacteria | 681 |
| 736 | Ga0495589_0135740 | 3300046794 | Bacteria | 1180 |
| 737 | Ga0495600_0093192 | 3300046809 | Bacteria | 1964 |
| 738 | Ga0495600_0115281 | 3300046809 | Bacteria | 1749 |
| 739 | Ga0495581_0000030 | 3300047315 | Bacteria | 53487 |
| 740 | Ga0495581_0126320 | 3300047315 | Bacteria | 1489 |
| 741 | Ga0495581_0144120 | 3300047315 | Bacteria | 1390 |
| 742 | Ga0495581_0352195 | 3300047315 | Bacteria | 859 |
| 743 | Ga0495604_0105989 | 3300047317 | Bacteria | 2057 |
| 744 | Ga0495604_0730681 | 3300047317 | Bacteria | 627 |
| 745 | Ga0495674_0012381 | 3300047319 | Bacteria | 8036 |
| 746 | Ga0495674_0026440 | 3300047319 | Bacteria | 5309 |
| 747 | Ga0495674_0170500 | 3300047319 | Bacteria | 1816 |
| 748 | Ga0495674_0433544 | 3300047319 | Bacteria | 1058 |
| 749 | Ga0495674_1157765 | 3300047319 | Bacteria | 586 |
| 750 | Ga0495672_0019292 | 3300047320 | Bacteria | 4502 |
| 751 | Ga0495676_0028804 | 3300047321 | Bacteria | 4738 |
| 752 | Ga0495676_0426845 | 3300047321 | Bacteria | 877 |
| 753 | Ga0495680_0139443 | 3300047322 | Bacteria | 1775 |
| 754 | Ga0495680_0289892 | 3300047322 | Bacteria | 1151 |
| 755 | Ga0495683_0383974 | 3300047323 | Bacteria | 587 |
| 756 | Ga0495675_0384899 | 3300047444 | Bacteria | 820 |
| 757 | Ga0495684_0021000 | 3300047471 | Bacteria | 5029 |
| 758 | Ga0495684_0053297 | 3300047471 | Bacteria | 3086 |
| 759 | Ga0495686_0085355 | 3300047472 | Bacteria | 1923 |
| 760 | Ga0495686_0171913 | 3300047472 | Bacteria | 1260 |
| 761 | Ga0495593_0000398 | 3300047673 | Bacteria | 24218 |
| 762 | Ga0495593_0181923 | 3300047673 | Bacteria | 1058 |
| 763 | Ga0495614_0046075 | 3300048089 | Bacteria | 1870 |
| 764 | Ga0496100_0073875 | 3300048903 | Bacteria | 2283 |
| 765 | Ga0496100_0369385 | 3300048903 | Bacteria | 1087 |
| 766 | Ga0496100_0926204 | 3300048903 | Bacteria | 685 |
| 767 | Ga0496101_0859744 | 3300048904 | Bacteria | 715 |
| 768 | Ga0496101_1368899 | 3300048904 | Bacteria | 552 |
| 769 | Ga0496102_0082256 | 3300048905 | Bacteria | 2969 |
| 770 | Ga0496102_0152685 | 3300048905 | Bacteria | 2170 |
| 771 | Ga0496102_0260356 | 3300048905 | Bacteria | 1635 |
| 772 | Ga0496102_0347549 | 3300048905 | Bacteria | 1396 |
| 773 | Ga0496102_0401306 | 3300048905 | Bacteria | 1289 |
| 774 | Ga0496103_0091837 | 3300048906 | Bacteria | 1916 |
| 775 | Ga0496103_0135099 | 3300048906 | Bacteria | 1576 |
| 776 | Ga0496103_0527388 | 3300048906 | Bacteria | 755 |
| 777 | Ga0496103_0636678 | 3300048906 | Bacteria | 678 |
| 778 | Ga0496104_0044883 | 3300048907 | Bacteria | 4154 |
| 779 | Ga0496104_0463833 | 3300048907 | Bacteria | 1178 |
| 780 | Ga0496104_0526120 | 3300048907 | Bacteria | 1093 |
| 781 | Ga0496104_0548848 | 3300048907 | Bacteria | 1066 |
| 782 | Ga0496104_0777062 | 3300048907 | Bacteria | 864 |
| 783 | Ga0496105_0051519 | 3300048908 | Bacteria | 3400 |
| 784 | Ga0496105_0094396 | 3300048908 | Bacteria | 2470 |
| 785 | Ga0496105_0737928 | 3300048908 | Bacteria | 753 |
| 786 | Ga0496105_0852426 | 3300048908 | Bacteria | 689 |
| 787 | Ga0496106_0411555 | 3300048909 | Bacteria | 1087 |
| 788 | Ga0496106_0607760 | 3300048909 | Bacteria | 875 |
| 789 | Ga0496106_0628249 | 3300048909 | Bacteria | 859 |
| 790 | Ga0496106_0766736 | 3300048909 | Bacteria | 766 |
| 791 | Ga0496107_0037476 | 3300048910 | Bacteria | 3479 |
| 792 | Ga0496107_0114537 | 3300048910 | Bacteria | 1984 |
| 793 | Ga0496107_0316488 | 3300048910 | Bacteria | 1161 |
| 794 | Ga0496107_1098843 | 3300048910 | Bacteria | 574 |
| 795 | Ga0496108_0036615 | 3300048911 | Bacteria | 4083 |
| 796 | Ga0496108_0060709 | 3300048911 | Bacteria | 3181 |
| 797 | Ga0496108_0443405 | 3300048911 | Bacteria | 1134 |
| 798 | Ga0496108_0571795 | 3300048911 | Bacteria | 985 |
| 799 | Ga0496108_1132709 | 3300048911 | Bacteria | 664 |
| 800 | Ga0496109_0057722 | 3300048912 | Bacteria | 3544 |
| 801 | Ga0496109_0353316 | 3300048912 | Bacteria | 1388 |
| 802 | Ga0496109_1851968 | 3300048912 | Bacteria | 536 |
| 803 | Ga0496110_1252080 | 3300048913 | Bacteria | 651 |
| 804 | Ga0496111_0034277 | 3300048914 | Bacteria | 3624 |
| 805 | Ga0496111_0680391 | 3300048914 | Bacteria | 749 |
| 806 | Ga0496112_0033543 | 3300048915 | Bacteria | 4991 |
| 807 | Ga0496112_0049766 | 3300048915 | Bacteria | 4107 |
| 808 | Ga0496112_0631524 | 3300048915 | Bacteria | 1001 |
| 809 | Ga0496112_1010109 | 3300048915 | Bacteria | 751 |
| 810 | Ga0496113_0017212 | 3300048916 | Bacteria | 5013 |
| 811 | Ga0496113_0032120 | 3300048916 | Bacteria | 3813 |
| 812 | Ga0496114_0078476 | 3300048917 | Bacteria | 2785 |
| 813 | Ga0496114_0420047 | 3300048917 | Bacteria | 1184 |
| 814 | Ga0496115_0150310 | 3300048918 | Bacteria | 1923 |
| 815 | Ga0496115_0281240 | 3300048918 | Bacteria | 1366 |
| 816 | Ga0496115_0335240 | 3300048918 | Bacteria | 1235 |
| 817 | Ga0496115_0439175 | 3300048918 | Bacteria | 1055 |
| 818 | Ga0496116_0159299 | 3300048919 | Bacteria | 1241 |
| 819 | Ga0496116_0235381 | 3300048919 | Bacteria | 925 |
| 820 | Ga0496117_0060867 | 3300048920 | Bacteria | 2599 |
| 821 | Ga0496117_0277004 | 3300048920 | Bacteria | 900 |
| 822 | Ga0496118_0134441 | 3300048921 | Bacteria | 1581 |
| 823 | Ga0496118_0283652 | 3300048921 | Bacteria | 920 |
| 824 | Ga0496118_0316502 | 3300048921 | Bacteria | 849 |
| 825 | Ga0496118_0410405 | 3300048921 | Bacteria | 700 |
| 826 | Ga0496119_0147277 | 3300048922 | Bacteria | 1265 |
| 827 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 828 | Ga0496121_0035287 | 3300048924 | Bacteria | 4485 |
| 829 | Ga0496121_0071562 | 3300048924 | Bacteria | 2788 |
| 830 | Ga0496121_0113457 | 3300048924 | Bacteria | 2062 |
| 831 | Ga0496121_0125511 | 3300048924 | Bacteria | 1930 |
| 832 | Ga0496121_0166716 | 3300048924 | Bacteria | 1604 |
| 833 | Ga0496121_0200405 | 3300048924 | Bacteria | 1423 |
| 834 | Ga0496121_0322537 | 3300048924 | Bacteria | 1039 |
| 835 | Ga0496121_0518333 | 3300048924 | Bacteria | 753 |
| 836 | Ga0496124_0236071 | 3300048927 | Bacteria | 1363 |
| 837 | Ga0496124_0248160 | 3300048927 | Bacteria | 1319 |
| 838 | Ga0496125_0576892 | 3300048928 | Bacteria | 618 |
| 839 | Ga0496126_0034975 | 3300048929 | Bacteria | 4711 |
| 840 | Ga0496126_0060610 | 3300048929 | Bacteria | 3402 |
| 841 | Ga0496126_0162691 | 3300048929 | Bacteria | 1906 |
| 842 | Ga0496126_0397020 | 3300048929 | Bacteria | 1119 |
| 843 | Ga0496126_0889485 | 3300048929 | Bacteria | 676 |
| 844 | Ga0501033_0597713 | 3300049570 | Bacteria | 757 |
| 845 | Ga0501047_0041970 | 3300049581 | Bacteria | 4421 |
| 846 | Ga0501048_0522722 | 3300049582 | Bacteria | 851 |
| 847 | Ga0501067_0050483 | 3300049583 | Bacteria | 2305 |
| 848 | Ga0501070_0248474 | 3300049586 | Bacteria | 1455 |
| 849 | Ga0501080_0128602 | 3300049742 | Bacteria | 2345 |
| 850 | Ga0501044_0083186 | 3300049823 | Bacteria | 3237 |
| 851 | nmdc:mga03683_210539_c1 | 3300050489 | Bacteria | 894 |
| 852 | nmdc:mga03683_265128_c1 | 3300050489 | Bacteria | 800 |
| 853 | nmdc:mga03n38_14558_c1 | 3300050490 | Bacteria | 3017 |
| 854 | nmdc:mga00v17_539811_c1 | 3300050491 | Bacteria | 754 |
| 855 | nmdc:mga0yw44_117836_c1 | 3300050492 | Bacteria | 1708 |
| 856 | nmdc:mga0yw44_464373_c1 | 3300050492 | Bacteria | 858 |
| 857 | nmdc:mga0yw44_644431_c1 | 3300050492 | Bacteria | 720 |
| 858 | nmdc:mga0yw44_804435_c1 | 3300050492 | Bacteria | 638 |
| 859 | nmdc:mga06z11_110457_c1 | 3300050494 | Bacteria | 1522 |
| 860 | nmdc:mga06z11_11045_c1 | 3300050494 | Bacteria | 3876 |
| 861 | nmdc:mga06z11_460298_c1 | 3300050494 | Bacteria | 769 |
| 862 | nmdc:mga06z11_583410_c1 | 3300050494 | Bacteria | 680 |
| 863 | nmdc:mga04h51_29235_c1 | 3300050495 | Bacteria | 1725 |
| 864 | nmdc:mga07m45_13114_c1 | 3300050496 | Bacteria | 4388 |
| 865 | nmdc:mga07m45_385630_c1 | 3300050496 | Bacteria | 814 |
| 866 | nmdc:mga07m45_64024_c1 | 3300050496 | Bacteria | 2086 |
| 867 | nmdc:mga08y16_619065_c1 | 3300050511 | Bacteria | 1090 |
| 868 | nmdc:mga0n895_378198_c1 | 3300050512 | Bacteria | 1433 |
| 869 | nmdc:mga0rr50_393867_c1 | 3300050513 | Bacteria | 1169 |
| 870 | nmdc:mga0a205_151249_c1 | 3300050515 | Bacteria | 2220 |
| 871 | Ga0495601_0017256 | 3300053077 | Bacteria | 4380 |
| 872 | Ga0495601_0136693 | 3300053077 | Bacteria | 1598 |
| 873 | Ga0495601_0343333 | 3300053077 | Bacteria | 971 |
| 874 | Ga0500610_0041583 | 3300053079 | Bacteria | 2377 |
| 875 | Ga0495655_0112132 | 3300053083 | Bacteria | 821 |
| 876 | Ga0495595_0219991 | 3300053084 | Bacteria | 947 |
| 877 | Ga0495619_0236354 | 3300053085 | Bacteria | 1266 |
| 878 | Ga0495619_0241630 | 3300053085 | Bacteria | 1251 |
| 879 | Ga0500643_000112 | 3300053087 | Bacteria | 84793 |
| 880 | Ga0500644_0362520 | 3300053088 | Bacteria | 628 |
| 881 | Ga0500646_0155861 | 3300053090 | Bacteria | 759 |
| 882 | Ga0500583_0085964 | 3300053092 | Bacteria | 1525 |
| 883 | Ga0500583_0166310 | 3300053092 | Bacteria | 1098 |
| 884 | Ga0500651_0033603 | 3300053093 | Bacteria | 3233 |
| 885 | Ga0500651_0258387 | 3300053093 | Bacteria | 1010 |
| 886 | Ga0500566_0011791 | 3300053094 | Bacteria | 5150 |
| 887 | Ga0500566_0043525 | 3300053094 | Bacteria | 2587 |
| 888 | Ga0500640_009445 | 3300053095 | Bacteria | 3899 |
| 889 | Ga0500641_0060146 | 3300053096 | Bacteria | 1580 |
| 890 | Ga0500641_0147163 | 3300053096 | Bacteria | 1017 |
| 891 | Ga0500650_0192335 | 3300053098 | Bacteria | 932 |
| 892 | Ga0500553_133854 | 3300053101 | Bacteria | 993 |
| 893 | Ga0500554_067639 | 3300053102 | Bacteria | 1157 |
| 894 | Ga0500555_004419 | 3300053103 | Bacteria | 3997 |
| 895 | Ga0500555_083377 | 3300053103 | Bacteria | 829 |
| 896 | Ga0500569_051549 | 3300053109 | Bacteria | 1243 |
| 897 | Ga0500569_085728 | 3300053109 | Bacteria | 1013 |
| 898 | Ga0500572_072413 | 3300053111 | Bacteria | 1067 |
| 899 | Ga0500582_116210 | 3300053114 | Bacteria | 932 |
| 900 | Ga0500592_014816 | 3300053116 | Bacteria | 1250 |
| 901 | Ga0500592_033615 | 3300053116 | Bacteria | 827 |
| 902 | Ga0500594_0011291 | 3300053118 | Bacteria | 2084 |
| 903 | Ga0500594_0253250 | 3300053118 | Bacteria | 586 |
| 904 | Ga0500595_001016 | 3300053119 | Bacteria | 15748 |
| 905 | Ga0500595_006803 | 3300053119 | Bacteria | 4813 |
| 906 | Ga0500595_014698 | 3300053119 | Bacteria | 2962 |
| 907 | Ga0500595_027760 | 3300053119 | Bacteria | 1935 |
| 908 | Ga0500595_043871 | 3300053119 | Bacteria | 1421 |
| 909 | Ga0500607_085637 | 3300053121 | Bacteria | 1597 |
| 910 | Ga0500608_234605 | 3300053122 | Bacteria | 729 |
| 911 | Ga0500614_108692 | 3300053123 | Bacteria | 806 |
| 912 | Ga0500614_193217 | 3300053123 | Bacteria | 625 |
| 913 | Ga0500628_143339 | 3300053129 | Bacteria | 664 |
| 914 | Ga0500642_0000362 | 3300053130 | Bacteria | 15284 |
| 915 | Ga0500642_0000641 | 3300053130 | Bacteria | 10431 |
| 916 | Ga0500642_0066658 | 3300053130 | Bacteria | 1629 |
| 917 | Ga0500655_040208 | 3300053133 | Bacteria | 916 |
| 918 | Ga0500658_0381921 | 3300053134 | Bacteria | 645 |
| 919 | Ga0500568_0067550 | 3300053139 | Bacteria | 1373 |
| 920 | Ga0500568_0129529 | 3300053139 | Bacteria | 938 |
| 921 | Ga0500577_0098647 | 3300053142 | Bacteria | 1191 |
| 922 | Ga0500577_0198761 | 3300053142 | Bacteria | 864 |
| 923 | Ga0500588_0101524 | 3300053146 | Bacteria | 992 |
| 924 | Ga0500589_226276 | 3300053147 | Bacteria | 701 |
| 925 | Ga0500589_262379 | 3300053147 | Bacteria | 628 |
| 926 | Ga0500590_147270 | 3300053148 | Bacteria | 1067 |
| 927 | Ga0500590_223751 | 3300053148 | Bacteria | 773 |
| 928 | Ga0500603_121939 | 3300053150 | Bacteria | 791 |
| 929 | Ga0500604_0049059 | 3300053151 | Bacteria | 1297 |
| 930 | Ga0500604_0089581 | 3300053151 | Bacteria | 1003 |
| 931 | Ga0500604_0178318 | 3300053151 | Bacteria | 728 |
| 932 | Ga0500616_0139503 | 3300053153 | Bacteria | 1135 |
| 933 | Ga0500620_238445 | 3300053155 | Bacteria | 609 |
| 934 | Ga0500622_0229091 | 3300053156 | Bacteria | 828 |
| 935 | Ga0500627_0125991 | 3300053158 | Bacteria | 1156 |
| 936 | Ga0500627_0203270 | 3300053158 | Bacteria | 887 |
| 937 | Ga0500627_0348998 | 3300053158 | Bacteria | 639 |
| 938 | Ga0500634_0212441 | 3300053161 | Bacteria | 838 |
| 939 | Ga0500638_005456 | 3300053162 | Bacteria | 5068 |
| 940 | Ga0500638_222988 | 3300053162 | Bacteria | 780 |
| 941 | Ga0500636_0276248 | 3300053177 | Bacteria | 841 |
| 942 | Ga0500636_0333676 | 3300053177 | Bacteria | 731 |
| 943 | Ga0500637_0000585 | 3300053178 | Bacteria | 14328 |
| 944 | Ga0500637_0186572 | 3300053178 | Bacteria | 1186 |
| 945 | Ga0500570_106621 | 3300053724 | Bacteria | 1155 |
| 946 | Ga0500611_158246 | 3300053727 | Bacteria | 625 |
| 947 | Ga0500609_006652 | 3300053731 | Bacteria | 1572 |
| 948 | Ga0500661_005871 | 3300055283 | Bacteria | 2287 |
| 949 | Ga0587080_148527 | 3300059503 | Bacteria | 541 |
| 950 | Ga0587083_0147968 | 3300059505 | Bacteria | 632 |
| 951 | Ga0587068_101443 | 3300059641 | Bacteria | 605 |
| 952 | Ga0587072_123946 | 3300059643 | Bacteria | 602 |
| 953 | Ga0587075_040357 | 3300059644 | Bacteria | 780 |
| 954 | Ga0587076_075966 | 3300059645 | Bacteria | 707 |
| 955 | Ga0587071_046432 | 3300060344 | Bacteria | 886 |
| 956 | Ga0466962_0031673 | 3300061719 | Bacteria | 2532 |
| 957 | Ga0466962_0128009 | 3300061719 | Bacteria | 1227 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041486 | Ga0451807_0826454 | Ga0451807_0826454_36_464 | 134 |
| 2 | iso_pu_bacteria | 8016557553 | 8016565829 | 138 |
| 3 | 3300039437 | Ga0436365_0346369 | Ga0436365_0346369_261_680 | 139 |
| 4 | 3300035695 | Ga0373927_1123709 | Ga0373927_1123709_67_501 | 140 |
| 5 | 3300037418 | Ga0395900_1525769 | Ga0395900_1525769_12_434 | 140 |
| 6 | 3300046523 | Ga0495644_0243040 | Ga0495644_0243040_265_687 | 140 |
| 7 | 3300046557 | Ga0495622_0249119 | Ga0495622_0249119_16_438 | 140 |
| 8 | 3300047319 | Ga0495674_1157765 | Ga0495674_1157765_152_574 | 140 |
| 9 | 3300048911 | Ga0496108_0443405 | Ga0496108_0443405_46_555 | 141 |
| 10 | 3300009551 | Ga0105238_10815971 | Ga0105238_108159711 | 142 |
| 11 | 3300005841 | Ga0068863_100488620 | Ga0068863_1004886203 | 146 |
| 12 | 3300026088 | Ga0207641_10474896 | Ga0207641_104748962 | 146 |
| 13 | iso_pu_bacteria | 2513237096 | 2513659509 | 154 |
| 14 | iso_pu_bacteria | 2513237137 | 2513859384 | 154 |
| 15 | iso_pu_bacteria | 2513237145 | 2513921558 | 154 |
| 16 | iso_pu_bacteria | 2517572143 | 2517889050 | 154 |
| 17 | iso_pu_bacteria | 2524023228 | 2524537485 | 154 |
| 18 | iso_pu_bacteria | 2667528175 | 2671124039 | 154 |
| 19 | iso_pu_bacteria | 2791355197 | 2793072711 | 154 |
| 20 | iso_pu_bacteria | 2885374607 | 2885377554 | 154 |
| 21 | iso_pu_bacteria | 2903748898 | 2903758797 | 154 |
| 22 | iso_pu_bacteria | 2904690495 | 2904691005 | 154 |
| 23 | iso_pu_bacteria | 2904699407 | 2904708402 | 154 |
| 24 | iso_pu_bacteria | 2906610324 | 2906613574 | 154 |
| 25 | iso_pu_bacteria | 2906635258 | 2906635831 | 154 |
| 26 | iso_pu_bacteria | 2906660503 | 2906668108 | 154 |
| 27 | iso_pu_bacteria | 2908739725 | 2908747652 | 154 |
| 28 | iso_pu_bacteria | 2908756301 | 2908757063 | 154 |
| 29 | iso_pu_bacteria | 2922361189 | 2922363207 | 154 |
| 30 | iso_pu_bacteria | 2922425934 | 2922434011 | 154 |
| 31 | iso_pu_bacteria | 2935630451 | 2935636038 | 154 |
| 32 | iso_pu_bacteria | 2941507105 | 2941512658 | 154 |
| 33 | iso_pu_bacteria | 2941515067 | 2941520504 | 154 |
| 34 | iso_pu_bacteria | 2941523033 | 2941528518 | 154 |
| 35 | iso_pu_bacteria | 3005474847 | 3005475274 | 154 |
| 36 | iso_pu_bacteria | 8006933436 | 8006936003 | 154 |
| 37 | iso_pu_bacteria | 8006973647 | 8006975873 | 154 |
| 38 | iso_pu_bacteria | 8019555841 | 8019562653 | 154 |
| 39 | iso_pu_bacteria | 8019565922 | 8019572730 | 154 |
| 40 | iso_pu_bacteria | 8056689827 | 8056691144 | 154 |
| 41 | iso_pu_bacteria | 2513237104 | 2513718240 | 155 |
| 42 | iso_pu_bacteria | 2881364244 | 2881368926 | 155 |
| 43 | iso_pu_bacteria | 2885409591 | 2885415852 | 155 |
| 44 | iso_pu_bacteria | 8056967851 | 8056971493 | 155 |
| 45 | 3300003659 | JGI25404J52841_10019296 | JGI25404J52841_100192962 | 157 |
| 46 | 3300003659 | JGI25404J52841_10035351 | JGI25404J52841_100353512 | 157 |
| 47 | 3300005289 | Ga0065704_10142844 | Ga0065704_101428442 | 157 |
| 48 | 3300005290 | Ga0065712_10228589 | Ga0065712_102285892 | 157 |
| 49 | 3300005295 | Ga0065707_10024212 | Ga0065707_100242122 | 157 |
| 50 | 3300005328 | Ga0070676_10229590 | Ga0070676_102295901 | 157 |
| 51 | 3300005328 | Ga0070676_10660950 | Ga0070676_106609502 | 157 |
| 52 | 3300005329 | Ga0070683_100109161 | Ga0070683_1001091612 | 157 |
| 53 | 3300005331 | Ga0070670_100746824 | Ga0070670_1007468242 | 157 |
| 54 | 3300005334 | Ga0068869_100451568 | Ga0068869_1004515682 | 157 |
| 55 | 3300005334 | Ga0068869_101189775 | Ga0068869_1011897751 | 157 |
| 56 | 3300005335 | Ga0070666_10947092 | Ga0070666_109470921 | 157 |
| 57 | 3300005338 | Ga0068868_100059956 | Ga0068868_1000599563 | 157 |
| 58 | 3300005338 | Ga0068868_101012133 | Ga0068868_1010121332 | 157 |
| 59 | 3300005339 | Ga0070660_100501648 | Ga0070660_1005016482 | 157 |
| 60 | 3300005341 | Ga0070691_10205067 | Ga0070691_102050671 | 157 |
| 61 | 3300005344 | Ga0070661_100466437 | Ga0070661_1004664372 | 157 |
| 62 | 3300005347 | Ga0070668_100216872 | Ga0070668_1002168722 | 157 |
| 63 | 3300005347 | Ga0070668_100776729 | Ga0070668_1007767292 | 157 |
| 64 | 3300005347 | Ga0070668_102037548 | Ga0070668_1020375481 | 157 |
| 65 | 3300005347 | Ga0070668_102037549 | Ga0070668_1020375491 | 157 |
| 66 | 3300005353 | Ga0070669_100609029 | Ga0070669_1006090292 | 157 |
| 67 | 3300005356 | Ga0070674_101290983 | Ga0070674_1012909831 | 157 |
| 68 | 3300005364 | Ga0070673_100230498 | Ga0070673_1002304981 | 157 |
| 69 | 3300005364 | Ga0070673_100760705 | Ga0070673_1007607051 | 157 |
| 70 | 3300005365 | Ga0070688_100208310 | Ga0070688_1002083101 | 157 |
| 71 | 3300005365 | Ga0070688_100588175 | Ga0070688_1005881752 | 157 |
| 72 | 3300005366 | Ga0070659_101317869 | Ga0070659_1013178691 | 157 |
| 73 | 3300005367 | Ga0070667_100271251 | Ga0070667_1002712511 | 157 |
| 74 | 3300005367 | Ga0070667_101493029 | Ga0070667_1014930291 | 157 |
| 75 | 3300005367 | Ga0070667_101683202 | Ga0070667_1016832021 | 157 |
| 76 | 3300005406 | Ga0070703_10299640 | Ga0070703_102996401 | 157 |
| 77 | 3300005438 | Ga0070701_10194738 | Ga0070701_101947382 | 157 |
| 78 | 3300005441 | Ga0070700_101071426 | Ga0070700_1010714261 | 157 |
| 79 | 3300005441 | Ga0070700_101158779 | Ga0070700_1011587791 | 157 |
| 80 | 3300005441 | Ga0070700_101302622 | Ga0070700_1013026221 | 157 |
| 81 | 3300005444 | Ga0070694_100479641 | Ga0070694_1004796411 | 157 |
| 82 | 3300005455 | Ga0070663_100718471 | Ga0070663_1007184711 | 157 |
| 83 | 3300005456 | Ga0070678_100363674 | Ga0070678_1003636742 | 157 |
| 84 | 3300005456 | Ga0070678_100584240 | Ga0070678_1005842402 | 157 |
| 85 | 3300005457 | Ga0070662_100289078 | Ga0070662_1002890782 | 157 |
| 86 | 3300005459 | Ga0068867_100630108 | Ga0068867_1006301081 | 157 |
| 87 | 3300005459 | Ga0068867_100633022 | Ga0068867_1006330221 | 157 |
| 88 | 3300005466 | Ga0070685_10466238 | Ga0070685_104662382 | 157 |
| 89 | 3300005467 | Ga0070706_100574081 | Ga0070706_1005740811 | 157 |
| 90 | 3300005518 | Ga0070699_100742484 | Ga0070699_1007424842 | 157 |
| 91 | 3300005535 | Ga0070684_100355097 | Ga0070684_1003550971 | 157 |
| 92 | 3300005535 | Ga0070684_100692908 | Ga0070684_1006929081 | 157 |
| 93 | 3300005539 | Ga0068853_100442522 | Ga0068853_1004425222 | 157 |
| 94 | 3300005539 | Ga0068853_100484951 | Ga0068853_1004849511 | 157 |
| 95 | 3300005543 | Ga0070672_100348785 | Ga0070672_1003487851 | 157 |
| 96 | 3300005547 | Ga0070693_100075050 | Ga0070693_1000750503 | 157 |
| 97 | 3300005548 | Ga0070665_100206184 | Ga0070665_1002061842 | 157 |
| 98 | 3300005548 | Ga0070665_100377590 | Ga0070665_1003775902 | 157 |
| 99 | 3300005548 | Ga0070665_100519344 | Ga0070665_1005193442 | 157 |
| 100 | 3300005548 | Ga0070665_101138158 | Ga0070665_1011381582 | 157 |
| 101 | 3300005564 | Ga0070664_101140914 | Ga0070664_1011409141 | 157 |
| 102 | 3300005577 | Ga0068857_100397294 | Ga0068857_1003972942 | 157 |
| 103 | 3300005578 | Ga0068854_100272559 | Ga0068854_1002725592 | 157 |
| 104 | 3300005614 | Ga0068856_100107320 | Ga0068856_1001073203 | 157 |
| 105 | 3300005616 | Ga0068852_100067130 | Ga0068852_1000671304 | 157 |
| 106 | 3300005616 | Ga0068852_100775901 | Ga0068852_1007759012 | 157 |
| 107 | 3300005617 | Ga0068859_100748173 | Ga0068859_1007481732 | 157 |
| 108 | 3300005617 | Ga0068859_101012421 | Ga0068859_1010124212 | 157 |
| 109 | 3300005617 | Ga0068859_101200521 | Ga0068859_1012005212 | 157 |
| 110 | 3300005618 | Ga0068864_100123810 | Ga0068864_1001238102 | 157 |
| 111 | 3300005618 | Ga0068864_100314239 | Ga0068864_1003142392 | 157 |
| 112 | 3300005618 | Ga0068864_100339767 | Ga0068864_1003397672 | 157 |
| 113 | 3300005718 | Ga0068866_10472137 | Ga0068866_104721371 | 157 |
| 114 | 3300005719 | Ga0068861_100413798 | Ga0068861_1004137982 | 157 |
| 115 | 3300005719 | Ga0068861_100541193 | Ga0068861_1005411932 | 157 |
| 116 | 3300005840 | Ga0068870_10062707 | Ga0068870_100627072 | 157 |
| 117 | 3300005840 | Ga0068870_10415719 | Ga0068870_104157192 | 157 |
| 118 | 3300005841 | Ga0068863_100531991 | Ga0068863_1005319912 | 157 |
| 119 | 3300005841 | Ga0068863_100554843 | Ga0068863_1005548431 | 157 |
| 120 | 3300005843 | Ga0068860_100247682 | Ga0068860_1002476823 | 157 |
| 121 | 3300005843 | Ga0068860_100952627 | Ga0068860_1009526272 | 157 |
| 122 | 3300005843 | Ga0068860_100960866 | Ga0068860_1009608662 | 157 |
| 123 | 3300005844 | Ga0068862_100148304 | Ga0068862_1001483042 | 157 |
| 124 | 3300005844 | Ga0068862_100358612 | Ga0068862_1003586122 | 157 |
| 125 | 3300005844 | Ga0068862_100632552 | Ga0068862_1006325522 | 157 |
| 126 | 3300005983 | Ga0081540_1020688 | Ga0081540_10206882 | 157 |
| 127 | 3300005983 | Ga0081540_1020881 | Ga0081540_10208813 | 157 |
| 128 | 3300005983 | Ga0081540_1118995 | Ga0081540_11189952 | 157 |
| 129 | 3300006038 | Ga0075365_10247886 | Ga0075365_102478862 | 157 |
| 130 | 3300006038 | Ga0075365_10344911 | Ga0075365_103449112 | 157 |
| 131 | 3300006038 | Ga0075365_10583859 | Ga0075365_105838592 | 157 |
| 132 | 3300006042 | Ga0075368_10022422 | Ga0075368_100224222 | 157 |
| 133 | 3300006042 | Ga0075368_10071058 | Ga0075368_100710582 | 157 |
| 134 | 3300006048 | Ga0075363_100247733 | Ga0075363_1002477332 | 157 |
| 135 | 3300006048 | Ga0075363_100253033 | Ga0075363_1002530332 | 157 |
| 136 | 3300006048 | Ga0075363_100285613 | Ga0075363_1002856132 | 157 |
| 137 | 3300006048 | Ga0075363_100768625 | Ga0075363_1007686251 | 157 |
| 138 | 3300006051 | Ga0075364_10102130 | Ga0075364_101021302 | 157 |
| 139 | 3300006163 | Ga0070715_10104876 | Ga0070715_101048762 | 157 |
| 140 | 3300006178 | Ga0075367_10112753 | Ga0075367_101127532 | 157 |
| 141 | 3300006178 | Ga0075367_10288413 | Ga0075367_102884132 | 157 |
| 142 | 3300006195 | Ga0075366_10278186 | Ga0075366_102781862 | 157 |
| 143 | 3300006237 | Ga0097621_100139391 | Ga0097621_1001393911 | 157 |
| 144 | 3300006237 | Ga0097621_100212164 | Ga0097621_1002121642 | 157 |
| 145 | 3300006237 | Ga0097621_101706938 | Ga0097621_1017069381 | 157 |
| 146 | 3300006353 | Ga0075370_10093373 | Ga0075370_100933733 | 157 |
| 147 | 3300006353 | Ga0075370_10178205 | Ga0075370_101782052 | 157 |
| 148 | 3300006358 | Ga0068871_100126029 | Ga0068871_1001260292 | 157 |
| 149 | 3300006358 | Ga0068871_100899132 | Ga0068871_1008991322 | 157 |
| 150 | 3300006844 | Ga0075428_100135007 | Ga0075428_1001350073 | 157 |
| 151 | 3300006871 | Ga0075434_100287226 | Ga0075434_1002872263 | 157 |
| 152 | 3300006881 | Ga0068865_100289192 | Ga0068865_1002891922 | 157 |
| 153 | 3300006931 | Ga0097620_100748205 | Ga0097620_1007482052 | 157 |
| 154 | 3300006931 | Ga0097620_101012391 | Ga0097620_1010123912 | 157 |
| 155 | 3300006931 | Ga0097620_101200522 | Ga0097620_1012005221 | 157 |
| 156 | 3300007076 | Ga0075435_100454561 | Ga0075435_1004545612 | 157 |
| 157 | 3300007265 | Ga0099794_10321430 | Ga0099794_103214302 | 157 |
| 158 | 3300009094 | Ga0111539_10530373 | Ga0111539_105303732 | 157 |
| 159 | 3300009094 | Ga0111539_10932697 | Ga0111539_109326972 | 157 |
| 160 | 3300009098 | Ga0105245_10405664 | Ga0105245_104056642 | 157 |
| 161 | 3300009098 | Ga0105245_10645803 | Ga0105245_106458032 | 157 |
| 162 | 3300009101 | Ga0105247_10130453 | Ga0105247_101304532 | 157 |
| 163 | 3300009148 | Ga0105243_10507900 | Ga0105243_105079002 | 157 |
| 164 | 3300009174 | Ga0105241_10153603 | Ga0105241_101536032 | 157 |
| 165 | 3300009174 | Ga0105241_10503326 | Ga0105241_105033262 | 157 |
| 166 | 3300009176 | Ga0105242_10771784 | Ga0105242_107717842 | 157 |
| 167 | 3300009176 | Ga0105242_10834310 | Ga0105242_108343102 | 157 |
| 168 | 3300009177 | Ga0105248_10410419 | Ga0105248_104104192 | 157 |
| 169 | 3300009545 | Ga0105237_10186788 | Ga0105237_101867882 | 157 |
| 170 | 3300009545 | Ga0105237_10391897 | Ga0105237_103918972 | 157 |
| 171 | 3300009545 | Ga0105237_11307060 | Ga0105237_113070602 | 157 |
| 172 | 3300009551 | Ga0105238_11172820 | Ga0105238_111728201 | 157 |
| 173 | 3300009553 | Ga0105249_11307958 | Ga0105249_113079582 | 157 |
| 174 | 3300010375 | Ga0105239_10325851 | Ga0105239_103258512 | 157 |
| 175 | 3300010375 | Ga0105239_11237394 | Ga0105239_112373942 | 157 |
| 176 | 3300010375 | Ga0105239_11992100 | Ga0105239_119921001 | 157 |
| 177 | 3300011119 | Ga0105246_10019273 | Ga0105246_100192733 | 157 |
| 178 | 3300011119 | Ga0105246_10634819 | Ga0105246_106348192 | 157 |
| 179 | 3300013296 | Ga0157374_10054089 | Ga0157374_100540893 | 157 |
| 180 | 3300013296 | Ga0157374_10353683 | Ga0157374_103536832 | 157 |
| 181 | 3300013297 | Ga0157378_11611005 | Ga0157378_116110052 | 157 |
| 182 | 3300013306 | Ga0163162_10045228 | Ga0163162_100452283 | 157 |
| 183 | 3300013306 | Ga0163162_11590985 | Ga0163162_115909852 | 157 |
| 184 | 3300013306 | Ga0163162_11937813 | Ga0163162_119378132 | 157 |
| 185 | 3300013306 | Ga0163162_12349777 | Ga0163162_123497772 | 157 |
| 186 | 3300013306 | Ga0163162_12826517 | Ga0163162_128265171 | 157 |
| 187 | 3300013307 | Ga0157372_10940107 | Ga0157372_109401072 | 157 |
| 188 | 3300013308 | Ga0157375_10691138 | Ga0157375_106911381 | 157 |
| 189 | 3300013308 | Ga0157375_10747294 | Ga0157375_107472942 | 157 |
| 190 | 3300014325 | Ga0163163_10127555 | Ga0163163_101275553 | 157 |
| 191 | 3300014325 | Ga0163163_10370574 | Ga0163163_103705742 | 157 |
| 192 | 3300014325 | Ga0163163_11096593 | Ga0163163_110965932 | 157 |
| 193 | 3300014325 | Ga0163163_12210602 | Ga0163163_122106021 | 157 |
| 194 | 3300014326 | Ga0157380_10341204 | Ga0157380_103412042 | 157 |
| 195 | 3300014326 | Ga0157380_10599164 | Ga0157380_105991642 | 157 |
| 196 | 3300014326 | Ga0157380_12204986 | Ga0157380_122049862 | 157 |
| 197 | 3300014968 | Ga0157379_10209640 | Ga0157379_102096401 | 157 |
| 198 | 3300014968 | Ga0157379_10568872 | Ga0157379_105688722 | 157 |
| 199 | 3300014969 | Ga0157376_10620496 | Ga0157376_106204962 | 157 |
| 200 | 3300014969 | Ga0157376_10804516 | Ga0157376_108045162 | 157 |
| 201 | 3300014969 | Ga0157376_10912082 | Ga0157376_109120822 | 157 |
| 202 | 3300015262 | Ga0182007_10241593 | Ga0182007_102415932 | 157 |
| 203 | 3300017792 | Ga0163161_10584233 | Ga0163161_105842332 | 157 |
| 204 | 3300017792 | Ga0163161_11136485 | Ga0163161_111364852 | 157 |
| 205 | 3300025261 | Ga0209233_1006623 | Ga0209233_10066234 | 157 |
| 206 | 3300025315 | Ga0207697_10022598 | Ga0207697_100225982 | 157 |
| 207 | 3300025315 | Ga0207697_10044238 | Ga0207697_100442382 | 157 |
| 208 | 3300025315 | Ga0207697_10227280 | Ga0207697_102272802 | 157 |
| 209 | 3300025315 | Ga0207697_10228741 | Ga0207697_102287412 | 157 |
| 210 | 3300025885 | Ga0207653_10076948 | Ga0207653_100769482 | 157 |
| 211 | 3300025899 | Ga0207642_10097318 | Ga0207642_100973181 | 157 |
| 212 | 3300025899 | Ga0207642_10859819 | Ga0207642_108598191 | 157 |
| 213 | 3300025900 | Ga0207710_10094956 | Ga0207710_100949562 | 157 |
| 214 | 3300025901 | Ga0207688_10151712 | Ga0207688_101517122 | 157 |
| 215 | 3300025903 | Ga0207680_10578662 | Ga0207680_105786621 | 157 |
| 216 | 3300025908 | Ga0207643_10135707 | Ga0207643_101357072 | 157 |
| 217 | 3300025908 | Ga0207643_10252516 | Ga0207643_102525162 | 157 |
| 218 | 3300025911 | Ga0207654_10096920 | Ga0207654_100969202 | 157 |
| 219 | 3300025911 | Ga0207654_10160018 | Ga0207654_101600182 | 157 |
| 220 | 3300025914 | Ga0207671_10595909 | Ga0207671_105959092 | 157 |
| 221 | 3300025916 | Ga0207663_10409162 | Ga0207663_104091621 | 157 |
| 222 | 3300025918 | Ga0207662_10335633 | Ga0207662_103356332 | 157 |
| 223 | 3300025919 | Ga0207657_10173641 | Ga0207657_101736412 | 157 |
| 224 | 3300025919 | Ga0207657_10907579 | Ga0207657_109075792 | 157 |
| 225 | 3300025920 | Ga0207649_10355147 | Ga0207649_103551472 | 157 |
| 226 | 3300025924 | Ga0207694_11235147 | Ga0207694_112351471 | 157 |
| 227 | 3300025925 | Ga0207650_10625123 | Ga0207650_106251231 | 157 |
| 228 | 3300025927 | Ga0207687_10305000 | Ga0207687_103050002 | 157 |
| 229 | 3300025927 | Ga0207687_10593584 | Ga0207687_105935842 | 157 |
| 230 | 3300025931 | Ga0207644_10179336 | Ga0207644_101793361 | 157 |
| 231 | 3300025931 | Ga0207644_10626714 | Ga0207644_106267142 | 157 |
| 232 | 3300025933 | Ga0207706_10326055 | Ga0207706_103260552 | 157 |
| 233 | 3300025935 | Ga0207709_10465780 | Ga0207709_104657802 | 157 |
| 234 | 3300025935 | Ga0207709_11359072 | Ga0207709_113590721 | 157 |
| 235 | 3300025936 | Ga0207670_10360927 | Ga0207670_103609272 | 157 |
| 236 | 3300025937 | Ga0207669_10207027 | Ga0207669_102070272 | 157 |
| 237 | 3300025937 | Ga0207669_11403328 | Ga0207669_114033281 | 157 |
| 238 | 3300025938 | Ga0207704_10166691 | Ga0207704_101666912 | 157 |
| 239 | 3300025940 | Ga0207691_10508924 | Ga0207691_105089242 | 157 |
| 240 | 3300025940 | Ga0207691_10844799 | Ga0207691_108447992 | 157 |
| 241 | 3300025941 | Ga0207711_10140227 | Ga0207711_101402272 | 157 |
| 242 | 3300025941 | Ga0207711_10300286 | Ga0207711_103002862 | 157 |
| 243 | 3300025942 | Ga0207689_10975978 | Ga0207689_109759782 | 157 |
| 244 | 3300025945 | Ga0207679_10356886 | Ga0207679_103568862 | 157 |
| 245 | 3300025949 | Ga0207667_10105980 | Ga0207667_101059803 | 157 |
| 246 | 3300025961 | Ga0207712_11397532 | Ga0207712_113975321 | 157 |
| 247 | 3300025972 | Ga0207668_11320483 | Ga0207668_113204832 | 157 |
| 248 | 3300025981 | Ga0207640_10083438 | Ga0207640_100834382 | 157 |
| 249 | 3300025981 | Ga0207640_10229671 | Ga0207640_102296712 | 157 |
| 250 | 3300025986 | Ga0207658_10602505 | Ga0207658_106025052 | 157 |
| 251 | 3300025986 | Ga0207658_11332541 | Ga0207658_113325412 | 157 |
| 252 | 3300026023 | Ga0207677_10091376 | Ga0207677_100913762 | 157 |
| 253 | 3300026035 | Ga0207703_10065112 | Ga0207703_100651122 | 157 |
| 254 | 3300026035 | Ga0207703_11145258 | Ga0207703_111452582 | 157 |
| 255 | 3300026035 | Ga0207703_11241870 | Ga0207703_112418702 | 157 |
| 256 | 3300026041 | Ga0207639_10268042 | Ga0207639_102680422 | 157 |
| 257 | 3300026041 | Ga0207639_10292211 | Ga0207639_102922112 | 157 |
| 258 | 3300026067 | Ga0207678_10561648 | Ga0207678_105616482 | 157 |
| 259 | 3300026067 | Ga0207678_10786279 | Ga0207678_107862792 | 157 |
| 260 | 3300026067 | Ga0207678_11095558 | Ga0207678_110955582 | 157 |
| 261 | 3300026078 | Ga0207702_11139192 | Ga0207702_111391922 | 157 |
| 262 | 3300026088 | Ga0207641_10357451 | Ga0207641_103574512 | 157 |
| 263 | 3300026088 | Ga0207641_10517494 | Ga0207641_105174943 | 157 |
| 264 | 3300026088 | Ga0207641_12096007 | Ga0207641_120960071 | 157 |
| 265 | 3300026089 | Ga0207648_10402717 | Ga0207648_104027171 | 157 |
| 266 | 3300026089 | Ga0207648_10499119 | Ga0207648_104991192 | 157 |
| 267 | 3300026089 | Ga0207648_10534857 | Ga0207648_105348572 | 157 |
| 268 | 3300026089 | Ga0207648_10706097 | Ga0207648_107060972 | 157 |
| 269 | 3300026095 | Ga0207676_10199904 | Ga0207676_101999042 | 157 |
| 270 | 3300026116 | Ga0207674_10670582 | Ga0207674_106705822 | 157 |
| 271 | 3300026118 | Ga0207675_100609178 | Ga0207675_1006091782 | 157 |
| 272 | 3300026118 | Ga0207675_101074709 | Ga0207675_1010747092 | 157 |
| 273 | 3300026121 | Ga0207683_10153979 | Ga0207683_101539792 | 157 |
| 274 | 3300026121 | Ga0207683_10461287 | Ga0207683_104612872 | 157 |
| 275 | 3300026121 | Ga0207683_10478614 | Ga0207683_104786142 | 157 |
| 276 | 3300026121 | Ga0207683_10984709 | Ga0207683_109847092 | 157 |
| 277 | 3300026121 | Ga0207683_11652559 | Ga0207683_116525591 | 157 |
| 278 | 3300026121 | Ga0207683_11813868 | Ga0207683_118138682 | 157 |
| 279 | 3300027671 | Ga0209588_1060561 | Ga0209588_10605612 | 157 |
| 280 | 3300028379 | Ga0268266_10066637 | Ga0268266_100666373 | 157 |
| 281 | 3300028379 | Ga0268266_10129302 | Ga0268266_101293023 | 157 |
| 282 | 3300028379 | Ga0268266_10378883 | Ga0268266_103788832 | 157 |
| 283 | 3300028379 | Ga0268266_10757186 | Ga0268266_107571862 | 157 |
| 284 | 3300028379 | Ga0268266_11222413 | Ga0268266_112224131 | 157 |
| 285 | 3300028379 | Ga0268266_11364934 | Ga0268266_113649341 | 157 |
| 286 | 3300028379 | Ga0268266_12068669 | Ga0268266_120686691 | 157 |
| 287 | 3300028380 | Ga0268265_10289989 | Ga0268265_102899891 | 157 |
| 288 | 3300028380 | Ga0268265_10506484 | Ga0268265_105064842 | 157 |
| 289 | 3300028381 | Ga0268264_10297652 | Ga0268264_102976522 | 157 |
| 290 | 3300028381 | Ga0268264_11273547 | Ga0268264_112735471 | 157 |
| 291 | 3300028786 | Ga0307517_10000232 | Ga0307517_1000023222 | 157 |
| 292 | 3300028786 | Ga0307517_10469903 | Ga0307517_104699031 | 157 |
| 293 | 3300028794 | Ga0307515_10087102 | Ga0307515_100871024 | 157 |
| 294 | 3300031456 | Ga0307513_10191401 | Ga0307513_101914012 | 157 |
| 295 | 3300031456 | Ga0307513_10240504 | Ga0307513_102405042 | 157 |
| 296 | 3300031507 | Ga0307509_10331144 | Ga0307509_103311442 | 157 |
| 297 | 3300031616 | Ga0307508_10328232 | Ga0307508_103282322 | 157 |
| 298 | 3300031616 | Ga0307508_10665446 | Ga0307508_106654462 | 157 |
| 299 | 3300031730 | Ga0307516_10114956 | Ga0307516_101149562 | 157 |
| 300 | 3300031730 | Ga0307516_10178300 | Ga0307516_101783003 | 157 |
| 301 | 3300031730 | Ga0307516_10279702 | Ga0307516_102797022 | 157 |
| 302 | 3300031731 | Ga0307405_10263134 | Ga0307405_102631342 | 157 |
| 303 | 3300031824 | Ga0307413_10594532 | Ga0307413_105945322 | 157 |
| 304 | 3300031901 | Ga0307406_10237733 | Ga0307406_102377332 | 157 |
| 305 | 3300031903 | Ga0307407_10538655 | Ga0307407_105386552 | 157 |
| 306 | 3300031911 | Ga0307412_10530413 | Ga0307412_105304132 | 157 |
| 307 | 3300032002 | Ga0307416_100460323 | Ga0307416_1004603232 | 157 |
| 308 | 3300032002 | Ga0307416_101979258 | Ga0307416_1019792582 | 157 |
| 309 | 3300032004 | Ga0307414_10974180 | Ga0307414_109741801 | 157 |
| 310 | 3300032126 | Ga0307415_100314346 | Ga0307415_1003143461 | 157 |
| 311 | 3300033180 | Ga0307510_10072618 | Ga0307510_100726184 | 157 |
| 312 | 3300033180 | Ga0307510_10121016 | Ga0307510_101210162 | 157 |
| 313 | 3300034819 | Ga0373958_0165769 | Ga0373958_0165769_58_534 | 157 |
| 314 | 3300034819 | Ga0373958_0166297 | Ga0373958_0166297_56_532 | 157 |
| 315 | 3300035090 | Ga0373949_0072389 | Ga0373949_0072389_382_858 | 157 |
| 316 | 3300035092 | Ga0373952_0253775 | Ga0373952_0253775_33_509 | 157 |
| 317 | 3300035114 | Ga0373939_0109740 | Ga0373939_0109740_265_741 | 157 |
| 318 | 3300035171 | Ga0373946_0214788 | Ga0373946_0214788_118_594 | 157 |
| 319 | 3300035241 | Ga0373961_0031149 | Ga0373961_0031149_546_1022 | 157 |
| 320 | 3300035241 | Ga0373961_0070941 | Ga0373961_0070941_46_522 | 157 |
| 321 | 3300035691 | Ga0373931_0015641 | Ga0373931_0015641_672_1148 | 157 |
| 322 | 3300035695 | Ga0373927_0328502 | Ga0373927_0328502_429_905 | 157 |
| 323 | 3300037068 | Ga0373925_0589307 | Ga0373925_0589307_241_717 | 157 |
| 324 | 3300039437 | Ga0436365_0209743 | Ga0436365_0209743_256_744 | 157 |
| 325 | 3300039437 | Ga0436365_1026627 | Ga0436365_1026627_503_979 | 157 |
| 326 | 3300041443 | Ga0451789_1333214 | Ga0451789_1333214_15_491 | 157 |
| 327 | 3300041452 | Ga0451793_1038465 | Ga0451793_1038465_30_506 | 157 |
| 328 | 3300041460 | Ga0451802_1431654 | Ga0451802_1431654_119_595 | 157 |
| 329 | 3300041511 | Ga0451855_0143711 | Ga0451855_0143711_52_528 | 157 |
| 330 | 3300044684 | Ga0466966_0343263 | Ga0466966_0343263_210_686 | 157 |
| 331 | 3300046455 | Ga0495603_0021318 | Ga0495603_0021318_55_531 | 157 |
| 332 | 3300046455 | Ga0495603_0392356 | Ga0495603_0392356_153_629 | 157 |
| 333 | 3300046459 | Ga0495629_0123416 | Ga0495629_0123416_970_1446 | 157 |
| 334 | 3300046459 | Ga0495629_0484623 | Ga0495629_0484623_75_551 | 157 |
| 335 | 3300046460 | Ga0495638_0139687 | Ga0495638_0139687_293_769 | 157 |
| 336 | 3300046471 | Ga0495650_0125333 | Ga0495650_0125333_67_543 | 157 |
| 337 | 3300046473 | Ga0495582_0082250 | Ga0495582_0082250_1165_1641 | 157 |
| 338 | 3300046492 | Ga0495585_0586092 | Ga0495585_0586092_15_491 | 157 |
| 339 | 3300046500 | Ga0495596_0130534 | Ga0495596_0130534_188_664 | 157 |
| 340 | 3300046500 | Ga0495596_0177088 | Ga0495596_0177088_108_584 | 157 |
| 341 | 3300046500 | Ga0495596_0195003 | Ga0495596_0195003_257_733 | 157 |
| 342 | 3300046518 | Ga0495631_0217855 | Ga0495631_0217855_218_694 | 157 |
| 343 | 3300046519 | Ga0495632_0063839 | Ga0495632_0063839_1229_1705 | 157 |
| 344 | 3300046520 | Ga0495637_0100090 | Ga0495637_0100090_506_982 | 157 |
| 345 | 3300046523 | Ga0495644_0281117 | Ga0495644_0281117_27_503 | 157 |
| 346 | 3300046523 | Ga0495644_0359059 | Ga0495644_0359059_25_501 | 157 |
| 347 | 3300046524 | Ga0495648_0373903 | Ga0495648_0373903_82_558 | 157 |
| 348 | 3300046525 | Ga0495663_0177723 | Ga0495663_0177723_174_650 | 157 |
| 349 | 3300046526 | Ga0495666_0167306 | Ga0495666_0167306_280_756 | 157 |
| 350 | 3300046528 | Ga0495642_0191454 | Ga0495642_0191454_142_618 | 157 |
| 351 | 3300046528 | Ga0495642_0198449 | Ga0495642_0198449_365_841 | 157 |
| 352 | 3300046533 | Ga0495640_0361314 | Ga0495640_0361314_13_489 | 157 |
| 353 | 3300046538 | Ga0495609_0131591 | Ga0495609_0131591_162_638 | 157 |
| 354 | 3300046616 | Ga0495668_0481719 | Ga0495668_0481719_177_653 | 157 |
| 355 | 3300046616 | Ga0495668_0732608 | Ga0495668_0732608_32_508 | 157 |
| 356 | 3300046660 | Ga0495625_0251011 | Ga0495625_0251011_83_559 | 157 |
| 357 | 3300046663 | Ga0495635_0255921 | Ga0495635_0255921_552_1028 | 157 |
| 358 | 3300046674 | Ga0495588_0416881 | Ga0495588_0416881_59_535 | 157 |
| 359 | 3300046683 | Ga0495658_0247379 | Ga0495658_0247379_403_879 | 157 |
| 360 | 3300046684 | Ga0495669_0310627 | Ga0495669_0310627_210_686 | 157 |
| 361 | 3300046691 | Ga0495670_0469767 | Ga0495670_0469767_134_610 | 157 |
| 362 | 3300046692 | Ga0495671_0091675 | Ga0495671_0091675_147_623 | 157 |
| 363 | 3300046692 | Ga0495671_0437409 | Ga0495671_0437409_17_493 | 157 |
| 364 | 3300046694 | Ga0495649_0299125 | Ga0495649_0299125_152_628 | 157 |
| 365 | 3300046694 | Ga0495649_0408599 | Ga0495649_0408599_125_601 | 157 |
| 366 | 3300047315 | Ga0495581_0352195 | Ga0495581_0352195_372_848 | 157 |
| 367 | 3300047317 | Ga0495604_0730681 | Ga0495604_0730681_101_577 | 157 |
| 368 | 3300047319 | Ga0495674_0433544 | Ga0495674_0433544_302_778 | 157 |
| 369 | 3300047323 | Ga0495683_0383974 | Ga0495683_0383974_55_531 | 157 |
| 370 | 3300048903 | Ga0496100_0073875 | Ga0496100_0073875_351_827 | 157 |
| 371 | 3300048903 | Ga0496100_0926204 | Ga0496100_0926204_102_578 | 157 |
| 372 | 3300048905 | Ga0496102_0152685 | Ga0496102_0152685_500_976 | 157 |
| 373 | 3300048905 | Ga0496102_0260356 | Ga0496102_0260356_775_1251 | 157 |
| 374 | 3300048905 | Ga0496102_0347549 | Ga0496102_0347549_720_1196 | 157 |
| 375 | 3300048905 | Ga0496102_0401306 | Ga0496102_0401306_527_1003 | 157 |
| 376 | 3300048906 | Ga0496103_0091837 | Ga0496103_0091837_890_1366 | 157 |
| 377 | 3300048906 | Ga0496103_0135099 | Ga0496103_0135099_735_1211 | 157 |
| 378 | 3300048907 | Ga0496104_0044883 | Ga0496104_0044883_1986_2462 | 157 |
| 379 | 3300048907 | Ga0496104_0463833 | Ga0496104_0463833_538_1014 | 157 |
| 380 | 3300048907 | Ga0496104_0526120 | Ga0496104_0526120_471_947 | 157 |
| 381 | 3300048907 | Ga0496104_0777062 | Ga0496104_0777062_167_643 | 157 |
| 382 | 3300048908 | Ga0496105_0051519 | Ga0496105_0051519_1223_1699 | 157 |
| 383 | 3300048908 | Ga0496105_0094396 | Ga0496105_0094396_1341_1817 | 157 |
| 384 | 3300048908 | Ga0496105_0737928 | Ga0496105_0737928_114_590 | 157 |
| 385 | 3300048909 | Ga0496106_0411555 | Ga0496106_0411555_125_601 | 157 |
| 386 | 3300048909 | Ga0496106_0607760 | Ga0496106_0607760_214_690 | 157 |
| 387 | 3300048909 | Ga0496106_0628249 | Ga0496106_0628249_327_803 | 157 |
| 388 | 3300048910 | Ga0496107_0037476 | Ga0496107_0037476_926_1402 | 157 |
| 389 | 3300048910 | Ga0496107_0316488 | Ga0496107_0316488_397_873 | 157 |
| 390 | 3300048911 | Ga0496108_0036615 | Ga0496108_0036615_1796_2272 | 157 |
| 391 | 3300048911 | Ga0496108_0571795 | Ga0496108_0571795_471_947 | 157 |
| 392 | 3300048911 | Ga0496108_1132709 | Ga0496108_1132709_105_581 | 157 |
| 393 | 3300048912 | Ga0496109_0057722 | Ga0496109_0057722_2348_2824 | 157 |
| 394 | 3300048912 | Ga0496109_0353316 | Ga0496109_0353316_150_626 | 157 |
| 395 | 3300048912 | Ga0496109_1851968 | Ga0496109_1851968_22_498 | 157 |
| 396 | 3300048914 | Ga0496111_0034277 | Ga0496111_0034277_1994_2470 | 157 |
| 397 | 3300048915 | Ga0496112_0033543 | Ga0496112_0033543_2658_3134 | 157 |
| 398 | 3300048915 | Ga0496112_0631524 | Ga0496112_0631524_288_764 | 157 |
| 399 | 3300048915 | Ga0496112_1010109 | Ga0496112_1010109_139_615 | 157 |
| 400 | 3300048916 | Ga0496113_0017212 | Ga0496113_0017212_1830_2306 | 157 |
| 401 | 3300048916 | Ga0496113_0032120 | Ga0496113_0032120_2435_2911 | 157 |
| 402 | 3300048917 | Ga0496114_0078476 | Ga0496114_0078476_374_850 | 157 |
| 403 | 3300048917 | Ga0496114_0420047 | Ga0496114_0420047_510_986 | 157 |
| 404 | 3300048918 | Ga0496115_0335240 | Ga0496115_0335240_494_970 | 157 |
| 405 | 3300048919 | Ga0496116_0235381 | Ga0496116_0235381_152_628 | 157 |
| 406 | 3300048921 | Ga0496118_0134441 | Ga0496118_0134441_166_642 | 157 |
| 407 | 3300048921 | Ga0496118_0283652 | Ga0496118_0283652_259_735 | 157 |
| 408 | 3300048924 | Ga0496121_0113457 | Ga0496121_0113457_721_1197 | 157 |
| 409 | 3300048924 | Ga0496121_0166716 | Ga0496121_0166716_802_1278 | 157 |
| 410 | 3300048924 | Ga0496121_0200405 | Ga0496121_0200405_278_754 | 157 |
| 411 | 3300048924 | Ga0496121_0322537 | Ga0496121_0322537_165_641 | 157 |
| 412 | 3300048927 | Ga0496124_0236071 | Ga0496124_0236071_270_746 | 157 |
| 413 | 3300048928 | Ga0496125_0576892 | Ga0496125_0576892_109_585 | 157 |
| 414 | 3300048929 | Ga0496126_0060610 | Ga0496126_0060610_2377_2853 | 157 |
| 415 | 3300048929 | Ga0496126_0397020 | Ga0496126_0397020_124_600 | 157 |
| 416 | 3300048929 | Ga0496126_0889485 | Ga0496126_0889485_16_492 | 157 |
| 417 | 3300050489 | nmdc:mga03683_265128_c1 | nmdc:mga03683_265128_c1_163_639 | 157 |
| 418 | 3300050491 | nmdc:mga00v17_539811_c1 | nmdc:mga00v17_539811_c1_42_518 | 157 |
| 419 | 3300050492 | nmdc:mga0yw44_117836_c1 | nmdc:mga0yw44_117836_c1_854_1330 | 157 |
| 420 | 3300050492 | nmdc:mga0yw44_464373_c1 | nmdc:mga0yw44_464373_c1_367_843 | 157 |
| 421 | 3300050492 | nmdc:mga0yw44_644431_c1 | nmdc:mga0yw44_644431_c1_28_504 | 157 |
| 422 | 3300050492 | nmdc:mga0yw44_804435_c1 | nmdc:mga0yw44_804435_c1_106_582 | 157 |
| 423 | 3300050494 | nmdc:mga06z11_110457_c1 | nmdc:mga06z11_110457_c1_608_1084 | 157 |
| 424 | 3300050494 | nmdc:mga06z11_460298_c1 | nmdc:mga06z11_460298_c1_241_717 | 157 |
| 425 | 3300050496 | nmdc:mga07m45_385630_c1 | nmdc:mga07m45_385630_c1_49_525 | 157 |
| 426 | 3300050496 | nmdc:mga07m45_64024_c1 | nmdc:mga07m45_64024_c1_1402_1878 | 157 |
| 427 | 3300050511 | nmdc:mga08y16_619065_c1 | nmdc:mga08y16_619065_c1_98_574 | 157 |
| 428 | 3300050512 | nmdc:mga0n895_378198_c1 | nmdc:mga0n895_378198_c1_435_911 | 157 |
| 429 | 3300050513 | nmdc:mga0rr50_393867_c1 | nmdc:mga0rr50_393867_c1_29_505 | 157 |
| 430 | 3300050515 | nmdc:mga0a205_151249_c1 | nmdc:mga0a205_151249_c1_1605_2081 | 157 |
| 431 | 3300053083 | Ga0495655_0112132 | Ga0495655_0112132_107_583 | 157 |
| 432 | 3300053090 | Ga0500646_0155861 | Ga0500646_0155861_117_593 | 157 |
| 433 | 3300053092 | Ga0500583_0085964 | Ga0500583_0085964_519_995 | 157 |
| 434 | 3300053094 | Ga0500566_0043525 | Ga0500566_0043525_1527_2003 | 157 |
| 435 | 3300053096 | Ga0500641_0147163 | Ga0500641_0147163_481_957 | 157 |
| 436 | 3300053102 | Ga0500554_067639 | Ga0500554_067639_235_711 | 157 |
| 437 | 3300053103 | Ga0500555_083377 | Ga0500555_083377_28_504 | 157 |
| 438 | 3300053114 | Ga0500582_116210 | Ga0500582_116210_271_747 | 157 |
| 439 | 3300053118 | Ga0500594_0011291 | Ga0500594_0011291_1519_1995 | 157 |
| 440 | 3300053119 | Ga0500595_001016 | Ga0500595_001016_14713_15189 | 157 |
| 441 | 3300053119 | Ga0500595_043871 | Ga0500595_043871_331_807 | 157 |
| 442 | 3300053122 | Ga0500608_234605 | Ga0500608_234605_209_685 | 157 |
| 443 | 3300053129 | Ga0500628_143339 | Ga0500628_143339_156_632 | 157 |
| 444 | 3300053133 | Ga0500655_040208 | Ga0500655_040208_353_829 | 157 |
| 445 | 3300053142 | Ga0500577_0198761 | Ga0500577_0198761_317_793 | 157 |
| 446 | 3300053147 | Ga0500589_226276 | Ga0500589_226276_77_553 | 157 |
| 447 | 3300053147 | Ga0500589_262379 | Ga0500589_262379_136_612 | 157 |
| 448 | 3300053148 | Ga0500590_147270 | Ga0500590_147270_183_659 | 157 |
| 449 | 3300053150 | Ga0500603_121939 | Ga0500603_121939_235_711 | 157 |
| 450 | 3300053151 | Ga0500604_0049059 | Ga0500604_0049059_695_1171 | 157 |
| 451 | 3300053151 | Ga0500604_0178318 | Ga0500604_0178318_211_687 | 157 |
| 452 | 3300053155 | Ga0500620_238445 | Ga0500620_238445_104_580 | 157 |
| 453 | 3300053158 | Ga0500627_0125991 | Ga0500627_0125991_418_894 | 157 |
| 454 | 3300053158 | Ga0500627_0348998 | Ga0500627_0348998_97_573 | 157 |
| 455 | 3300053161 | Ga0500634_0212441 | Ga0500634_0212441_154_630 | 157 |
| 456 | 3300053162 | Ga0500638_005456 | Ga0500638_005456_3633_4109 | 157 |
| 457 | 3300053177 | Ga0500636_0276248 | Ga0500636_0276248_215_691 | 157 |
| 458 | 3300053177 | Ga0500636_0333676 | Ga0500636_0333676_48_524 | 157 |
| 459 | 3300053178 | Ga0500637_0000585 | Ga0500637_0000585_11917_12393 | 157 |
| 460 | 3300053727 | Ga0500611_158246 | Ga0500611_158246_102_578 | 157 |
| 461 | 3300055283 | Ga0500661_005871 | Ga0500661_005871_314_790 | 157 |
| 462 | 3300003214 | JGI25165J46597_1004955 | JGI25165J46597_10049552 | 158 |
| 463 | 3300003215 | JGI25153J46596_10030586 | JGI25153J46596_100305863 | 158 |
| 464 | 3300003752 | Ga0055539_1020748 | Ga0055539_10207482 | 158 |
| 465 | 3300003762 | Ga0055542_1014646 | Ga0055542_10146462 | 158 |
| 466 | 3300004625 | Ga0055543_1011352 | Ga0055543_10113522 | 158 |
| 467 | 3300005329 | Ga0070683_100167461 | Ga0070683_1001674612 | 158 |
| 468 | 3300005329 | Ga0070683_100270090 | Ga0070683_1002700902 | 158 |
| 469 | 3300005329 | Ga0070683_100277403 | Ga0070683_1002774032 | 158 |
| 470 | 3300005336 | Ga0070680_100463354 | Ga0070680_1004633542 | 158 |
| 471 | 3300005336 | Ga0070680_100852515 | Ga0070680_1008525152 | 158 |
| 472 | 3300005337 | Ga0070682_100140690 | Ga0070682_1001406902 | 158 |
| 473 | 3300005337 | Ga0070682_100954204 | Ga0070682_1009542042 | 158 |
| 474 | 3300005338 | Ga0068868_101458966 | Ga0068868_1014589661 | 158 |
| 475 | 3300005344 | Ga0070661_100739494 | Ga0070661_1007394942 | 158 |
| 476 | 3300005344 | Ga0070661_101243556 | Ga0070661_1012435561 | 158 |
| 477 | 3300005347 | Ga0070668_100424000 | Ga0070668_1004240002 | 158 |
| 478 | 3300005355 | Ga0070671_101076359 | Ga0070671_1010763591 | 158 |
| 479 | 3300005434 | Ga0070709_10194830 | Ga0070709_101948302 | 158 |
| 480 | 3300005434 | Ga0070709_10357658 | Ga0070709_103576582 | 158 |
| 481 | 3300005434 | Ga0070709_10420172 | Ga0070709_104201722 | 158 |
| 482 | 3300005434 | Ga0070709_10833475 | Ga0070709_108334751 | 158 |
| 483 | 3300005434 | Ga0070709_10905858 | Ga0070709_109058582 | 158 |
| 484 | 3300005435 | Ga0070714_100021967 | Ga0070714_1000219672 | 158 |
| 485 | 3300005435 | Ga0070714_100431950 | Ga0070714_1004319502 | 158 |
| 486 | 3300005435 | Ga0070714_100930256 | Ga0070714_1009302561 | 158 |
| 487 | 3300005436 | Ga0070713_100029455 | Ga0070713_1000294554 | 158 |
| 488 | 3300005436 | Ga0070713_100080502 | Ga0070713_1000805023 | 158 |
| 489 | 3300005436 | Ga0070713_100156027 | Ga0070713_1001560271 | 158 |
| 490 | 3300005436 | Ga0070713_100330033 | Ga0070713_1003300332 | 158 |
| 491 | 3300005436 | Ga0070713_100737828 | Ga0070713_1007378281 | 158 |
| 492 | 3300005436 | Ga0070713_101283380 | Ga0070713_1012833801 | 158 |
| 493 | 3300005437 | Ga0070710_10041326 | Ga0070710_100413262 | 158 |
| 494 | 3300005437 | Ga0070710_10055278 | Ga0070710_100552783 | 158 |
| 495 | 3300005437 | Ga0070710_10297910 | Ga0070710_102979102 | 158 |
| 496 | 3300005437 | Ga0070710_10336269 | Ga0070710_103362692 | 158 |
| 497 | 3300005437 | Ga0070710_10577282 | Ga0070710_105772822 | 158 |
| 498 | 3300005437 | Ga0070710_10611687 | Ga0070710_106116872 | 158 |
| 499 | 3300005437 | Ga0070710_10754729 | Ga0070710_107547292 | 158 |
| 500 | 3300005439 | Ga0070711_100005553 | Ga0070711_1000055537 | 158 |
| 501 | 3300005439 | Ga0070711_100194344 | Ga0070711_1001943442 | 158 |
| 502 | 3300005439 | Ga0070711_100268474 | Ga0070711_1002684742 | 158 |
| 503 | 3300005439 | Ga0070711_100315259 | Ga0070711_1003152592 | 158 |
| 504 | 3300005455 | Ga0070663_100861160 | Ga0070663_1008611602 | 158 |
| 505 | 3300005455 | Ga0070663_101271406 | Ga0070663_1012714061 | 158 |
| 506 | 3300005456 | Ga0070678_100096322 | Ga0070678_1000963222 | 158 |
| 507 | 3300005458 | Ga0070681_10017254 | Ga0070681_100172541 | 158 |
| 508 | 3300005458 | Ga0070681_10037401 | Ga0070681_100374013 | 158 |
| 509 | 3300005458 | Ga0070681_10075073 | Ga0070681_100750733 | 158 |
| 510 | 3300005458 | Ga0070681_10436888 | Ga0070681_104368882 | 158 |
| 511 | 3300005467 | Ga0070706_100234156 | Ga0070706_1002341563 | 158 |
| 512 | 3300005467 | Ga0070706_100317287 | Ga0070706_1003172872 | 158 |
| 513 | 3300005467 | Ga0070706_100600472 | Ga0070706_1006004722 | 158 |
| 514 | 3300005471 | Ga0070698_100059290 | Ga0070698_1000592903 | 158 |
| 515 | 3300005471 | Ga0070698_100981492 | Ga0070698_1009814922 | 158 |
| 516 | 3300005518 | Ga0070699_100681478 | Ga0070699_1006814782 | 158 |
| 517 | 3300005530 | Ga0070679_100015647 | Ga0070679_1000156475 | 158 |
| 518 | 3300005530 | Ga0070679_100163330 | Ga0070679_1001633302 | 158 |
| 519 | 3300005535 | Ga0070684_100395167 | Ga0070684_1003951671 | 158 |
| 520 | 3300005535 | Ga0070684_100884156 | Ga0070684_1008841562 | 158 |
| 521 | 3300005536 | Ga0070697_100201326 | Ga0070697_1002013262 | 158 |
| 522 | 3300005539 | Ga0068853_100390609 | Ga0068853_1003906092 | 158 |
| 523 | 3300005539 | Ga0068853_100695337 | Ga0068853_1006953371 | 158 |
| 524 | 3300005547 | Ga0070693_100040796 | Ga0070693_1000407962 | 158 |
| 525 | 3300005547 | Ga0070693_100395572 | Ga0070693_1003955721 | 158 |
| 526 | 3300005563 | Ga0068855_100444992 | Ga0068855_1004449922 | 158 |
| 527 | 3300005563 | Ga0068855_100686734 | Ga0068855_1006867342 | 158 |
| 528 | 3300005563 | Ga0068855_101263499 | Ga0068855_1012634992 | 158 |
| 529 | 3300005564 | Ga0070664_101838180 | Ga0070664_1018381801 | 158 |
| 530 | 3300005577 | Ga0068857_100183974 | Ga0068857_1001839742 | 158 |
| 531 | 3300005577 | Ga0068857_100311302 | Ga0068857_1003113022 | 158 |
| 532 | 3300005578 | Ga0068854_100442540 | Ga0068854_1004425401 | 158 |
| 533 | 3300005578 | Ga0068854_100501576 | Ga0068854_1005015762 | 158 |
| 534 | 3300005614 | Ga0068856_100000883 | Ga0068856_10000088333 | 158 |
| 535 | 3300005614 | Ga0068856_100491914 | Ga0068856_1004919141 | 158 |
| 536 | 3300005614 | Ga0068856_101140658 | Ga0068856_1011406582 | 158 |
| 537 | 3300005614 | Ga0068856_101473787 | Ga0068856_1014737872 | 158 |
| 538 | 3300005614 | Ga0068856_101840282 | Ga0068856_1018402822 | 158 |
| 539 | 3300005616 | Ga0068852_100780793 | Ga0068852_1007807932 | 158 |
| 540 | 3300005616 | Ga0068852_101142168 | Ga0068852_1011421681 | 158 |
| 541 | 3300005616 | Ga0068852_101700076 | Ga0068852_1017000762 | 158 |
| 542 | 3300005840 | Ga0068870_10419108 | Ga0068870_104191082 | 158 |
| 543 | 3300005983 | Ga0081540_1035114 | Ga0081540_10351142 | 158 |
| 544 | 3300005983 | Ga0081540_1055889 | Ga0081540_10558892 | 158 |
| 545 | 3300006028 | Ga0070717_10123888 | Ga0070717_101238882 | 158 |
| 546 | 3300006028 | Ga0070717_10242931 | Ga0070717_102429312 | 158 |
| 547 | 3300006028 | Ga0070717_10549537 | Ga0070717_105495372 | 158 |
| 548 | 3300006038 | Ga0075365_10434159 | Ga0075365_104341592 | 158 |
| 549 | 3300006048 | Ga0075363_100065058 | Ga0075363_1000650582 | 158 |
| 550 | 3300006163 | Ga0070715_10194769 | Ga0070715_101947691 | 158 |
| 551 | 3300006163 | Ga0070715_10256318 | Ga0070715_102563182 | 158 |
| 552 | 3300006173 | Ga0070716_100094913 | Ga0070716_1000949132 | 158 |
| 553 | 3300006173 | Ga0070716_101320005 | Ga0070716_1013200051 | 158 |
| 554 | 3300006175 | Ga0070712_100038086 | Ga0070712_1000380863 | 158 |
| 555 | 3300006175 | Ga0070712_100111114 | Ga0070712_1001111142 | 158 |
| 556 | 3300006175 | Ga0070712_100314022 | Ga0070712_1003140222 | 158 |
| 557 | 3300006178 | Ga0075367_10022547 | Ga0075367_100225473 | 158 |
| 558 | 3300006195 | Ga0075366_10397943 | Ga0075366_103979432 | 158 |
| 559 | 3300006237 | Ga0097621_100927645 | Ga0097621_1009276452 | 158 |
| 560 | 3300006353 | Ga0075370_10024394 | Ga0075370_100243943 | 158 |
| 561 | 3300006358 | Ga0068871_101274140 | Ga0068871_1012741402 | 158 |
| 562 | 3300006881 | Ga0068865_100708827 | Ga0068865_1007088272 | 158 |
| 563 | 3300007265 | Ga0099794_10174147 | Ga0099794_101741472 | 158 |
| 564 | 3300007788 | Ga0099795_10066779 | Ga0099795_100667792 | 158 |
| 565 | 3300009093 | Ga0105240_10551341 | Ga0105240_105513412 | 158 |
| 566 | 3300009093 | Ga0105240_10749887 | Ga0105240_107498872 | 158 |
| 567 | 3300009093 | Ga0105240_10822471 | Ga0105240_108224712 | 158 |
| 568 | 3300009093 | Ga0105240_11711774 | Ga0105240_117117741 | 158 |
| 569 | 3300009148 | Ga0105243_10393668 | Ga0105243_103936682 | 158 |
| 570 | 3300009174 | Ga0105241_10441133 | Ga0105241_104411332 | 158 |
| 571 | 3300009174 | Ga0105241_10691131 | Ga0105241_106911312 | 158 |
| 572 | 3300009545 | Ga0105237_11256989 | Ga0105237_112569892 | 158 |
| 573 | 3300009545 | Ga0105237_11267388 | Ga0105237_112673882 | 158 |
| 574 | 3300009545 | Ga0105237_11310150 | Ga0105237_113101501 | 158 |
| 575 | 3300009551 | Ga0105238_10122580 | Ga0105238_101225803 | 158 |
| 576 | 3300009551 | Ga0105238_10153518 | Ga0105238_101535182 | 158 |
| 577 | 3300009551 | Ga0105238_10589215 | Ga0105238_105892152 | 158 |
| 578 | 3300009551 | Ga0105238_10899903 | Ga0105238_108999032 | 158 |
| 579 | 3300009551 | Ga0105238_10916090 | Ga0105238_109160902 | 158 |
| 580 | 3300009551 | Ga0105238_11355898 | Ga0105238_113558981 | 158 |
| 581 | 3300009551 | Ga0105238_11573732 | Ga0105238_115737321 | 158 |
| 582 | 3300009553 | Ga0105249_11152751 | Ga0105249_111527512 | 158 |
| 583 | 3300010159 | Ga0099796_10081558 | Ga0099796_100815582 | 158 |
| 584 | 3300010159 | Ga0099796_10235288 | Ga0099796_102352881 | 158 |
| 585 | 3300010375 | Ga0105239_10526109 | Ga0105239_105261091 | 158 |
| 586 | 3300011119 | Ga0105246_11279383 | Ga0105246_112793832 | 158 |
| 587 | 3300013100 | Ga0157373_10675974 | Ga0157373_106759742 | 158 |
| 588 | 3300013104 | Ga0157370_10137726 | Ga0157370_101377261 | 158 |
| 589 | 3300013105 | Ga0157369_10021333 | Ga0157369_100213332 | 158 |
| 590 | 3300013105 | Ga0157369_10401604 | Ga0157369_104016042 | 158 |
| 591 | 3300013296 | Ga0157374_10498604 | Ga0157374_104986042 | 158 |
| 592 | 3300013296 | Ga0157374_11026557 | Ga0157374_110265572 | 158 |
| 593 | 3300013306 | Ga0163162_11000743 | Ga0163162_110007432 | 158 |
| 594 | 3300013307 | Ga0157372_10201797 | Ga0157372_102017972 | 158 |
| 595 | 3300013307 | Ga0157372_10579615 | Ga0157372_105796152 | 158 |
| 596 | 3300013308 | Ga0157375_10624930 | Ga0157375_106249301 | 158 |
| 597 | 3300014325 | Ga0163163_11391692 | Ga0163163_113916922 | 158 |
| 598 | 3300017792 | Ga0163161_10486050 | Ga0163161_104860502 | 158 |
| 599 | 3300020070 | Ga0206356_10348709 | Ga0206356_103487092 | 158 |
| 600 | 3300020081 | Ga0206354_10763753 | Ga0206354_107637531 | 158 |
| 601 | 3300021384 | Ga0213876_10169534 | Ga0213876_101695342 | 158 |
| 602 | 3300021384 | Ga0213876_10325057 | Ga0213876_103250571 | 158 |
| 603 | 3300021384 | Ga0213876_10467307 | Ga0213876_104673071 | 158 |
| 604 | 3300021388 | Ga0213875_10150372 | Ga0213875_101503722 | 158 |
| 605 | 3300022467 | Ga0224712_10096101 | Ga0224712_100961012 | 158 |
| 606 | 3300025230 | Ga0209563_101315 | Ga0209563_1013153 | 158 |
| 607 | 3300025253 | Ga0209677_100543 | Ga0209677_1005436 | 158 |
| 608 | 3300025253 | Ga0209677_100722 | Ga0209677_10072210 | 158 |
| 609 | 3300025254 | Ga0209148_1000295 | Ga0209148_100029564 | 158 |
| 610 | 3300025261 | Ga0209233_1002578 | Ga0209233_10025782 | 158 |
| 611 | 3300025272 | Ga0209455_1003238 | Ga0209455_10032381 | 158 |
| 612 | 3300025272 | Ga0209455_1004716 | Ga0209455_10047163 | 158 |
| 613 | 3300025272 | Ga0209455_1021696 | Ga0209455_10216962 | 158 |
| 614 | 3300025297 | Ga0209758_1001900 | Ga0209758_100190013 | 158 |
| 615 | 3300025297 | Ga0209758_1013412 | Ga0209758_10134123 | 158 |
| 616 | 3300025299 | Ga0209256_1052131 | Ga0209256_10521312 | 158 |
| 617 | 3300025898 | Ga0207692_10042210 | Ga0207692_100422102 | 158 |
| 618 | 3300025898 | Ga0207692_10152647 | Ga0207692_101526472 | 158 |
| 619 | 3300025898 | Ga0207692_10250021 | Ga0207692_102500212 | 158 |
| 620 | 3300025898 | Ga0207692_10263072 | Ga0207692_102630722 | 158 |
| 621 | 3300025898 | Ga0207692_10340988 | Ga0207692_103409882 | 158 |
| 622 | 3300025898 | Ga0207692_10616693 | Ga0207692_106166932 | 158 |
| 623 | 3300025904 | Ga0207647_10113451 | Ga0207647_101134512 | 158 |
| 624 | 3300025906 | Ga0207699_10011800 | Ga0207699_100118003 | 158 |
| 625 | 3300025906 | Ga0207699_10267408 | Ga0207699_102674081 | 158 |
| 626 | 3300025906 | Ga0207699_10504622 | Ga0207699_105046222 | 158 |
| 627 | 3300025906 | Ga0207699_10586267 | Ga0207699_105862672 | 158 |
| 628 | 3300025910 | Ga0207684_10366162 | Ga0207684_103661621 | 158 |
| 629 | 3300025911 | Ga0207654_10224647 | Ga0207654_102246472 | 158 |
| 630 | 3300025912 | Ga0207707_10008183 | Ga0207707_100081834 | 158 |
| 631 | 3300025912 | Ga0207707_10369948 | Ga0207707_103699482 | 158 |
| 632 | 3300025912 | Ga0207707_10477221 | Ga0207707_104772212 | 158 |
| 633 | 3300025912 | Ga0207707_10669777 | Ga0207707_106697772 | 158 |
| 634 | 3300025913 | Ga0207695_10071334 | Ga0207695_100713342 | 158 |
| 635 | 3300025914 | Ga0207671_10508006 | Ga0207671_105080062 | 158 |
| 636 | 3300025915 | Ga0207693_10045163 | Ga0207693_100451632 | 158 |
| 637 | 3300025915 | Ga0207693_10055491 | Ga0207693_100554912 | 158 |
| 638 | 3300025915 | Ga0207693_10263120 | Ga0207693_102631202 | 158 |
| 639 | 3300025916 | Ga0207663_10002736 | Ga0207663_100027362 | 158 |
| 640 | 3300025920 | Ga0207649_10201576 | Ga0207649_102015762 | 158 |
| 641 | 3300025920 | Ga0207649_10503760 | Ga0207649_105037602 | 158 |
| 642 | 3300025921 | Ga0207652_10129770 | Ga0207652_101297703 | 158 |
| 643 | 3300025921 | Ga0207652_10164815 | Ga0207652_101648152 | 158 |
| 644 | 3300025921 | Ga0207652_10305259 | Ga0207652_103052592 | 158 |
| 645 | 3300025921 | Ga0207652_10351820 | Ga0207652_103518202 | 158 |
| 646 | 3300025921 | Ga0207652_10610512 | Ga0207652_106105122 | 158 |
| 647 | 3300025921 | Ga0207652_11500576 | Ga0207652_115005761 | 158 |
| 648 | 3300025922 | Ga0207646_10369425 | Ga0207646_103694252 | 158 |
| 649 | 3300025924 | Ga0207694_10206275 | Ga0207694_102062752 | 158 |
| 650 | 3300025924 | Ga0207694_10266828 | Ga0207694_102668282 | 158 |
| 651 | 3300025924 | Ga0207694_11040842 | Ga0207694_110408422 | 158 |
| 652 | 3300025928 | Ga0207700_10010462 | Ga0207700_100104626 | 158 |
| 653 | 3300025928 | Ga0207700_10012790 | Ga0207700_100127902 | 158 |
| 654 | 3300025928 | Ga0207700_10029757 | Ga0207700_100297573 | 158 |
| 655 | 3300025928 | Ga0207700_10378915 | Ga0207700_103789152 | 158 |
| 656 | 3300025928 | Ga0207700_10400753 | Ga0207700_104007532 | 158 |
| 657 | 3300025928 | Ga0207700_10684841 | Ga0207700_106848412 | 158 |
| 658 | 3300025928 | Ga0207700_11148398 | Ga0207700_111483982 | 158 |
| 659 | 3300025929 | Ga0207664_10254380 | Ga0207664_102543802 | 158 |
| 660 | 3300025929 | Ga0207664_10340402 | Ga0207664_103404022 | 158 |
| 661 | 3300025933 | Ga0207706_10130949 | Ga0207706_101309492 | 158 |
| 662 | 3300025938 | Ga0207704_10708908 | Ga0207704_107089082 | 158 |
| 663 | 3300025944 | Ga0207661_10000878 | Ga0207661_1000087811 | 158 |
| 664 | 3300025944 | Ga0207661_10062380 | Ga0207661_100623803 | 158 |
| 665 | 3300025944 | Ga0207661_10850753 | Ga0207661_108507532 | 158 |
| 666 | 3300025944 | Ga0207661_11273548 | Ga0207661_112735481 | 158 |
| 667 | 3300025949 | Ga0207667_10144958 | Ga0207667_101449582 | 158 |
| 668 | 3300025949 | Ga0207667_10148791 | Ga0207667_101487913 | 158 |
| 669 | 3300025949 | Ga0207667_11145110 | Ga0207667_111451102 | 158 |
| 670 | 3300025961 | Ga0207712_10857651 | Ga0207712_108576512 | 158 |
| 671 | 3300025981 | Ga0207640_10356669 | Ga0207640_103566692 | 158 |
| 672 | 3300026023 | Ga0207677_10443850 | Ga0207677_104438502 | 158 |
| 673 | 3300026041 | Ga0207639_10240699 | Ga0207639_102406992 | 158 |
| 674 | 3300026067 | Ga0207678_10246188 | Ga0207678_102461882 | 158 |
| 675 | 3300026078 | Ga0207702_10000318 | Ga0207702_1000031832 | 158 |
| 676 | 3300026078 | Ga0207702_10312632 | Ga0207702_103126322 | 158 |
| 677 | 3300026078 | Ga0207702_10372300 | Ga0207702_103723002 | 158 |
| 678 | 3300026116 | Ga0207674_10073988 | Ga0207674_100739882 | 158 |
| 679 | 3300026116 | Ga0207674_10666112 | Ga0207674_106661122 | 158 |
| 680 | 3300026121 | Ga0207683_10083899 | Ga0207683_100838992 | 158 |
| 681 | 3300026121 | Ga0207683_11224932 | Ga0207683_112249321 | 158 |
| 682 | 3300026142 | Ga0207698_10403643 | Ga0207698_104036432 | 158 |
| 683 | 3300026142 | Ga0207698_10715809 | Ga0207698_107158091 | 158 |
| 684 | 3300027866 | Ga0209813_10024630 | Ga0209813_100246302 | 158 |
| 685 | 3300028379 | Ga0268266_10341670 | Ga0268266_103416702 | 158 |
| 686 | 3300031238 | Ga0265332_10035231 | Ga0265332_100352312 | 158 |
| 687 | 3300031247 | Ga0265340_10091462 | Ga0265340_100914622 | 158 |
| 688 | 3300031247 | Ga0265340_10217072 | Ga0265340_102170722 | 158 |
| 689 | 3300031249 | Ga0265339_10073499 | Ga0265339_100734992 | 158 |
| 690 | 3300031250 | Ga0265331_10089610 | Ga0265331_100896102 | 158 |
| 691 | 3300031344 | Ga0265316_10196584 | Ga0265316_101965842 | 158 |
| 692 | 3300031344 | Ga0265316_10588938 | Ga0265316_105889382 | 158 |
| 693 | 3300031595 | Ga0265313_10342930 | Ga0265313_103429301 | 158 |
| 694 | 3300031616 | Ga0307508_10126440 | Ga0307508_101264402 | 158 |
| 695 | 3300031711 | Ga0265314_10005054 | Ga0265314_100050544 | 158 |
| 696 | 3300031711 | Ga0265314_10220531 | Ga0265314_102205311 | 158 |
| 697 | 3300032002 | Ga0307416_101970837 | Ga0307416_1019708372 | 158 |
| 698 | 3300032126 | Ga0307415_100662739 | Ga0307415_1006627392 | 158 |
| 699 | 3300033180 | Ga0307510_10089264 | Ga0307510_100892643 | 158 |
| 700 | 3300033180 | Ga0307510_10301776 | Ga0307510_103017762 | 158 |
| 701 | 3300033442 | Ga0315911_1000008 | Ga0315911_100000898 | 158 |
| 702 | 3300035083 | Ga0373926_0033050 | Ga0373926_0033050_962_1441 | 158 |
| 703 | 3300035086 | Ga0373934_0023493 | Ga0373934_0023493_659_1138 | 158 |
| 704 | 3300035086 | Ga0373934_0096153 | Ga0373934_0096153_228_707 | 158 |
| 705 | 3300035091 | Ga0373951_0095136 | Ga0373951_0095136_159_638 | 158 |
| 706 | 3300035111 | Ga0373923_0004936 | Ga0373923_0004936_1110_1589 | 158 |
| 707 | 3300035111 | Ga0373923_0039874 | Ga0373923_0039874_197_676 | 158 |
| 708 | 3300035111 | Ga0373923_0042855 | Ga0373923_0042855_234_713 | 158 |
| 709 | 3300035113 | Ga0373936_0070753 | Ga0373936_0070753_126_605 | 158 |
| 710 | 3300035116 | Ga0373945_0015296 | Ga0373945_0015296_2084_2563 | 158 |
| 711 | 3300035116 | Ga0373945_0100694 | Ga0373945_0100694_18_497 | 158 |
| 712 | 3300035117 | Ga0373953_0078384 | Ga0373953_0078384_690_1169 | 158 |
| 713 | 3300035117 | Ga0373953_0247502 | Ga0373953_0247502_240_719 | 158 |
| 714 | 3300035118 | Ga0373954_0011463 | Ga0373954_0011463_2376_2855 | 158 |
| 715 | 3300035118 | Ga0373954_0174243 | Ga0373954_0174243_455_934 | 158 |
| 716 | 3300035119 | Ga0373956_0082067 | Ga0373956_0082067_34_513 | 158 |
| 717 | 3300035119 | Ga0373956_0155201 | Ga0373956_0155201_71_550 | 158 |
| 718 | 3300035119 | Ga0373956_0451395 | Ga0373956_0451395_32_511 | 158 |
| 719 | 3300035120 | Ga0373957_0120048 | Ga0373957_0120048_75_554 | 158 |
| 720 | 3300035170 | Ga0373943_0141500 | Ga0373943_0141500_714_1193 | 158 |
| 721 | 3300035170 | Ga0373943_0463427 | Ga0373943_0463427_163_642 | 158 |
| 722 | 3300035171 | Ga0373946_0014322 | Ga0373946_0014322_2025_2504 | 158 |
| 723 | 3300035171 | Ga0373946_0482002 | Ga0373946_0482002_122_601 | 158 |
| 724 | 3300035172 | Ga0373955_0004380 | Ga0373955_0004380_2828_3307 | 158 |
| 725 | 3300035172 | Ga0373955_0051079 | Ga0373955_0051079_1621_2100 | 158 |
| 726 | 3300035410 | Ga0373924_0033451 | Ga0373924_0033451_16_495 | 158 |
| 727 | 3300035410 | Ga0373924_0093920 | Ga0373924_0093920_211_690 | 158 |
| 728 | 3300035692 | Ga0373935_0001267 | Ga0373935_0001267_3608_4087 | 158 |
| 729 | 3300035692 | Ga0373935_0039786 | Ga0373935_0039786_1596_2075 | 158 |
| 730 | 3300035695 | Ga0373927_0000766 | Ga0373927_0000766_12732_13211 | 158 |
| 731 | 3300035695 | Ga0373927_0006724 | Ga0373927_0006724_3837_4316 | 158 |
| 732 | 3300035695 | Ga0373927_0200773 | Ga0373927_0200773_75_554 | 158 |
| 733 | 3300035695 | Ga0373927_0288502 | Ga0373927_0288502_208_687 | 158 |
| 734 | 3300035695 | Ga0373927_0349402 | Ga0373927_0349402_391_870 | 158 |
| 735 | 3300035724 | Ga0373933_0000218 | Ga0373933_0000218_11867_12343 | 158 |
| 736 | 3300035724 | Ga0373933_0231444 | Ga0373933_0231444_344_823 | 158 |
| 737 | 3300035724 | Ga0373933_0356576 | Ga0373933_0356576_358_837 | 158 |
| 738 | 3300035725 | Ga0373947_0000310 | Ga0373947_0000310_14292_14771 | 158 |
| 739 | 3300035725 | Ga0373947_0013664 | Ga0373947_0013664_2204_2683 | 158 |
| 740 | 3300035725 | Ga0373947_0374672 | Ga0373947_0374672_230_709 | 158 |
| 741 | 3300036401 | Ga0373937_0014630 | Ga0373937_0014630_5227_5706 | 158 |
| 742 | 3300037068 | Ga0373925_0006419 | Ga0373925_0006419_3952_4431 | 158 |
| 743 | 3300037068 | Ga0373925_0021485 | Ga0373925_0021485_684_1163 | 158 |
| 744 | 3300037068 | Ga0373925_0078313 | Ga0373925_0078313_1114_1593 | 158 |
| 745 | 3300037068 | Ga0373925_0654343 | Ga0373925_0654343_90_569 | 158 |
| 746 | 3300037418 | Ga0395900_0032832 | Ga0395900_0032832_3699_4178 | 158 |
| 747 | 3300037418 | Ga0395900_0108628 | Ga0395900_0108628_1887_2363 | 158 |
| 748 | 3300037418 | Ga0395900_0199177 | Ga0395900_0199177_67_546 | 158 |
| 749 | 3300037466 | Ga0395898_0089031 | Ga0395898_0089031_2027_2506 | 158 |
| 750 | 3300037466 | Ga0395898_0631023 | Ga0395898_0631023_189_668 | 158 |
| 751 | 3300037471 | Ga0395905_0048135 | Ga0395905_0048135_1785_2264 | 158 |
| 752 | 3300037853 | Ga0436364_0331795 | Ga0436364_0331795_1016_1495 | 158 |
| 753 | 3300037853 | Ga0436364_0603569 | Ga0436364_0603569_331_810 | 158 |
| 754 | 3300038443 | Ga0395901_0113781 | Ga0395901_0113781_1612_2088 | 158 |
| 755 | 3300038443 | Ga0395901_0297332 | Ga0395901_0297332_236_715 | 158 |
| 756 | 3300039437 | Ga0436365_0118730 | Ga0436365_0118730_244_723 | 158 |
| 757 | 3300039437 | Ga0436365_0135384 | Ga0436365_0135384_474_950 | 158 |
| 758 | 3300039437 | Ga0436365_0279102 | Ga0436365_0279102_2159_2638 | 158 |
| 759 | 3300039453 | Ga0436362_0249161 | Ga0436362_0249161_75_554 | 158 |
| 760 | 3300039453 | Ga0436362_1201460 | Ga0436362_1201460_46_525 | 158 |
| 761 | 3300044656 | Ga0466969_0093259 | Ga0466969_0093259_704_1183 | 158 |
| 762 | 3300044658 | Ga0466972_0029548 | Ga0466972_0029548_385_864 | 158 |
| 763 | 3300044693 | Ga0466961_0156035 | Ga0466961_0156035_922_1398 | 158 |
| 764 | 3300044694 | Ga0466963_0258548 | Ga0466963_0258548_571_1050 | 158 |
| 765 | 3300044694 | Ga0466963_0996490 | Ga0466963_0996490_92_571 | 158 |
| 766 | 3300044719 | Ga0466971_0156462 | Ga0466971_0156462_106_585 | 158 |
| 767 | 3300044735 | Ga0466968_0379186 | Ga0466968_0379186_201_680 | 158 |
| 768 | 3300044765 | Ga0466970_0260390 | Ga0466970_0260390_378_863 | 158 |
| 769 | 3300044842 | Ga0466957_0080078 | Ga0466957_0080078_249_728 | 158 |
| 770 | 3300044842 | Ga0466957_0237937 | Ga0466957_0237937_707_1186 | 158 |
| 771 | 3300044842 | Ga0466957_0297429 | Ga0466957_0297429_114_593 | 158 |
| 772 | 3300044842 | Ga0466957_0427749 | Ga0466957_0427749_306_785 | 158 |
| 773 | 3300044901 | Ga0466960_0181359 | Ga0466960_0181359_405_884 | 158 |
| 774 | 3300045049 | Ga0466959_0048894 | Ga0466959_0048894_1221_1697 | 158 |
| 775 | 3300045976 | Ga0466967_0028253 | Ga0466967_0028253_3925_4404 | 158 |
| 776 | 3300045976 | Ga0466967_0062009 | Ga0466967_0062009_74_550 | 158 |
| 777 | 3300045976 | Ga0466967_0204967 | Ga0466967_0204967_1223_1702 | 158 |
| 778 | 3300045976 | Ga0466967_1213654 | Ga0466967_1213654_241_720 | 158 |
| 779 | 3300046452 | Ga0495617_107272 | Ga0495617_107272_178_657 | 158 |
| 780 | 3300046454 | Ga0495592_0102991 | Ga0495592_0102991_536_1015 | 158 |
| 781 | 3300046454 | Ga0495592_0142617 | Ga0495592_0142617_474_953 | 158 |
| 782 | 3300046455 | Ga0495603_0000936 | Ga0495603_0000936_3020_3499 | 158 |
| 783 | 3300046455 | Ga0495603_0105542 | Ga0495603_0105542_509_988 | 158 |
| 784 | 3300046455 | Ga0495603_0237833 | Ga0495603_0237833_61_540 | 158 |
| 785 | 3300046459 | Ga0495629_0001416 | Ga0495629_0001416_13716_14195 | 158 |
| 786 | 3300046459 | Ga0495629_0633985 | Ga0495629_0633985_218_697 | 158 |
| 787 | 3300046460 | Ga0495638_0317616 | Ga0495638_0317616_242_721 | 158 |
| 788 | 3300046461 | Ga0495641_0016464 | Ga0495641_0016464_2898_3377 | 158 |
| 789 | 3300046461 | Ga0495641_0138934 | Ga0495641_0138934_22_501 | 158 |
| 790 | 3300046462 | Ga0495651_0019880 | Ga0495651_0019880_2557_3036 | 158 |
| 791 | 3300046462 | Ga0495651_0178579 | Ga0495651_0178579_854_1333 | 158 |
| 792 | 3300046463 | Ga0495653_0049261 | Ga0495653_0049261_2156_2635 | 158 |
| 793 | 3300046463 | Ga0495653_0117625 | Ga0495653_0117625_488_967 | 158 |
| 794 | 3300046472 | Ga0495580_0005025 | Ga0495580_0005025_3981_4460 | 158 |
| 795 | 3300046472 | Ga0495580_0006058 | Ga0495580_0006058_6688_7167 | 158 |
| 796 | 3300046472 | Ga0495580_0514895 | Ga0495580_0514895_89_568 | 158 |
| 797 | 3300046473 | Ga0495582_0018773 | Ga0495582_0018773_1139_1618 | 158 |
| 798 | 3300046473 | Ga0495582_0038113 | Ga0495582_0038113_1646_2125 | 158 |
| 799 | 3300046473 | Ga0495582_0124167 | Ga0495582_0124167_947_1426 | 158 |
| 800 | 3300046475 | Ga0495639_0000072 | Ga0495639_0000072_19757_20236 | 158 |
| 801 | 3300046476 | Ga0495662_0000572 | Ga0495662_0000572_14255_14734 | 158 |
| 802 | 3300046476 | Ga0495662_0185583 | Ga0495662_0185583_446_925 | 158 |
| 803 | 3300046476 | Ga0495662_0217863 | Ga0495662_0217863_381_860 | 158 |
| 804 | 3300046477 | Ga0495664_0014835 | Ga0495664_0014835_3221_3700 | 158 |
| 805 | 3300046477 | Ga0495664_0045196 | Ga0495664_0045196_1853_2332 | 158 |
| 806 | 3300046499 | Ga0495594_0000046 | Ga0495594_0000046_30567_31046 | 158 |
| 807 | 3300046499 | Ga0495594_0297721 | Ga0495594_0297721_143_622 | 158 |
| 808 | 3300046507 | Ga0495606_0168025 | Ga0495606_0168025_743_1222 | 158 |
| 809 | 3300046511 | Ga0495608_0323669 | Ga0495608_0323669_47_526 | 158 |
| 810 | 3300046511 | Ga0495608_0637386 | Ga0495608_0637386_13_492 | 158 |
| 811 | 3300046512 | Ga0495610_0029757 | Ga0495610_0029757_215_694 | 158 |
| 812 | 3300046514 | Ga0495618_0100704 | Ga0495618_0100704_840_1319 | 158 |
| 813 | 3300046514 | Ga0495618_0186351 | Ga0495618_0186351_676_1155 | 158 |
| 814 | 3300046515 | Ga0495620_0229342 | Ga0495620_0229342_139_618 | 158 |
| 815 | 3300046516 | Ga0495628_0018626 | Ga0495628_0018626_4059_4538 | 158 |
| 816 | 3300046516 | Ga0495628_0033483 | Ga0495628_0033483_1761_2240 | 158 |
| 817 | 3300046516 | Ga0495628_0327775 | Ga0495628_0327775_23_502 | 158 |
| 818 | 3300046516 | Ga0495628_0517885 | Ga0495628_0517885_91_570 | 158 |
| 819 | 3300046517 | Ga0495630_0024634 | Ga0495630_0024634_1008_1487 | 158 |
| 820 | 3300046517 | Ga0495630_0093534 | Ga0495630_0093534_1411_1890 | 158 |
| 821 | 3300046517 | Ga0495630_0154765 | Ga0495630_0154765_319_798 | 158 |
| 822 | 3300046517 | Ga0495630_0513814 | Ga0495630_0513814_246_725 | 158 |
| 823 | 3300046518 | Ga0495631_0334536 | Ga0495631_0334536_78_557 | 158 |
| 824 | 3300046523 | Ga0495644_0153157 | Ga0495644_0153157_138_617 | 158 |
| 825 | 3300046524 | Ga0495648_0249358 | Ga0495648_0249358_223_702 | 158 |
| 826 | 3300046526 | Ga0495666_0041837 | Ga0495666_0041837_1363_1842 | 158 |
| 827 | 3300046531 | Ga0495665_0000335 | Ga0495665_0000335_1330_1809 | 158 |
| 828 | 3300046533 | Ga0495640_0002138 | Ga0495640_0002138_12239_12718 | 158 |
| 829 | 3300046533 | Ga0495640_0051516 | Ga0495640_0051516_581_1060 | 158 |
| 830 | 3300046535 | Ga0495586_0059346 | Ga0495586_0059346_303_782 | 158 |
| 831 | 3300046536 | Ga0495587_0345412 | Ga0495587_0345412_77_556 | 158 |
| 832 | 3300046538 | Ga0495609_0119716 | Ga0495609_0119716_63_542 | 158 |
| 833 | 3300046543 | Ga0495645_0013978 | Ga0495645_0013978_4740_5219 | 158 |
| 834 | 3300046543 | Ga0495645_0036237 | Ga0495645_0036237_1507_1986 | 158 |
| 835 | 3300046557 | Ga0495622_0084671 | Ga0495622_0084671_225_704 | 158 |
| 836 | 3300046558 | Ga0495633_0312506 | Ga0495633_0312506_127_606 | 158 |
| 837 | 3300046559 | Ga0495667_0032717 | Ga0495667_0032717_2845_3324 | 158 |
| 838 | 3300046559 | Ga0495667_0803522 | Ga0495667_0803522_41_520 | 158 |
| 839 | 3300046616 | Ga0495668_0168169 | Ga0495668_0168169_506_985 | 158 |
| 840 | 3300046642 | Ga0495634_0003037 | Ga0495634_0003037_11125_11604 | 158 |
| 841 | 3300046642 | Ga0495634_0044482 | Ga0495634_0044482_1711_2190 | 158 |
| 842 | 3300046648 | Ga0495611_0066313 | Ga0495611_0066313_983_1462 | 158 |
| 843 | 3300046648 | Ga0495611_0300332 | Ga0495611_0300332_133_612 | 158 |
| 844 | 3300046663 | Ga0495635_0002038 | Ga0495635_0002038_12634_13113 | 158 |
| 845 | 3300046663 | Ga0495635_0016231 | Ga0495635_0016231_840_1319 | 158 |
| 846 | 3300046663 | Ga0495635_0089467 | Ga0495635_0089467_13_492 | 158 |
| 847 | 3300046675 | Ga0495657_0121602 | Ga0495657_0121602_663_1142 | 158 |
| 848 | 3300046678 | Ga0495599_0128792 | Ga0495599_0128792_540_1019 | 158 |
| 849 | 3300046678 | Ga0495599_0191494 | Ga0495599_0191494_489_968 | 158 |
| 850 | 3300046678 | Ga0495599_0306147 | Ga0495599_0306147_65_544 | 158 |
| 851 | 3300046678 | Ga0495599_0644747 | Ga0495599_0644747_49_528 | 158 |
| 852 | 3300046679 | Ga0495623_0075175 | Ga0495623_0075175_1386_1865 | 158 |
| 853 | 3300046680 | Ga0495646_0066903 | Ga0495646_0066903_1176_1655 | 158 |
| 854 | 3300046680 | Ga0495646_0081016 | Ga0495646_0081016_657_1136 | 158 |
| 855 | 3300046680 | Ga0495646_0119658 | Ga0495646_0119658_883_1362 | 158 |
| 856 | 3300046680 | Ga0495646_0481522 | Ga0495646_0481522_29_508 | 158 |
| 857 | 3300046681 | Ga0495647_0008783 | Ga0495647_0008783_895_1374 | 158 |
| 858 | 3300046681 | Ga0495647_0016367 | Ga0495647_0016367_1679_2158 | 158 |
| 859 | 3300046683 | Ga0495658_0002742 | Ga0495658_0002742_2641_3120 | 158 |
| 860 | 3300046683 | Ga0495658_0009522 | Ga0495658_0009522_4091_4570 | 158 |
| 861 | 3300046684 | Ga0495669_0124118 | Ga0495669_0124118_609_1088 | 158 |
| 862 | 3300046684 | Ga0495669_0198256 | Ga0495669_0198256_58_537 | 158 |
| 863 | 3300046689 | Ga0495613_0081505 | Ga0495613_0081505_1144_1623 | 158 |
| 864 | 3300046689 | Ga0495613_0148666 | Ga0495613_0148666_627_1106 | 158 |
| 865 | 3300046690 | Ga0495624_0000795 | Ga0495624_0000795_14276_14755 | 158 |
| 866 | 3300046690 | Ga0495624_0056079 | Ga0495624_0056079_200_679 | 158 |
| 867 | 3300046794 | Ga0495589_0135740 | Ga0495589_0135740_298_777 | 158 |
| 868 | 3300046809 | Ga0495600_0093192 | Ga0495600_0093192_641_1120 | 158 |
| 869 | 3300046809 | Ga0495600_0115281 | Ga0495600_0115281_1109_1588 | 158 |
| 870 | 3300047315 | Ga0495581_0000030 | Ga0495581_0000030_22110_22589 | 158 |
| 871 | 3300047315 | Ga0495581_0126320 | Ga0495581_0126320_217_696 | 158 |
| 872 | 3300047315 | Ga0495581_0144120 | Ga0495581_0144120_68_547 | 158 |
| 873 | 3300047317 | Ga0495604_0105989 | Ga0495604_0105989_1101_1580 | 158 |
| 874 | 3300047319 | Ga0495674_0012381 | Ga0495674_0012381_2909_3388 | 158 |
| 875 | 3300047319 | Ga0495674_0026440 | Ga0495674_0026440_4540_5019 | 158 |
| 876 | 3300047319 | Ga0495674_0170500 | Ga0495674_0170500_79_558 | 158 |
| 877 | 3300047320 | Ga0495672_0019292 | Ga0495672_0019292_716_1195 | 158 |
| 878 | 3300047321 | Ga0495676_0028804 | Ga0495676_0028804_887_1366 | 158 |
| 879 | 3300047321 | Ga0495676_0426845 | Ga0495676_0426845_50_529 | 158 |
| 880 | 3300047322 | Ga0495680_0139443 | Ga0495680_0139443_1072_1551 | 158 |
| 881 | 3300047322 | Ga0495680_0289892 | Ga0495680_0289892_352_831 | 158 |
| 882 | 3300047444 | Ga0495675_0384899 | Ga0495675_0384899_124_603 | 158 |
| 883 | 3300047471 | Ga0495684_0021000 | Ga0495684_0021000_4005_4484 | 158 |
| 884 | 3300047471 | Ga0495684_0053297 | Ga0495684_0053297_346_825 | 158 |
| 885 | 3300047472 | Ga0495686_0085355 | Ga0495686_0085355_566_1045 | 158 |
| 886 | 3300047472 | Ga0495686_0171913 | Ga0495686_0171913_85_564 | 158 |
| 887 | 3300047673 | Ga0495593_0000398 | Ga0495593_0000398_19884_20363 | 158 |
| 888 | 3300047673 | Ga0495593_0181923 | Ga0495593_0181923_555_1034 | 158 |
| 889 | 3300048089 | Ga0495614_0046075 | Ga0495614_0046075_70_549 | 158 |
| 890 | 3300048903 | Ga0496100_0369385 | Ga0496100_0369385_325_804 | 158 |
| 891 | 3300048904 | Ga0496101_0859744 | Ga0496101_0859744_197_676 | 158 |
| 892 | 3300048904 | Ga0496101_1368899 | Ga0496101_1368899_21_500 | 158 |
| 893 | 3300048905 | Ga0496102_0082256 | Ga0496102_0082256_2465_2944 | 158 |
| 894 | 3300048906 | Ga0496103_0527388 | Ga0496103_0527388_251_730 | 158 |
| 895 | 3300048906 | Ga0496103_0636678 | Ga0496103_0636678_140_616 | 158 |
| 896 | 3300048907 | Ga0496104_0548848 | Ga0496104_0548848_338_817 | 158 |
| 897 | 3300048908 | Ga0496105_0852426 | Ga0496105_0852426_82_561 | 158 |
| 898 | 3300048909 | Ga0496106_0766736 | Ga0496106_0766736_86_562 | 158 |
| 899 | 3300048910 | Ga0496107_0114537 | Ga0496107_0114537_1235_1711 | 158 |
| 900 | 3300048910 | Ga0496107_1098843 | Ga0496107_1098843_82_561 | 158 |
| 901 | 3300048911 | Ga0496108_0060709 | Ga0496108_0060709_2028_2507 | 158 |
| 902 | 3300048913 | Ga0496110_1252080 | Ga0496110_1252080_85_564 | 158 |
| 903 | 3300048914 | Ga0496111_0680391 | Ga0496111_0680391_186_665 | 158 |
| 904 | 3300048915 | Ga0496112_0049766 | Ga0496112_0049766_507_986 | 158 |
| 905 | 3300048918 | Ga0496115_0150310 | Ga0496115_0150310_485_964 | 158 |
| 906 | 3300048918 | Ga0496115_0281240 | Ga0496115_0281240_44_520 | 158 |
| 907 | 3300048918 | Ga0496115_0439175 | Ga0496115_0439175_391_870 | 158 |
| 908 | 3300048919 | Ga0496116_0159299 | Ga0496116_0159299_150_629 | 158 |
| 909 | 3300048920 | Ga0496117_0060867 | Ga0496117_0060867_1122_1601 | 158 |
| 910 | 3300048920 | Ga0496117_0277004 | Ga0496117_0277004_294_773 | 158 |
| 911 | 3300048921 | Ga0496118_0316502 | Ga0496118_0316502_128_604 | 158 |
| 912 | 3300048921 | Ga0496118_0410405 | Ga0496118_0410405_107_586 | 158 |
| 913 | 3300048922 | Ga0496119_0147277 | Ga0496119_0147277_548_1027 | 158 |
| 914 | 3300048924 | Ga0496121_0000278 | Ga0496121_0000278_48593_49072 | 158 |
| 915 | 3300048924 | Ga0496121_0035287 | Ga0496121_0035287_193_672 | 158 |
| 916 | 3300048924 | Ga0496121_0071562 | Ga0496121_0071562_620_1099 | 158 |
| 917 | 3300048924 | Ga0496121_0125511 | Ga0496121_0125511_613_1089 | 158 |
| 918 | 3300048924 | Ga0496121_0518333 | Ga0496121_0518333_54_530 | 158 |
| 919 | 3300048927 | Ga0496124_0248160 | Ga0496124_0248160_256_735 | 158 |
| 920 | 3300048929 | Ga0496126_0034975 | Ga0496126_0034975_3386_3865 | 158 |
| 921 | 3300048929 | Ga0496126_0162691 | Ga0496126_0162691_1030_1509 | 158 |
| 922 | 3300049570 | Ga0501033_0597713 | Ga0501033_0597713_153_632 | 158 |
| 923 | 3300049581 | Ga0501047_0041970 | Ga0501047_0041970_1976_2455 | 158 |
| 924 | 3300049582 | Ga0501048_0522722 | Ga0501048_0522722_142_621 | 158 |
| 925 | 3300049583 | Ga0501067_0050483 | Ga0501067_0050483_1448_1927 | 158 |
| 926 | 3300049586 | Ga0501070_0248474 | Ga0501070_0248474_276_755 | 158 |
| 927 | 3300049742 | Ga0501080_0128602 | Ga0501080_0128602_691_1170 | 158 |
| 928 | 3300049823 | Ga0501044_0083186 | Ga0501044_0083186_2509_2988 | 158 |
| 929 | 3300050489 | nmdc:mga03683_210539_c1 | nmdc:mga03683_210539_c1_144_623 | 158 |
| 930 | 3300050490 | nmdc:mga03n38_14558_c1 | nmdc:mga03n38_14558_c1_662_1141 | 158 |
| 931 | 3300050494 | nmdc:mga06z11_11045_c1 | nmdc:mga06z11_11045_c1_1451_1930 | 158 |
| 932 | 3300050494 | nmdc:mga06z11_583410_c1 | nmdc:mga06z11_583410_c1_117_596 | 158 |
| 933 | 3300050495 | nmdc:mga04h51_29235_c1 | nmdc:mga04h51_29235_c1_330_809 | 158 |
| 934 | 3300050496 | nmdc:mga07m45_13114_c1 | nmdc:mga07m45_13114_c1_1679_2158 | 158 |
| 935 | 3300053077 | Ga0495601_0017256 | Ga0495601_0017256_358_837 | 158 |
| 936 | 3300053077 | Ga0495601_0136693 | Ga0495601_0136693_122_601 | 158 |
| 937 | 3300053077 | Ga0495601_0343333 | Ga0495601_0343333_443_922 | 158 |
| 938 | 3300053079 | Ga0500610_0041583 | Ga0500610_0041583_1794_2273 | 158 |
| 939 | 3300053084 | Ga0495595_0219991 | Ga0495595_0219991_359_838 | 158 |
| 940 | 3300053085 | Ga0495619_0236354 | Ga0495619_0236354_717_1196 | 158 |
| 941 | 3300053085 | Ga0495619_0241630 | Ga0495619_0241630_532_1011 | 158 |
| 942 | 3300053087 | Ga0500643_000112 | Ga0500643_000112_9238_9717 | 158 |
| 943 | 3300053088 | Ga0500644_0362520 | Ga0500644_0362520_139_618 | 158 |
| 944 | 3300053092 | Ga0500583_0166310 | Ga0500583_0166310_236_715 | 158 |
| 945 | 3300053093 | Ga0500651_0033603 | Ga0500651_0033603_594_1073 | 158 |
| 946 | 3300053093 | Ga0500651_0258387 | Ga0500651_0258387_496_975 | 158 |
| 947 | 3300053094 | Ga0500566_0011791 | Ga0500566_0011791_798_1277 | 158 |
| 948 | 3300053095 | Ga0500640_009445 | Ga0500640_009445_1079_1558 | 158 |
| 949 | 3300053096 | Ga0500641_0060146 | Ga0500641_0060146_343_822 | 158 |
| 950 | 3300053098 | Ga0500650_0192335 | Ga0500650_0192335_202_681 | 158 |
| 951 | 3300053101 | Ga0500553_133854 | Ga0500553_133854_46_525 | 158 |
| 952 | 3300053103 | Ga0500555_004419 | Ga0500555_004419_222_701 | 158 |
| 953 | 3300053109 | Ga0500569_051549 | Ga0500569_051549_53_532 | 158 |
| 954 | 3300053109 | Ga0500569_085728 | Ga0500569_085728_330_809 | 158 |
| 955 | 3300053111 | Ga0500572_072413 | Ga0500572_072413_572_1051 | 158 |
| 956 | 3300053116 | Ga0500592_014816 | Ga0500592_014816_554_1033 | 158 |
| 957 | 3300053116 | Ga0500592_033615 | Ga0500592_033615_144_623 | 158 |
| 958 | 3300053118 | Ga0500594_0253250 | Ga0500594_0253250_53_532 | 158 |
| 959 | 3300053119 | Ga0500595_006803 | Ga0500595_006803_1944_2423 | 158 |
| 960 | 3300053119 | Ga0500595_014698 | Ga0500595_014698_975_1454 | 158 |
| 961 | 3300053119 | Ga0500595_027760 | Ga0500595_027760_528_1007 | 158 |
| 962 | 3300053121 | Ga0500607_085637 | Ga0500607_085637_976_1455 | 158 |
| 963 | 3300053123 | Ga0500614_108692 | Ga0500614_108692_243_722 | 158 |
| 964 | 3300053123 | Ga0500614_193217 | Ga0500614_193217_115_594 | 158 |
| 965 | 3300053130 | Ga0500642_0000362 | Ga0500642_0000362_51_530 | 158 |
| 966 | 3300053130 | Ga0500642_0000641 | Ga0500642_0000641_85_564 | 158 |
| 967 | 3300053130 | Ga0500642_0066658 | Ga0500642_0066658_1012_1491 | 158 |
| 968 | 3300053134 | Ga0500658_0381921 | Ga0500658_0381921_24_503 | 158 |
| 969 | 3300053139 | Ga0500568_0067550 | Ga0500568_0067550_268_747 | 158 |
| 970 | 3300053139 | Ga0500568_0129529 | Ga0500568_0129529_437_916 | 158 |
| 971 | 3300053142 | Ga0500577_0098647 | Ga0500577_0098647_554_1033 | 158 |
| 972 | 3300053146 | Ga0500588_0101524 | Ga0500588_0101524_331_810 | 158 |
| 973 | 3300053148 | Ga0500590_223751 | Ga0500590_223751_11_490 | 158 |
| 974 | 3300053151 | Ga0500604_0089581 | Ga0500604_0089581_434_913 | 158 |
| 975 | 3300053153 | Ga0500616_0139503 | Ga0500616_0139503_281_760 | 158 |
| 976 | 3300053156 | Ga0500622_0229091 | Ga0500622_0229091_12_491 | 158 |
| 977 | 3300053158 | Ga0500627_0203270 | Ga0500627_0203270_352_831 | 158 |
| 978 | 3300053162 | Ga0500638_222988 | Ga0500638_222988_52_531 | 158 |
| 979 | 3300053178 | Ga0500637_0186572 | Ga0500637_0186572_442_921 | 158 |
| 980 | 3300053724 | Ga0500570_106621 | Ga0500570_106621_449_928 | 158 |
| 981 | 3300053731 | Ga0500609_006652 | Ga0500609_006652_940_1419 | 158 |
| 982 | 3300059503 | Ga0587080_148527 | Ga0587080_148527_33_512 | 158 |
| 983 | 3300059505 | Ga0587083_0147968 | Ga0587083_0147968_115_594 | 158 |
| 984 | 3300059641 | Ga0587068_101443 | Ga0587068_101443_91_570 | 158 |
| 985 | 3300059643 | Ga0587072_123946 | Ga0587072_123946_64_543 | 158 |
| 986 | 3300059644 | Ga0587075_040357 | Ga0587075_040357_34_513 | 158 |
| 987 | 3300059645 | Ga0587076_075966 | Ga0587076_075966_204_683 | 158 |
| 988 | 3300060344 | Ga0587071_046432 | Ga0587071_046432_376_855 | 158 |
| 989 | 3300061719 | Ga0466962_0031673 | Ga0466962_0031673_718_1197 | 158 |
| 990 | 3300061719 | Ga0466962_0128009 | Ga0466962_0128009_671_1150 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sfn-assembly1.cif.gz_A | crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin | 0.8715 | 7 | 158 |
| 7sfn-assembly1.cif.gz_A | crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin | 0.8551 | 7 | 158 |
| 7sfn-assembly1.cif.gz_B | crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin | 0.836 | 1 | 158 |
| 7sfn-assembly1.cif.gz_B | crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin | 0.831 | 1 | 158 |
| 7sfp-assembly1.cif.gz_A | crystal structure of osso, a spirocyclase involved in the biosynthesis of ossamycin | 0.803 | 7 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q556I7_1_158_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.814 | 11 | 157 | 2.40.128.20 |
| af_A0A2C9C2Z6_71_253_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.7961 | 11 | 157 | 2.40.128.20 |
| af_Q5N900_107_401_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7919 | 108 | 158 | 3.40.50.150 |
| af_Q22857_66_227_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.7896 | 9 | 158 | 2.40.128.20 |
| 3wjeB00 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.7882 | 7 | 157 | 2.40.128.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537XP13-F1-model_v4 | DUF1579 domain-containing protein | 0.9873 | 33 | 158 |
|
| AF-A0A7Y4GZB7-F1-model_v4 | DUF1579 domain-containing protein | 0.9818 | 1 | 158 |
|
| AF-A0A534NU50-F1-model_v4 | DUF1579 domain-containing protein | 0.9817 | 5 | 157 |
|
| AF-A0A431RL37-F1-model_v4 | deleted | 0.9801 | 1 | 140 |
|
| AF-A0A537XP13-F1-model_v4 | DUF1579 domain-containing protein | 0.9796 | 33 | 158 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar