F487624

General Info

Members Datasets Scaffolds Average Seq Length
990 466 957 158

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016557553|8016565829
Length 171
Sequence HLAASSPLPEHARLAAFAGEWNGEEVVFPSRWTEGGSATSHVVAHMDLNGFYLIQDSVQTRDGKQVFATHGIFTFDREDRTYKLFWYDSLGYTPPSPASGGWSREDPDAGARLAPRQCAPRLRNHRRRFLFVEDPVLAGRGRLGRRPHRRLPPHPLTSHTLVSRKQTSCPS

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
8 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
9 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
10 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
11 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
12 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
13 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
14 2904699407
15 2906610324
16 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
17 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
18 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
19 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
20 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
21 2922425934
22 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
23 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
24 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
25 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
26 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
27 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
223 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
228 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
229 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
237 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
238 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
239 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
240 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
248 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
249 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
250 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
251 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
254 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
271 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
272 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
273 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
274 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
275 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
276 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
277 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
278 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
279 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
280 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
281 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
282 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
283 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
296 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
303 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
304 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
307 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
308 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
309 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
314 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
315 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
316 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
317 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
318 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
319 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
320 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
321 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
322 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
332 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
337 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
338 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
339 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
340 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
341 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
344 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
345 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
346 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
347 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
348 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
352 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
353 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
354 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
355 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
356 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
359 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
360 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
381 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
385 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
389 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
401 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
402 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
405 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
406 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
407 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
408 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
409 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
410 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
411 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
412 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
413 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
414 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
415 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
416 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
417 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
418 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
419 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
420 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
421 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
422 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
423 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
424 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
425 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
426 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
427 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
428 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
429 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
430 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
431 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
432 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
435 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
436 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
437 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
438 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
439 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
442 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
443 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
444 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
445 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
446 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
447 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
448 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
449 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
450 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
451 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
452 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
460 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
461 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
462 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
463 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
464 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
465 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
466 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 1.01
Isolates 3.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.63
Nodule 2.42
Rhizoplane 5.96
Rhizosphere 72.53
Stem 0
Stem Tuber 0
Unclassified 6.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1004955 3300003214 Bacteria 2682
2 JGI25153J46596_10030586 3300003215 Bacteria 1829
3 JGI25404J52841_10019296 3300003659 Bacteria 1477
4 JGI25404J52841_10035351 3300003659 Bacteria 1064
5 Ga0055539_1020748 3300003752 Bacteria 783
6 Ga0055542_1014646 3300003762 Bacteria 1281
7 Ga0055543_1011352 3300004625 Bacteria 1827
8 Ga0065704_10142844 3300005289 Bacteria 1501
9 Ga0065712_10228589 3300005290 Bacteria 1003
10 Ga0065707_10024212 3300005295 Bacteria 1755
11 Ga0070676_10229590 3300005328 Bacteria 1230
12 Ga0070676_10660950 3300005328 Bacteria 759
13 Ga0070683_100109161 3300005329 Bacteria 2610
14 Ga0070683_100167461 3300005329 Bacteria 2085
15 Ga0070683_100270090 3300005329 Bacteria 1618
16 Ga0070683_100277403 3300005329 Bacteria 1595
17 Ga0070670_100746824 3300005331 Bacteria 881
18 Ga0068869_100451568 3300005334 Bacteria 1065
19 Ga0068869_101189775 3300005334 Bacteria 669
20 Ga0070666_10947092 3300005335 Bacteria 637
21 Ga0070680_100463354 3300005336 Bacteria 1083
22 Ga0070680_100852515 3300005336 Bacteria 785
23 Ga0070682_100140690 3300005337 Bacteria 1645
24 Ga0070682_100954204 3300005337 Bacteria 708
25 Ga0068868_100059956 3300005338 Bacteria 3011
26 Ga0068868_101012133 3300005338 Bacteria 761
27 Ga0068868_101458966 3300005338 Bacteria 639
28 Ga0070660_100501648 3300005339 Bacteria 1010
29 Ga0070691_10205067 3300005341 Bacteria 1038
30 Ga0070661_100466437 3300005344 Bacteria 1006
31 Ga0070661_100739494 3300005344 Bacteria 804
32 Ga0070661_101243556 3300005344 Bacteria 623
33 Ga0070668_100216872 3300005347 Bacteria 1576
34 Ga0070668_100424000 3300005347 Bacteria 1139
35 Ga0070668_100776729 3300005347 Bacteria 849
36 Ga0070668_102037548 3300005347 Bacteria 529
37 Ga0070668_102037549 3300005347 Bacteria 529
38 Ga0070669_100609029 3300005353 Bacteria 916
39 Ga0070671_101076359 3300005355 Bacteria 706
40 Ga0070674_101290983 3300005356 Bacteria 651
41 Ga0070673_100230498 3300005364 Bacteria 1606
42 Ga0070673_100760705 3300005364 Bacteria 892
43 Ga0070688_100208310 3300005365 Bacteria 1371
44 Ga0070688_100588175 3300005365 Bacteria 850
45 Ga0070659_101317869 3300005366 Bacteria 640
46 Ga0070667_100271251 3300005367 Bacteria 1521
47 Ga0070667_101493029 3300005367 Bacteria 635
48 Ga0070667_101683202 3300005367 Bacteria 596
49 Ga0070703_10299640 3300005406 Bacteria 670
50 Ga0070709_10194830 3300005434 Bacteria 1432
51 Ga0070709_10357658 3300005434 Bacteria 1080
52 Ga0070709_10420172 3300005434 Bacteria 1002
53 Ga0070709_10833475 3300005434 Bacteria 726
54 Ga0070709_10905858 3300005434 Bacteria 697
55 Ga0070714_100021967 3300005435 Bacteria 5227
56 Ga0070714_100431950 3300005435 Bacteria 1249
57 Ga0070714_100930256 3300005435 Bacteria 844
58 Ga0070713_100029455 3300005436 Bacteria 4349
59 Ga0070713_100080502 3300005436 Bacteria 2778
60 Ga0070713_100156027 3300005436 Bacteria 2034
61 Ga0070713_100330033 3300005436 Bacteria 1411
62 Ga0070713_100737828 3300005436 Bacteria 942
63 Ga0070713_101283380 3300005436 Bacteria 709
64 Ga0070710_10041326 3300005437 Bacteria 2546
65 Ga0070710_10055278 3300005437 Bacteria 2243
66 Ga0070710_10297910 3300005437 Bacteria 1052
67 Ga0070710_10336269 3300005437 Bacteria 995
68 Ga0070710_10577282 3300005437 Bacteria 780
69 Ga0070710_10611687 3300005437 Bacteria 760
70 Ga0070710_10754729 3300005437 Bacteria 691
71 Ga0070701_10194738 3300005438 Bacteria 1194
72 Ga0070711_100005553 3300005439 Bacteria 7552
73 Ga0070711_100194344 3300005439 Bacteria 1561
74 Ga0070711_100268474 3300005439 Bacteria 1345
75 Ga0070711_100315259 3300005439 Bacteria 1248
76 Ga0070700_101071426 3300005441 Bacteria 666
77 Ga0070700_101158779 3300005441 Bacteria 643
78 Ga0070700_101302622 3300005441 Bacteria 611
79 Ga0070694_100479641 3300005444 Bacteria 986
80 Ga0070663_100718471 3300005455 Bacteria 850
81 Ga0070663_100861160 3300005455 Bacteria 780
82 Ga0070663_101271406 3300005455 Bacteria 648
83 Ga0070678_100096322 3300005456 Bacteria 2282
84 Ga0070678_100363674 3300005456 Bacteria 1247
85 Ga0070678_100584240 3300005456 Bacteria 995
86 Ga0070662_100289078 3300005457 Bacteria 1328
87 Ga0070681_10017254 3300005458 Bacteria 7216
88 Ga0070681_10037401 3300005458 Bacteria 4871
89 Ga0070681_10075073 3300005458 Bacteria 3341
90 Ga0070681_10436888 3300005458 Bacteria 1221
91 Ga0068867_100630108 3300005459 Bacteria 938
92 Ga0068867_100633022 3300005459 Bacteria 936
93 Ga0070685_10466238 3300005466 Bacteria 888
94 Ga0070706_100234156 3300005467 Bacteria 1714
95 Ga0070706_100317287 3300005467 Bacteria 1454
96 Ga0070706_100574081 3300005467 Bacteria 1048
97 Ga0070706_100600472 3300005467 Bacteria 1023
98 Ga0070698_100059290 3300005471 Bacteria 3866
99 Ga0070698_100981492 3300005471 Bacteria 791
100 Ga0070699_100681478 3300005518 Bacteria 939
101 Ga0070699_100742484 3300005518 Bacteria 897
102 Ga0070679_100015647 3300005530 Bacteria 7292
103 Ga0070679_100163330 3300005530 Bacteria 2201
104 Ga0070684_100355097 3300005535 Bacteria 1349
105 Ga0070684_100395167 3300005535 Bacteria 1274
106 Ga0070684_100692908 3300005535 Bacteria 950
107 Ga0070684_100884156 3300005535 Bacteria 837
108 Ga0070697_100201326 3300005536 Bacteria 1693
109 Ga0068853_100390609 3300005539 Bacteria 1301
110 Ga0068853_100442522 3300005539 Bacteria 1221
111 Ga0068853_100484951 3300005539 Bacteria 1166
112 Ga0068853_100695337 3300005539 Bacteria 970
113 Ga0070672_100348785 3300005543 Bacteria 1261
114 Ga0070693_100040796 3300005547 Bacteria 2608
115 Ga0070693_100075050 3300005547 Bacteria 2001
116 Ga0070693_100395572 3300005547 Bacteria 957
117 Ga0070665_100206184 3300005548 Bacteria 1966
118 Ga0070665_100377590 3300005548 Bacteria 1425
119 Ga0070665_100519344 3300005548 Bacteria 1202
120 Ga0070665_101138158 3300005548 Bacteria 792
121 Ga0068855_100444992 3300005563 Bacteria 1414
122 Ga0068855_100686734 3300005563 Bacteria 1097
123 Ga0068855_101263499 3300005563 Bacteria 765
124 Ga0070664_101140914 3300005564 Bacteria 735
125 Ga0070664_101838180 3300005564 Bacteria 575
126 Ga0068857_100183974 3300005577 Bacteria 1902
127 Ga0068857_100311302 3300005577 Bacteria 1453
128 Ga0068857_100397294 3300005577 Bacteria 1282
129 Ga0068854_100272559 3300005578 Bacteria 1359
130 Ga0068854_100442540 3300005578 Bacteria 1084
131 Ga0068854_100501576 3300005578 Bacteria 1022
132 Ga0068856_100000883 3300005614 Bacteria 32112
133 Ga0068856_100107320 3300005614 Bacteria 2787
134 Ga0068856_100491914 3300005614 Bacteria 1247
135 Ga0068856_101140658 3300005614 Bacteria 796
136 Ga0068856_101473787 3300005614 Bacteria 695
137 Ga0068856_101840282 3300005614 Bacteria 617
138 Ga0068852_100067130 3300005616 Bacteria 3135
139 Ga0068852_100775901 3300005616 Bacteria 972
140 Ga0068852_100780793 3300005616 Bacteria 969
141 Ga0068852_101142168 3300005616 Bacteria 800
142 Ga0068852_101700076 3300005616 Bacteria 653
143 Ga0068859_100748173 3300005617 Bacteria 1066
144 Ga0068859_101012421 3300005617 Bacteria 912
145 Ga0068859_101200521 3300005617 Bacteria 835
146 Ga0068864_100123810 3300005618 Bacteria 2314
147 Ga0068864_100314239 3300005618 Bacteria 1470
148 Ga0068864_100339767 3300005618 Bacteria 1415
149 Ga0068866_10472137 3300005718 Bacteria 825
150 Ga0068861_100413798 3300005719 Bacteria 1200
151 Ga0068861_100541193 3300005719 Bacteria 1059
152 Ga0068870_10062707 3300005840 Bacteria 2003
153 Ga0068870_10415719 3300005840 Bacteria 879
154 Ga0068870_10419108 3300005840 Bacteria 876
155 Ga0068863_100488620 3300005841 Bacteria 1211
156 Ga0068863_100531991 3300005841 Bacteria 1159
157 Ga0068863_100554843 3300005841 Bacteria 1134
158 Ga0068860_100247682 3300005843 Bacteria 1734
159 Ga0068860_100952627 3300005843 Bacteria 875
160 Ga0068860_100960866 3300005843 Bacteria 872
161 Ga0068862_100148304 3300005844 Bacteria 2086
162 Ga0068862_100358612 3300005844 Bacteria 1354
163 Ga0068862_100632552 3300005844 Bacteria 1030
164 Ga0081540_1020688 3300005983 Bacteria 3947
165 Ga0081540_1020881 3300005983 Bacteria 3922
166 Ga0081540_1035114 3300005983 Bacteria 2693
167 Ga0081540_1055889 3300005983 Bacteria 1920
168 Ga0081540_1118995 3300005983 Bacteria 1100
169 Ga0070717_10123888 3300006028 Bacteria 2217
170 Ga0070717_10242931 3300006028 Bacteria 1588
171 Ga0070717_10549537 3300006028 Bacteria 1046
172 Ga0075365_10247886 3300006038 Bacteria 1251
173 Ga0075365_10344911 3300006038 Bacteria 1049
174 Ga0075365_10434159 3300006038 Bacteria 927
175 Ga0075365_10583859 3300006038 Bacteria 790
176 Ga0075368_10022422 3300006042 Bacteria 2404
177 Ga0075368_10071058 3300006042 Bacteria 1406
178 Ga0075363_100065058 3300006048 Bacteria 1971
179 Ga0075363_100247733 3300006048 Bacteria 1025
180 Ga0075363_100253033 3300006048 Bacteria 1015
181 Ga0075363_100285613 3300006048 Bacteria 955
182 Ga0075363_100768625 3300006048 Bacteria 584
183 Ga0075364_10102130 3300006051 Bacteria 1909
184 Ga0070715_10104876 3300006163 Bacteria 1324
185 Ga0070715_10194769 3300006163 Bacteria 1026
186 Ga0070715_10256318 3300006163 Bacteria 917
187 Ga0070716_100094913 3300006173 Bacteria 1814
188 Ga0070716_101320005 3300006173 Bacteria 584
189 Ga0070712_100038086 3300006175 Bacteria 3283
190 Ga0070712_100111114 3300006175 Bacteria 2045
191 Ga0070712_100314022 3300006175 Bacteria 1272
192 Ga0075367_10022547 3300006178 Bacteria 3533
193 Ga0075367_10112753 3300006178 Bacteria 1670
194 Ga0075367_10288413 3300006178 Bacteria 1032
195 Ga0075366_10278186 3300006195 Bacteria 1023
196 Ga0075366_10397943 3300006195 Bacteria 848
197 Ga0097621_100139391 3300006237 Bacteria 2071
198 Ga0097621_100212164 3300006237 Bacteria 1684
199 Ga0097621_100927645 3300006237 Bacteria 812
200 Ga0097621_101706938 3300006237 Bacteria 600
201 Ga0075370_10024394 3300006353 Bacteria 3340
202 Ga0075370_10093373 3300006353 Bacteria 1737
203 Ga0075370_10178205 3300006353 Bacteria 1250
204 Ga0068871_100126029 3300006358 Bacteria 2167
205 Ga0068871_100899132 3300006358 Bacteria 820
206 Ga0068871_101274140 3300006358 Bacteria 691
207 Ga0075428_100135007 3300006844 Bacteria 2683
208 Ga0075434_100287226 3300006871 Bacteria 1665
209 Ga0068865_100289192 3300006881 Bacteria 1308
210 Ga0068865_100708827 3300006881 Bacteria 861
211 Ga0097620_100748205 3300006931 Bacteria 1066
212 Ga0097620_101012391 3300006931 Bacteria 912
213 Ga0097620_101200522 3300006931 Bacteria 835
214 Ga0075435_100454561 3300007076 Bacteria 1105
215 Ga0099794_10174147 3300007265 Bacteria 1097
216 Ga0099794_10321430 3300007265 Bacteria 803
217 Ga0099795_10066779 3300007788 Bacteria 1348
218 Ga0105240_10551341 3300009093 Bacteria 1275
219 Ga0105240_10749887 3300009093 Bacteria 1061
220 Ga0105240_10822471 3300009093 Bacteria 1005
221 Ga0105240_11711774 3300009093 Bacteria 656
222 Ga0111539_10530373 3300009094 Bacteria 1372
223 Ga0111539_10932697 3300009094 Bacteria 1010
224 Ga0105245_10405664 3300009098 Bacteria 1363
225 Ga0105245_10645803 3300009098 Bacteria 1088
226 Ga0105247_10130453 3300009101 Bacteria 1638
227 Ga0105243_10393668 3300009148 Bacteria 1285
228 Ga0105243_10507900 3300009148 Bacteria 1144
229 Ga0105241_10153603 3300009174 Bacteria 1885
230 Ga0105241_10441133 3300009174 Bacteria 1150
231 Ga0105241_10503326 3300009174 Bacteria 1080
232 Ga0105241_10691131 3300009174 Bacteria 930
233 Ga0105242_10771784 3300009176 Bacteria 948
234 Ga0105242_10834310 3300009176 Bacteria 916
235 Ga0105248_10410419 3300009177 Bacteria 1525
236 Ga0105237_10186788 3300009545 Bacteria 2072
237 Ga0105237_10391897 3300009545 Bacteria 1394
238 Ga0105237_11256989 3300009545 Bacteria 747
239 Ga0105237_11267388 3300009545 Bacteria 744
240 Ga0105237_11307060 3300009545 Bacteria 732
241 Ga0105237_11310150 3300009545 Bacteria 731
242 Ga0105238_10122580 3300009551 Bacteria 2579
243 Ga0105238_10153518 3300009551 Bacteria 2277
244 Ga0105238_10589215 3300009551 Bacteria 1119
245 Ga0105238_10815971 3300009551 Bacteria 949
246 Ga0105238_10899903 3300009551 Bacteria 903
247 Ga0105238_10916090 3300009551 Bacteria 895
248 Ga0105238_11172820 3300009551 Bacteria 792
249 Ga0105238_11355898 3300009551 Bacteria 738
250 Ga0105238_11573732 3300009551 Bacteria 687
251 Ga0105249_11152751 3300009553 Bacteria 846
252 Ga0105249_11307958 3300009553 Bacteria 796
253 Ga0099796_10081558 3300010159 Bacteria 1187
254 Ga0099796_10235288 3300010159 Bacteria 755
255 Ga0105239_10325851 3300010375 Bacteria 1733
256 Ga0105239_10526109 3300010375 Bacteria 1346
257 Ga0105239_11237394 3300010375 Bacteria 861
258 Ga0105239_11992100 3300010375 Bacteria 674
259 Ga0105246_10019273 3300011119 Bacteria 4357
260 Ga0105246_10634819 3300011119 Bacteria 927
261 Ga0105246_11279383 3300011119 Bacteria 679
262 Ga0157373_10675974 3300013100 Bacteria 755
263 Ga0157370_10137726 3300013104 Bacteria 2274
264 Ga0157369_10021333 3300013105 Bacteria 7245
265 Ga0157369_10401604 3300013105 Bacteria 1422
266 Ga0157374_10054089 3300013296 Bacteria 3744
267 Ga0157374_10353683 3300013296 Bacteria 1460
268 Ga0157374_10498604 3300013296 Bacteria 1222
269 Ga0157374_11026557 3300013296 Bacteria 844
270 Ga0157378_11611005 3300013297 Bacteria 695
271 Ga0163162_10045228 3300013306 Bacteria 4411
272 Ga0163162_11000743 3300013306 Bacteria 945
273 Ga0163162_11590985 3300013306 Bacteria 745
274 Ga0163162_11937813 3300013306 Bacteria 675
275 Ga0163162_12349777 3300013306 Bacteria 613
276 Ga0163162_12826517 3300013306 Bacteria 559
277 Ga0157372_10201797 3300013307 Bacteria 2304
278 Ga0157372_10579615 3300013307 Bacteria 1308
279 Ga0157372_10940107 3300013307 Bacteria 1002
280 Ga0157375_10624930 3300013308 Bacteria 1235
281 Ga0157375_10691138 3300013308 Bacteria 1174
282 Ga0157375_10747294 3300013308 Bacteria 1130
283 Ga0163163_10127555 3300014325 Bacteria 2583
284 Ga0163163_10370574 3300014325 Bacteria 1489
285 Ga0163163_11096593 3300014325 Bacteria 859
286 Ga0163163_11391692 3300014325 Bacteria 763
287 Ga0163163_12210602 3300014325 Bacteria 609
288 Ga0157380_10341204 3300014326 Bacteria 1397
289 Ga0157380_10599164 3300014326 Bacteria 1090
290 Ga0157380_12204986 3300014326 Bacteria 615
291 Ga0157379_10209640 3300014968 Bacteria 1764
292 Ga0157379_10568872 3300014968 Bacteria 1056
293 Ga0157376_10620496 3300014969 Bacteria 1078
294 Ga0157376_10804516 3300014969 Bacteria 953
295 Ga0157376_10912082 3300014969 Bacteria 897
296 Ga0182007_10241593 3300015262 Bacteria 645
297 Ga0163161_10486050 3300017792 Bacteria 1003
298 Ga0163161_10584233 3300017792 Bacteria 919
299 Ga0163161_11136485 3300017792 Bacteria 673
300 Ga0206356_10348709 3300020070 Bacteria 608
301 Ga0206354_10763753 3300020081 Bacteria 726
302 Ga0213876_10169534 3300021384 Bacteria 1161
303 Ga0213876_10325057 3300021384 Bacteria 818
304 Ga0213876_10467307 3300021384 Bacteria 671
305 Ga0213875_10150372 3300021388 Bacteria 1091
306 Ga0224712_10096101 3300022467 Bacteria 1249
307 Ga0209563_101315 3300025230 Bacteria 6776
308 Ga0209677_100543 3300025253 Bacteria 21018
309 Ga0209677_100722 3300025253 Bacteria 16832
310 Ga0209148_1000295 3300025254 Bacteria 73660
311 Ga0209233_1002578 3300025261 Bacteria 6591
312 Ga0209233_1006623 3300025261 Bacteria 3719
313 Ga0209455_1003238 3300025272 Bacteria 5870
314 Ga0209455_1004716 3300025272 Bacteria 4383
315 Ga0209455_1021696 3300025272 Bacteria 1240
316 Ga0209758_1001900 3300025297 Bacteria 22801
317 Ga0209758_1013412 3300025297 Bacteria 4470
318 Ga0209256_1052131 3300025299 Bacteria 984
319 Ga0207697_10022598 3300025315 Bacteria 2576
320 Ga0207697_10044238 3300025315 Bacteria 1832
321 Ga0207697_10227280 3300025315 Bacteria 824
322 Ga0207697_10228741 3300025315 Bacteria 821
323 Ga0207653_10076948 3300025885 Bacteria 1149
324 Ga0207692_10042210 3300025898 Bacteria 2263
325 Ga0207692_10152647 3300025898 Bacteria 1324
326 Ga0207692_10250021 3300025898 Bacteria 1062
327 Ga0207692_10263072 3300025898 Bacteria 1038
328 Ga0207692_10340988 3300025898 Bacteria 922
329 Ga0207692_10616693 3300025898 Bacteria 699
330 Ga0207642_10097318 3300025899 Bacteria 1469
331 Ga0207642_10859819 3300025899 Bacteria 579
332 Ga0207710_10094956 3300025900 Bacteria 1400
333 Ga0207688_10151712 3300025901 Bacteria 1369
334 Ga0207680_10578662 3300025903 Bacteria 802
335 Ga0207647_10113451 3300025904 Bacteria 1602
336 Ga0207699_10011800 3300025906 Bacteria 4427
337 Ga0207699_10267408 3300025906 Bacteria 1184
338 Ga0207699_10504622 3300025906 Bacteria 873
339 Ga0207699_10586267 3300025906 Bacteria 811
340 Ga0207643_10135707 3300025908 Bacteria 1467
341 Ga0207643_10252516 3300025908 Bacteria 1087
342 Ga0207684_10366162 3300025910 Bacteria 1240
343 Ga0207654_10096920 3300025911 Bacteria 1810
344 Ga0207654_10160018 3300025911 Bacteria 1454
345 Ga0207654_10224647 3300025911 Bacteria 1247
346 Ga0207707_10008183 3300025912 Bacteria 9074
347 Ga0207707_10369948 3300025912 Bacteria 1233
348 Ga0207707_10477221 3300025912 Bacteria 1065
349 Ga0207707_10669777 3300025912 Bacteria 873
350 Ga0207695_10071334 3300025913 Bacteria 3548
351 Ga0207671_10508006 3300025914 Bacteria 961
352 Ga0207671_10595909 3300025914 Bacteria 881
353 Ga0207693_10045163 3300025915 Bacteria 3461
354 Ga0207693_10055491 3300025915 Bacteria 3108
355 Ga0207693_10263120 3300025915 Bacteria 1352
356 Ga0207663_10002736 3300025916 Bacteria 8503
357 Ga0207663_10409162 3300025916 Bacteria 1039
358 Ga0207662_10335633 3300025918 Bacteria 1012
359 Ga0207657_10173641 3300025919 Bacteria 1745
360 Ga0207657_10907579 3300025919 Bacteria 679
361 Ga0207649_10201576 3300025920 Bacteria 1406
362 Ga0207649_10355147 3300025920 Bacteria 1086
363 Ga0207649_10503760 3300025920 Bacteria 921
364 Ga0207652_10129770 3300025921 Bacteria 2247
365 Ga0207652_10164815 3300025921 Bacteria 1987
366 Ga0207652_10305259 3300025921 Bacteria 1436
367 Ga0207652_10351820 3300025921 Bacteria 1330
368 Ga0207652_10610512 3300025921 Bacteria 978
369 Ga0207652_11500576 3300025921 Bacteria 578
370 Ga0207646_10369425 3300025922 Bacteria 1296
371 Ga0207694_10206275 3300025924 Bacteria 1600
372 Ga0207694_10266828 3300025924 Bacteria 1403
373 Ga0207694_11040842 3300025924 Bacteria 693
374 Ga0207694_11235147 3300025924 Bacteria 632
375 Ga0207650_10625123 3300025925 Bacteria 907
376 Ga0207687_10305000 3300025927 Bacteria 1284
377 Ga0207687_10593584 3300025927 Bacteria 933
378 Ga0207700_10010462 3300025928 Bacteria 5857
379 Ga0207700_10012790 3300025928 Bacteria 5427
380 Ga0207700_10029757 3300025928 Bacteria 3858
381 Ga0207700_10378915 3300025928 Bacteria 1237
382 Ga0207700_10400753 3300025928 Bacteria 1202
383 Ga0207700_10684841 3300025928 Bacteria 915
384 Ga0207700_11148398 3300025928 Bacteria 694
385 Ga0207664_10254380 3300025929 Bacteria 1534
386 Ga0207664_10340402 3300025929 Bacteria 1326
387 Ga0207644_10179336 3300025931 Bacteria 1659
388 Ga0207644_10626714 3300025931 Bacteria 894
389 Ga0207706_10130949 3300025933 Bacteria 2206
390 Ga0207706_10326055 3300025933 Bacteria 1336
391 Ga0207709_10465780 3300025935 Bacteria 980
392 Ga0207709_11359072 3300025935 Bacteria 588
393 Ga0207670_10360927 3300025936 Bacteria 1153
394 Ga0207669_10207027 3300025937 Bacteria 1429
395 Ga0207669_11403328 3300025937 Bacteria 595
396 Ga0207704_10166691 3300025938 Bacteria 1574
397 Ga0207704_10708908 3300025938 Bacteria 834
398 Ga0207691_10508924 3300025940 Bacteria 1022
399 Ga0207691_10844799 3300025940 Bacteria 768
400 Ga0207711_10140227 3300025941 Bacteria 2174
401 Ga0207711_10300286 3300025941 Bacteria 1481
402 Ga0207689_10975978 3300025942 Bacteria 715
403 Ga0207661_10000878 3300025944 Bacteria 19794
404 Ga0207661_10062380 3300025944 Bacteria 3015
405 Ga0207661_10850753 3300025944 Bacteria 840
406 Ga0207661_11273548 3300025944 Bacteria 676
407 Ga0207679_10356886 3300025945 Bacteria 1276
408 Ga0207667_10105980 3300025949 Bacteria 2900
409 Ga0207667_10144958 3300025949 Bacteria 2445
410 Ga0207667_10148791 3300025949 Bacteria 2410
411 Ga0207667_11145110 3300025949 Bacteria 759
412 Ga0207712_10857651 3300025961 Bacteria 801
413 Ga0207712_11397532 3300025961 Bacteria 626
414 Ga0207668_11320483 3300025972 Bacteria 649
415 Ga0207640_10083438 3300025981 Bacteria 2191
416 Ga0207640_10229671 3300025981 Bacteria 1427
417 Ga0207640_10356669 3300025981 Bacteria 1177
418 Ga0207658_10602505 3300025986 Bacteria 987
419 Ga0207658_11332541 3300025986 Bacteria 656
420 Ga0207677_10091376 3300026023 Bacteria 2214
421 Ga0207677_10443850 3300026023 Bacteria 1110
422 Ga0207703_10065112 3300026035 Bacteria 2994
423 Ga0207703_11145258 3300026035 Bacteria 747
424 Ga0207703_11241870 3300026035 Bacteria 716
425 Ga0207639_10240699 3300026041 Bacteria 1573
426 Ga0207639_10268042 3300026041 Bacteria 1497
427 Ga0207639_10292211 3300026041 Bacteria 1437
428 Ga0207678_10246188 3300026067 Bacteria 1531
429 Ga0207678_10561648 3300026067 Bacteria 999
430 Ga0207678_10786279 3300026067 Bacteria 840
431 Ga0207678_11095558 3300026067 Bacteria 705
432 Ga0207702_10000318 3300026078 Bacteria 55209
433 Ga0207702_10312632 3300026078 Bacteria 1494
434 Ga0207702_10372300 3300026078 Bacteria 1372
435 Ga0207702_11139192 3300026078 Bacteria 774
436 Ga0207641_10357451 3300026088 Bacteria 1393
437 Ga0207641_10474896 3300026088 Bacteria 1211
438 Ga0207641_10517494 3300026088 Bacteria 1160
439 Ga0207641_12096007 3300026088 Bacteria 566
440 Ga0207648_10402717 3300026089 Bacteria 1240
441 Ga0207648_10499119 3300026089 Bacteria 1113
442 Ga0207648_10534857 3300026089 Bacteria 1075
443 Ga0207648_10706097 3300026089 Bacteria 935
444 Ga0207676_10199904 3300026095 Bacteria 1765
445 Ga0207674_10073988 3300026116 Bacteria 3420
446 Ga0207674_10666112 3300026116 Bacteria 1005
447 Ga0207674_10670582 3300026116 Bacteria 1001
448 Ga0207675_100609178 3300026118 Bacteria 1096
449 Ga0207675_101074709 3300026118 Bacteria 824
450 Ga0207683_10083899 3300026121 Bacteria 2832
451 Ga0207683_10153979 3300026121 Bacteria 2076
452 Ga0207683_10461287 3300026121 Bacteria 1172
453 Ga0207683_10478614 3300026121 Bacteria 1149
454 Ga0207683_10984709 3300026121 Bacteria 783
455 Ga0207683_11224932 3300026121 Bacteria 695
456 Ga0207683_11652559 3300026121 Bacteria 590
457 Ga0207683_11813868 3300026121 Bacteria 559
458 Ga0207698_10403643 3300026142 Bacteria 1307
459 Ga0207698_10715809 3300026142 Bacteria 997
460 Ga0209588_1060561 3300027671 Bacteria 1224
461 Ga0209813_10024630 3300027866 Bacteria 1723
462 Ga0268266_10066637 3300028379 Bacteria 3114
463 Ga0268266_10129302 3300028379 Bacteria 2257
464 Ga0268266_10341670 3300028379 Bacteria 1405
465 Ga0268266_10378883 3300028379 Bacteria 1334
466 Ga0268266_10757186 3300028379 Bacteria 937
467 Ga0268266_11222413 3300028379 Bacteria 726
468 Ga0268266_11364934 3300028379 Bacteria 684
469 Ga0268266_12068669 3300028379 Bacteria 542
470 Ga0268265_10289989 3300028380 Bacteria 1468
471 Ga0268265_10506484 3300028380 Bacteria 1138
472 Ga0268264_10297652 3300028381 Bacteria 1518
473 Ga0268264_11273547 3300028381 Bacteria 745
474 Ga0307517_10000232 3300028786 Bacteria 94332
475 Ga0307517_10469903 3300028786 Bacteria 647
476 Ga0307515_10087102 3300028794 Bacteria 3970
477 Ga0265332_10035231 3300031238 Bacteria 2174
478 Ga0265340_10091462 3300031247 Bacteria 1421
479 Ga0265340_10217072 3300031247 Bacteria 857
480 Ga0265339_10073499 3300031249 Bacteria 1818
481 Ga0265331_10089610 3300031250 Bacteria 1423
482 Ga0265316_10196584 3300031344 Bacteria 1496
483 Ga0265316_10588938 3300031344 Bacteria 789
484 Ga0307513_10191401 3300031456 Bacteria 1897
485 Ga0307513_10240504 3300031456 Bacteria 1615
486 Ga0307509_10331144 3300031507 Bacteria 1254
487 Ga0265313_10342930 3300031595 Bacteria 593
488 Ga0307508_10126440 3300031616 Bacteria 2159
489 Ga0307508_10328232 3300031616 Bacteria 1122
490 Ga0307508_10665446 3300031616 Bacteria 648
491 Ga0265314_10005054 3300031711 Bacteria 12021
492 Ga0265314_10220531 3300031711 Bacteria 1107
493 Ga0307516_10114956 3300031730 Bacteria 2488
494 Ga0307516_10178300 3300031730 Bacteria 1860
495 Ga0307516_10279702 3300031730 Bacteria 1351
496 Ga0307405_10263134 3300031731 Bacteria 1289
497 Ga0307413_10594532 3300031824 Bacteria 904
498 Ga0307406_10237733 3300031901 Bacteria 1364
499 Ga0307407_10538655 3300031903 Bacteria 861
500 Ga0307412_10530413 3300031911 Bacteria 985
501 Ga0307416_100460323 3300032002 Bacteria 1327
502 Ga0307416_101970837 3300032002 Bacteria 687
503 Ga0307416_101979258 3300032002 Bacteria 685
504 Ga0307414_10974180 3300032004 Bacteria 780
505 Ga0307415_100314346 3300032126 Bacteria 1303
506 Ga0307415_100662739 3300032126 Bacteria 937
507 Ga0307510_10072618 3300033180 Bacteria 3417
508 Ga0307510_10089264 3300033180 Bacteria 2936
509 Ga0307510_10121016 3300033180 Bacteria 2322
510 Ga0307510_10301776 3300033180 Bacteria 1063
511 Ga0315911_1000008 3300033442 Bacteria 381285
512 Ga0373958_0165769 3300034819 Bacteria 561
513 Ga0373958_0166297 3300034819 Bacteria 561
514 Ga0373926_0033050 3300035083 Bacteria 1827
515 Ga0373934_0023493 3300035086 Bacteria 2382
516 Ga0373934_0096153 3300035086 Bacteria 1196
517 Ga0373949_0072389 3300035090 Bacteria 905
518 Ga0373951_0095136 3300035091 Bacteria 786
519 Ga0373952_0253775 3300035092 Bacteria 533
520 Ga0373923_0004936 3300035111 Bacteria 4481
521 Ga0373923_0039874 3300035111 Bacteria 1930
522 Ga0373923_0042855 3300035111 Bacteria 1871
523 Ga0373936_0070753 3300035113 Bacteria 1437
524 Ga0373939_0109740 3300035114 Bacteria 959
525 Ga0373945_0015296 3300035116 Bacteria 2579
526 Ga0373945_0100694 3300035116 Bacteria 1130
527 Ga0373953_0078384 3300035117 Bacteria 1370
528 Ga0373953_0247502 3300035117 Bacteria 774
529 Ga0373954_0011463 3300035118 Bacteria 3929
530 Ga0373954_0174243 3300035118 Bacteria 1054
531 Ga0373956_0082067 3300035119 Bacteria 1480
532 Ga0373956_0155201 3300035119 Bacteria 1077
533 Ga0373956_0451395 3300035119 Bacteria 613
534 Ga0373957_0120048 3300035120 Bacteria 1063
535 Ga0373943_0141500 3300035170 Bacteria 1296
536 Ga0373943_0463427 3300035170 Bacteria 737
537 Ga0373946_0014322 3300035171 Bacteria 2989
538 Ga0373946_0214788 3300035171 Bacteria 927
539 Ga0373946_0482002 3300035171 Bacteria 634
540 Ga0373955_0004380 3300035172 Bacteria 6246
541 Ga0373955_0051079 3300035172 Bacteria 2251
542 Ga0373961_0031149 3300035241 Bacteria 1488
543 Ga0373961_0070941 3300035241 Bacteria 1077
544 Ga0373924_0033451 3300035410 Bacteria 2075
545 Ga0373924_0093920 3300035410 Bacteria 1285
546 Ga0373931_0015641 3300035691 Bacteria 3723
547 Ga0373935_0001267 3300035692 Bacteria 13929
548 Ga0373935_0039786 3300035692 Bacteria 2948
549 Ga0373927_0000766 3300035695 Bacteria 24573
550 Ga0373927_0006724 3300035695 Bacteria 7827
551 Ga0373927_0200773 3300035695 Bacteria 1309
552 Ga0373927_0288502 3300035695 Bacteria 1080
553 Ga0373927_0328502 3300035695 Bacteria 1007
554 Ga0373927_0349402 3300035695 Bacteria 974
555 Ga0373927_1123709 3300035695 Bacteria 518
556 Ga0373933_0000218 3300035724 Bacteria 37928
557 Ga0373933_0231444 3300035724 Bacteria 1187
558 Ga0373933_0356576 3300035724 Bacteria 950
559 Ga0373947_0000310 3300035725 Bacteria 27577
560 Ga0373947_0013664 3300035725 Bacteria 4651
561 Ga0373947_0374672 3300035725 Bacteria 957
562 Ga0373937_0014630 3300036401 Bacteria 6929
563 Ga0373925_0006419 3300037068 Bacteria 8654
564 Ga0373925_0021485 3300037068 Bacteria 4702
565 Ga0373925_0078313 3300037068 Bacteria 2510
566 Ga0373925_0589307 3300037068 Bacteria 915
567 Ga0373925_0654343 3300037068 Bacteria 866
568 Ga0395900_0032832 3300037418 Bacteria 5339
569 Ga0395900_0108628 3300037418 Bacteria 2850
570 Ga0395900_0199177 3300037418 Bacteria 2027
571 Ga0395900_1525769 3300037418 Bacteria 580
572 Ga0395898_0089031 3300037466 Bacteria 2971
573 Ga0395898_0631023 3300037466 Bacteria 1014
574 Ga0395905_0048135 3300037471 Bacteria 3996
575 Ga0436364_0331795 3300037853 Bacteria 1630
576 Ga0436364_0603569 3300037853 Bacteria 1111
577 Ga0395901_0113781 3300038443 Bacteria 2842
578 Ga0395901_0297332 3300038443 Bacteria 1674
579 Ga0436365_0118730 3300039437 Bacteria 842
580 Ga0436365_0135384 3300039437 Bacteria 2104
581 Ga0436365_0209743 3300039437 Bacteria 2892
582 Ga0436365_0279102 3300039437 Bacteria 2928
583 Ga0436365_0346369 3300039437 Bacteria 1174
584 Ga0436365_1026627 3300039437 Bacteria 1239
585 Ga0436362_0249161 3300039453 Bacteria 713
586 Ga0436362_1201460 3300039453 Bacteria 556
587 Ga0451789_1333214 3300041443 Bacteria 540
588 Ga0451793_1038465 3300041452 Bacteria 1074
589 Ga0451802_1431654 3300041460 Bacteria 677
590 Ga0451807_0826454 3300041486 Bacteria 519
591 Ga0451855_0143711 3300041511 Bacteria 572
592 Ga0466969_0093259 3300044656 Bacteria 1425
593 Ga0466972_0029548 3300044658 Bacteria 2698
594 Ga0466966_0343263 3300044684 Bacteria 897
595 Ga0466961_0156035 3300044693 Bacteria 1424
596 Ga0466963_0258548 3300044694 Bacteria 1222
597 Ga0466963_0996490 3300044694 Bacteria 590
598 Ga0466971_0156462 3300044719 Bacteria 1065
599 Ga0466968_0379186 3300044735 Bacteria 690
600 Ga0466970_0260390 3300044765 Bacteria 973
601 Ga0466957_0080078 3300044842 Bacteria 2033
602 Ga0466957_0237937 3300044842 Bacteria 1207
603 Ga0466957_0297429 3300044842 Bacteria 1084
604 Ga0466957_0427749 3300044842 Bacteria 909
605 Ga0466960_0181359 3300044901 Bacteria 1141
606 Ga0466959_0048894 3300045049 Bacteria 3107
607 Ga0466967_0028253 3300045976 Bacteria 4680
608 Ga0466967_0062009 3300045976 Bacteria 3318
609 Ga0466967_0204967 3300045976 Bacteria 1869
610 Ga0466967_1213654 3300045976 Bacteria 751
611 Ga0495617_107272 3300046452 Bacteria 905
612 Ga0495592_0102991 3300046454 Bacteria 2032
613 Ga0495592_0142617 3300046454 Bacteria 1664
614 Ga0495603_0000936 3300046455 Bacteria 16788
615 Ga0495603_0021318 3300046455 Bacteria 3924
616 Ga0495603_0105542 3300046455 Bacteria 1644
617 Ga0495603_0237833 3300046455 Bacteria 1049
618 Ga0495603_0392356 3300046455 Bacteria 796
619 Ga0495629_0001416 3300046459 Bacteria 18913
620 Ga0495629_0123416 3300046459 Bacteria 1804
621 Ga0495629_0484623 3300046459 Bacteria 835
622 Ga0495629_0633985 3300046459 Bacteria 713
623 Ga0495638_0139687 3300046460 Bacteria 1415
624 Ga0495638_0317616 3300046460 Bacteria 833
625 Ga0495641_0016464 3300046461 Bacteria 3896
626 Ga0495641_0138934 3300046461 Bacteria 1085
627 Ga0495651_0019880 3300046462 Bacteria 5207
628 Ga0495651_0178579 3300046462 Bacteria 1505
629 Ga0495653_0049261 3300046463 Bacteria 3246
630 Ga0495653_0117625 3300046463 Bacteria 1899
631 Ga0495650_0125333 3300046471 Bacteria 942
632 Ga0495580_0005025 3300046472 Bacteria 11027
633 Ga0495580_0006058 3300046472 Bacteria 9898
634 Ga0495580_0514895 3300046472 Bacteria 798
635 Ga0495582_0018773 3300046473 Bacteria 3780
636 Ga0495582_0038113 3300046473 Bacteria 2644
637 Ga0495582_0082250 3300046473 Bacteria 1789
638 Ga0495582_0124167 3300046473 Bacteria 1456
639 Ga0495639_0000072 3300046475 Bacteria 46904
640 Ga0495662_0000572 3300046476 Bacteria 16948
641 Ga0495662_0185583 3300046476 Bacteria 1025
642 Ga0495662_0217863 3300046476 Bacteria 941
643 Ga0495664_0014835 3300046477 Bacteria 4423
644 Ga0495664_0045196 3300046477 Bacteria 2611
645 Ga0495585_0586092 3300046492 Bacteria 525
646 Ga0495594_0000046 3300046499 Bacteria 53822
647 Ga0495594_0297721 3300046499 Bacteria 919
648 Ga0495596_0130534 3300046500 Bacteria 975
649 Ga0495596_0177088 3300046500 Bacteria 829
650 Ga0495596_0195003 3300046500 Bacteria 787
651 Ga0495606_0168025 3300046507 Bacteria 1275
652 Ga0495608_0323669 3300046511 Bacteria 952
653 Ga0495608_0637386 3300046511 Bacteria 638
654 Ga0495610_0029757 3300046512 Bacteria 2871
655 Ga0495618_0100704 3300046514 Bacteria 1849
656 Ga0495618_0186351 3300046514 Bacteria 1317
657 Ga0495620_0229342 3300046515 Bacteria 710
658 Ga0495628_0018626 3300046516 Bacteria 5747
659 Ga0495628_0033483 3300046516 Bacteria 4141
660 Ga0495628_0327775 3300046516 Bacteria 1129
661 Ga0495628_0517885 3300046516 Bacteria 859
662 Ga0495630_0024634 3300046517 Bacteria 4447
663 Ga0495630_0093534 3300046517 Bacteria 2272
664 Ga0495630_0154765 3300046517 Bacteria 1745
665 Ga0495630_0513814 3300046517 Bacteria 918
666 Ga0495631_0217855 3300046518 Bacteria 815
667 Ga0495631_0334536 3300046518 Bacteria 644
668 Ga0495632_0063839 3300046519 Bacteria 1782
669 Ga0495637_0100090 3300046520 Bacteria 1134
670 Ga0495644_0153157 3300046523 Bacteria 883
671 Ga0495644_0243040 3300046523 Bacteria 698
672 Ga0495644_0281117 3300046523 Bacteria 649
673 Ga0495644_0359059 3300046523 Bacteria 574
674 Ga0495648_0249358 3300046524 Bacteria 858
675 Ga0495648_0373903 3300046524 Bacteria 644
676 Ga0495663_0177723 3300046525 Bacteria 736
677 Ga0495666_0041837 3300046526 Bacteria 2217
678 Ga0495666_0167306 3300046526 Bacteria 1018
679 Ga0495642_0191454 3300046528 Bacteria 891
680 Ga0495642_0198449 3300046528 Bacteria 875
681 Ga0495665_0000335 3300046531 Bacteria 23811
682 Ga0495640_0002138 3300046533 Bacteria 15789
683 Ga0495640_0051516 3300046533 Bacteria 2830
684 Ga0495640_0361314 3300046533 Bacteria 895
685 Ga0495586_0059346 3300046535 Bacteria 2079
686 Ga0495587_0345412 3300046536 Bacteria 830
687 Ga0495609_0119716 3300046538 Bacteria 1133
688 Ga0495609_0131591 3300046538 Bacteria 1071
689 Ga0495645_0013978 3300046543 Bacteria 5689
690 Ga0495645_0036237 3300046543 Bacteria 3596
691 Ga0495622_0084671 3300046557 Bacteria 1458
692 Ga0495622_0249119 3300046557 Bacteria 782
693 Ga0495633_0312506 3300046558 Bacteria 713
694 Ga0495667_0032717 3300046559 Bacteria 3482
695 Ga0495667_0803522 3300046559 Bacteria 580
696 Ga0495668_0168169 3300046616 Bacteria 1201
697 Ga0495668_0481719 3300046616 Bacteria 683
698 Ga0495668_0732608 3300046616 Bacteria 547
699 Ga0495634_0003037 3300046642 Bacteria 13668
700 Ga0495634_0044482 3300046642 Bacteria 3005
701 Ga0495611_0066313 3300046648 Bacteria 1646
702 Ga0495611_0300332 3300046648 Bacteria 740
703 Ga0495625_0251011 3300046660 Bacteria 1148
704 Ga0495635_0002038 3300046663 Bacteria 13679
705 Ga0495635_0016231 3300046663 Bacteria 5198
706 Ga0495635_0089467 3300046663 Bacteria 2106
707 Ga0495635_0255921 3300046663 Bacteria 1180
708 Ga0495588_0416881 3300046674 Bacteria 705
709 Ga0495657_0121602 3300046675 Bacteria 1644
710 Ga0495599_0128792 3300046678 Bacteria 1572
711 Ga0495599_0191494 3300046678 Bacteria 1258
712 Ga0495599_0306147 3300046678 Bacteria 958
713 Ga0495599_0644747 3300046678 Bacteria 614
714 Ga0495623_0075175 3300046679 Bacteria 2098
715 Ga0495646_0066903 3300046680 Bacteria 2125
716 Ga0495646_0081016 3300046680 Bacteria 1892
717 Ga0495646_0119658 3300046680 Bacteria 1491
718 Ga0495646_0481522 3300046680 Bacteria 638
719 Ga0495647_0008783 3300046681 Bacteria 3403
720 Ga0495647_0016367 3300046681 Bacteria 2610
721 Ga0495658_0002742 3300046683 Bacteria 8859
722 Ga0495658_0009522 3300046683 Bacteria 4844
723 Ga0495658_0247379 3300046683 Bacteria 1121
724 Ga0495669_0124118 3300046684 Bacteria 1212
725 Ga0495669_0198256 3300046684 Bacteria 959
726 Ga0495669_0310627 3300046684 Bacteria 760
727 Ga0495613_0081505 3300046689 Bacteria 2351
728 Ga0495613_0148666 3300046689 Bacteria 1672
729 Ga0495624_0000795 3300046690 Bacteria 24919
730 Ga0495624_0056079 3300046690 Bacteria 2480
731 Ga0495670_0469767 3300046691 Bacteria 682
732 Ga0495671_0091675 3300046692 Bacteria 1487
733 Ga0495671_0437409 3300046692 Bacteria 625
734 Ga0495649_0299125 3300046694 Bacteria 819
735 Ga0495649_0408599 3300046694 Bacteria 681
736 Ga0495589_0135740 3300046794 Bacteria 1180
737 Ga0495600_0093192 3300046809 Bacteria 1964
738 Ga0495600_0115281 3300046809 Bacteria 1749
739 Ga0495581_0000030 3300047315 Bacteria 53487
740 Ga0495581_0126320 3300047315 Bacteria 1489
741 Ga0495581_0144120 3300047315 Bacteria 1390
742 Ga0495581_0352195 3300047315 Bacteria 859
743 Ga0495604_0105989 3300047317 Bacteria 2057
744 Ga0495604_0730681 3300047317 Bacteria 627
745 Ga0495674_0012381 3300047319 Bacteria 8036
746 Ga0495674_0026440 3300047319 Bacteria 5309
747 Ga0495674_0170500 3300047319 Bacteria 1816
748 Ga0495674_0433544 3300047319 Bacteria 1058
749 Ga0495674_1157765 3300047319 Bacteria 586
750 Ga0495672_0019292 3300047320 Bacteria 4502
751 Ga0495676_0028804 3300047321 Bacteria 4738
752 Ga0495676_0426845 3300047321 Bacteria 877
753 Ga0495680_0139443 3300047322 Bacteria 1775
754 Ga0495680_0289892 3300047322 Bacteria 1151
755 Ga0495683_0383974 3300047323 Bacteria 587
756 Ga0495675_0384899 3300047444 Bacteria 820
757 Ga0495684_0021000 3300047471 Bacteria 5029
758 Ga0495684_0053297 3300047471 Bacteria 3086
759 Ga0495686_0085355 3300047472 Bacteria 1923
760 Ga0495686_0171913 3300047472 Bacteria 1260
761 Ga0495593_0000398 3300047673 Bacteria 24218
762 Ga0495593_0181923 3300047673 Bacteria 1058
763 Ga0495614_0046075 3300048089 Bacteria 1870
764 Ga0496100_0073875 3300048903 Bacteria 2283
765 Ga0496100_0369385 3300048903 Bacteria 1087
766 Ga0496100_0926204 3300048903 Bacteria 685
767 Ga0496101_0859744 3300048904 Bacteria 715
768 Ga0496101_1368899 3300048904 Bacteria 552
769 Ga0496102_0082256 3300048905 Bacteria 2969
770 Ga0496102_0152685 3300048905 Bacteria 2170
771 Ga0496102_0260356 3300048905 Bacteria 1635
772 Ga0496102_0347549 3300048905 Bacteria 1396
773 Ga0496102_0401306 3300048905 Bacteria 1289
774 Ga0496103_0091837 3300048906 Bacteria 1916
775 Ga0496103_0135099 3300048906 Bacteria 1576
776 Ga0496103_0527388 3300048906 Bacteria 755
777 Ga0496103_0636678 3300048906 Bacteria 678
778 Ga0496104_0044883 3300048907 Bacteria 4154
779 Ga0496104_0463833 3300048907 Bacteria 1178
780 Ga0496104_0526120 3300048907 Bacteria 1093
781 Ga0496104_0548848 3300048907 Bacteria 1066
782 Ga0496104_0777062 3300048907 Bacteria 864
783 Ga0496105_0051519 3300048908 Bacteria 3400
784 Ga0496105_0094396 3300048908 Bacteria 2470
785 Ga0496105_0737928 3300048908 Bacteria 753
786 Ga0496105_0852426 3300048908 Bacteria 689
787 Ga0496106_0411555 3300048909 Bacteria 1087
788 Ga0496106_0607760 3300048909 Bacteria 875
789 Ga0496106_0628249 3300048909 Bacteria 859
790 Ga0496106_0766736 3300048909 Bacteria 766
791 Ga0496107_0037476 3300048910 Bacteria 3479
792 Ga0496107_0114537 3300048910 Bacteria 1984
793 Ga0496107_0316488 3300048910 Bacteria 1161
794 Ga0496107_1098843 3300048910 Bacteria 574
795 Ga0496108_0036615 3300048911 Bacteria 4083
796 Ga0496108_0060709 3300048911 Bacteria 3181
797 Ga0496108_0443405 3300048911 Bacteria 1134
798 Ga0496108_0571795 3300048911 Bacteria 985
799 Ga0496108_1132709 3300048911 Bacteria 664
800 Ga0496109_0057722 3300048912 Bacteria 3544
801 Ga0496109_0353316 3300048912 Bacteria 1388
802 Ga0496109_1851968 3300048912 Bacteria 536
803 Ga0496110_1252080 3300048913 Bacteria 651
804 Ga0496111_0034277 3300048914 Bacteria 3624
805 Ga0496111_0680391 3300048914 Bacteria 749
806 Ga0496112_0033543 3300048915 Bacteria 4991
807 Ga0496112_0049766 3300048915 Bacteria 4107
808 Ga0496112_0631524 3300048915 Bacteria 1001
809 Ga0496112_1010109 3300048915 Bacteria 751
810 Ga0496113_0017212 3300048916 Bacteria 5013
811 Ga0496113_0032120 3300048916 Bacteria 3813
812 Ga0496114_0078476 3300048917 Bacteria 2785
813 Ga0496114_0420047 3300048917 Bacteria 1184
814 Ga0496115_0150310 3300048918 Bacteria 1923
815 Ga0496115_0281240 3300048918 Bacteria 1366
816 Ga0496115_0335240 3300048918 Bacteria 1235
817 Ga0496115_0439175 3300048918 Bacteria 1055
818 Ga0496116_0159299 3300048919 Bacteria 1241
819 Ga0496116_0235381 3300048919 Bacteria 925
820 Ga0496117_0060867 3300048920 Bacteria 2599
821 Ga0496117_0277004 3300048920 Bacteria 900
822 Ga0496118_0134441 3300048921 Bacteria 1581
823 Ga0496118_0283652 3300048921 Bacteria 920
824 Ga0496118_0316502 3300048921 Bacteria 849
825 Ga0496118_0410405 3300048921 Bacteria 700
826 Ga0496119_0147277 3300048922 Bacteria 1265
827 Ga0496121_0000278 3300048924 Bacteria 106838
828 Ga0496121_0035287 3300048924 Bacteria 4485
829 Ga0496121_0071562 3300048924 Bacteria 2788
830 Ga0496121_0113457 3300048924 Bacteria 2062
831 Ga0496121_0125511 3300048924 Bacteria 1930
832 Ga0496121_0166716 3300048924 Bacteria 1604
833 Ga0496121_0200405 3300048924 Bacteria 1423
834 Ga0496121_0322537 3300048924 Bacteria 1039
835 Ga0496121_0518333 3300048924 Bacteria 753
836 Ga0496124_0236071 3300048927 Bacteria 1363
837 Ga0496124_0248160 3300048927 Bacteria 1319
838 Ga0496125_0576892 3300048928 Bacteria 618
839 Ga0496126_0034975 3300048929 Bacteria 4711
840 Ga0496126_0060610 3300048929 Bacteria 3402
841 Ga0496126_0162691 3300048929 Bacteria 1906
842 Ga0496126_0397020 3300048929 Bacteria 1119
843 Ga0496126_0889485 3300048929 Bacteria 676
844 Ga0501033_0597713 3300049570 Bacteria 757
845 Ga0501047_0041970 3300049581 Bacteria 4421
846 Ga0501048_0522722 3300049582 Bacteria 851
847 Ga0501067_0050483 3300049583 Bacteria 2305
848 Ga0501070_0248474 3300049586 Bacteria 1455
849 Ga0501080_0128602 3300049742 Bacteria 2345
850 Ga0501044_0083186 3300049823 Bacteria 3237
851 nmdc:mga03683_210539_c1 3300050489 Bacteria 894
852 nmdc:mga03683_265128_c1 3300050489 Bacteria 800
853 nmdc:mga03n38_14558_c1 3300050490 Bacteria 3017
854 nmdc:mga00v17_539811_c1 3300050491 Bacteria 754
855 nmdc:mga0yw44_117836_c1 3300050492 Bacteria 1708
856 nmdc:mga0yw44_464373_c1 3300050492 Bacteria 858
857 nmdc:mga0yw44_644431_c1 3300050492 Bacteria 720
858 nmdc:mga0yw44_804435_c1 3300050492 Bacteria 638
859 nmdc:mga06z11_110457_c1 3300050494 Bacteria 1522
860 nmdc:mga06z11_11045_c1 3300050494 Bacteria 3876
861 nmdc:mga06z11_460298_c1 3300050494 Bacteria 769
862 nmdc:mga06z11_583410_c1 3300050494 Bacteria 680
863 nmdc:mga04h51_29235_c1 3300050495 Bacteria 1725
864 nmdc:mga07m45_13114_c1 3300050496 Bacteria 4388
865 nmdc:mga07m45_385630_c1 3300050496 Bacteria 814
866 nmdc:mga07m45_64024_c1 3300050496 Bacteria 2086
867 nmdc:mga08y16_619065_c1 3300050511 Bacteria 1090
868 nmdc:mga0n895_378198_c1 3300050512 Bacteria 1433
869 nmdc:mga0rr50_393867_c1 3300050513 Bacteria 1169
870 nmdc:mga0a205_151249_c1 3300050515 Bacteria 2220
871 Ga0495601_0017256 3300053077 Bacteria 4380
872 Ga0495601_0136693 3300053077 Bacteria 1598
873 Ga0495601_0343333 3300053077 Bacteria 971
874 Ga0500610_0041583 3300053079 Bacteria 2377
875 Ga0495655_0112132 3300053083 Bacteria 821
876 Ga0495595_0219991 3300053084 Bacteria 947
877 Ga0495619_0236354 3300053085 Bacteria 1266
878 Ga0495619_0241630 3300053085 Bacteria 1251
879 Ga0500643_000112 3300053087 Bacteria 84793
880 Ga0500644_0362520 3300053088 Bacteria 628
881 Ga0500646_0155861 3300053090 Bacteria 759
882 Ga0500583_0085964 3300053092 Bacteria 1525
883 Ga0500583_0166310 3300053092 Bacteria 1098
884 Ga0500651_0033603 3300053093 Bacteria 3233
885 Ga0500651_0258387 3300053093 Bacteria 1010
886 Ga0500566_0011791 3300053094 Bacteria 5150
887 Ga0500566_0043525 3300053094 Bacteria 2587
888 Ga0500640_009445 3300053095 Bacteria 3899
889 Ga0500641_0060146 3300053096 Bacteria 1580
890 Ga0500641_0147163 3300053096 Bacteria 1017
891 Ga0500650_0192335 3300053098 Bacteria 932
892 Ga0500553_133854 3300053101 Bacteria 993
893 Ga0500554_067639 3300053102 Bacteria 1157
894 Ga0500555_004419 3300053103 Bacteria 3997
895 Ga0500555_083377 3300053103 Bacteria 829
896 Ga0500569_051549 3300053109 Bacteria 1243
897 Ga0500569_085728 3300053109 Bacteria 1013
898 Ga0500572_072413 3300053111 Bacteria 1067
899 Ga0500582_116210 3300053114 Bacteria 932
900 Ga0500592_014816 3300053116 Bacteria 1250
901 Ga0500592_033615 3300053116 Bacteria 827
902 Ga0500594_0011291 3300053118 Bacteria 2084
903 Ga0500594_0253250 3300053118 Bacteria 586
904 Ga0500595_001016 3300053119 Bacteria 15748
905 Ga0500595_006803 3300053119 Bacteria 4813
906 Ga0500595_014698 3300053119 Bacteria 2962
907 Ga0500595_027760 3300053119 Bacteria 1935
908 Ga0500595_043871 3300053119 Bacteria 1421
909 Ga0500607_085637 3300053121 Bacteria 1597
910 Ga0500608_234605 3300053122 Bacteria 729
911 Ga0500614_108692 3300053123 Bacteria 806
912 Ga0500614_193217 3300053123 Bacteria 625
913 Ga0500628_143339 3300053129 Bacteria 664
914 Ga0500642_0000362 3300053130 Bacteria 15284
915 Ga0500642_0000641 3300053130 Bacteria 10431
916 Ga0500642_0066658 3300053130 Bacteria 1629
917 Ga0500655_040208 3300053133 Bacteria 916
918 Ga0500658_0381921 3300053134 Bacteria 645
919 Ga0500568_0067550 3300053139 Bacteria 1373
920 Ga0500568_0129529 3300053139 Bacteria 938
921 Ga0500577_0098647 3300053142 Bacteria 1191
922 Ga0500577_0198761 3300053142 Bacteria 864
923 Ga0500588_0101524 3300053146 Bacteria 992
924 Ga0500589_226276 3300053147 Bacteria 701
925 Ga0500589_262379 3300053147 Bacteria 628
926 Ga0500590_147270 3300053148 Bacteria 1067
927 Ga0500590_223751 3300053148 Bacteria 773
928 Ga0500603_121939 3300053150 Bacteria 791
929 Ga0500604_0049059 3300053151 Bacteria 1297
930 Ga0500604_0089581 3300053151 Bacteria 1003
931 Ga0500604_0178318 3300053151 Bacteria 728
932 Ga0500616_0139503 3300053153 Bacteria 1135
933 Ga0500620_238445 3300053155 Bacteria 609
934 Ga0500622_0229091 3300053156 Bacteria 828
935 Ga0500627_0125991 3300053158 Bacteria 1156
936 Ga0500627_0203270 3300053158 Bacteria 887
937 Ga0500627_0348998 3300053158 Bacteria 639
938 Ga0500634_0212441 3300053161 Bacteria 838
939 Ga0500638_005456 3300053162 Bacteria 5068
940 Ga0500638_222988 3300053162 Bacteria 780
941 Ga0500636_0276248 3300053177 Bacteria 841
942 Ga0500636_0333676 3300053177 Bacteria 731
943 Ga0500637_0000585 3300053178 Bacteria 14328
944 Ga0500637_0186572 3300053178 Bacteria 1186
945 Ga0500570_106621 3300053724 Bacteria 1155
946 Ga0500611_158246 3300053727 Bacteria 625
947 Ga0500609_006652 3300053731 Bacteria 1572
948 Ga0500661_005871 3300055283 Bacteria 2287
949 Ga0587080_148527 3300059503 Bacteria 541
950 Ga0587083_0147968 3300059505 Bacteria 632
951 Ga0587068_101443 3300059641 Bacteria 605
952 Ga0587072_123946 3300059643 Bacteria 602
953 Ga0587075_040357 3300059644 Bacteria 780
954 Ga0587076_075966 3300059645 Bacteria 707
955 Ga0587071_046432 3300060344 Bacteria 886
956 Ga0466962_0031673 3300061719 Bacteria 2532
957 Ga0466962_0128009 3300061719 Bacteria 1227

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_0826454 Ga0451807_0826454_36_464 134
2 iso_pu_bacteria 8016557553 8016565829 138
3 3300039437 Ga0436365_0346369 Ga0436365_0346369_261_680 139
4 3300035695 Ga0373927_1123709 Ga0373927_1123709_67_501 140
5 3300037418 Ga0395900_1525769 Ga0395900_1525769_12_434 140
6 3300046523 Ga0495644_0243040 Ga0495644_0243040_265_687 140
7 3300046557 Ga0495622_0249119 Ga0495622_0249119_16_438 140
8 3300047319 Ga0495674_1157765 Ga0495674_1157765_152_574 140
9 3300048911 Ga0496108_0443405 Ga0496108_0443405_46_555 141
10 3300009551 Ga0105238_10815971 Ga0105238_108159711 142
11 3300005841 Ga0068863_100488620 Ga0068863_1004886203 146
12 3300026088 Ga0207641_10474896 Ga0207641_104748962 146
13 iso_pu_bacteria 2513237096 2513659509 154
14 iso_pu_bacteria 2513237137 2513859384 154
15 iso_pu_bacteria 2513237145 2513921558 154
16 iso_pu_bacteria 2517572143 2517889050 154
17 iso_pu_bacteria 2524023228 2524537485 154
18 iso_pu_bacteria 2667528175 2671124039 154
19 iso_pu_bacteria 2791355197 2793072711 154
20 iso_pu_bacteria 2885374607 2885377554 154
21 iso_pu_bacteria 2903748898 2903758797 154
22 iso_pu_bacteria 2904690495 2904691005 154
23 iso_pu_bacteria 2904699407 2904708402 154
24 iso_pu_bacteria 2906610324 2906613574 154
25 iso_pu_bacteria 2906635258 2906635831 154
26 iso_pu_bacteria 2906660503 2906668108 154
27 iso_pu_bacteria 2908739725 2908747652 154
28 iso_pu_bacteria 2908756301 2908757063 154
29 iso_pu_bacteria 2922361189 2922363207 154
30 iso_pu_bacteria 2922425934 2922434011 154
31 iso_pu_bacteria 2935630451 2935636038 154
32 iso_pu_bacteria 2941507105 2941512658 154
33 iso_pu_bacteria 2941515067 2941520504 154
34 iso_pu_bacteria 2941523033 2941528518 154
35 iso_pu_bacteria 3005474847 3005475274 154
36 iso_pu_bacteria 8006933436 8006936003 154
37 iso_pu_bacteria 8006973647 8006975873 154
38 iso_pu_bacteria 8019555841 8019562653 154
39 iso_pu_bacteria 8019565922 8019572730 154
40 iso_pu_bacteria 8056689827 8056691144 154
41 iso_pu_bacteria 2513237104 2513718240 155
42 iso_pu_bacteria 2881364244 2881368926 155
43 iso_pu_bacteria 2885409591 2885415852 155
44 iso_pu_bacteria 8056967851 8056971493 155
45 3300003659 JGI25404J52841_10019296 JGI25404J52841_100192962 157
46 3300003659 JGI25404J52841_10035351 JGI25404J52841_100353512 157
47 3300005289 Ga0065704_10142844 Ga0065704_101428442 157
48 3300005290 Ga0065712_10228589 Ga0065712_102285892 157
49 3300005295 Ga0065707_10024212 Ga0065707_100242122 157
50 3300005328 Ga0070676_10229590 Ga0070676_102295901 157
51 3300005328 Ga0070676_10660950 Ga0070676_106609502 157
52 3300005329 Ga0070683_100109161 Ga0070683_1001091612 157
53 3300005331 Ga0070670_100746824 Ga0070670_1007468242 157
54 3300005334 Ga0068869_100451568 Ga0068869_1004515682 157
55 3300005334 Ga0068869_101189775 Ga0068869_1011897751 157
56 3300005335 Ga0070666_10947092 Ga0070666_109470921 157
57 3300005338 Ga0068868_100059956 Ga0068868_1000599563 157
58 3300005338 Ga0068868_101012133 Ga0068868_1010121332 157
59 3300005339 Ga0070660_100501648 Ga0070660_1005016482 157
60 3300005341 Ga0070691_10205067 Ga0070691_102050671 157
61 3300005344 Ga0070661_100466437 Ga0070661_1004664372 157
62 3300005347 Ga0070668_100216872 Ga0070668_1002168722 157
63 3300005347 Ga0070668_100776729 Ga0070668_1007767292 157
64 3300005347 Ga0070668_102037548 Ga0070668_1020375481 157
65 3300005347 Ga0070668_102037549 Ga0070668_1020375491 157
66 3300005353 Ga0070669_100609029 Ga0070669_1006090292 157
67 3300005356 Ga0070674_101290983 Ga0070674_1012909831 157
68 3300005364 Ga0070673_100230498 Ga0070673_1002304981 157
69 3300005364 Ga0070673_100760705 Ga0070673_1007607051 157
70 3300005365 Ga0070688_100208310 Ga0070688_1002083101 157
71 3300005365 Ga0070688_100588175 Ga0070688_1005881752 157
72 3300005366 Ga0070659_101317869 Ga0070659_1013178691 157
73 3300005367 Ga0070667_100271251 Ga0070667_1002712511 157
74 3300005367 Ga0070667_101493029 Ga0070667_1014930291 157
75 3300005367 Ga0070667_101683202 Ga0070667_1016832021 157
76 3300005406 Ga0070703_10299640 Ga0070703_102996401 157
77 3300005438 Ga0070701_10194738 Ga0070701_101947382 157
78 3300005441 Ga0070700_101071426 Ga0070700_1010714261 157
79 3300005441 Ga0070700_101158779 Ga0070700_1011587791 157
80 3300005441 Ga0070700_101302622 Ga0070700_1013026221 157
81 3300005444 Ga0070694_100479641 Ga0070694_1004796411 157
82 3300005455 Ga0070663_100718471 Ga0070663_1007184711 157
83 3300005456 Ga0070678_100363674 Ga0070678_1003636742 157
84 3300005456 Ga0070678_100584240 Ga0070678_1005842402 157
85 3300005457 Ga0070662_100289078 Ga0070662_1002890782 157
86 3300005459 Ga0068867_100630108 Ga0068867_1006301081 157
87 3300005459 Ga0068867_100633022 Ga0068867_1006330221 157
88 3300005466 Ga0070685_10466238 Ga0070685_104662382 157
89 3300005467 Ga0070706_100574081 Ga0070706_1005740811 157
90 3300005518 Ga0070699_100742484 Ga0070699_1007424842 157
91 3300005535 Ga0070684_100355097 Ga0070684_1003550971 157
92 3300005535 Ga0070684_100692908 Ga0070684_1006929081 157
93 3300005539 Ga0068853_100442522 Ga0068853_1004425222 157
94 3300005539 Ga0068853_100484951 Ga0068853_1004849511 157
95 3300005543 Ga0070672_100348785 Ga0070672_1003487851 157
96 3300005547 Ga0070693_100075050 Ga0070693_1000750503 157
97 3300005548 Ga0070665_100206184 Ga0070665_1002061842 157
98 3300005548 Ga0070665_100377590 Ga0070665_1003775902 157
99 3300005548 Ga0070665_100519344 Ga0070665_1005193442 157
100 3300005548 Ga0070665_101138158 Ga0070665_1011381582 157
101 3300005564 Ga0070664_101140914 Ga0070664_1011409141 157
102 3300005577 Ga0068857_100397294 Ga0068857_1003972942 157
103 3300005578 Ga0068854_100272559 Ga0068854_1002725592 157
104 3300005614 Ga0068856_100107320 Ga0068856_1001073203 157
105 3300005616 Ga0068852_100067130 Ga0068852_1000671304 157
106 3300005616 Ga0068852_100775901 Ga0068852_1007759012 157
107 3300005617 Ga0068859_100748173 Ga0068859_1007481732 157
108 3300005617 Ga0068859_101012421 Ga0068859_1010124212 157
109 3300005617 Ga0068859_101200521 Ga0068859_1012005212 157
110 3300005618 Ga0068864_100123810 Ga0068864_1001238102 157
111 3300005618 Ga0068864_100314239 Ga0068864_1003142392 157
112 3300005618 Ga0068864_100339767 Ga0068864_1003397672 157
113 3300005718 Ga0068866_10472137 Ga0068866_104721371 157
114 3300005719 Ga0068861_100413798 Ga0068861_1004137982 157
115 3300005719 Ga0068861_100541193 Ga0068861_1005411932 157
116 3300005840 Ga0068870_10062707 Ga0068870_100627072 157
117 3300005840 Ga0068870_10415719 Ga0068870_104157192 157
118 3300005841 Ga0068863_100531991 Ga0068863_1005319912 157
119 3300005841 Ga0068863_100554843 Ga0068863_1005548431 157
120 3300005843 Ga0068860_100247682 Ga0068860_1002476823 157
121 3300005843 Ga0068860_100952627 Ga0068860_1009526272 157
122 3300005843 Ga0068860_100960866 Ga0068860_1009608662 157
123 3300005844 Ga0068862_100148304 Ga0068862_1001483042 157
124 3300005844 Ga0068862_100358612 Ga0068862_1003586122 157
125 3300005844 Ga0068862_100632552 Ga0068862_1006325522 157
126 3300005983 Ga0081540_1020688 Ga0081540_10206882 157
127 3300005983 Ga0081540_1020881 Ga0081540_10208813 157
128 3300005983 Ga0081540_1118995 Ga0081540_11189952 157
129 3300006038 Ga0075365_10247886 Ga0075365_102478862 157
130 3300006038 Ga0075365_10344911 Ga0075365_103449112 157
131 3300006038 Ga0075365_10583859 Ga0075365_105838592 157
132 3300006042 Ga0075368_10022422 Ga0075368_100224222 157
133 3300006042 Ga0075368_10071058 Ga0075368_100710582 157
134 3300006048 Ga0075363_100247733 Ga0075363_1002477332 157
135 3300006048 Ga0075363_100253033 Ga0075363_1002530332 157
136 3300006048 Ga0075363_100285613 Ga0075363_1002856132 157
137 3300006048 Ga0075363_100768625 Ga0075363_1007686251 157
138 3300006051 Ga0075364_10102130 Ga0075364_101021302 157
139 3300006163 Ga0070715_10104876 Ga0070715_101048762 157
140 3300006178 Ga0075367_10112753 Ga0075367_101127532 157
141 3300006178 Ga0075367_10288413 Ga0075367_102884132 157
142 3300006195 Ga0075366_10278186 Ga0075366_102781862 157
143 3300006237 Ga0097621_100139391 Ga0097621_1001393911 157
144 3300006237 Ga0097621_100212164 Ga0097621_1002121642 157
145 3300006237 Ga0097621_101706938 Ga0097621_1017069381 157
146 3300006353 Ga0075370_10093373 Ga0075370_100933733 157
147 3300006353 Ga0075370_10178205 Ga0075370_101782052 157
148 3300006358 Ga0068871_100126029 Ga0068871_1001260292 157
149 3300006358 Ga0068871_100899132 Ga0068871_1008991322 157
150 3300006844 Ga0075428_100135007 Ga0075428_1001350073 157
151 3300006871 Ga0075434_100287226 Ga0075434_1002872263 157
152 3300006881 Ga0068865_100289192 Ga0068865_1002891922 157
153 3300006931 Ga0097620_100748205 Ga0097620_1007482052 157
154 3300006931 Ga0097620_101012391 Ga0097620_1010123912 157
155 3300006931 Ga0097620_101200522 Ga0097620_1012005221 157
156 3300007076 Ga0075435_100454561 Ga0075435_1004545612 157
157 3300007265 Ga0099794_10321430 Ga0099794_103214302 157
158 3300009094 Ga0111539_10530373 Ga0111539_105303732 157
159 3300009094 Ga0111539_10932697 Ga0111539_109326972 157
160 3300009098 Ga0105245_10405664 Ga0105245_104056642 157
161 3300009098 Ga0105245_10645803 Ga0105245_106458032 157
162 3300009101 Ga0105247_10130453 Ga0105247_101304532 157
163 3300009148 Ga0105243_10507900 Ga0105243_105079002 157
164 3300009174 Ga0105241_10153603 Ga0105241_101536032 157
165 3300009174 Ga0105241_10503326 Ga0105241_105033262 157
166 3300009176 Ga0105242_10771784 Ga0105242_107717842 157
167 3300009176 Ga0105242_10834310 Ga0105242_108343102 157
168 3300009177 Ga0105248_10410419 Ga0105248_104104192 157
169 3300009545 Ga0105237_10186788 Ga0105237_101867882 157
170 3300009545 Ga0105237_10391897 Ga0105237_103918972 157
171 3300009545 Ga0105237_11307060 Ga0105237_113070602 157
172 3300009551 Ga0105238_11172820 Ga0105238_111728201 157
173 3300009553 Ga0105249_11307958 Ga0105249_113079582 157
174 3300010375 Ga0105239_10325851 Ga0105239_103258512 157
175 3300010375 Ga0105239_11237394 Ga0105239_112373942 157
176 3300010375 Ga0105239_11992100 Ga0105239_119921001 157
177 3300011119 Ga0105246_10019273 Ga0105246_100192733 157
178 3300011119 Ga0105246_10634819 Ga0105246_106348192 157
179 3300013296 Ga0157374_10054089 Ga0157374_100540893 157
180 3300013296 Ga0157374_10353683 Ga0157374_103536832 157
181 3300013297 Ga0157378_11611005 Ga0157378_116110052 157
182 3300013306 Ga0163162_10045228 Ga0163162_100452283 157
183 3300013306 Ga0163162_11590985 Ga0163162_115909852 157
184 3300013306 Ga0163162_11937813 Ga0163162_119378132 157
185 3300013306 Ga0163162_12349777 Ga0163162_123497772 157
186 3300013306 Ga0163162_12826517 Ga0163162_128265171 157
187 3300013307 Ga0157372_10940107 Ga0157372_109401072 157
188 3300013308 Ga0157375_10691138 Ga0157375_106911381 157
189 3300013308 Ga0157375_10747294 Ga0157375_107472942 157
190 3300014325 Ga0163163_10127555 Ga0163163_101275553 157
191 3300014325 Ga0163163_10370574 Ga0163163_103705742 157
192 3300014325 Ga0163163_11096593 Ga0163163_110965932 157
193 3300014325 Ga0163163_12210602 Ga0163163_122106021 157
194 3300014326 Ga0157380_10341204 Ga0157380_103412042 157
195 3300014326 Ga0157380_10599164 Ga0157380_105991642 157
196 3300014326 Ga0157380_12204986 Ga0157380_122049862 157
197 3300014968 Ga0157379_10209640 Ga0157379_102096401 157
198 3300014968 Ga0157379_10568872 Ga0157379_105688722 157
199 3300014969 Ga0157376_10620496 Ga0157376_106204962 157
200 3300014969 Ga0157376_10804516 Ga0157376_108045162 157
201 3300014969 Ga0157376_10912082 Ga0157376_109120822 157
202 3300015262 Ga0182007_10241593 Ga0182007_102415932 157
203 3300017792 Ga0163161_10584233 Ga0163161_105842332 157
204 3300017792 Ga0163161_11136485 Ga0163161_111364852 157
205 3300025261 Ga0209233_1006623 Ga0209233_10066234 157
206 3300025315 Ga0207697_10022598 Ga0207697_100225982 157
207 3300025315 Ga0207697_10044238 Ga0207697_100442382 157
208 3300025315 Ga0207697_10227280 Ga0207697_102272802 157
209 3300025315 Ga0207697_10228741 Ga0207697_102287412 157
210 3300025885 Ga0207653_10076948 Ga0207653_100769482 157
211 3300025899 Ga0207642_10097318 Ga0207642_100973181 157
212 3300025899 Ga0207642_10859819 Ga0207642_108598191 157
213 3300025900 Ga0207710_10094956 Ga0207710_100949562 157
214 3300025901 Ga0207688_10151712 Ga0207688_101517122 157
215 3300025903 Ga0207680_10578662 Ga0207680_105786621 157
216 3300025908 Ga0207643_10135707 Ga0207643_101357072 157
217 3300025908 Ga0207643_10252516 Ga0207643_102525162 157
218 3300025911 Ga0207654_10096920 Ga0207654_100969202 157
219 3300025911 Ga0207654_10160018 Ga0207654_101600182 157
220 3300025914 Ga0207671_10595909 Ga0207671_105959092 157
221 3300025916 Ga0207663_10409162 Ga0207663_104091621 157
222 3300025918 Ga0207662_10335633 Ga0207662_103356332 157
223 3300025919 Ga0207657_10173641 Ga0207657_101736412 157
224 3300025919 Ga0207657_10907579 Ga0207657_109075792 157
225 3300025920 Ga0207649_10355147 Ga0207649_103551472 157
226 3300025924 Ga0207694_11235147 Ga0207694_112351471 157
227 3300025925 Ga0207650_10625123 Ga0207650_106251231 157
228 3300025927 Ga0207687_10305000 Ga0207687_103050002 157
229 3300025927 Ga0207687_10593584 Ga0207687_105935842 157
230 3300025931 Ga0207644_10179336 Ga0207644_101793361 157
231 3300025931 Ga0207644_10626714 Ga0207644_106267142 157
232 3300025933 Ga0207706_10326055 Ga0207706_103260552 157
233 3300025935 Ga0207709_10465780 Ga0207709_104657802 157
234 3300025935 Ga0207709_11359072 Ga0207709_113590721 157
235 3300025936 Ga0207670_10360927 Ga0207670_103609272 157
236 3300025937 Ga0207669_10207027 Ga0207669_102070272 157
237 3300025937 Ga0207669_11403328 Ga0207669_114033281 157
238 3300025938 Ga0207704_10166691 Ga0207704_101666912 157
239 3300025940 Ga0207691_10508924 Ga0207691_105089242 157
240 3300025940 Ga0207691_10844799 Ga0207691_108447992 157
241 3300025941 Ga0207711_10140227 Ga0207711_101402272 157
242 3300025941 Ga0207711_10300286 Ga0207711_103002862 157
243 3300025942 Ga0207689_10975978 Ga0207689_109759782 157
244 3300025945 Ga0207679_10356886 Ga0207679_103568862 157
245 3300025949 Ga0207667_10105980 Ga0207667_101059803 157
246 3300025961 Ga0207712_11397532 Ga0207712_113975321 157
247 3300025972 Ga0207668_11320483 Ga0207668_113204832 157
248 3300025981 Ga0207640_10083438 Ga0207640_100834382 157
249 3300025981 Ga0207640_10229671 Ga0207640_102296712 157
250 3300025986 Ga0207658_10602505 Ga0207658_106025052 157
251 3300025986 Ga0207658_11332541 Ga0207658_113325412 157
252 3300026023 Ga0207677_10091376 Ga0207677_100913762 157
253 3300026035 Ga0207703_10065112 Ga0207703_100651122 157
254 3300026035 Ga0207703_11145258 Ga0207703_111452582 157
255 3300026035 Ga0207703_11241870 Ga0207703_112418702 157
256 3300026041 Ga0207639_10268042 Ga0207639_102680422 157
257 3300026041 Ga0207639_10292211 Ga0207639_102922112 157
258 3300026067 Ga0207678_10561648 Ga0207678_105616482 157
259 3300026067 Ga0207678_10786279 Ga0207678_107862792 157
260 3300026067 Ga0207678_11095558 Ga0207678_110955582 157
261 3300026078 Ga0207702_11139192 Ga0207702_111391922 157
262 3300026088 Ga0207641_10357451 Ga0207641_103574512 157
263 3300026088 Ga0207641_10517494 Ga0207641_105174943 157
264 3300026088 Ga0207641_12096007 Ga0207641_120960071 157
265 3300026089 Ga0207648_10402717 Ga0207648_104027171 157
266 3300026089 Ga0207648_10499119 Ga0207648_104991192 157
267 3300026089 Ga0207648_10534857 Ga0207648_105348572 157
268 3300026089 Ga0207648_10706097 Ga0207648_107060972 157
269 3300026095 Ga0207676_10199904 Ga0207676_101999042 157
270 3300026116 Ga0207674_10670582 Ga0207674_106705822 157
271 3300026118 Ga0207675_100609178 Ga0207675_1006091782 157
272 3300026118 Ga0207675_101074709 Ga0207675_1010747092 157
273 3300026121 Ga0207683_10153979 Ga0207683_101539792 157
274 3300026121 Ga0207683_10461287 Ga0207683_104612872 157
275 3300026121 Ga0207683_10478614 Ga0207683_104786142 157
276 3300026121 Ga0207683_10984709 Ga0207683_109847092 157
277 3300026121 Ga0207683_11652559 Ga0207683_116525591 157
278 3300026121 Ga0207683_11813868 Ga0207683_118138682 157
279 3300027671 Ga0209588_1060561 Ga0209588_10605612 157
280 3300028379 Ga0268266_10066637 Ga0268266_100666373 157
281 3300028379 Ga0268266_10129302 Ga0268266_101293023 157
282 3300028379 Ga0268266_10378883 Ga0268266_103788832 157
283 3300028379 Ga0268266_10757186 Ga0268266_107571862 157
284 3300028379 Ga0268266_11222413 Ga0268266_112224131 157
285 3300028379 Ga0268266_11364934 Ga0268266_113649341 157
286 3300028379 Ga0268266_12068669 Ga0268266_120686691 157
287 3300028380 Ga0268265_10289989 Ga0268265_102899891 157
288 3300028380 Ga0268265_10506484 Ga0268265_105064842 157
289 3300028381 Ga0268264_10297652 Ga0268264_102976522 157
290 3300028381 Ga0268264_11273547 Ga0268264_112735471 157
291 3300028786 Ga0307517_10000232 Ga0307517_1000023222 157
292 3300028786 Ga0307517_10469903 Ga0307517_104699031 157
293 3300028794 Ga0307515_10087102 Ga0307515_100871024 157
294 3300031456 Ga0307513_10191401 Ga0307513_101914012 157
295 3300031456 Ga0307513_10240504 Ga0307513_102405042 157
296 3300031507 Ga0307509_10331144 Ga0307509_103311442 157
297 3300031616 Ga0307508_10328232 Ga0307508_103282322 157
298 3300031616 Ga0307508_10665446 Ga0307508_106654462 157
299 3300031730 Ga0307516_10114956 Ga0307516_101149562 157
300 3300031730 Ga0307516_10178300 Ga0307516_101783003 157
301 3300031730 Ga0307516_10279702 Ga0307516_102797022 157
302 3300031731 Ga0307405_10263134 Ga0307405_102631342 157
303 3300031824 Ga0307413_10594532 Ga0307413_105945322 157
304 3300031901 Ga0307406_10237733 Ga0307406_102377332 157
305 3300031903 Ga0307407_10538655 Ga0307407_105386552 157
306 3300031911 Ga0307412_10530413 Ga0307412_105304132 157
307 3300032002 Ga0307416_100460323 Ga0307416_1004603232 157
308 3300032002 Ga0307416_101979258 Ga0307416_1019792582 157
309 3300032004 Ga0307414_10974180 Ga0307414_109741801 157
310 3300032126 Ga0307415_100314346 Ga0307415_1003143461 157
311 3300033180 Ga0307510_10072618 Ga0307510_100726184 157
312 3300033180 Ga0307510_10121016 Ga0307510_101210162 157
313 3300034819 Ga0373958_0165769 Ga0373958_0165769_58_534 157
314 3300034819 Ga0373958_0166297 Ga0373958_0166297_56_532 157
315 3300035090 Ga0373949_0072389 Ga0373949_0072389_382_858 157
316 3300035092 Ga0373952_0253775 Ga0373952_0253775_33_509 157
317 3300035114 Ga0373939_0109740 Ga0373939_0109740_265_741 157
318 3300035171 Ga0373946_0214788 Ga0373946_0214788_118_594 157
319 3300035241 Ga0373961_0031149 Ga0373961_0031149_546_1022 157
320 3300035241 Ga0373961_0070941 Ga0373961_0070941_46_522 157
321 3300035691 Ga0373931_0015641 Ga0373931_0015641_672_1148 157
322 3300035695 Ga0373927_0328502 Ga0373927_0328502_429_905 157
323 3300037068 Ga0373925_0589307 Ga0373925_0589307_241_717 157
324 3300039437 Ga0436365_0209743 Ga0436365_0209743_256_744 157
325 3300039437 Ga0436365_1026627 Ga0436365_1026627_503_979 157
326 3300041443 Ga0451789_1333214 Ga0451789_1333214_15_491 157
327 3300041452 Ga0451793_1038465 Ga0451793_1038465_30_506 157
328 3300041460 Ga0451802_1431654 Ga0451802_1431654_119_595 157
329 3300041511 Ga0451855_0143711 Ga0451855_0143711_52_528 157
330 3300044684 Ga0466966_0343263 Ga0466966_0343263_210_686 157
331 3300046455 Ga0495603_0021318 Ga0495603_0021318_55_531 157
332 3300046455 Ga0495603_0392356 Ga0495603_0392356_153_629 157
333 3300046459 Ga0495629_0123416 Ga0495629_0123416_970_1446 157
334 3300046459 Ga0495629_0484623 Ga0495629_0484623_75_551 157
335 3300046460 Ga0495638_0139687 Ga0495638_0139687_293_769 157
336 3300046471 Ga0495650_0125333 Ga0495650_0125333_67_543 157
337 3300046473 Ga0495582_0082250 Ga0495582_0082250_1165_1641 157
338 3300046492 Ga0495585_0586092 Ga0495585_0586092_15_491 157
339 3300046500 Ga0495596_0130534 Ga0495596_0130534_188_664 157
340 3300046500 Ga0495596_0177088 Ga0495596_0177088_108_584 157
341 3300046500 Ga0495596_0195003 Ga0495596_0195003_257_733 157
342 3300046518 Ga0495631_0217855 Ga0495631_0217855_218_694 157
343 3300046519 Ga0495632_0063839 Ga0495632_0063839_1229_1705 157
344 3300046520 Ga0495637_0100090 Ga0495637_0100090_506_982 157
345 3300046523 Ga0495644_0281117 Ga0495644_0281117_27_503 157
346 3300046523 Ga0495644_0359059 Ga0495644_0359059_25_501 157
347 3300046524 Ga0495648_0373903 Ga0495648_0373903_82_558 157
348 3300046525 Ga0495663_0177723 Ga0495663_0177723_174_650 157
349 3300046526 Ga0495666_0167306 Ga0495666_0167306_280_756 157
350 3300046528 Ga0495642_0191454 Ga0495642_0191454_142_618 157
351 3300046528 Ga0495642_0198449 Ga0495642_0198449_365_841 157
352 3300046533 Ga0495640_0361314 Ga0495640_0361314_13_489 157
353 3300046538 Ga0495609_0131591 Ga0495609_0131591_162_638 157
354 3300046616 Ga0495668_0481719 Ga0495668_0481719_177_653 157
355 3300046616 Ga0495668_0732608 Ga0495668_0732608_32_508 157
356 3300046660 Ga0495625_0251011 Ga0495625_0251011_83_559 157
357 3300046663 Ga0495635_0255921 Ga0495635_0255921_552_1028 157
358 3300046674 Ga0495588_0416881 Ga0495588_0416881_59_535 157
359 3300046683 Ga0495658_0247379 Ga0495658_0247379_403_879 157
360 3300046684 Ga0495669_0310627 Ga0495669_0310627_210_686 157
361 3300046691 Ga0495670_0469767 Ga0495670_0469767_134_610 157
362 3300046692 Ga0495671_0091675 Ga0495671_0091675_147_623 157
363 3300046692 Ga0495671_0437409 Ga0495671_0437409_17_493 157
364 3300046694 Ga0495649_0299125 Ga0495649_0299125_152_628 157
365 3300046694 Ga0495649_0408599 Ga0495649_0408599_125_601 157
366 3300047315 Ga0495581_0352195 Ga0495581_0352195_372_848 157
367 3300047317 Ga0495604_0730681 Ga0495604_0730681_101_577 157
368 3300047319 Ga0495674_0433544 Ga0495674_0433544_302_778 157
369 3300047323 Ga0495683_0383974 Ga0495683_0383974_55_531 157
370 3300048903 Ga0496100_0073875 Ga0496100_0073875_351_827 157
371 3300048903 Ga0496100_0926204 Ga0496100_0926204_102_578 157
372 3300048905 Ga0496102_0152685 Ga0496102_0152685_500_976 157
373 3300048905 Ga0496102_0260356 Ga0496102_0260356_775_1251 157
374 3300048905 Ga0496102_0347549 Ga0496102_0347549_720_1196 157
375 3300048905 Ga0496102_0401306 Ga0496102_0401306_527_1003 157
376 3300048906 Ga0496103_0091837 Ga0496103_0091837_890_1366 157
377 3300048906 Ga0496103_0135099 Ga0496103_0135099_735_1211 157
378 3300048907 Ga0496104_0044883 Ga0496104_0044883_1986_2462 157
379 3300048907 Ga0496104_0463833 Ga0496104_0463833_538_1014 157
380 3300048907 Ga0496104_0526120 Ga0496104_0526120_471_947 157
381 3300048907 Ga0496104_0777062 Ga0496104_0777062_167_643 157
382 3300048908 Ga0496105_0051519 Ga0496105_0051519_1223_1699 157
383 3300048908 Ga0496105_0094396 Ga0496105_0094396_1341_1817 157
384 3300048908 Ga0496105_0737928 Ga0496105_0737928_114_590 157
385 3300048909 Ga0496106_0411555 Ga0496106_0411555_125_601 157
386 3300048909 Ga0496106_0607760 Ga0496106_0607760_214_690 157
387 3300048909 Ga0496106_0628249 Ga0496106_0628249_327_803 157
388 3300048910 Ga0496107_0037476 Ga0496107_0037476_926_1402 157
389 3300048910 Ga0496107_0316488 Ga0496107_0316488_397_873 157
390 3300048911 Ga0496108_0036615 Ga0496108_0036615_1796_2272 157
391 3300048911 Ga0496108_0571795 Ga0496108_0571795_471_947 157
392 3300048911 Ga0496108_1132709 Ga0496108_1132709_105_581 157
393 3300048912 Ga0496109_0057722 Ga0496109_0057722_2348_2824 157
394 3300048912 Ga0496109_0353316 Ga0496109_0353316_150_626 157
395 3300048912 Ga0496109_1851968 Ga0496109_1851968_22_498 157
396 3300048914 Ga0496111_0034277 Ga0496111_0034277_1994_2470 157
397 3300048915 Ga0496112_0033543 Ga0496112_0033543_2658_3134 157
398 3300048915 Ga0496112_0631524 Ga0496112_0631524_288_764 157
399 3300048915 Ga0496112_1010109 Ga0496112_1010109_139_615 157
400 3300048916 Ga0496113_0017212 Ga0496113_0017212_1830_2306 157
401 3300048916 Ga0496113_0032120 Ga0496113_0032120_2435_2911 157
402 3300048917 Ga0496114_0078476 Ga0496114_0078476_374_850 157
403 3300048917 Ga0496114_0420047 Ga0496114_0420047_510_986 157
404 3300048918 Ga0496115_0335240 Ga0496115_0335240_494_970 157
405 3300048919 Ga0496116_0235381 Ga0496116_0235381_152_628 157
406 3300048921 Ga0496118_0134441 Ga0496118_0134441_166_642 157
407 3300048921 Ga0496118_0283652 Ga0496118_0283652_259_735 157
408 3300048924 Ga0496121_0113457 Ga0496121_0113457_721_1197 157
409 3300048924 Ga0496121_0166716 Ga0496121_0166716_802_1278 157
410 3300048924 Ga0496121_0200405 Ga0496121_0200405_278_754 157
411 3300048924 Ga0496121_0322537 Ga0496121_0322537_165_641 157
412 3300048927 Ga0496124_0236071 Ga0496124_0236071_270_746 157
413 3300048928 Ga0496125_0576892 Ga0496125_0576892_109_585 157
414 3300048929 Ga0496126_0060610 Ga0496126_0060610_2377_2853 157
415 3300048929 Ga0496126_0397020 Ga0496126_0397020_124_600 157
416 3300048929 Ga0496126_0889485 Ga0496126_0889485_16_492 157
417 3300050489 nmdc:mga03683_265128_c1 nmdc:mga03683_265128_c1_163_639 157
418 3300050491 nmdc:mga00v17_539811_c1 nmdc:mga00v17_539811_c1_42_518 157
419 3300050492 nmdc:mga0yw44_117836_c1 nmdc:mga0yw44_117836_c1_854_1330 157
420 3300050492 nmdc:mga0yw44_464373_c1 nmdc:mga0yw44_464373_c1_367_843 157
421 3300050492 nmdc:mga0yw44_644431_c1 nmdc:mga0yw44_644431_c1_28_504 157
422 3300050492 nmdc:mga0yw44_804435_c1 nmdc:mga0yw44_804435_c1_106_582 157
423 3300050494 nmdc:mga06z11_110457_c1 nmdc:mga06z11_110457_c1_608_1084 157
424 3300050494 nmdc:mga06z11_460298_c1 nmdc:mga06z11_460298_c1_241_717 157
425 3300050496 nmdc:mga07m45_385630_c1 nmdc:mga07m45_385630_c1_49_525 157
426 3300050496 nmdc:mga07m45_64024_c1 nmdc:mga07m45_64024_c1_1402_1878 157
427 3300050511 nmdc:mga08y16_619065_c1 nmdc:mga08y16_619065_c1_98_574 157
428 3300050512 nmdc:mga0n895_378198_c1 nmdc:mga0n895_378198_c1_435_911 157
429 3300050513 nmdc:mga0rr50_393867_c1 nmdc:mga0rr50_393867_c1_29_505 157
430 3300050515 nmdc:mga0a205_151249_c1 nmdc:mga0a205_151249_c1_1605_2081 157
431 3300053083 Ga0495655_0112132 Ga0495655_0112132_107_583 157
432 3300053090 Ga0500646_0155861 Ga0500646_0155861_117_593 157
433 3300053092 Ga0500583_0085964 Ga0500583_0085964_519_995 157
434 3300053094 Ga0500566_0043525 Ga0500566_0043525_1527_2003 157
435 3300053096 Ga0500641_0147163 Ga0500641_0147163_481_957 157
436 3300053102 Ga0500554_067639 Ga0500554_067639_235_711 157
437 3300053103 Ga0500555_083377 Ga0500555_083377_28_504 157
438 3300053114 Ga0500582_116210 Ga0500582_116210_271_747 157
439 3300053118 Ga0500594_0011291 Ga0500594_0011291_1519_1995 157
440 3300053119 Ga0500595_001016 Ga0500595_001016_14713_15189 157
441 3300053119 Ga0500595_043871 Ga0500595_043871_331_807 157
442 3300053122 Ga0500608_234605 Ga0500608_234605_209_685 157
443 3300053129 Ga0500628_143339 Ga0500628_143339_156_632 157
444 3300053133 Ga0500655_040208 Ga0500655_040208_353_829 157
445 3300053142 Ga0500577_0198761 Ga0500577_0198761_317_793 157
446 3300053147 Ga0500589_226276 Ga0500589_226276_77_553 157
447 3300053147 Ga0500589_262379 Ga0500589_262379_136_612 157
448 3300053148 Ga0500590_147270 Ga0500590_147270_183_659 157
449 3300053150 Ga0500603_121939 Ga0500603_121939_235_711 157
450 3300053151 Ga0500604_0049059 Ga0500604_0049059_695_1171 157
451 3300053151 Ga0500604_0178318 Ga0500604_0178318_211_687 157
452 3300053155 Ga0500620_238445 Ga0500620_238445_104_580 157
453 3300053158 Ga0500627_0125991 Ga0500627_0125991_418_894 157
454 3300053158 Ga0500627_0348998 Ga0500627_0348998_97_573 157
455 3300053161 Ga0500634_0212441 Ga0500634_0212441_154_630 157
456 3300053162 Ga0500638_005456 Ga0500638_005456_3633_4109 157
457 3300053177 Ga0500636_0276248 Ga0500636_0276248_215_691 157
458 3300053177 Ga0500636_0333676 Ga0500636_0333676_48_524 157
459 3300053178 Ga0500637_0000585 Ga0500637_0000585_11917_12393 157
460 3300053727 Ga0500611_158246 Ga0500611_158246_102_578 157
461 3300055283 Ga0500661_005871 Ga0500661_005871_314_790 157
462 3300003214 JGI25165J46597_1004955 JGI25165J46597_10049552 158
463 3300003215 JGI25153J46596_10030586 JGI25153J46596_100305863 158
464 3300003752 Ga0055539_1020748 Ga0055539_10207482 158
465 3300003762 Ga0055542_1014646 Ga0055542_10146462 158
466 3300004625 Ga0055543_1011352 Ga0055543_10113522 158
467 3300005329 Ga0070683_100167461 Ga0070683_1001674612 158
468 3300005329 Ga0070683_100270090 Ga0070683_1002700902 158
469 3300005329 Ga0070683_100277403 Ga0070683_1002774032 158
470 3300005336 Ga0070680_100463354 Ga0070680_1004633542 158
471 3300005336 Ga0070680_100852515 Ga0070680_1008525152 158
472 3300005337 Ga0070682_100140690 Ga0070682_1001406902 158
473 3300005337 Ga0070682_100954204 Ga0070682_1009542042 158
474 3300005338 Ga0068868_101458966 Ga0068868_1014589661 158
475 3300005344 Ga0070661_100739494 Ga0070661_1007394942 158
476 3300005344 Ga0070661_101243556 Ga0070661_1012435561 158
477 3300005347 Ga0070668_100424000 Ga0070668_1004240002 158
478 3300005355 Ga0070671_101076359 Ga0070671_1010763591 158
479 3300005434 Ga0070709_10194830 Ga0070709_101948302 158
480 3300005434 Ga0070709_10357658 Ga0070709_103576582 158
481 3300005434 Ga0070709_10420172 Ga0070709_104201722 158
482 3300005434 Ga0070709_10833475 Ga0070709_108334751 158
483 3300005434 Ga0070709_10905858 Ga0070709_109058582 158
484 3300005435 Ga0070714_100021967 Ga0070714_1000219672 158
485 3300005435 Ga0070714_100431950 Ga0070714_1004319502 158
486 3300005435 Ga0070714_100930256 Ga0070714_1009302561 158
487 3300005436 Ga0070713_100029455 Ga0070713_1000294554 158
488 3300005436 Ga0070713_100080502 Ga0070713_1000805023 158
489 3300005436 Ga0070713_100156027 Ga0070713_1001560271 158
490 3300005436 Ga0070713_100330033 Ga0070713_1003300332 158
491 3300005436 Ga0070713_100737828 Ga0070713_1007378281 158
492 3300005436 Ga0070713_101283380 Ga0070713_1012833801 158
493 3300005437 Ga0070710_10041326 Ga0070710_100413262 158
494 3300005437 Ga0070710_10055278 Ga0070710_100552783 158
495 3300005437 Ga0070710_10297910 Ga0070710_102979102 158
496 3300005437 Ga0070710_10336269 Ga0070710_103362692 158
497 3300005437 Ga0070710_10577282 Ga0070710_105772822 158
498 3300005437 Ga0070710_10611687 Ga0070710_106116872 158
499 3300005437 Ga0070710_10754729 Ga0070710_107547292 158
500 3300005439 Ga0070711_100005553 Ga0070711_1000055537 158
501 3300005439 Ga0070711_100194344 Ga0070711_1001943442 158
502 3300005439 Ga0070711_100268474 Ga0070711_1002684742 158
503 3300005439 Ga0070711_100315259 Ga0070711_1003152592 158
504 3300005455 Ga0070663_100861160 Ga0070663_1008611602 158
505 3300005455 Ga0070663_101271406 Ga0070663_1012714061 158
506 3300005456 Ga0070678_100096322 Ga0070678_1000963222 158
507 3300005458 Ga0070681_10017254 Ga0070681_100172541 158
508 3300005458 Ga0070681_10037401 Ga0070681_100374013 158
509 3300005458 Ga0070681_10075073 Ga0070681_100750733 158
510 3300005458 Ga0070681_10436888 Ga0070681_104368882 158
511 3300005467 Ga0070706_100234156 Ga0070706_1002341563 158
512 3300005467 Ga0070706_100317287 Ga0070706_1003172872 158
513 3300005467 Ga0070706_100600472 Ga0070706_1006004722 158
514 3300005471 Ga0070698_100059290 Ga0070698_1000592903 158
515 3300005471 Ga0070698_100981492 Ga0070698_1009814922 158
516 3300005518 Ga0070699_100681478 Ga0070699_1006814782 158
517 3300005530 Ga0070679_100015647 Ga0070679_1000156475 158
518 3300005530 Ga0070679_100163330 Ga0070679_1001633302 158
519 3300005535 Ga0070684_100395167 Ga0070684_1003951671 158
520 3300005535 Ga0070684_100884156 Ga0070684_1008841562 158
521 3300005536 Ga0070697_100201326 Ga0070697_1002013262 158
522 3300005539 Ga0068853_100390609 Ga0068853_1003906092 158
523 3300005539 Ga0068853_100695337 Ga0068853_1006953371 158
524 3300005547 Ga0070693_100040796 Ga0070693_1000407962 158
525 3300005547 Ga0070693_100395572 Ga0070693_1003955721 158
526 3300005563 Ga0068855_100444992 Ga0068855_1004449922 158
527 3300005563 Ga0068855_100686734 Ga0068855_1006867342 158
528 3300005563 Ga0068855_101263499 Ga0068855_1012634992 158
529 3300005564 Ga0070664_101838180 Ga0070664_1018381801 158
530 3300005577 Ga0068857_100183974 Ga0068857_1001839742 158
531 3300005577 Ga0068857_100311302 Ga0068857_1003113022 158
532 3300005578 Ga0068854_100442540 Ga0068854_1004425401 158
533 3300005578 Ga0068854_100501576 Ga0068854_1005015762 158
534 3300005614 Ga0068856_100000883 Ga0068856_10000088333 158
535 3300005614 Ga0068856_100491914 Ga0068856_1004919141 158
536 3300005614 Ga0068856_101140658 Ga0068856_1011406582 158
537 3300005614 Ga0068856_101473787 Ga0068856_1014737872 158
538 3300005614 Ga0068856_101840282 Ga0068856_1018402822 158
539 3300005616 Ga0068852_100780793 Ga0068852_1007807932 158
540 3300005616 Ga0068852_101142168 Ga0068852_1011421681 158
541 3300005616 Ga0068852_101700076 Ga0068852_1017000762 158
542 3300005840 Ga0068870_10419108 Ga0068870_104191082 158
543 3300005983 Ga0081540_1035114 Ga0081540_10351142 158
544 3300005983 Ga0081540_1055889 Ga0081540_10558892 158
545 3300006028 Ga0070717_10123888 Ga0070717_101238882 158
546 3300006028 Ga0070717_10242931 Ga0070717_102429312 158
547 3300006028 Ga0070717_10549537 Ga0070717_105495372 158
548 3300006038 Ga0075365_10434159 Ga0075365_104341592 158
549 3300006048 Ga0075363_100065058 Ga0075363_1000650582 158
550 3300006163 Ga0070715_10194769 Ga0070715_101947691 158
551 3300006163 Ga0070715_10256318 Ga0070715_102563182 158
552 3300006173 Ga0070716_100094913 Ga0070716_1000949132 158
553 3300006173 Ga0070716_101320005 Ga0070716_1013200051 158
554 3300006175 Ga0070712_100038086 Ga0070712_1000380863 158
555 3300006175 Ga0070712_100111114 Ga0070712_1001111142 158
556 3300006175 Ga0070712_100314022 Ga0070712_1003140222 158
557 3300006178 Ga0075367_10022547 Ga0075367_100225473 158
558 3300006195 Ga0075366_10397943 Ga0075366_103979432 158
559 3300006237 Ga0097621_100927645 Ga0097621_1009276452 158
560 3300006353 Ga0075370_10024394 Ga0075370_100243943 158
561 3300006358 Ga0068871_101274140 Ga0068871_1012741402 158
562 3300006881 Ga0068865_100708827 Ga0068865_1007088272 158
563 3300007265 Ga0099794_10174147 Ga0099794_101741472 158
564 3300007788 Ga0099795_10066779 Ga0099795_100667792 158
565 3300009093 Ga0105240_10551341 Ga0105240_105513412 158
566 3300009093 Ga0105240_10749887 Ga0105240_107498872 158
567 3300009093 Ga0105240_10822471 Ga0105240_108224712 158
568 3300009093 Ga0105240_11711774 Ga0105240_117117741 158
569 3300009148 Ga0105243_10393668 Ga0105243_103936682 158
570 3300009174 Ga0105241_10441133 Ga0105241_104411332 158
571 3300009174 Ga0105241_10691131 Ga0105241_106911312 158
572 3300009545 Ga0105237_11256989 Ga0105237_112569892 158
573 3300009545 Ga0105237_11267388 Ga0105237_112673882 158
574 3300009545 Ga0105237_11310150 Ga0105237_113101501 158
575 3300009551 Ga0105238_10122580 Ga0105238_101225803 158
576 3300009551 Ga0105238_10153518 Ga0105238_101535182 158
577 3300009551 Ga0105238_10589215 Ga0105238_105892152 158
578 3300009551 Ga0105238_10899903 Ga0105238_108999032 158
579 3300009551 Ga0105238_10916090 Ga0105238_109160902 158
580 3300009551 Ga0105238_11355898 Ga0105238_113558981 158
581 3300009551 Ga0105238_11573732 Ga0105238_115737321 158
582 3300009553 Ga0105249_11152751 Ga0105249_111527512 158
583 3300010159 Ga0099796_10081558 Ga0099796_100815582 158
584 3300010159 Ga0099796_10235288 Ga0099796_102352881 158
585 3300010375 Ga0105239_10526109 Ga0105239_105261091 158
586 3300011119 Ga0105246_11279383 Ga0105246_112793832 158
587 3300013100 Ga0157373_10675974 Ga0157373_106759742 158
588 3300013104 Ga0157370_10137726 Ga0157370_101377261 158
589 3300013105 Ga0157369_10021333 Ga0157369_100213332 158
590 3300013105 Ga0157369_10401604 Ga0157369_104016042 158
591 3300013296 Ga0157374_10498604 Ga0157374_104986042 158
592 3300013296 Ga0157374_11026557 Ga0157374_110265572 158
593 3300013306 Ga0163162_11000743 Ga0163162_110007432 158
594 3300013307 Ga0157372_10201797 Ga0157372_102017972 158
595 3300013307 Ga0157372_10579615 Ga0157372_105796152 158
596 3300013308 Ga0157375_10624930 Ga0157375_106249301 158
597 3300014325 Ga0163163_11391692 Ga0163163_113916922 158
598 3300017792 Ga0163161_10486050 Ga0163161_104860502 158
599 3300020070 Ga0206356_10348709 Ga0206356_103487092 158
600 3300020081 Ga0206354_10763753 Ga0206354_107637531 158
601 3300021384 Ga0213876_10169534 Ga0213876_101695342 158
602 3300021384 Ga0213876_10325057 Ga0213876_103250571 158
603 3300021384 Ga0213876_10467307 Ga0213876_104673071 158
604 3300021388 Ga0213875_10150372 Ga0213875_101503722 158
605 3300022467 Ga0224712_10096101 Ga0224712_100961012 158
606 3300025230 Ga0209563_101315 Ga0209563_1013153 158
607 3300025253 Ga0209677_100543 Ga0209677_1005436 158
608 3300025253 Ga0209677_100722 Ga0209677_10072210 158
609 3300025254 Ga0209148_1000295 Ga0209148_100029564 158
610 3300025261 Ga0209233_1002578 Ga0209233_10025782 158
611 3300025272 Ga0209455_1003238 Ga0209455_10032381 158
612 3300025272 Ga0209455_1004716 Ga0209455_10047163 158
613 3300025272 Ga0209455_1021696 Ga0209455_10216962 158
614 3300025297 Ga0209758_1001900 Ga0209758_100190013 158
615 3300025297 Ga0209758_1013412 Ga0209758_10134123 158
616 3300025299 Ga0209256_1052131 Ga0209256_10521312 158
617 3300025898 Ga0207692_10042210 Ga0207692_100422102 158
618 3300025898 Ga0207692_10152647 Ga0207692_101526472 158
619 3300025898 Ga0207692_10250021 Ga0207692_102500212 158
620 3300025898 Ga0207692_10263072 Ga0207692_102630722 158
621 3300025898 Ga0207692_10340988 Ga0207692_103409882 158
622 3300025898 Ga0207692_10616693 Ga0207692_106166932 158
623 3300025904 Ga0207647_10113451 Ga0207647_101134512 158
624 3300025906 Ga0207699_10011800 Ga0207699_100118003 158
625 3300025906 Ga0207699_10267408 Ga0207699_102674081 158
626 3300025906 Ga0207699_10504622 Ga0207699_105046222 158
627 3300025906 Ga0207699_10586267 Ga0207699_105862672 158
628 3300025910 Ga0207684_10366162 Ga0207684_103661621 158
629 3300025911 Ga0207654_10224647 Ga0207654_102246472 158
630 3300025912 Ga0207707_10008183 Ga0207707_100081834 158
631 3300025912 Ga0207707_10369948 Ga0207707_103699482 158
632 3300025912 Ga0207707_10477221 Ga0207707_104772212 158
633 3300025912 Ga0207707_10669777 Ga0207707_106697772 158
634 3300025913 Ga0207695_10071334 Ga0207695_100713342 158
635 3300025914 Ga0207671_10508006 Ga0207671_105080062 158
636 3300025915 Ga0207693_10045163 Ga0207693_100451632 158
637 3300025915 Ga0207693_10055491 Ga0207693_100554912 158
638 3300025915 Ga0207693_10263120 Ga0207693_102631202 158
639 3300025916 Ga0207663_10002736 Ga0207663_100027362 158
640 3300025920 Ga0207649_10201576 Ga0207649_102015762 158
641 3300025920 Ga0207649_10503760 Ga0207649_105037602 158
642 3300025921 Ga0207652_10129770 Ga0207652_101297703 158
643 3300025921 Ga0207652_10164815 Ga0207652_101648152 158
644 3300025921 Ga0207652_10305259 Ga0207652_103052592 158
645 3300025921 Ga0207652_10351820 Ga0207652_103518202 158
646 3300025921 Ga0207652_10610512 Ga0207652_106105122 158
647 3300025921 Ga0207652_11500576 Ga0207652_115005761 158
648 3300025922 Ga0207646_10369425 Ga0207646_103694252 158
649 3300025924 Ga0207694_10206275 Ga0207694_102062752 158
650 3300025924 Ga0207694_10266828 Ga0207694_102668282 158
651 3300025924 Ga0207694_11040842 Ga0207694_110408422 158
652 3300025928 Ga0207700_10010462 Ga0207700_100104626 158
653 3300025928 Ga0207700_10012790 Ga0207700_100127902 158
654 3300025928 Ga0207700_10029757 Ga0207700_100297573 158
655 3300025928 Ga0207700_10378915 Ga0207700_103789152 158
656 3300025928 Ga0207700_10400753 Ga0207700_104007532 158
657 3300025928 Ga0207700_10684841 Ga0207700_106848412 158
658 3300025928 Ga0207700_11148398 Ga0207700_111483982 158
659 3300025929 Ga0207664_10254380 Ga0207664_102543802 158
660 3300025929 Ga0207664_10340402 Ga0207664_103404022 158
661 3300025933 Ga0207706_10130949 Ga0207706_101309492 158
662 3300025938 Ga0207704_10708908 Ga0207704_107089082 158
663 3300025944 Ga0207661_10000878 Ga0207661_1000087811 158
664 3300025944 Ga0207661_10062380 Ga0207661_100623803 158
665 3300025944 Ga0207661_10850753 Ga0207661_108507532 158
666 3300025944 Ga0207661_11273548 Ga0207661_112735481 158
667 3300025949 Ga0207667_10144958 Ga0207667_101449582 158
668 3300025949 Ga0207667_10148791 Ga0207667_101487913 158
669 3300025949 Ga0207667_11145110 Ga0207667_111451102 158
670 3300025961 Ga0207712_10857651 Ga0207712_108576512 158
671 3300025981 Ga0207640_10356669 Ga0207640_103566692 158
672 3300026023 Ga0207677_10443850 Ga0207677_104438502 158
673 3300026041 Ga0207639_10240699 Ga0207639_102406992 158
674 3300026067 Ga0207678_10246188 Ga0207678_102461882 158
675 3300026078 Ga0207702_10000318 Ga0207702_1000031832 158
676 3300026078 Ga0207702_10312632 Ga0207702_103126322 158
677 3300026078 Ga0207702_10372300 Ga0207702_103723002 158
678 3300026116 Ga0207674_10073988 Ga0207674_100739882 158
679 3300026116 Ga0207674_10666112 Ga0207674_106661122 158
680 3300026121 Ga0207683_10083899 Ga0207683_100838992 158
681 3300026121 Ga0207683_11224932 Ga0207683_112249321 158
682 3300026142 Ga0207698_10403643 Ga0207698_104036432 158
683 3300026142 Ga0207698_10715809 Ga0207698_107158091 158
684 3300027866 Ga0209813_10024630 Ga0209813_100246302 158
685 3300028379 Ga0268266_10341670 Ga0268266_103416702 158
686 3300031238 Ga0265332_10035231 Ga0265332_100352312 158
687 3300031247 Ga0265340_10091462 Ga0265340_100914622 158
688 3300031247 Ga0265340_10217072 Ga0265340_102170722 158
689 3300031249 Ga0265339_10073499 Ga0265339_100734992 158
690 3300031250 Ga0265331_10089610 Ga0265331_100896102 158
691 3300031344 Ga0265316_10196584 Ga0265316_101965842 158
692 3300031344 Ga0265316_10588938 Ga0265316_105889382 158
693 3300031595 Ga0265313_10342930 Ga0265313_103429301 158
694 3300031616 Ga0307508_10126440 Ga0307508_101264402 158
695 3300031711 Ga0265314_10005054 Ga0265314_100050544 158
696 3300031711 Ga0265314_10220531 Ga0265314_102205311 158
697 3300032002 Ga0307416_101970837 Ga0307416_1019708372 158
698 3300032126 Ga0307415_100662739 Ga0307415_1006627392 158
699 3300033180 Ga0307510_10089264 Ga0307510_100892643 158
700 3300033180 Ga0307510_10301776 Ga0307510_103017762 158
701 3300033442 Ga0315911_1000008 Ga0315911_100000898 158
702 3300035083 Ga0373926_0033050 Ga0373926_0033050_962_1441 158
703 3300035086 Ga0373934_0023493 Ga0373934_0023493_659_1138 158
704 3300035086 Ga0373934_0096153 Ga0373934_0096153_228_707 158
705 3300035091 Ga0373951_0095136 Ga0373951_0095136_159_638 158
706 3300035111 Ga0373923_0004936 Ga0373923_0004936_1110_1589 158
707 3300035111 Ga0373923_0039874 Ga0373923_0039874_197_676 158
708 3300035111 Ga0373923_0042855 Ga0373923_0042855_234_713 158
709 3300035113 Ga0373936_0070753 Ga0373936_0070753_126_605 158
710 3300035116 Ga0373945_0015296 Ga0373945_0015296_2084_2563 158
711 3300035116 Ga0373945_0100694 Ga0373945_0100694_18_497 158
712 3300035117 Ga0373953_0078384 Ga0373953_0078384_690_1169 158
713 3300035117 Ga0373953_0247502 Ga0373953_0247502_240_719 158
714 3300035118 Ga0373954_0011463 Ga0373954_0011463_2376_2855 158
715 3300035118 Ga0373954_0174243 Ga0373954_0174243_455_934 158
716 3300035119 Ga0373956_0082067 Ga0373956_0082067_34_513 158
717 3300035119 Ga0373956_0155201 Ga0373956_0155201_71_550 158
718 3300035119 Ga0373956_0451395 Ga0373956_0451395_32_511 158
719 3300035120 Ga0373957_0120048 Ga0373957_0120048_75_554 158
720 3300035170 Ga0373943_0141500 Ga0373943_0141500_714_1193 158
721 3300035170 Ga0373943_0463427 Ga0373943_0463427_163_642 158
722 3300035171 Ga0373946_0014322 Ga0373946_0014322_2025_2504 158
723 3300035171 Ga0373946_0482002 Ga0373946_0482002_122_601 158
724 3300035172 Ga0373955_0004380 Ga0373955_0004380_2828_3307 158
725 3300035172 Ga0373955_0051079 Ga0373955_0051079_1621_2100 158
726 3300035410 Ga0373924_0033451 Ga0373924_0033451_16_495 158
727 3300035410 Ga0373924_0093920 Ga0373924_0093920_211_690 158
728 3300035692 Ga0373935_0001267 Ga0373935_0001267_3608_4087 158
729 3300035692 Ga0373935_0039786 Ga0373935_0039786_1596_2075 158
730 3300035695 Ga0373927_0000766 Ga0373927_0000766_12732_13211 158
731 3300035695 Ga0373927_0006724 Ga0373927_0006724_3837_4316 158
732 3300035695 Ga0373927_0200773 Ga0373927_0200773_75_554 158
733 3300035695 Ga0373927_0288502 Ga0373927_0288502_208_687 158
734 3300035695 Ga0373927_0349402 Ga0373927_0349402_391_870 158
735 3300035724 Ga0373933_0000218 Ga0373933_0000218_11867_12343 158
736 3300035724 Ga0373933_0231444 Ga0373933_0231444_344_823 158
737 3300035724 Ga0373933_0356576 Ga0373933_0356576_358_837 158
738 3300035725 Ga0373947_0000310 Ga0373947_0000310_14292_14771 158
739 3300035725 Ga0373947_0013664 Ga0373947_0013664_2204_2683 158
740 3300035725 Ga0373947_0374672 Ga0373947_0374672_230_709 158
741 3300036401 Ga0373937_0014630 Ga0373937_0014630_5227_5706 158
742 3300037068 Ga0373925_0006419 Ga0373925_0006419_3952_4431 158
743 3300037068 Ga0373925_0021485 Ga0373925_0021485_684_1163 158
744 3300037068 Ga0373925_0078313 Ga0373925_0078313_1114_1593 158
745 3300037068 Ga0373925_0654343 Ga0373925_0654343_90_569 158
746 3300037418 Ga0395900_0032832 Ga0395900_0032832_3699_4178 158
747 3300037418 Ga0395900_0108628 Ga0395900_0108628_1887_2363 158
748 3300037418 Ga0395900_0199177 Ga0395900_0199177_67_546 158
749 3300037466 Ga0395898_0089031 Ga0395898_0089031_2027_2506 158
750 3300037466 Ga0395898_0631023 Ga0395898_0631023_189_668 158
751 3300037471 Ga0395905_0048135 Ga0395905_0048135_1785_2264 158
752 3300037853 Ga0436364_0331795 Ga0436364_0331795_1016_1495 158
753 3300037853 Ga0436364_0603569 Ga0436364_0603569_331_810 158
754 3300038443 Ga0395901_0113781 Ga0395901_0113781_1612_2088 158
755 3300038443 Ga0395901_0297332 Ga0395901_0297332_236_715 158
756 3300039437 Ga0436365_0118730 Ga0436365_0118730_244_723 158
757 3300039437 Ga0436365_0135384 Ga0436365_0135384_474_950 158
758 3300039437 Ga0436365_0279102 Ga0436365_0279102_2159_2638 158
759 3300039453 Ga0436362_0249161 Ga0436362_0249161_75_554 158
760 3300039453 Ga0436362_1201460 Ga0436362_1201460_46_525 158
761 3300044656 Ga0466969_0093259 Ga0466969_0093259_704_1183 158
762 3300044658 Ga0466972_0029548 Ga0466972_0029548_385_864 158
763 3300044693 Ga0466961_0156035 Ga0466961_0156035_922_1398 158
764 3300044694 Ga0466963_0258548 Ga0466963_0258548_571_1050 158
765 3300044694 Ga0466963_0996490 Ga0466963_0996490_92_571 158
766 3300044719 Ga0466971_0156462 Ga0466971_0156462_106_585 158
767 3300044735 Ga0466968_0379186 Ga0466968_0379186_201_680 158
768 3300044765 Ga0466970_0260390 Ga0466970_0260390_378_863 158
769 3300044842 Ga0466957_0080078 Ga0466957_0080078_249_728 158
770 3300044842 Ga0466957_0237937 Ga0466957_0237937_707_1186 158
771 3300044842 Ga0466957_0297429 Ga0466957_0297429_114_593 158
772 3300044842 Ga0466957_0427749 Ga0466957_0427749_306_785 158
773 3300044901 Ga0466960_0181359 Ga0466960_0181359_405_884 158
774 3300045049 Ga0466959_0048894 Ga0466959_0048894_1221_1697 158
775 3300045976 Ga0466967_0028253 Ga0466967_0028253_3925_4404 158
776 3300045976 Ga0466967_0062009 Ga0466967_0062009_74_550 158
777 3300045976 Ga0466967_0204967 Ga0466967_0204967_1223_1702 158
778 3300045976 Ga0466967_1213654 Ga0466967_1213654_241_720 158
779 3300046452 Ga0495617_107272 Ga0495617_107272_178_657 158
780 3300046454 Ga0495592_0102991 Ga0495592_0102991_536_1015 158
781 3300046454 Ga0495592_0142617 Ga0495592_0142617_474_953 158
782 3300046455 Ga0495603_0000936 Ga0495603_0000936_3020_3499 158
783 3300046455 Ga0495603_0105542 Ga0495603_0105542_509_988 158
784 3300046455 Ga0495603_0237833 Ga0495603_0237833_61_540 158
785 3300046459 Ga0495629_0001416 Ga0495629_0001416_13716_14195 158
786 3300046459 Ga0495629_0633985 Ga0495629_0633985_218_697 158
787 3300046460 Ga0495638_0317616 Ga0495638_0317616_242_721 158
788 3300046461 Ga0495641_0016464 Ga0495641_0016464_2898_3377 158
789 3300046461 Ga0495641_0138934 Ga0495641_0138934_22_501 158
790 3300046462 Ga0495651_0019880 Ga0495651_0019880_2557_3036 158
791 3300046462 Ga0495651_0178579 Ga0495651_0178579_854_1333 158
792 3300046463 Ga0495653_0049261 Ga0495653_0049261_2156_2635 158
793 3300046463 Ga0495653_0117625 Ga0495653_0117625_488_967 158
794 3300046472 Ga0495580_0005025 Ga0495580_0005025_3981_4460 158
795 3300046472 Ga0495580_0006058 Ga0495580_0006058_6688_7167 158
796 3300046472 Ga0495580_0514895 Ga0495580_0514895_89_568 158
797 3300046473 Ga0495582_0018773 Ga0495582_0018773_1139_1618 158
798 3300046473 Ga0495582_0038113 Ga0495582_0038113_1646_2125 158
799 3300046473 Ga0495582_0124167 Ga0495582_0124167_947_1426 158
800 3300046475 Ga0495639_0000072 Ga0495639_0000072_19757_20236 158
801 3300046476 Ga0495662_0000572 Ga0495662_0000572_14255_14734 158
802 3300046476 Ga0495662_0185583 Ga0495662_0185583_446_925 158
803 3300046476 Ga0495662_0217863 Ga0495662_0217863_381_860 158
804 3300046477 Ga0495664_0014835 Ga0495664_0014835_3221_3700 158
805 3300046477 Ga0495664_0045196 Ga0495664_0045196_1853_2332 158
806 3300046499 Ga0495594_0000046 Ga0495594_0000046_30567_31046 158
807 3300046499 Ga0495594_0297721 Ga0495594_0297721_143_622 158
808 3300046507 Ga0495606_0168025 Ga0495606_0168025_743_1222 158
809 3300046511 Ga0495608_0323669 Ga0495608_0323669_47_526 158
810 3300046511 Ga0495608_0637386 Ga0495608_0637386_13_492 158
811 3300046512 Ga0495610_0029757 Ga0495610_0029757_215_694 158
812 3300046514 Ga0495618_0100704 Ga0495618_0100704_840_1319 158
813 3300046514 Ga0495618_0186351 Ga0495618_0186351_676_1155 158
814 3300046515 Ga0495620_0229342 Ga0495620_0229342_139_618 158
815 3300046516 Ga0495628_0018626 Ga0495628_0018626_4059_4538 158
816 3300046516 Ga0495628_0033483 Ga0495628_0033483_1761_2240 158
817 3300046516 Ga0495628_0327775 Ga0495628_0327775_23_502 158
818 3300046516 Ga0495628_0517885 Ga0495628_0517885_91_570 158
819 3300046517 Ga0495630_0024634 Ga0495630_0024634_1008_1487 158
820 3300046517 Ga0495630_0093534 Ga0495630_0093534_1411_1890 158
821 3300046517 Ga0495630_0154765 Ga0495630_0154765_319_798 158
822 3300046517 Ga0495630_0513814 Ga0495630_0513814_246_725 158
823 3300046518 Ga0495631_0334536 Ga0495631_0334536_78_557 158
824 3300046523 Ga0495644_0153157 Ga0495644_0153157_138_617 158
825 3300046524 Ga0495648_0249358 Ga0495648_0249358_223_702 158
826 3300046526 Ga0495666_0041837 Ga0495666_0041837_1363_1842 158
827 3300046531 Ga0495665_0000335 Ga0495665_0000335_1330_1809 158
828 3300046533 Ga0495640_0002138 Ga0495640_0002138_12239_12718 158
829 3300046533 Ga0495640_0051516 Ga0495640_0051516_581_1060 158
830 3300046535 Ga0495586_0059346 Ga0495586_0059346_303_782 158
831 3300046536 Ga0495587_0345412 Ga0495587_0345412_77_556 158
832 3300046538 Ga0495609_0119716 Ga0495609_0119716_63_542 158
833 3300046543 Ga0495645_0013978 Ga0495645_0013978_4740_5219 158
834 3300046543 Ga0495645_0036237 Ga0495645_0036237_1507_1986 158
835 3300046557 Ga0495622_0084671 Ga0495622_0084671_225_704 158
836 3300046558 Ga0495633_0312506 Ga0495633_0312506_127_606 158
837 3300046559 Ga0495667_0032717 Ga0495667_0032717_2845_3324 158
838 3300046559 Ga0495667_0803522 Ga0495667_0803522_41_520 158
839 3300046616 Ga0495668_0168169 Ga0495668_0168169_506_985 158
840 3300046642 Ga0495634_0003037 Ga0495634_0003037_11125_11604 158
841 3300046642 Ga0495634_0044482 Ga0495634_0044482_1711_2190 158
842 3300046648 Ga0495611_0066313 Ga0495611_0066313_983_1462 158
843 3300046648 Ga0495611_0300332 Ga0495611_0300332_133_612 158
844 3300046663 Ga0495635_0002038 Ga0495635_0002038_12634_13113 158
845 3300046663 Ga0495635_0016231 Ga0495635_0016231_840_1319 158
846 3300046663 Ga0495635_0089467 Ga0495635_0089467_13_492 158
847 3300046675 Ga0495657_0121602 Ga0495657_0121602_663_1142 158
848 3300046678 Ga0495599_0128792 Ga0495599_0128792_540_1019 158
849 3300046678 Ga0495599_0191494 Ga0495599_0191494_489_968 158
850 3300046678 Ga0495599_0306147 Ga0495599_0306147_65_544 158
851 3300046678 Ga0495599_0644747 Ga0495599_0644747_49_528 158
852 3300046679 Ga0495623_0075175 Ga0495623_0075175_1386_1865 158
853 3300046680 Ga0495646_0066903 Ga0495646_0066903_1176_1655 158
854 3300046680 Ga0495646_0081016 Ga0495646_0081016_657_1136 158
855 3300046680 Ga0495646_0119658 Ga0495646_0119658_883_1362 158
856 3300046680 Ga0495646_0481522 Ga0495646_0481522_29_508 158
857 3300046681 Ga0495647_0008783 Ga0495647_0008783_895_1374 158
858 3300046681 Ga0495647_0016367 Ga0495647_0016367_1679_2158 158
859 3300046683 Ga0495658_0002742 Ga0495658_0002742_2641_3120 158
860 3300046683 Ga0495658_0009522 Ga0495658_0009522_4091_4570 158
861 3300046684 Ga0495669_0124118 Ga0495669_0124118_609_1088 158
862 3300046684 Ga0495669_0198256 Ga0495669_0198256_58_537 158
863 3300046689 Ga0495613_0081505 Ga0495613_0081505_1144_1623 158
864 3300046689 Ga0495613_0148666 Ga0495613_0148666_627_1106 158
865 3300046690 Ga0495624_0000795 Ga0495624_0000795_14276_14755 158
866 3300046690 Ga0495624_0056079 Ga0495624_0056079_200_679 158
867 3300046794 Ga0495589_0135740 Ga0495589_0135740_298_777 158
868 3300046809 Ga0495600_0093192 Ga0495600_0093192_641_1120 158
869 3300046809 Ga0495600_0115281 Ga0495600_0115281_1109_1588 158
870 3300047315 Ga0495581_0000030 Ga0495581_0000030_22110_22589 158
871 3300047315 Ga0495581_0126320 Ga0495581_0126320_217_696 158
872 3300047315 Ga0495581_0144120 Ga0495581_0144120_68_547 158
873 3300047317 Ga0495604_0105989 Ga0495604_0105989_1101_1580 158
874 3300047319 Ga0495674_0012381 Ga0495674_0012381_2909_3388 158
875 3300047319 Ga0495674_0026440 Ga0495674_0026440_4540_5019 158
876 3300047319 Ga0495674_0170500 Ga0495674_0170500_79_558 158
877 3300047320 Ga0495672_0019292 Ga0495672_0019292_716_1195 158
878 3300047321 Ga0495676_0028804 Ga0495676_0028804_887_1366 158
879 3300047321 Ga0495676_0426845 Ga0495676_0426845_50_529 158
880 3300047322 Ga0495680_0139443 Ga0495680_0139443_1072_1551 158
881 3300047322 Ga0495680_0289892 Ga0495680_0289892_352_831 158
882 3300047444 Ga0495675_0384899 Ga0495675_0384899_124_603 158
883 3300047471 Ga0495684_0021000 Ga0495684_0021000_4005_4484 158
884 3300047471 Ga0495684_0053297 Ga0495684_0053297_346_825 158
885 3300047472 Ga0495686_0085355 Ga0495686_0085355_566_1045 158
886 3300047472 Ga0495686_0171913 Ga0495686_0171913_85_564 158
887 3300047673 Ga0495593_0000398 Ga0495593_0000398_19884_20363 158
888 3300047673 Ga0495593_0181923 Ga0495593_0181923_555_1034 158
889 3300048089 Ga0495614_0046075 Ga0495614_0046075_70_549 158
890 3300048903 Ga0496100_0369385 Ga0496100_0369385_325_804 158
891 3300048904 Ga0496101_0859744 Ga0496101_0859744_197_676 158
892 3300048904 Ga0496101_1368899 Ga0496101_1368899_21_500 158
893 3300048905 Ga0496102_0082256 Ga0496102_0082256_2465_2944 158
894 3300048906 Ga0496103_0527388 Ga0496103_0527388_251_730 158
895 3300048906 Ga0496103_0636678 Ga0496103_0636678_140_616 158
896 3300048907 Ga0496104_0548848 Ga0496104_0548848_338_817 158
897 3300048908 Ga0496105_0852426 Ga0496105_0852426_82_561 158
898 3300048909 Ga0496106_0766736 Ga0496106_0766736_86_562 158
899 3300048910 Ga0496107_0114537 Ga0496107_0114537_1235_1711 158
900 3300048910 Ga0496107_1098843 Ga0496107_1098843_82_561 158
901 3300048911 Ga0496108_0060709 Ga0496108_0060709_2028_2507 158
902 3300048913 Ga0496110_1252080 Ga0496110_1252080_85_564 158
903 3300048914 Ga0496111_0680391 Ga0496111_0680391_186_665 158
904 3300048915 Ga0496112_0049766 Ga0496112_0049766_507_986 158
905 3300048918 Ga0496115_0150310 Ga0496115_0150310_485_964 158
906 3300048918 Ga0496115_0281240 Ga0496115_0281240_44_520 158
907 3300048918 Ga0496115_0439175 Ga0496115_0439175_391_870 158
908 3300048919 Ga0496116_0159299 Ga0496116_0159299_150_629 158
909 3300048920 Ga0496117_0060867 Ga0496117_0060867_1122_1601 158
910 3300048920 Ga0496117_0277004 Ga0496117_0277004_294_773 158
911 3300048921 Ga0496118_0316502 Ga0496118_0316502_128_604 158
912 3300048921 Ga0496118_0410405 Ga0496118_0410405_107_586 158
913 3300048922 Ga0496119_0147277 Ga0496119_0147277_548_1027 158
914 3300048924 Ga0496121_0000278 Ga0496121_0000278_48593_49072 158
915 3300048924 Ga0496121_0035287 Ga0496121_0035287_193_672 158
916 3300048924 Ga0496121_0071562 Ga0496121_0071562_620_1099 158
917 3300048924 Ga0496121_0125511 Ga0496121_0125511_613_1089 158
918 3300048924 Ga0496121_0518333 Ga0496121_0518333_54_530 158
919 3300048927 Ga0496124_0248160 Ga0496124_0248160_256_735 158
920 3300048929 Ga0496126_0034975 Ga0496126_0034975_3386_3865 158
921 3300048929 Ga0496126_0162691 Ga0496126_0162691_1030_1509 158
922 3300049570 Ga0501033_0597713 Ga0501033_0597713_153_632 158
923 3300049581 Ga0501047_0041970 Ga0501047_0041970_1976_2455 158
924 3300049582 Ga0501048_0522722 Ga0501048_0522722_142_621 158
925 3300049583 Ga0501067_0050483 Ga0501067_0050483_1448_1927 158
926 3300049586 Ga0501070_0248474 Ga0501070_0248474_276_755 158
927 3300049742 Ga0501080_0128602 Ga0501080_0128602_691_1170 158
928 3300049823 Ga0501044_0083186 Ga0501044_0083186_2509_2988 158
929 3300050489 nmdc:mga03683_210539_c1 nmdc:mga03683_210539_c1_144_623 158
930 3300050490 nmdc:mga03n38_14558_c1 nmdc:mga03n38_14558_c1_662_1141 158
931 3300050494 nmdc:mga06z11_11045_c1 nmdc:mga06z11_11045_c1_1451_1930 158
932 3300050494 nmdc:mga06z11_583410_c1 nmdc:mga06z11_583410_c1_117_596 158
933 3300050495 nmdc:mga04h51_29235_c1 nmdc:mga04h51_29235_c1_330_809 158
934 3300050496 nmdc:mga07m45_13114_c1 nmdc:mga07m45_13114_c1_1679_2158 158
935 3300053077 Ga0495601_0017256 Ga0495601_0017256_358_837 158
936 3300053077 Ga0495601_0136693 Ga0495601_0136693_122_601 158
937 3300053077 Ga0495601_0343333 Ga0495601_0343333_443_922 158
938 3300053079 Ga0500610_0041583 Ga0500610_0041583_1794_2273 158
939 3300053084 Ga0495595_0219991 Ga0495595_0219991_359_838 158
940 3300053085 Ga0495619_0236354 Ga0495619_0236354_717_1196 158
941 3300053085 Ga0495619_0241630 Ga0495619_0241630_532_1011 158
942 3300053087 Ga0500643_000112 Ga0500643_000112_9238_9717 158
943 3300053088 Ga0500644_0362520 Ga0500644_0362520_139_618 158
944 3300053092 Ga0500583_0166310 Ga0500583_0166310_236_715 158
945 3300053093 Ga0500651_0033603 Ga0500651_0033603_594_1073 158
946 3300053093 Ga0500651_0258387 Ga0500651_0258387_496_975 158
947 3300053094 Ga0500566_0011791 Ga0500566_0011791_798_1277 158
948 3300053095 Ga0500640_009445 Ga0500640_009445_1079_1558 158
949 3300053096 Ga0500641_0060146 Ga0500641_0060146_343_822 158
950 3300053098 Ga0500650_0192335 Ga0500650_0192335_202_681 158
951 3300053101 Ga0500553_133854 Ga0500553_133854_46_525 158
952 3300053103 Ga0500555_004419 Ga0500555_004419_222_701 158
953 3300053109 Ga0500569_051549 Ga0500569_051549_53_532 158
954 3300053109 Ga0500569_085728 Ga0500569_085728_330_809 158
955 3300053111 Ga0500572_072413 Ga0500572_072413_572_1051 158
956 3300053116 Ga0500592_014816 Ga0500592_014816_554_1033 158
957 3300053116 Ga0500592_033615 Ga0500592_033615_144_623 158
958 3300053118 Ga0500594_0253250 Ga0500594_0253250_53_532 158
959 3300053119 Ga0500595_006803 Ga0500595_006803_1944_2423 158
960 3300053119 Ga0500595_014698 Ga0500595_014698_975_1454 158
961 3300053119 Ga0500595_027760 Ga0500595_027760_528_1007 158
962 3300053121 Ga0500607_085637 Ga0500607_085637_976_1455 158
963 3300053123 Ga0500614_108692 Ga0500614_108692_243_722 158
964 3300053123 Ga0500614_193217 Ga0500614_193217_115_594 158
965 3300053130 Ga0500642_0000362 Ga0500642_0000362_51_530 158
966 3300053130 Ga0500642_0000641 Ga0500642_0000641_85_564 158
967 3300053130 Ga0500642_0066658 Ga0500642_0066658_1012_1491 158
968 3300053134 Ga0500658_0381921 Ga0500658_0381921_24_503 158
969 3300053139 Ga0500568_0067550 Ga0500568_0067550_268_747 158
970 3300053139 Ga0500568_0129529 Ga0500568_0129529_437_916 158
971 3300053142 Ga0500577_0098647 Ga0500577_0098647_554_1033 158
972 3300053146 Ga0500588_0101524 Ga0500588_0101524_331_810 158
973 3300053148 Ga0500590_223751 Ga0500590_223751_11_490 158
974 3300053151 Ga0500604_0089581 Ga0500604_0089581_434_913 158
975 3300053153 Ga0500616_0139503 Ga0500616_0139503_281_760 158
976 3300053156 Ga0500622_0229091 Ga0500622_0229091_12_491 158
977 3300053158 Ga0500627_0203270 Ga0500627_0203270_352_831 158
978 3300053162 Ga0500638_222988 Ga0500638_222988_52_531 158
979 3300053178 Ga0500637_0186572 Ga0500637_0186572_442_921 158
980 3300053724 Ga0500570_106621 Ga0500570_106621_449_928 158
981 3300053731 Ga0500609_006652 Ga0500609_006652_940_1419 158
982 3300059503 Ga0587080_148527 Ga0587080_148527_33_512 158
983 3300059505 Ga0587083_0147968 Ga0587083_0147968_115_594 158
984 3300059641 Ga0587068_101443 Ga0587068_101443_91_570 158
985 3300059643 Ga0587072_123946 Ga0587072_123946_64_543 158
986 3300059644 Ga0587075_040357 Ga0587075_040357_34_513 158
987 3300059645 Ga0587076_075966 Ga0587076_075966_204_683 158
988 3300060344 Ga0587071_046432 Ga0587071_046432_376_855 158
989 3300061719 Ga0466962_0031673 Ga0466962_0031673_718_1197 158
990 3300061719 Ga0466962_0128009 Ga0466962_0128009_671_1150 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07617

DUF1579

Protein of unknown function (DUF1579)

6

96

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfn-assembly1.cif.gz_A crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8715 7 158
7sfn-assembly1.cif.gz_A crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8551 7 158
7sfn-assembly1.cif.gz_B crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.836 1 158
7sfn-assembly1.cif.gz_B crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.831 1 158
7sfp-assembly1.cif.gz_A crystal structure of osso, a spirocyclase involved in the biosynthesis of ossamycin 0.803 7 157
ID Description Score Start End Superfamily
af_Q556I7_1_158_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.814 11 157 2.40.128.20
af_A0A2C9C2Z6_71_253_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7961 11 157 2.40.128.20
af_Q5N900_107_401_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7919 108 158 3.40.50.150
af_Q22857_66_227_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7896 9 158 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7882 7 157 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A537XP13-F1-model_v4 DUF1579 domain-containing protein 0.9873 33 158
AF-A0A7Y4GZB7-F1-model_v4 DUF1579 domain-containing protein 0.9818 1 158
AF-A0A534NU50-F1-model_v4 DUF1579 domain-containing protein 0.9817 5 157
AF-A0A431RL37-F1-model_v4 deleted 0.9801 1 140
AF-A0A537XP13-F1-model_v4 DUF1579 domain-containing protein 0.9796 33 158

Feature Viewer

pLDDT pTM Quality
94.15 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map