F487626

General Info

Members Datasets Scaffolds Average Seq Length
991 355 976 239

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10110627|rootL2_101106272
Length 272
Sequence MKTLSETWFADGYIDFELKKYTLLAYLQEIHQHFSQNKLYPQLSDIIFHYNNLVAFRENKKYLQEQFPKKLTGVQIEKLQVLYELLIEDDELMQELEDIINYASQEMKSAISSGTEIYEFVEDKLTIFPVGLIPLDNHEGYFFLSEGSYSDTRVYQYRLSFFEKHDERYRSIRTEYIDSWTRNMVNTYENIKAELIRVKTAMPNPAVYSIETELKFPVDETLLPIAKRSLVRYISTPVISLHQGIFFIFMKWCIAINKIDQPEFNFVSFPFK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
5 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
6 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
7 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
8 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
9 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
10 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
11 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
12 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
13 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
14 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
15 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
16 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
212 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
233 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
236 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
237 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
238 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
239 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
240 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
241 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
242 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
278 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
296 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
297 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
298 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
299 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
300 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
301 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
302 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
303 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
304 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
305 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
306 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
307 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
308 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
309 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
310 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
311 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
312 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
313 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
314 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
315 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
316 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
317 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
322 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
333 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
334 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
335 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
336 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
337 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
338 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
339 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
343 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
344 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
345 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
346 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
347 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
348 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
349 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
350 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
351 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
352 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0
Isolates 1.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.06
Nodule 0
Rhizoplane 0.2
Rhizosphere 86.68
Stem 0
Stem Tuber 0
Unclassified 6.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1763716 2162886007 Unclassified 1771
2 JGI24736J21556_1010067 3300001904 Bacteria 1549
3 JGI24740J21852_10009246 3300001979 Bacteria 3868
4 JGI24740J21852_10027647 3300001979 Bacteria 1885
5 JGI24751J29686_10043817 3300002459 Bacteria 925
6 JGI25154J39366_1000014 3300002738 Bacteria 265287
7 JGI25406J46586_10010665 3300003203 Bacteria 4067
8 JGI25153J46596_10018336 3300003215 Bacteria 2723
9 JGI25153J46596_10048003 3300003215 Bacteria 1251
10 rootH2_10008932 3300003320 Bacteria 37271
11 rootH2_10009459 3300003320 Bacteria 2099
12 rootH2_10009460 3300003320 Bacteria 1248
13 rootH2_10014077 3300003320 Bacteria 4191
14 rootH2_10041861 3300003320 Bacteria 17793
15 rootH2_10097088 3300003320 Bacteria 5060
16 rootH2_10133384 3300003320 Bacteria 1526
17 rootH2_10187341 3300003320 Bacteria 2901
18 rootH2_10287768 3300003320 Bacteria 1573
19 rootL2_10066602 3300003322 Bacteria 3899
20 rootL2_10110627 3300003322 Bacteria 4370
21 rootL2_10178503 3300003322 Bacteria 2274
22 rootL2_10252348 3300003322 Bacteria 1178
23 rootL2_10296671 3300003322 Bacteria 1416
24 rootH1_10091661 3300003323 Bacteria 6486
25 rootH1_10092711 3300003323 Bacteria 1942
26 rootH1_10146227 3300003323 Bacteria 10114
27 rootH1_10149908 3300003323 Bacteria 2031
28 rootH1_10156460 3300003323 Bacteria 1805
29 rootH1_10309255 3300003323 Bacteria 1323
30 JGI25160J50197_1008228 3300003354 Bacteria 3991
31 JGI25160J50197_1008916 3300003354 Bacteria 3770
32 JGI25160J50197_1015038 3300003354 Bacteria 2559
33 JGI25160J50197_1025790 3300003354 Bacteria 1635
34 Ga0055542_1004837 3300003762 Bacteria 3156
35 Ga0055528_1001076 3300003790 Bacteria 18002
36 Ga0055530_10000707 3300003791 Bacteria 28075
37 Ga0055531_10000093 3300003794 Bacteria 97901
38 Ga0055543_1019289 3300004625 Unclassified 1263
39 Ga0065165_1000036 3300005262 Bacteria 212900
40 Ga0065165_1024369 3300005262 Bacteria 2034
41 Ga0065165_1061452 3300005262 Bacteria 1028
42 Ga0065704_10121130 3300005289 Unclassified 1771
43 Ga0065712_10029724 3300005290 Bacteria 1940
44 Ga0065715_10106144 3300005293 Bacteria 2842
45 Ga0065707_10156284 3300005295 Bacteria 1606
46 Ga0070658_10002948 3300005327 Bacteria 14112
47 Ga0070658_10005453 3300005327 Bacteria 10313
48 Ga0070658_10020168 3300005327 Bacteria 5340
49 Ga0070658_10266824 3300005327 Bacteria 1455
50 Ga0070658_10758694 3300005327 Bacteria 842
51 Ga0070676_10001904 3300005328 Bacteria 10604
52 Ga0070676_10062169 3300005328 Unclassified 2221
53 Ga0070683_100006532 3300005329 Bacteria 9793
54 Ga0070683_100045232 3300005329 Bacteria 4063
55 Ga0070683_100064309 3300005329 Bacteria 3415
56 Ga0070683_100070065 3300005329 Bacteria 3271
57 Ga0070683_100396763 3300005329 Bacteria 1315
58 Ga0070683_100652963 3300005329 Unclassified 1007
59 Ga0070690_100415821 3300005330 Unclassified 990
60 Ga0070670_100031739 3300005331 Bacteria 4550
61 Ga0070670_100063065 3300005331 Bacteria 3180
62 Ga0070670_100133226 3300005331 Unclassified 2147
63 Ga0070670_100185995 3300005331 Bacteria 1804
64 Ga0070670_100340430 3300005331 Unclassified 1316
65 Ga0070670_100355289 3300005331 Bacteria 1288
66 Ga0070670_100373312 3300005331 Bacteria 1256
67 Ga0070670_100431894 3300005331 Unclassified 1165
68 Ga0070670_100714569 3300005331 Bacteria 902
69 Ga0070677_10262856 3300005333 Bacteria 862
70 Ga0068869_100031459 3300005334 Bacteria 3733
71 Ga0068869_100109898 3300005334 Bacteria 2096
72 Ga0068869_100130791 3300005334 Bacteria 1929
73 Ga0068869_100442492 3300005334 Bacteria 1076
74 Ga0068869_100869694 3300005334 Unclassified 778
75 Ga0070666_10000247 3300005335 Bacteria 36276
76 Ga0070666_10000885 3300005335 Bacteria 18201
77 Ga0070666_10057807 3300005335 Bacteria 2621
78 Ga0070666_10167108 3300005335 Bacteria 1539
79 Ga0070680_100002380 3300005336 Bacteria 13907
80 Ga0070680_100023180 3300005336 Bacteria 4948
81 Ga0070680_100258005 3300005336 Bacteria 1474
82 Ga0070682_100010074 3300005337 Bacteria 5357
83 Ga0070682_100013374 3300005337 Bacteria 4719
84 Ga0070682_100230413 3300005337 Bacteria 1324
85 Ga0070682_100290170 3300005337 Bacteria 1196
86 Ga0070682_100323963 3300005337 Bacteria 1139
87 Ga0068868_100000075 3300005338 Bacteria 58452
88 Ga0068868_100013056 3300005338 Bacteria 6081
89 Ga0068868_100068306 3300005338 Bacteria 2830
90 Ga0068868_100088975 3300005338 Bacteria 2485
91 Ga0068868_100102340 3300005338 Bacteria 2319
92 Ga0068868_100213039 3300005338 Bacteria 1615
93 Ga0068868_100238090 3300005338 Unclassified 1528
94 Ga0068868_100734692 3300005338 Unclassified 886
95 Ga0070660_100142760 3300005339 Bacteria 1922
96 Ga0070660_100249257 3300005339 Bacteria 1448
97 Ga0070689_100027122 3300005340 Bacteria 4316
98 Ga0070689_100074988 3300005340 Bacteria 2647
99 Ga0070689_100583446 3300005340 Unclassified 966
100 Ga0070691_10040723 3300005341 Bacteria 2196
101 Ga0070661_100083927 3300005344 Bacteria 2353
102 Ga0070661_100218436 3300005344 Bacteria 1461
103 Ga0070661_100239428 3300005344 Bacteria 1397
104 Ga0070661_100474396 3300005344 Unclassified 998
105 Ga0070668_100000859 3300005347 Bacteria 21121
106 Ga0070668_100138352 3300005347 Bacteria 1960
107 Ga0070668_100300827 3300005347 Bacteria 1345
108 Ga0070669_100115704 3300005353 Bacteria 2040
109 Ga0070669_100243810 3300005353 Bacteria 1429
110 Ga0070669_100312009 3300005353 Bacteria 1268
111 Ga0070675_100002335 3300005354 Bacteria 14099
112 Ga0070675_100261587 3300005354 Bacteria 1516
113 Ga0070675_100304470 3300005354 Bacteria 1405
114 Ga0070675_100393707 3300005354 Bacteria 1235
115 Ga0070675_100621897 3300005354 Bacteria 980
116 Ga0070671_100011147 3300005355 Bacteria 7219
117 Ga0070671_100059311 3300005355 Bacteria 3184
118 Ga0070671_100082473 3300005355 Unclassified 2688
119 Ga0070671_100540540 3300005355 Bacteria 1004
120 Ga0070674_100141000 3300005356 Bacteria 1809
121 Ga0070674_100355722 3300005356 Bacteria 1184
122 Ga0070673_100000448 3300005364 Bacteria 21839
123 Ga0070673_100060234 3300005364 Bacteria 3007
124 Ga0070673_100113380 3300005364 Bacteria 2251
125 Ga0070673_100129828 3300005364 Bacteria 2113
126 Ga0070688_100141765 3300005365 Bacteria 1633
127 Ga0070688_100282480 3300005365 Bacteria 1193
128 Ga0070659_100000828 3300005366 Bacteria 22546
129 Ga0070659_100001692 3300005366 Bacteria 15868
130 Ga0070659_100156699 3300005366 Bacteria 1860
131 Ga0070667_100000482 3300005367 Bacteria 40557
132 Ga0070667_100003979 3300005367 Bacteria 12525
133 Ga0070667_100042511 3300005367 Bacteria 3813
134 Ga0070667_100066306 3300005367 Bacteria 3067
135 Ga0070667_100460163 3300005367 Bacteria 1163
136 Ga0070700_100143578 3300005441 Bacteria 1625
137 Ga0070663_100042799 3300005455 Bacteria 3184
138 Ga0070663_100664288 3300005455 Bacteria 883
139 Ga0070678_100084340 3300005456 Bacteria 2418
140 Ga0070678_100220271 3300005456 Bacteria 1577
141 Ga0070678_100389306 3300005456 Bacteria 1208
142 Ga0070678_100487863 3300005456 Bacteria 1085
143 Ga0070678_100495465 3300005456 Bacteria 1077
144 Ga0070678_100504184 3300005456 Bacteria 1068
145 Ga0070678_100613397 3300005456 Bacteria 972
146 Ga0070662_100002983 3300005457 Bacteria 10519
147 Ga0070662_100029479 3300005457 Bacteria 3830
148 Ga0070662_100369440 3300005457 Bacteria 1179
149 Ga0070681_10059457 3300005458 Bacteria 3802
150 Ga0070681_10115068 3300005458 Bacteria 2628
151 Ga0070681_10527626 3300005458 Bacteria 1094
152 Ga0068867_100005606 3300005459 Bacteria 8895
153 Ga0068867_100013182 3300005459 Bacteria 5855
154 Ga0068867_100103322 3300005459 Bacteria 2179
155 Ga0068867_100176404 3300005459 Bacteria 1696
156 Ga0068867_100191364 3300005459 Bacteria 1633
157 Ga0068867_100233512 3300005459 Unclassified 1488
158 Ga0068867_100378076 3300005459 Bacteria 1189
159 Ga0070685_10001175 3300005466 Bacteria 14009
160 Ga0070685_10047256 3300005466 Bacteria 2474
161 Ga0070706_100403127 3300005467 Bacteria 1273
162 Ga0070706_100478269 3300005467 Bacteria 1159
163 Ga0070698_100001454 3300005471 Bacteria 26303
164 Ga0070698_100188702 3300005471 Bacteria 1999
165 Ga0070698_100287347 3300005471 Bacteria 1576
166 Ga0070679_100001831 3300005530 Bacteria 19163
167 Ga0070679_100026151 3300005530 Bacteria 5729
168 Ga0070679_100632879 3300005530 Bacteria 1013
169 Ga0070684_100002043 3300005535 Bacteria 14865
170 Ga0070684_100002647 3300005535 Bacteria 13212
171 Ga0070684_100036799 3300005535 Bacteria 4195
172 Ga0070684_100066025 3300005535 Bacteria 3176
173 Ga0068853_100006239 3300005539 Bacteria 9446
174 Ga0068853_100007967 3300005539 Bacteria 8495
175 Ga0068853_100029438 3300005539 Bacteria 4630
176 Ga0068853_100038435 3300005539 Bacteria 4076
177 Ga0068853_100043831 3300005539 Bacteria 3828
178 Ga0068853_100304429 3300005539 Bacteria 1474
179 Ga0068853_100450622 3300005539 Bacteria 1210
180 Ga0070672_100000361 3300005543 Bacteria 26202
181 Ga0070672_100082710 3300005543 Bacteria 2576
182 Ga0070672_100179153 3300005543 Bacteria 1765
183 Ga0070672_100421243 3300005543 Unclassified 1147
184 Ga0070672_100580201 3300005543 Unclassified 975
185 Ga0070686_100131878 3300005544 Bacteria 1729
186 Ga0070693_100030023 3300005547 Bacteria 2969
187 Ga0070693_100368666 3300005547 Bacteria 987
188 Ga0070693_100392077 3300005547 Unclassified 960
189 Ga0070665_100000001 3300005548 Bacteria 1083363
190 Ga0070665_100002163 3300005548 Bacteria 21925
191 Ga0070665_100362726 3300005548 Bacteria 1455
192 Ga0070704_100091979 3300005549 Bacteria 2263
193 Ga0068855_100000089 3300005563 Bacteria 110845
194 Ga0068855_100018669 3300005563 Bacteria 8340
195 Ga0068855_100022692 3300005563 Bacteria 7520
196 Ga0068855_100164681 3300005563 Bacteria 2514
197 Ga0068855_100177211 3300005563 Bacteria 2411
198 Ga0068855_100181633 3300005563 Bacteria 2378
199 Ga0068855_100484639 3300005563 Bacteria 1346
200 Ga0070664_100022709 3300005564 Bacteria 5174
201 Ga0070664_100031477 3300005564 Unclassified 4433
202 Ga0070664_100058013 3300005564 Bacteria 3292
203 Ga0070664_100097591 3300005564 Bacteria 2551
204 Ga0070664_100255772 3300005564 Unclassified 1575
205 Ga0070664_100456359 3300005564 Unclassified 1174
206 Ga0068857_100025308 3300005577 Bacteria 5227
207 Ga0068857_100078843 3300005577 Bacteria 2940
208 Ga0068857_100155484 3300005577 Bacteria 2073
209 Ga0068857_100246793 3300005577 Bacteria 1636
210 Ga0068857_100301295 3300005577 Unclassified 1478
211 Ga0068857_100663516 3300005577 Bacteria 989
212 Ga0068854_100047350 3300005578 Unclassified 3064
213 Ga0068854_100052769 3300005578 Bacteria 2917
214 Ga0068854_100130636 3300005578 Bacteria 1917
215 Ga0068854_100766387 3300005578 Unclassified 838
216 Ga0068856_100003735 3300005614 Bacteria 15264
217 Ga0068856_100023059 3300005614 Bacteria 6053
218 Ga0068856_100025703 3300005614 Bacteria 5741
219 Ga0068856_100258618 3300005614 Bacteria 1756
220 Ga0068856_100797272 3300005614 Unclassified 964
221 Ga0070702_100105931 3300005615 Bacteria 1734
222 Ga0070702_100212383 3300005615 Bacteria 1289
223 Ga0068852_100004440 3300005616 Bacteria 9918
224 Ga0068852_100006386 3300005616 Bacteria 8515
225 Ga0068852_100019362 3300005616 Bacteria 5385
226 Ga0068852_100039630 3300005616 Bacteria 3968
227 Ga0068852_100086040 3300005616 Bacteria 2801
228 Ga0068852_100147688 3300005616 Bacteria 2183
229 Ga0068852_100151063 3300005616 Bacteria 2160
230 Ga0068852_100178390 3300005616 Bacteria 1996
231 Ga0068852_100183670 3300005616 Unclassified 1968
232 Ga0068852_100338617 3300005616 Bacteria 1465
233 Ga0068852_100586270 3300005616 Bacteria 1118
234 Ga0068852_100718569 3300005616 Bacteria 1010
235 Ga0068859_100000012 3300005617 Bacteria 300376
236 Ga0068859_100158154 3300005617 Bacteria 2344
237 Ga0068859_100174460 3300005617 Unclassified 2231
238 Ga0068859_100554889 3300005617 Bacteria 1243
239 Ga0068859_100673995 3300005617 Bacteria 1125
240 Ga0068859_101181071 3300005617 Bacteria 843
241 Ga0068864_100000785 3300005618 Bacteria 26636
242 Ga0068864_100007484 3300005618 Bacteria 8996
243 Ga0068864_100046783 3300005618 Bacteria 3713
244 Ga0068864_100121314 3300005618 Bacteria 2337
245 Ga0068864_100230121 3300005618 Bacteria 1714
246 Ga0068866_10138905 3300005718 Bacteria 1392
247 Ga0068861_100005861 3300005719 Bacteria 8349
248 Ga0068861_100025336 3300005719 Bacteria 4301
249 Ga0068861_100369858 3300005719 Bacteria 1263
250 Ga0068861_100434340 3300005719 Bacteria 1173
251 Ga0068861_100657574 3300005719 Bacteria 969
252 Ga0068851_10001706 3300005834 Bacteria 9614
253 Ga0068851_10062786 3300005834 Bacteria 1907
254 Ga0068870_10316628 3300005840 Bacteria 990
255 Ga0068870_10419458 3300005840 Bacteria 875
256 Ga0068863_100001993 3300005841 Bacteria 20286
257 Ga0068863_100007688 3300005841 Bacteria 10544
258 Ga0068863_100017853 3300005841 Bacteria 6789
259 Ga0068863_100064072 3300005841 Bacteria 3476
260 Ga0068863_100615262 3300005841 Bacteria 1076
261 Ga0068863_100636357 3300005841 Bacteria 1057
262 Ga0068858_100001413 3300005842 Bacteria 24658
263 Ga0068858_100003623 3300005842 Bacteria 15279
264 Ga0068858_100106825 3300005842 Bacteria 2613
265 Ga0068858_100365833 3300005842 Unclassified 1382
266 Ga0068858_100530105 3300005842 Bacteria 1139
267 Ga0068860_100000111 3300005843 Bacteria 131004
268 Ga0068860_100001074 3300005843 Bacteria 30126
269 Ga0068860_100002836 3300005843 Bacteria 18019
270 Ga0068860_100003730 3300005843 Bacteria 15673
271 Ga0068860_100359310 3300005843 Bacteria 1434
272 Ga0068862_100168094 3300005844 Unclassified 1962
273 Ga0068862_100310139 3300005844 Bacteria 1454
274 Ga0081540_1039418 3300005983 Unclassified 2476
275 Ga0081539_10000337 3300005985 Bacteria 103868
276 Ga0081539_10200780 3300005985 Unclassified 921
277 Ga0075366_10009448 3300006195 Bacteria 5442
278 Ga0075366_10039932 3300006195 Bacteria 2774
279 Ga0097621_100000063 3300006237 Bacteria 55571
280 Ga0097621_100003845 3300006237 Bacteria 10402
281 Ga0097621_100004135 3300006237 Bacteria 10062
282 Ga0097621_100031558 3300006237 Bacteria 4205
283 Ga0097621_100063054 3300006237 Bacteria 3045
284 Ga0097621_100122957 3300006237 Bacteria 2203
285 Ga0097621_100525959 3300006237 Unclassified 1074
286 Ga0097621_100598157 3300006237 Bacteria 1008
287 Ga0068871_100000981 3300006358 Bacteria 19104
288 Ga0068871_100001569 3300006358 Bacteria 15347
289 Ga0068871_100005200 3300006358 Bacteria 9099
290 Ga0068871_100008715 3300006358 Bacteria 7295
291 Ga0068871_100009289 3300006358 Bacteria 7116
292 Ga0068871_100128248 3300006358 Bacteria 2149
293 Ga0068871_100157109 3300006358 Bacteria 1942
294 Ga0068871_100299036 3300006358 Bacteria 1412
295 Ga0068871_100554954 3300006358 Bacteria 1041
296 Ga0068871_100746485 3300006358 Unclassified 899
297 Ga0075428_100049669 3300006844 Bacteria 4602
298 Ga0075430_100004854 3300006846 Bacteria 11313
299 Ga0075430_100121445 3300006846 Bacteria 2178
300 Ga0075431_100009279 3300006847 Bacteria 9869
301 Ga0075429_100004948 3300006880 Bacteria 11476
302 Ga0068865_100029986 3300006881 Bacteria 3614
303 Ga0097620_100000012 3300006931 Bacteria 300376
304 Ga0097620_100158144 3300006931 Bacteria 2344
305 Ga0097620_100174468 3300006931 Unclassified 2231
306 Ga0097620_100554979 3300006931 Bacteria 1243
307 Ga0097620_100673994 3300006931 Bacteria 1125
308 Ga0097620_101181033 3300006931 Bacteria 843
309 Ga0105240_10000074 3300009093 Bacteria 199611
310 Ga0105240_10003320 3300009093 Bacteria 25129
311 Ga0105240_10004846 3300009093 Bacteria 20276
312 Ga0105240_10005940 3300009093 Bacteria 18085
313 Ga0105240_10022330 3300009093 Bacteria 8390
314 Ga0105240_10025898 3300009093 Bacteria 7702
315 Ga0105240_10054314 3300009093 Bacteria 5021
316 Ga0105240_10062591 3300009093 Bacteria 4632
317 Ga0105240_10062996 3300009093 Bacteria 4615
318 Ga0105240_10137778 3300009093 Bacteria 2921
319 Ga0105240_10143372 3300009093 Bacteria 2854
320 Ga0105240_10402284 3300009093 Bacteria 1542
321 Ga0105240_10943553 3300009093 Bacteria 926
322 Ga0111539_10268897 3300009094 Bacteria 1984
323 Ga0111539_10308220 3300009094 Bacteria 1842
324 Ga0111539_10311274 3300009094 Bacteria 1833
325 Ga0111539_11382818 3300009094 Bacteria 817
326 Ga0105245_10108552 3300009098 Bacteria 2578
327 Ga0105245_10516949 3300009098 Bacteria 1212
328 Ga0105247_10002080 3300009101 Bacteria 13849
329 Ga0105247_10019554 3300009101 Bacteria 4067
330 Ga0114129_10006710 3300009147 Bacteria 16344
331 Ga0114129_10072252 3300009147 Bacteria 4810
332 Ga0105243_10440509 3300009148 Bacteria 1220
333 Ga0105241_10001370 3300009174 Bacteria 18574
334 Ga0105241_10006316 3300009174 Bacteria 8743
335 Ga0105241_10127913 3300009174 Bacteria 2053
336 Ga0105241_10153083 3300009174 Bacteria 1888
337 Ga0105241_10158698 3300009174 Bacteria 1857
338 Ga0105241_10261798 3300009174 Bacteria 1470
339 Ga0105242_10067512 3300009176 Bacteria 2957
340 Ga0105242_10095326 3300009176 Bacteria 2512
341 Ga0105242_10111690 3300009176 Bacteria 2331
342 Ga0105242_10186313 3300009176 Bacteria 1834
343 Ga0105248_10008799 3300009177 Bacteria 11087
344 Ga0105248_10208314 3300009177 Unclassified 2203
345 Ga0105237_10004958 3300009545 Bacteria 15198
346 Ga0105237_10007143 3300009545 Bacteria 12270
347 Ga0105237_10010659 3300009545 Bacteria 9766
348 Ga0105237_10032799 3300009545 Bacteria 5258
349 Ga0105237_10039892 3300009545 Bacteria 4737
350 Ga0105237_10077957 3300009545 Bacteria 3303
351 Ga0105237_10092997 3300009545 Bacteria 3005
352 Ga0105237_10137697 3300009545 Bacteria 2436
353 Ga0105237_10206872 3300009545 Bacteria 1963
354 Ga0105237_10233038 3300009545 Bacteria 1842
355 Ga0105237_10263919 3300009545 Bacteria 1725
356 Ga0105237_10488081 3300009545 Bacteria 1238
357 Ga0105238_10011152 3300009551 Bacteria 9038
358 Ga0105238_10052644 3300009551 Unclassified 4092
359 Ga0105238_10204680 3300009551 Bacteria 1949
360 Ga0105238_10269065 3300009551 Bacteria 1684
361 Ga0105238_10565361 3300009551 Bacteria 1142
362 Ga0105238_10714467 3300009551 Bacteria 1014
363 Ga0105249_10001749 3300009553 Bacteria 18941
364 Ga0105249_10003402 3300009553 Bacteria 13780
365 Ga0105249_10003442 3300009553 Bacteria 13704
366 Ga0105249_10006330 3300009553 Bacteria 10290
367 Ga0105249_10031375 3300009553 Bacteria 4806
368 Ga0105249_10067135 3300009553 Bacteria 3304
369 Ga0105249_10184275 3300009553 Bacteria 2033
370 Ga0105249_10372969 3300009553 Unclassified 1451
371 Ga0105249_10726482 3300009553 Bacteria 1054
372 Ga0105239_10000529 3300010375 Bacteria 55233
373 Ga0105239_10000905 3300010375 Bacteria 42180
374 Ga0105239_10005517 3300010375 Bacteria 14819
375 Ga0105239_10007318 3300010375 Bacteria 12672
376 Ga0105239_10083078 3300010375 Bacteria 3527
377 Ga0105239_10095150 3300010375 Bacteria 3290
378 Ga0105239_10134775 3300010375 Bacteria 2749
379 Ga0105239_10134852 3300010375 Bacteria 2748
380 Ga0105239_10142518 3300010375 Unclassified 2671
381 Ga0105239_10198587 3300010375 Bacteria 2247
382 Ga0105239_10339876 3300010375 Bacteria 1694
383 Ga0105239_10679370 3300010375 Bacteria 1177
384 Ga0105246_10036356 3300011119 Bacteria 3298
385 Ga0105246_10215285 3300011119 Bacteria 1502
386 Ga0105246_10473631 3300011119 Bacteria 1058
387 Ga0157373_10009945 3300013100 Bacteria 7010
388 Ga0157373_10103997 3300013100 Bacteria 1997
389 Ga0157373_10420627 3300013100 Unclassified 959
390 Ga0157371_10220435 3300013102 Unclassified 1362
391 Ga0157371_10240641 3300013102 Bacteria 1302
392 Ga0157371_10375771 3300013102 Bacteria 1037
393 Ga0157370_10004650 3300013104 Bacteria 15684
394 Ga0157370_10009011 3300013104 Bacteria 10710
395 Ga0157370_10088618 3300013104 Bacteria 2906
396 Ga0157370_10102402 3300013104 Bacteria 2681
397 Ga0157370_10106612 3300013104 Bacteria 2622
398 Ga0157370_10140852 3300013104 Bacteria 2247
399 Ga0157370_10540286 3300013104 Bacteria 1069
400 Ga0157370_10708659 3300013104 Bacteria 918
401 Ga0157370_10711999 3300013104 Unclassified 916
402 Ga0157369_10064707 3300013105 Bacteria 3938
403 Ga0157369_10099672 3300013105 Bacteria 3097
404 Ga0157369_10164989 3300013105 Bacteria 2337
405 Ga0157369_10212800 3300013105 Bacteria 2025
406 Ga0157369_10212931 3300013105 Bacteria 2025
407 Ga0157369_10277145 3300013105 Bacteria 1747
408 Ga0157369_10360925 3300013105 Bacteria 1508
409 Ga0157374_10000001 3300013296 Bacteria 1077351
410 Ga0157374_10002589 3300013296 Bacteria 15240
411 Ga0157374_10003428 3300013296 Bacteria 13327
412 Ga0157374_10030755 3300013296 Bacteria 4877
413 Ga0157374_10224309 3300013296 Bacteria 1845
414 Ga0157374_10379282 3300013296 Unclassified 1408
415 Ga0157374_10393503 3300013296 Bacteria 1382
416 Ga0157374_10890623 3300013296 Bacteria 907
417 Ga0157378_10004677 3300013297 Bacteria 12010
418 Ga0157378_10008896 3300013297 Bacteria 8739
419 Ga0157378_10039378 3300013297 Bacteria 4192
420 Ga0157378_10039860 3300013297 Bacteria 4166
421 Ga0157378_10114878 3300013297 Unclassified 2473
422 Ga0157378_10351564 3300013297 Bacteria 1440
423 Ga0157378_10578478 3300013297 Bacteria 1132
424 Ga0163162_10000158 3300013306 Bacteria 62514
425 Ga0163162_10000328 3300013306 Bacteria 43763
426 Ga0163162_10000377 3300013306 Bacteria 40533
427 Ga0163162_10002130 3300013306 Bacteria 18568
428 Ga0163162_10016844 3300013306 Bacteria 7144
429 Ga0163162_10029831 3300013306 Bacteria 5399
430 Ga0163162_10066818 3300013306 Bacteria 3645
431 Ga0163162_10083684 3300013306 Bacteria 3265
432 Ga0163162_10211501 3300013306 Bacteria 2069
433 Ga0163162_10216519 3300013306 Bacteria 2045
434 Ga0163162_10253270 3300013306 Bacteria 1892
435 Ga0163162_10548084 3300013306 Bacteria 1285
436 Ga0163162_10576699 3300013306 Bacteria 1252
437 Ga0157372_10001344 3300013307 Bacteria 26596
438 Ga0157372_10002881 3300013307 Bacteria 18600
439 Ga0157372_10016802 3300013307 Bacteria 7855
440 Ga0157372_10104080 3300013307 Bacteria 3244
441 Ga0157372_10132250 3300013307 Bacteria 2871
442 Ga0157372_10138602 3300013307 Bacteria 2802
443 Ga0157372_10142018 3300013307 Bacteria 2767
444 Ga0157372_10154931 3300013307 Bacteria 2646
445 Ga0157372_10156451 3300013307 Bacteria 2633
446 Ga0157372_10217256 3300013307 Bacteria 2216
447 Ga0157372_10226401 3300013307 Bacteria 2168
448 Ga0157372_10316135 3300013307 Bacteria 1818
449 Ga0157372_10423072 3300013307 Bacteria 1552
450 Ga0157372_10748626 3300013307 Bacteria 1136
451 Ga0157372_10849972 3300013307 Bacteria 1059
452 Ga0157372_10878493 3300013307 Bacteria 1040
453 Ga0157372_10900873 3300013307 Unclassified 1026
454 Ga0157372_11016303 3300013307 Bacteria 960
455 Ga0157372_11141087 3300013307 Bacteria 901
456 Ga0157375_10000228 3300013308 Bacteria 52278
457 Ga0157375_10004745 3300013308 Bacteria 11813
458 Ga0157375_10052910 3300013308 Bacteria 3994
459 Ga0157375_10084393 3300013308 Bacteria 3225
460 Ga0157375_10097458 3300013308 Bacteria 3015
461 Ga0157375_10214820 3300013308 Bacteria 2081
462 Ga0157375_10224496 3300013308 Bacteria 2037
463 Ga0157375_10264623 3300013308 Bacteria 1881
464 Ga0157375_10295455 3300013308 Bacteria 1783
465 Ga0163163_10000712 3300014325 Bacteria 28219
466 Ga0163163_10000752 3300014325 Bacteria 27543
467 Ga0163163_10026537 3300014325 Bacteria 5539
468 Ga0163163_10031622 3300014325 Bacteria 5109
469 Ga0163163_10059076 3300014325 Bacteria 3792
470 Ga0157380_10295405 3300014326 Bacteria 1490
471 Ga0157380_10312973 3300014326 Bacteria 1452
472 Ga0157377_10009590 3300014745 Bacteria 4758
473 Ga0157377_10027455 3300014745 Unclassified 3057
474 Ga0157379_10000440 3300014968 Bacteria 33697
475 Ga0157379_10028369 3300014968 Bacteria 4979
476 Ga0157379_10152648 3300014968 Bacteria 2083
477 Ga0157379_10193105 3300014968 Bacteria 1840
478 Ga0157379_10288422 3300014968 Unclassified 1494
479 Ga0157376_10000381 3300014969 Bacteria 28821
480 Ga0157376_10001773 3300014969 Bacteria 14357
481 Ga0157376_10002491 3300014969 Bacteria 12466
482 Ga0157376_10003377 3300014969 Bacteria 10986
483 Ga0157376_10029578 3300014969 Bacteria 4364
484 Ga0157376_10048370 3300014969 Bacteria 3516
485 Ga0157376_10109093 3300014969 Unclassified 2433
486 Ga0157376_10122083 3300014969 Bacteria 2311
487 Ga0157376_10252328 3300014969 Bacteria 1648
488 Ga0157376_10490978 3300014969 Bacteria 1205
489 Ga0182005_1000039 3300015265 Bacteria 155210
490 Ga0163161_10003038 3300017792 Bacteria 11852
491 Ga0163161_10018054 3300017792 Bacteria 4944
492 Ga0163161_10056909 3300017792 Bacteria 2841
493 Ga0163161_10102284 3300017792 Bacteria 2134
494 Ga0213876_10003898 3300021384 Bacteria 8432
495 Ga0213876_10004533 3300021384 Bacteria 7760
496 Ga0209436_101598 3300025208 Bacteria 7605
497 Ga0209436_102525 3300025208 Bacteria 5435
498 Ga0209258_100195 3300025242 Bacteria 124409
499 Ga0209646_1000002 3300025246 Bacteria 1425781
500 Ga0209646_1001511 3300025246 Bacteria 6167
501 Ga0209026_1000178 3300025250 Bacteria 96368
502 Ga0209148_1000515 3300025254 Bacteria 38582
503 Ga0209129_1006332 3300025258 Bacteria 3864
504 Ga0209673_1000261 3300025273 Bacteria 99491
505 Ga0209564_1002640 3300025295 Bacteria 13694
506 Ga0209564_1003255 3300025295 Bacteria 11350
507 Ga0209758_1002812 3300025297 Bacteria 16942
508 Ga0209758_1004501 3300025297 Bacteria 11560
509 Ga0209758_1004617 3300025297 Bacteria 11305
510 Ga0209050_1000160 3300025298 Bacteria 157000
511 Ga0207426_1000023 3300025302 Bacteria 545465
512 Ga0207426_1000318 3300025302 Bacteria 93692
513 Ga0207426_1000360 3300025302 Bacteria 82007
514 Ga0207426_1001116 3300025302 Bacteria 24631
515 Ga0209257_1000001 3300025304 Bacteria 2274655
516 Ga0209257_1003010 3300025304 Bacteria 15255
517 Ga0207697_10034636 3300025315 Bacteria 2067
518 Ga0207656_10000424 3300025321 Bacteria 14223
519 Ga0207656_10060613 3300025321 Bacteria 1659
520 Ga0207682_10150865 3300025893 Unclassified 1048
521 Ga0207642_10119293 3300025899 Bacteria 1358
522 Ga0207710_10023114 3300025900 Bacteria 2670
523 Ga0207680_10000031 3300025903 Bacteria 77871
524 Ga0207680_10001363 3300025903 Bacteria 11575
525 Ga0207680_10028330 3300025903 Bacteria 3132
526 Ga0207680_10046942 3300025903 Bacteria 2556
527 Ga0207680_10056804 3300025903 Bacteria 2366
528 Ga0207647_10000045 3300025904 Bacteria 90413
529 Ga0207647_10002250 3300025904 Bacteria 14710
530 Ga0207647_10026185 3300025904 Bacteria 3819
531 Ga0207647_10038494 3300025904 Bacteria 3023
532 Ga0207647_10052486 3300025904 Unclassified 2516
533 Ga0207645_10000949 3300025907 Bacteria 24072
534 Ga0207645_10136641 3300025907 Bacteria 1597
535 Ga0207643_10019993 3300025908 Bacteria 3672
536 Ga0207643_10194996 3300025908 Bacteria 1231
537 Ga0207643_10239042 3300025908 Bacteria 1116
538 Ga0207705_10023675 3300025909 Bacteria 4381
539 Ga0207705_10077545 3300025909 Bacteria 2417
540 Ga0207705_10363306 3300025909 Bacteria 1117
541 Ga0207684_10779694 3300025910 Unclassified 809
542 Ga0207654_10008187 3300025911 Bacteria 5272
543 Ga0207654_10089572 3300025911 Bacteria 1872
544 Ga0207654_10250453 3300025911 Bacteria 1187
545 Ga0207707_10013305 3300025912 Bacteria 7172
546 Ga0207695_10000071 3300025913 Bacteria 315568
547 Ga0207695_10000084 3300025913 Bacteria 282392
548 Ga0207695_10000515 3300025913 Bacteria 82285
549 Ga0207695_10002195 3300025913 Bacteria 29420
550 Ga0207695_10006026 3300025913 Bacteria 15840
551 Ga0207695_10028771 3300025913 Bacteria 6153
552 Ga0207695_10066633 3300025913 Bacteria 3697
553 Ga0207695_10102521 3300025913 Bacteria 2854
554 Ga0207695_10118835 3300025913 Bacteria 2614
555 Ga0207695_10188505 3300025913 Bacteria 1981
556 Ga0207671_10000318 3300025914 Bacteria 71076
557 Ga0207671_10000981 3300025914 Bacteria 35291
558 Ga0207671_10001871 3300025914 Bacteria 23410
559 Ga0207671_10003538 3300025914 Bacteria 15491
560 Ga0207671_10007411 3300025914 Bacteria 9520
561 Ga0207671_10017355 3300025914 Bacteria 5553
562 Ga0207671_10029600 3300025914 Bacteria 4088
563 Ga0207671_10056341 3300025914 Bacteria 2912
564 Ga0207671_10095614 3300025914 Bacteria 2244
565 Ga0207671_10160536 3300025914 Bacteria 1740
566 Ga0207671_10223928 3300025914 Bacteria 1474
567 Ga0207660_10079904 3300025917 Bacteria 2400
568 Ga0207660_10081653 3300025917 Bacteria 2376
569 Ga0207660_10177864 3300025917 Bacteria 1651
570 Ga0207662_10066277 3300025918 Bacteria 2175
571 Ga0207657_10122946 3300025919 Bacteria 2134
572 Ga0207657_10301692 3300025919 Bacteria 1269
573 Ga0207657_10376892 3300025919 Unclassified 1118
574 Ga0207649_10152000 3300025920 Bacteria 1595
575 Ga0207649_10191723 3300025920 Bacteria 1438
576 Ga0207649_10212117 3300025920 Bacteria 1374
577 Ga0207649_10337386 3300025920 Bacteria 1112
578 Ga0207652_10005894 3300025921 Bacteria 9916
579 Ga0207652_10255578 3300025921 Bacteria 1580
580 Ga0207681_10126139 3300025923 Bacteria 1885
581 Ga0207694_10045035 3300025924 Bacteria 3408
582 Ga0207694_10097947 3300025924 Unclassified 2321
583 Ga0207694_10451294 3300025924 Bacteria 1073
584 Ga0207650_10025832 3300025925 Bacteria 4186
585 Ga0207650_10075554 3300025925 Bacteria 2543
586 Ga0207650_10113726 3300025925 Bacteria 2099
587 Ga0207650_10128661 3300025925 Bacteria 1979
588 Ga0207650_10152951 3300025925 Bacteria 1822
589 Ga0207650_10193494 3300025925 Bacteria 1626
590 Ga0207650_10296737 3300025925 Bacteria 1319
591 Ga0207650_10338186 3300025925 Bacteria 1236
592 Ga0207650_10698208 3300025925 Bacteria 857
593 Ga0207659_10050982 3300025926 Bacteria 2941
594 Ga0207659_10094095 3300025926 Bacteria 2245
595 Ga0207659_10113156 3300025926 Bacteria 2066
596 Ga0207659_10356397 3300025926 Bacteria 1215
597 Ga0207659_10452665 3300025926 Bacteria 1081
598 Ga0207644_10015110 3300025931 Bacteria 5179
599 Ga0207644_10141830 3300025931 Bacteria 1851
600 Ga0207644_10358775 3300025931 Bacteria 1185
601 Ga0207644_10541834 3300025931 Bacteria 963
602 Ga0207690_10011286 3300025932 Bacteria 5337
603 Ga0207690_10119886 3300025932 Bacteria 1909
604 Ga0207706_10002788 3300025933 Bacteria 16975
605 Ga0207706_10011186 3300025933 Bacteria 8182
606 Ga0207686_10001258 3300025934 Bacteria 14622
607 Ga0207686_10068276 3300025934 Bacteria 2277
608 Ga0207686_10181112 3300025934 Bacteria 1494
609 Ga0207670_10019460 3300025936 Bacteria 4148
610 Ga0207670_10179885 3300025936 Bacteria 1592
611 Ga0207670_10603259 3300025936 Unclassified 902
612 Ga0207669_10010995 3300025937 Bacteria 4383
613 Ga0207669_10186175 3300025937 Bacteria 1493
614 Ga0207669_10301958 3300025937 Bacteria 1217
615 Ga0207669_10696637 3300025937 Bacteria 835
616 Ga0207704_10268152 3300025938 Bacteria 1291
617 Ga0207704_10438155 3300025938 Bacteria 1040
618 Ga0207691_10000037 3300025940 Bacteria 108385
619 Ga0207691_10165053 3300025940 Bacteria 1941
620 Ga0207691_10177818 3300025940 Bacteria 1860
621 Ga0207691_10444575 3300025940 Unclassified 1103
622 Ga0207691_10450186 3300025940 Bacteria 1096
623 Ga0207691_10609711 3300025940 Bacteria 924
624 Ga0207711_10141669 3300025941 Unclassified 2164
625 Ga0207711_10264135 3300025941 Bacteria 1583
626 Ga0207689_10013283 3300025942 Bacteria 7024
627 Ga0207689_10014782 3300025942 Bacteria 6627
628 Ga0207689_10025181 3300025942 Bacteria 4987
629 Ga0207689_10087990 3300025942 Bacteria 2551
630 Ga0207689_10181501 3300025942 Bacteria 1735
631 Ga0207689_10381058 3300025942 Bacteria 1174
632 Ga0207661_10005710 3300025944 Bacteria 8780
633 Ga0207661_10109119 3300025944 Bacteria 2337
634 Ga0207661_10490001 3300025944 Unclassified 1123
635 Ga0207679_10012240 3300025945 Bacteria 5590
636 Ga0207679_10075284 3300025945 Bacteria 2561
637 Ga0207679_10209756 3300025945 Bacteria 1633
638 Ga0207679_10226153 3300025945 Unclassified 1577
639 Ga0207679_10622513 3300025945 Bacteria 974
640 Ga0207667_10000209 3300025949 Bacteria 83277
641 Ga0207667_10001238 3300025949 Bacteria 32040
642 Ga0207667_10022196 3300025949 Bacteria 7019
643 Ga0207667_10152416 3300025949 Bacteria 2379
644 Ga0207667_10168669 3300025949 Bacteria 2250
645 Ga0207667_10391755 3300025949 Bacteria 1415
646 Ga0207667_10456282 3300025949 Bacteria 1298
647 Ga0207651_10000443 3300025960 Bacteria 17529
648 Ga0207651_10041938 3300025960 Bacteria 3042
649 Ga0207651_10059015 3300025960 Bacteria 2654
650 Ga0207651_10179134 3300025960 Bacteria 1680
651 Ga0207651_10355749 3300025960 Bacteria 1234
652 Ga0207712_10003355 3300025961 Bacteria 10136
653 Ga0207712_10004607 3300025961 Bacteria 8711
654 Ga0207712_10005091 3300025961 Bacteria 8312
655 Ga0207712_10114190 3300025961 Bacteria 2031
656 Ga0207668_10001307 3300025972 Bacteria 14792
657 Ga0207668_10064884 3300025972 Bacteria 2583
658 Ga0207668_10081464 3300025972 Bacteria 2348
659 Ga0207668_10478402 3300025972 Bacteria 1068
660 Ga0207668_10609087 3300025972 Bacteria 952
661 Ga0207640_10013350 3300025981 Bacteria 4704
662 Ga0207640_10031093 3300025981 Unclassified 3295
663 Ga0207658_10000629 3300025986 Bacteria 31155
664 Ga0207658_10007220 3300025986 Bacteria 7576
665 Ga0207658_10043522 3300025986 Bacteria 3264
666 Ga0207658_10089862 3300025986 Bacteria 2379
667 Ga0207658_10354041 3300025986 Unclassified 1279
668 Ga0207658_10533985 3300025986 Bacteria 1048
669 Ga0207677_10005907 3300026023 Bacteria 6662
670 Ga0207677_10119659 3300026023 Bacteria 1978
671 Ga0207677_10132512 3300026023 Bacteria 1895
672 Ga0207677_10133440 3300026023 Bacteria 1889
673 Ga0207677_10133809 3300026023 Unclassified 1887
674 Ga0207677_10350671 3300026023 Bacteria 1237
675 Ga0207677_10422919 3300026023 Bacteria 1135
676 Ga0207677_10483752 3300026023 Bacteria 1067
677 Ga0207677_10659996 3300026023 Bacteria 924
678 Ga0207677_10736357 3300026023 Unclassified 878
679 Ga0207703_10004145 3300026035 Bacteria 11957
680 Ga0207703_10009241 3300026035 Bacteria 7751
681 Ga0207703_10103200 3300026035 Bacteria 2420
682 Ga0207703_10231510 3300026035 Bacteria 1657
683 Ga0207703_10331517 3300026035 Bacteria 1396
684 Ga0207703_10335318 3300026035 Bacteria 1388
685 Ga0207639_10012262 3300026041 Bacteria 5968
686 Ga0207639_10042141 3300026041 Bacteria 3420
687 Ga0207639_10045458 3300026041 Bacteria 3307
688 Ga0207639_10105023 3300026041 Bacteria 2291
689 Ga0207639_10112154 3300026041 Unclassified 2225
690 Ga0207639_10425988 3300026041 Bacteria 1201
691 Ga0207639_10737766 3300026041 Bacteria 915
692 Ga0207678_10177411 3300026067 Bacteria 1819
693 Ga0207678_10209599 3300026067 Bacteria 1667
694 Ga0207708_10031445 3300026075 Bacteria 4028
695 Ga0207702_10174569 3300026078 Bacteria 1973
696 Ga0207702_10662725 3300026078 Bacteria 1027
697 Ga0207702_10823524 3300026078 Unclassified 918
698 Ga0207641_10000048 3300026088 Bacteria 178206
699 Ga0207641_10000253 3300026088 Bacteria 67848
700 Ga0207641_10014740 3300026088 Bacteria 6409
701 Ga0207641_10092372 3300026088 Bacteria 2650
702 Ga0207641_10323166 3300026088 Bacteria 1464
703 Ga0207641_10464825 3300026088 Bacteria 1224
704 Ga0207648_10001276 3300026089 Bacteria 28144
705 Ga0207648_10002983 3300026089 Bacteria 17886
706 Ga0207648_10046709 3300026089 Bacteria 3796
707 Ga0207648_10127146 3300026089 Unclassified 2242
708 Ga0207648_10129143 3300026089 Bacteria 2224
709 Ga0207648_10215866 3300026089 Bacteria 1704
710 Ga0207648_10347242 3300026089 Unclassified 1337
711 Ga0207676_10002535 3300026095 Bacteria 13033
712 Ga0207676_10013593 3300026095 Bacteria 5842
713 Ga0207676_10148146 3300026095 Bacteria 2018
714 Ga0207676_10184364 3300026095 Bacteria 1830
715 Ga0207676_10302096 3300026095 Bacteria 1462
716 Ga0207676_10501915 3300026095 Bacteria 1152
717 Ga0207674_10027023 3300026116 Bacteria 6081
718 Ga0207674_10047001 3300026116 Bacteria 4428
719 Ga0207674_10097318 3300026116 Bacteria 2926
720 Ga0207674_10184015 3300026116 Bacteria 2040
721 Ga0207674_10204912 3300026116 Unclassified 1922
722 Ga0207674_10463346 3300026116 Bacteria 1225
723 Ga0207674_10651125 3300026116 Bacteria 1017
724 Ga0207675_100011688 3300026118 Bacteria 8208
725 Ga0207675_100080094 3300026118 Bacteria 3061
726 Ga0207675_100086055 3300026118 Bacteria 2951
727 Ga0207675_100534232 3300026118 Bacteria 1170
728 Ga0207675_101068917 3300026118 Bacteria 826
729 Ga0207683_10021593 3300026121 Bacteria 5516
730 Ga0207683_10344952 3300026121 Bacteria 1366
731 Ga0207698_10001674 3300026142 Bacteria 12934
732 Ga0207698_10004014 3300026142 Bacteria 8933
733 Ga0207698_10004963 3300026142 Bacteria 8157
734 Ga0207698_10013497 3300026142 Bacteria 5391
735 Ga0207698_10066040 3300026142 Bacteria 2846
736 Ga0207698_10181912 3300026142 Bacteria 1863
737 Ga0207698_10213394 3300026142 Bacteria 1738
738 Ga0207698_10253376 3300026142 Bacteria 1612
739 Ga0207698_10385425 3300026142 Bacteria 1335
740 Ga0207698_10716631 3300026142 Bacteria 997
741 Ga0209968_1015309 3300027526 Bacteria 1213
742 Ga0209974_10034900 3300027876 Bacteria 1670
743 Ga0207428_10422732 3300027907 Bacteria 974
744 Ga0268266_10000038 3300028379 Bacteria 325729
745 Ga0268266_10004818 3300028379 Bacteria 12818
746 Ga0268266_10005123 3300028379 Bacteria 12353
747 Ga0268265_10439011 3300028380 Bacteria 1216
748 Ga0268264_10000167 3300028381 Bacteria 146190
749 Ga0268264_10001271 3300028381 Bacteria 23942
750 Ga0268264_10017828 3300028381 Bacteria 5811
751 Ga0268264_10056056 3300028381 Bacteria 3294
752 Ga0268264_10221177 3300028381 Bacteria 1743
753 Ga0307517_10009245 3300028786 Bacteria 14011
754 Ga0307515_10000072 3300028794 Bacteria 237798
755 Ga0307511_10003621 3300030521 Bacteria 15822
756 Ga0307512_10147533 3300030522 Bacteria 1418
757 Ga0265327_10000030 3300031251 Bacteria 333531
758 Ga0265327_10144276 3300031251 Bacteria 1110
759 Ga0307513_10233026 3300031456 Bacteria 1653
760 Ga0307513_10333598 3300031456 Bacteria 1270
761 Ga0307509_10030533 3300031507 Bacteria 5959
762 Ga0307509_10061200 3300031507 Unclassified 3976
763 Ga0307509_10141256 3300031507 Bacteria 2343
764 Ga0307408_100756664 3300031548 Bacteria 878
765 Ga0265313_10036991 3300031595 Bacteria 2446
766 Ga0307508_10002859 3300031616 Bacteria 17909
767 Ga0307508_10266846 3300031616 Bacteria 1306
768 Ga0307516_10001231 3300031730 Bacteria 35640
769 Ga0307413_10049606 3300031824 Bacteria 2517
770 Ga0307410_10023713 3300031852 Bacteria 3821
771 Ga0307412_10072787 3300031911 Bacteria 2350
772 Ga0307416_100113769 3300032002 Bacteria 2392
773 Ga0307416_101128801 3300032002 Unclassified 889
774 Ga0307416_101469237 3300032002 Bacteria 787
775 Ga0307414_10224178 3300032004 Bacteria 1545
776 Ga0307411_10104084 3300032005 Bacteria 2015
777 Ga0307415_100021613 3300032126 Bacteria 3959
778 Ga0307415_100147730 3300032126 Bacteria 1805
779 Ga0307510_10000528 3300033180 Bacteria 38156
780 Ga0307510_10135555 3300033180 Bacteria 2121
781 Ga0395898_0245968 3300037466 Unclassified 1706
782 Ga0395905_0002094 3300037471 Bacteria 22677
783 Ga0395905_0232234 3300037471 Bacteria 1725
784 Ga0395901_0294991 3300038443 Bacteria 1682
785 Ga0436365_0773211 3300039437 Bacteria 2127
786 Ga0436365_1089979 3300039437 Bacteria 20099
787 Ga0436365_1777169 3300039437 Bacteria 24248
788 Ga0439439_0012499 3300041406 Bacteria 2054
789 Ga0439439_0017565 3300041406 Bacteria 1761
790 Ga0439465_0021139 3300041413 Bacteria 2041
791 Ga0451853_2959559 3300041512 Bacteria 874
792 Ga0451853_4098937 3300041512 Bacteria 987
793 Ga0439445_0003921 3300042004 Bacteria 3354
794 Ga0439449_0030282 3300042007 Bacteria 2017
795 Ga0439449_0032789 3300042007 Bacteria 1936
796 Ga0439449_0063955 3300042007 Bacteria 1357
797 Ga0439449_0118294 3300042007 Bacteria 983
798 Ga0439454_018308 3300042011 Bacteria 1009
799 Ga0439457_005153 3300042014 Unclassified 3322
800 Ga0439457_015693 3300042014 Bacteria 1690
801 Ga0439462_0005229 3300042015 Bacteria 3193
802 Ga0439462_0045911 3300042015 Bacteria 1170
803 Ga0450923_058260 3300042125 Bacteria 839
804 Ga0450896_017370 3300042133 Bacteria 1038
805 Ga0450898_002673 3300042134 Bacteria 2497
806 Ga0439434_0022823 3300042435 Bacteria 1882
807 Ga0450893_0031840 3300042532 Bacteria 942
808 Ga0466969_0000746 3300044656 Bacteria 17610
809 Ga0466972_0000038 3300044658 Bacteria 135937
810 Ga0466972_0010101 3300044658 Bacteria 4744
811 Ga0466972_0100253 3300044658 Bacteria 1371
812 Ga0466972_0138714 3300044658 Bacteria 1144
813 Ga0466966_0001759 3300044684 Bacteria 14029
814 Ga0466961_0025984 3300044693 Bacteria 3764
815 Ga0453684_0349573 3300044712 Bacteria 1667
816 Ga0466971_0094657 3300044719 Bacteria 1369
817 Ga0466971_0136812 3300044719 Bacteria 1140
818 Ga0466957_0001679 3300044842 Bacteria 11631
819 Ga0466959_0000056 3300045049 Bacteria 78465
820 Ga0466959_0004213 3300045049 Bacteria 9584
821 Ga0466959_0014943 3300045049 Bacteria 5657
822 Ga0466958_0066685 3300045836 Bacteria 2198
823 Ga0466967_0107825 3300045976 Bacteria 2555
824 Ga0466967_0175518 3300045976 Bacteria 2019
825 Ga0495627_002875 3300046453 Bacteria 7939
826 Ga0495638_0129567 3300046460 Bacteria 1483
827 Ga0495580_0159903 3300046472 Unclassified 1559
828 Ga0495639_0133904 3300046475 Bacteria 1188
829 Ga0495606_0017959 3300046507 Bacteria 5322
830 Ga0495630_0140407 3300046517 Unclassified 1837
831 Ga0495630_0224691 3300046517 Bacteria 1434
832 Ga0495648_0122239 3300046524 Bacteria 1397
833 Ga0495598_0084955 3300046537 Bacteria 1022
834 Ga0495621_0083863 3300046539 Unclassified 1192
835 Ga0495622_0041194 3300046557 Bacteria 2148
836 Ga0495633_0000005 3300046558 Bacteria 357644
837 Ga0495668_0002497 3300046616 Bacteria 15047
838 Ga0495611_0000278 3300046648 Bacteria 34852
839 Ga0495672_0020115 3300047320 Bacteria 4383
840 Ga0495672_0060891 3300047320 Unclassified 2178
841 Ga0495676_0085516 3300047321 Unclassified 2376
842 Ga0495687_000001 3300047443 Bacteria 1215582
843 Ga0495686_0000004 3300047472 Bacteria 869019
844 Ga0495686_0194672 3300047472 Bacteria 1166
845 Ga0496101_0093126 3300048904 Bacteria 2244
846 Ga0496109_0071641 3300048912 Bacteria 3183
847 Ga0496121_0000020 3300048924 Bacteria 498732
848 Ga0496121_0482897 3300048924 Bacteria 791
849 Ga0496125_0259894 3300048928 Bacteria 1089
850 Ga0496126_0007895 3300048929 Bacteria 11585
851 Ga0501292_001056 3300049515 Bacteria 3367
852 Ga0501298_000064 3300049521 Bacteria 11334
853 Ga0501032_0009464 3300049569 Bacteria 7063
854 Ga0501032_0049879 3300049569 Unclassified 2823
855 Ga0501033_0011813 3300049570 Bacteria 6675
856 Ga0501034_0004387 3300049571 Bacteria 15716
857 Ga0501034_0091347 3300049571 Unclassified 3042
858 Ga0501034_0173582 3300049571 Bacteria 2122
859 Ga0501034_0333990 3300049571 Bacteria 1447
860 Ga0501036_0054709 3300049572 Bacteria 3381
861 Ga0501037_0007406 3300049573 Bacteria 8024
862 Ga0501037_0046918 3300049573 Bacteria 3167
863 Ga0501037_0163701 3300049573 Bacteria 1585
864 Ga0501039_0015162 3300049575 Bacteria 5898
865 Ga0501039_0082677 3300049575 Bacteria 2500
866 Ga0501039_0181995 3300049575 Bacteria 1652
867 Ga0501043_0015695 3300049579 Bacteria 5938
868 Ga0501043_0060404 3300049579 Bacteria 2975
869 Ga0501043_0077780 3300049579 Bacteria 2606
870 Ga0501043_0149539 3300049579 Bacteria 1828
871 Ga0501046_0010399 3300049580 Bacteria 7994
872 Ga0501046_0327802 3300049580 Bacteria 1115
873 Ga0501046_0365587 3300049580 Bacteria 1046
874 Ga0501047_0009790 3300049581 Bacteria 9056
875 Ga0501047_0053692 3300049581 Bacteria 3897
876 Ga0501047_0249985 3300049581 Bacteria 1621
877 Ga0501048_0069252 3300049582 Unclassified 2492
878 Ga0501067_0123912 3300049583 Bacteria 1438
879 Ga0501067_0172694 3300049583 Unclassified 1204
880 Ga0501069_0145123 3300049585 Bacteria 1362
881 Ga0501070_0096581 3300049586 Bacteria 2444
882 Ga0501072_0530928 3300049588 Unclassified 930
883 Ga0501073_0004845 3300049589 Bacteria 10100
884 Ga0501073_0193939 3300049589 Bacteria 1405
885 Ga0501074_0065938 3300049590 Bacteria 2605
886 Ga0501201_000527 3300049651 Bacteria 3536
887 Ga0501202_000744 3300049652 Bacteria 4874
888 Ga0501202_008310 3300049652 Bacteria 1890
889 Ga0501206_000832 3300049653 Bacteria 3781
890 Ga0501207_004627 3300049654 Bacteria 1880
891 Ga0501217_000216 3300049661 Bacteria 8713
892 Ga0501217_007529 3300049661 Bacteria 2337
893 Ga0501222_002054 3300049662 Bacteria 2786
894 Ga0501224_003158 3300049664 Bacteria 2289
895 Ga0501227_010002 3300049665 Bacteria 2052
896 Ga0501235_000267 3300049669 Bacteria 9671
897 Ga0501238_018655 3300049671 Bacteria 972
898 Ga0501242_000198 3300049674 Bacteria 4677
899 Ga0501242_002573 3300049674 Bacteria 1914
900 Ga0501243_002944 3300049675 Bacteria 2509
901 Ga0501250_007642 3300049680 Bacteria 1173
902 Ga0501252_000167 3300049682 Bacteria 4191
903 Ga0501253_001083 3300049683 Bacteria 2645
904 Ga0501257_022523 3300049686 Bacteria 1491
905 Ga0501257_042554 3300049686 Bacteria 1118
906 Ga0501260_003704 3300049689 Bacteria 1384
907 Ga0501261_000281 3300049690 Bacteria 6962
908 Ga0501219_000074 3300049703 Bacteria 17135
909 Ga0501221_001294 3300049704 Bacteria 4134
910 Ga0501225_0002607 3300049705 Bacteria 5541
911 Ga0501225_0005062 3300049705 Bacteria 3886
912 Ga0501225_0005570 3300049705 Bacteria 3693
913 Ga0501225_0077422 3300049705 Bacteria 952
914 Ga0501234_004702 3300049707 Bacteria 2141
915 Ga0501245_000671 3300049708 Bacteria 4224
916 Ga0501079_0212590 3300049741 Bacteria 1511
917 Ga0501080_0022014 3300049742 Bacteria 5904
918 Ga0501080_0564532 3300049742 Bacteria 1013
919 Ga0501083_0068438 3300049744 Bacteria 2363
920 Ga0501241_005898 3300049758 Bacteria 2273
921 Ga0501266_002278 3300049763 Unclassified 2430
922 Ga0501035_0009939 3300049822 Bacteria 8834
923 Ga0501035_0032518 3300049822 Bacteria 4745
924 Ga0501035_0100158 3300049822 Bacteria 2544
925 Ga0501035_0548247 3300049822 Unclassified 947
926 Ga0501044_0003293 3300049823 Bacteria 18191
927 Ga0501044_0004254 3300049823 Bacteria 16062
928 Ga0501284_00029 3300050005 Bacteria 74818
929 nmdc:mga0k408_183517_c1 3300050493 Bacteria 1248
930 nmdc:mga0k408_37004_c1 3300050493 Unclassified 2801
931 nmdc:mga0k408_6193_c1 3300050493 Bacteria 6380
932 nmdc:mga0k408_62043_c1 3300050493 Bacteria 2173
933 nmdc:mga05p37_4450_c1 3300050507 Bacteria 16377
934 nmdc:mga05p37_62080_c1 3300050507 Bacteria 4599
935 nmdc:mga09592_20389_c1 3300050508 Bacteria 5450
936 nmdc:mga09592_675256_c1 3300050508 Bacteria 881
937 nmdc:mga0qj67_178793_c1 3300050509 Bacteria 1723
938 nmdc:mga0qj67_37014_c1 3300050509 Bacteria 3821
939 nmdc:mga06r32_368086_c1 3300050510 Bacteria 1421
940 nmdc:mga08y16_305799_c1 3300050511 Bacteria 1638
941 nmdc:mga08y16_439882_c1 3300050511 Bacteria 1331
942 Ga0500578_0036117 3300053086 Bacteria 3175
943 Ga0500644_0000184 3300053088 Bacteria 39747
944 Ga0500646_0003030 3300053090 Bacteria 4312
945 Ga0500646_0015258 3300053090 Bacteria 2000
946 Ga0500646_0016948 3300053090 Unclassified 1906
947 Ga0500583_0000047 3300053092 Bacteria 78958
948 Ga0500583_0004533 3300053092 Bacteria 4544
949 Ga0500583_0005677 3300053092 Bacteria 4207
950 Ga0500583_0007722 3300053092 Bacteria 3807
951 Ga0500651_0019215 3300053093 Bacteria 4242
952 Ga0500651_0109110 3300053093 Bacteria 1690
953 Ga0500651_0362188 3300053093 Bacteria 821
954 Ga0500569_000886 3300053109 Bacteria 5341
955 Ga0500594_0035071 3300053118 Bacteria 1344
956 Ga0500652_000909 3300053131 Bacteria 9751
957 Ga0500559_0025729 3300053136 Bacteria 2505
958 Ga0500568_0001204 3300053139 Bacteria 17268
959 Ga0500568_0011377 3300053139 Bacteria 4135
960 Ga0500568_0078890 3300053139 Bacteria 1252
961 Ga0500577_0001440 3300053142 Bacteria 6089
962 Ga0500589_069955 3300053147 Bacteria 1590
963 Ga0500604_0004694 3300053151 Bacteria 3618
964 Ga0500604_0040572 3300053151 Bacteria 1404
965 Ga0500616_0009438 3300053153 Bacteria 5935
966 Ga0500619_031757 3300053154 Bacteria 1615
967 Ga0500622_0001887 3300053156 Bacteria 15831
968 Ga0500622_0009069 3300053156 Bacteria 5523
969 Ga0500633_0013134 3300053160 Bacteria 2310
970 Ga0500639_166892 3300053163 Bacteria 993
971 Ga0500636_0073241 3300053177 Bacteria 1984
972 Ga0500611_000022 3300053727 Bacteria 102349
973 Ga0500656_004668 3300053732 Bacteria 1330
974 Ga0501084_0082222 3300054114 Bacteria 2702
975 Ga0466962_0028059 3300061719 Bacteria 2698
976 Ga0466962_0197519 3300061719 Bacteria 982

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10266824 Ga0070658_102668241 218
2 3300025925 Ga0207650_10338186 Ga0207650_103381862 220
3 3300005459 Ga0068867_100233512 Ga0068867_1002335122 222
4 3300005719 Ga0068861_100025336 Ga0068861_1000253363 222
5 3300005844 Ga0068862_100168094 Ga0068862_1001680942 222
6 3300025942 Ga0207689_10013283 Ga0207689_100132832 222
7 3300026089 Ga0207648_10347242 Ga0207648_103472421 222
8 3300026118 Ga0207675_100080094 Ga0207675_1000800942 222
9 3300049573 Ga0501037_0046918 Ga0501037_0046918_882_1601 226
10 3300005331 Ga0070670_100373312 Ga0070670_1003733121 227
11 3300006358 Ga0068871_100554954 Ga0068871_1005549541 227
12 3300025925 Ga0207650_10113726 Ga0207650_101137262 227
13 3300005337 Ga0070682_100323963 Ga0070682_1003239631 228
14 3300005455 Ga0070663_100664288 Ga0070663_1006642881 228
15 3300005547 Ga0070693_100368666 Ga0070693_1003686661 228
16 3300001979 JGI24740J21852_10027647 JGI24740J21852_100276472 229
17 3300005616 Ga0068852_100718569 Ga0068852_1007185692 229
18 3300009545 Ga0105237_10007143 Ga0105237_100071432 229
19 3300025914 Ga0207671_10095614 Ga0207671_100956142 229
20 3300026142 Ga0207698_10253376 Ga0207698_102533761 229
21 3300003354 JGI25160J50197_1008228 JGI25160J50197_10082285 230
22 3300009093 Ga0105240_10062996 Ga0105240_100629962 230
23 3300009093 Ga0105240_10137778 Ga0105240_101377782 230
24 3300010375 Ga0105239_10134775 Ga0105239_101347752 230
25 3300010375 Ga0105239_10134852 Ga0105239_101348522 230
26 3300013105 Ga0157369_10064707 Ga0157369_100647072 230
27 3300025302 Ga0207426_1000023 Ga0207426_1000023231 230
28 3300005329 Ga0070683_100070065 Ga0070683_1000700652 231
29 3300005457 Ga0070662_100369440 Ga0070662_1003694401 231
30 3300005535 Ga0070684_100066025 Ga0070684_1000660252 231
31 3300013296 Ga0157374_10224309 Ga0157374_102243091 231
32 3300013306 Ga0163162_10083684 Ga0163162_100836842 231
33 3300025920 Ga0207649_10212117 Ga0207649_102121171 231
34 iso_pu_bacteria 2738541278 2738726462 234
35 iso_pu_bacteria 2818991442 2819574042 235
36 iso_pu_bacteria 2818991460 2819680253 235
37 iso_pu_bacteria 2821136567 2821137359 235
38 iso_pu_bacteria 2840677318 2840677366 235
39 iso_pu_bacteria 2883068021 2883072799 235
40 iso_pu_bacteria 2884791551 2884798413 235
41 iso_pu_bacteria 2896085136 2896085184 235
42 iso_pu_bacteria 2896109856 2896115109 235
43 iso_pu_bacteria 2904467357 2904467900 235
44 iso_pu_bacteria 2929177148 2929182592 235
45 iso_pu_bacteria 2929921140 2929923629 235
46 iso_pu_bacteria 2945977869 2945978517 235
47 iso_pu_bacteria 2946013367 2946015621 235
48 iso_pu_bacteria 8003151029 8003155237 235
49 3300005327 Ga0070658_10758694 Ga0070658_107586941 236
50 3300005329 Ga0070683_100045232 Ga0070683_1000452322 236
51 3300005329 Ga0070683_100652963 Ga0070683_1006529631 236
52 3300005331 Ga0070670_100340430 Ga0070670_1003404301 236
53 3300005336 Ga0070680_100023180 Ga0070680_1000231806 236
54 3300005338 Ga0068868_100213039 Ga0068868_1002130391 236
55 3300005338 Ga0068868_100734692 Ga0068868_1007346922 236
56 3300005339 Ga0070660_100249257 Ga0070660_1002492571 236
57 3300005344 Ga0070661_100239428 Ga0070661_1002394281 236
58 3300005344 Ga0070661_100474396 Ga0070661_1004743961 236
59 3300005355 Ga0070671_100082473 Ga0070671_1000824733 236
60 3300005530 Ga0070679_100001831 Ga0070679_10000183114 236
61 3300005535 Ga0070684_100036799 Ga0070684_1000367992 236
62 3300005564 Ga0070664_100022709 Ga0070664_1000227094 236
63 3300005564 Ga0070664_100255772 Ga0070664_1002557721 236
64 3300005564 Ga0070664_100456359 Ga0070664_1004563592 236
65 3300005578 Ga0068854_100130636 Ga0068854_1001306362 236
66 3300005616 Ga0068852_100006386 Ga0068852_1000063861 236
67 3300005616 Ga0068852_100086040 Ga0068852_1000860403 236
68 3300013102 Ga0157371_10220435 Ga0157371_102204352 236
69 3300013104 Ga0157370_10004650 Ga0157370_100046504 236
70 3300013104 Ga0157370_10140852 Ga0157370_101408521 236
71 3300013104 Ga0157370_10540286 Ga0157370_105402862 236
72 3300013104 Ga0157370_10708659 Ga0157370_107086591 236
73 3300013105 Ga0157369_10164989 Ga0157369_101649892 236
74 3300013105 Ga0157369_10277145 Ga0157369_102771451 236
75 3300013296 Ga0157374_10890623 Ga0157374_108906231 236
76 3300013307 Ga0157372_10104080 Ga0157372_101040802 236
77 3300013307 Ga0157372_10217256 Ga0157372_102172562 236
78 3300013307 Ga0157372_10748626 Ga0157372_107486262 236
79 3300014325 Ga0163163_10026537 Ga0163163_100265373 236
80 3300014745 Ga0157377_10009590 Ga0157377_100095902 236
81 3300021384 Ga0213876_10003898 Ga0213876_100038983 236
82 3300025909 Ga0207705_10363306 Ga0207705_103633062 236
83 3300025917 Ga0207660_10177864 Ga0207660_101778641 236
84 3300025919 Ga0207657_10122946 Ga0207657_101229462 236
85 3300025919 Ga0207657_10376892 Ga0207657_103768922 236
86 3300025920 Ga0207649_10191723 Ga0207649_101917232 236
87 3300025921 Ga0207652_10005894 Ga0207652_100058947 236
88 3300025925 Ga0207650_10698208 Ga0207650_106982082 236
89 3300025931 Ga0207644_10141830 Ga0207644_101418301 236
90 3300025944 Ga0207661_10490001 Ga0207661_104900012 236
91 3300025945 Ga0207679_10012240 Ga0207679_100122402 236
92 3300025945 Ga0207679_10226153 Ga0207679_102261531 236
93 3300025960 Ga0207651_10179134 Ga0207651_101791342 236
94 3300026023 Ga0207677_10350671 Ga0207677_103506711 236
95 3300026023 Ga0207677_10659996 Ga0207677_106599962 236
96 3300026095 Ga0207676_10302096 Ga0207676_103020962 236
97 3300026142 Ga0207698_10013497 Ga0207698_100134974 236
98 3300039437 Ga0436365_1777169 Ga0436365_1777169_2268_2978 236
99 3300003320 rootH2_10287768 rootH2_102877682 237
100 3300003323 rootH1_10091661 rootH1_100916616 237
101 3300005336 Ga0070680_100258005 Ga0070680_1002580052 237
102 3300005353 Ga0070669_100115704 Ga0070669_1001157043 237
103 3300005354 Ga0070675_100002335 Ga0070675_1000023357 237
104 3300005543 Ga0070672_100082710 Ga0070672_1000827102 237
105 3300005614 Ga0068856_100797272 Ga0068856_1007972721 237
106 3300006847 Ga0075431_100009279 Ga0075431_1000092798 237
107 3300009147 Ga0114129_10072252 Ga0114129_100722522 237
108 3300013100 Ga0157373_10103997 Ga0157373_101039972 237
109 3300013102 Ga0157371_10240641 Ga0157371_102406412 237
110 3300013306 Ga0163162_10066818 Ga0163162_100668183 237
111 3300025923 Ga0207681_10126139 Ga0207681_101261391 237
112 3300025926 Ga0207659_10113156 Ga0207659_101131562 237
113 3300027526 Ga0209968_1015309 Ga0209968_10153092 237
114 3300027876 Ga0209974_10034900 Ga0209974_100349002 237
115 3300031251 Ga0265327_10000030 Ga0265327_10000030190 237
116 3300032002 Ga0307416_101128801 Ga0307416_1011288011 237
117 3300032126 Ga0307415_100147730 Ga0307415_1001477301 237
118 3300037466 Ga0395898_0245968 Ga0395898_0245968_46_759 237
119 3300037471 Ga0395905_0002094 Ga0395905_0002094_5966_6679 237
120 3300038443 Ga0395901_0294991 Ga0395901_0294991_919_1632 237
121 3300048904 Ga0496101_0093126 Ga0496101_0093126_33_746 237
122 3300049569 Ga0501032_0009464 Ga0501032_0009464_3134_3847 237
123 3300049570 Ga0501033_0011813 Ga0501033_0011813_3341_4054 237
124 3300049571 Ga0501034_0004387 Ga0501034_0004387_2527_3240 237
125 3300049575 Ga0501039_0015162 Ga0501039_0015162_3445_4158 237
126 3300049579 Ga0501043_0015695 Ga0501043_0015695_3640_4353 237
127 3300049579 Ga0501043_0077780 Ga0501043_0077780_934_1647 237
128 3300049581 Ga0501047_0009790 Ga0501047_0009790_4531_5244 237
129 3300049661 Ga0501217_007529 Ga0501217_007529_1232_1945 237
130 3300049822 Ga0501035_0009939 Ga0501035_0009939_1176_1889 237
131 3300049823 Ga0501044_0004254 Ga0501044_0004254_2660_3373 237
132 3300050507 nmdc:mga05p37_62080_c1 nmdc:mga05p37_62080_c1_2291_3004 237
133 3300050508 nmdc:mga09592_675256_c1 nmdc:mga09592_675256_c1_150_863 237
134 3300050510 nmdc:mga06r32_368086_c1 nmdc:mga06r32_368086_c1_499_1212 237
135 3300001904 JGI24736J21556_1010067 JGI24736J21556_10100673 238
136 3300002459 JGI24751J29686_10043817 JGI24751J29686_100438171 238
137 3300003322 rootL2_10296671 rootL2_102966712 238
138 3300003323 rootH1_10146227 rootH1_101462273 238
139 3300005327 Ga0070658_10002948 Ga0070658_100029488 238
140 3300005328 Ga0070676_10062169 Ga0070676_100621692 238
141 3300005329 Ga0070683_100064309 Ga0070683_1000643094 238
142 3300005329 Ga0070683_100396763 Ga0070683_1003967632 238
143 3300005331 Ga0070670_100133226 Ga0070670_1001332262 238
144 3300005331 Ga0070670_100431894 Ga0070670_1004318941 238
145 3300005333 Ga0070677_10262856 Ga0070677_102628561 238
146 3300005347 Ga0070668_100300827 Ga0070668_1003008272 238
147 3300005353 Ga0070669_100312009 Ga0070669_1003120092 238
148 3300005366 Ga0070659_100000828 Ga0070659_1000008289 238
149 3300005459 Ga0068867_100191364 Ga0068867_1001913642 238
150 3300005467 Ga0070706_100403127 Ga0070706_1004031272 238
151 3300005539 Ga0068853_100304429 Ga0068853_1003044292 238
152 3300005563 Ga0068855_100022692 Ga0068855_1000226924 238
153 3300005577 Ga0068857_100246793 Ga0068857_1002467932 238
154 3300005577 Ga0068857_100663516 Ga0068857_1006635162 238
155 3300005578 Ga0068854_100047350 Ga0068854_1000473503 238
156 3300005614 Ga0068856_100023059 Ga0068856_1000230592 238
157 3300005614 Ga0068856_100258618 Ga0068856_1002586182 238
158 3300005616 Ga0068852_100004440 Ga0068852_1000044403 238
159 3300005616 Ga0068852_100147688 Ga0068852_1001476883 238
160 3300005616 Ga0068852_100586270 Ga0068852_1005862702 238
161 3300005617 Ga0068859_101181071 Ga0068859_1011810712 238
162 3300005719 Ga0068861_100657574 Ga0068861_1006575742 238
163 3300005844 Ga0068862_100310139 Ga0068862_1003101392 238
164 3300006237 Ga0097621_100525959 Ga0097621_1005259591 238
165 3300006931 Ga0097620_101181033 Ga0097620_1011810332 238
166 3300009093 Ga0105240_10402284 Ga0105240_104022842 238
167 3300009147 Ga0114129_10006710 Ga0114129_1000671011 238
168 3300009174 Ga0105241_10006316 Ga0105241_100063161 238
169 3300009545 Ga0105237_10004958 Ga0105237_1000495810 238
170 3300009545 Ga0105237_10137697 Ga0105237_101376972 238
171 3300009553 Ga0105249_10067135 Ga0105249_100671352 238
172 3300010375 Ga0105239_10007318 Ga0105239_1000731811 238
173 3300010375 Ga0105239_10679370 Ga0105239_106793701 238
174 3300013102 Ga0157371_10375771 Ga0157371_103757711 238
175 3300013104 Ga0157370_10106612 Ga0157370_101066122 238
176 3300013296 Ga0157374_10030755 Ga0157374_100307551 238
177 3300013296 Ga0157374_10393503 Ga0157374_103935032 238
178 3300013297 Ga0157378_10008896 Ga0157378_100088962 238
179 3300013307 Ga0157372_10016802 Ga0157372_100168025 238
180 3300013307 Ga0157372_10142018 Ga0157372_101420181 238
181 3300013307 Ga0157372_10849972 Ga0157372_108499721 238
182 3300013307 Ga0157372_11016303 Ga0157372_110163031 238
183 3300013307 Ga0157372_11141087 Ga0157372_111410871 238
184 3300013308 Ga0157375_10052910 Ga0157375_100529102 238
185 3300021384 Ga0213876_10004533 Ga0213876_100045333 238
186 3300025246 Ga0209646_1001511 Ga0209646_10015114 238
187 3300025904 Ga0207647_10000045 Ga0207647_1000004571 238
188 3300025904 Ga0207647_10002250 Ga0207647_100022502 238
189 3300025909 Ga0207705_10077545 Ga0207705_100775453 238
190 3300025911 Ga0207654_10089572 Ga0207654_100895722 238
191 3300025913 Ga0207695_10028771 Ga0207695_100287713 238
192 3300025913 Ga0207695_10118835 Ga0207695_101188352 238
193 3300025914 Ga0207671_10000318 Ga0207671_1000031854 238
194 3300025925 Ga0207650_10152951 Ga0207650_101529512 238
195 3300025932 Ga0207690_10011286 Ga0207690_100112863 238
196 3300025949 Ga0207667_10391755 Ga0207667_103917552 238
197 3300025972 Ga0207668_10064884 Ga0207668_100648842 238
198 3300025981 Ga0207640_10031093 Ga0207640_100310932 238
199 3300026041 Ga0207639_10105023 Ga0207639_101050233 238
200 3300026078 Ga0207702_10174569 Ga0207702_101745692 238
201 3300026116 Ga0207674_10097318 Ga0207674_100973182 238
202 3300026116 Ga0207674_10204912 Ga0207674_102049122 238
203 3300026116 Ga0207674_10651125 Ga0207674_106511252 238
204 3300026118 Ga0207675_101068917 Ga0207675_1010689171 238
205 3300026142 Ga0207698_10004014 Ga0207698_100040142 238
206 3300026142 Ga0207698_10213394 Ga0207698_102133941 238
207 3300028379 Ga0268266_10005123 Ga0268266_100051233 238
208 3300028380 Ga0268265_10439011 Ga0268265_104390112 238
209 3300028381 Ga0268264_10221177 Ga0268264_102211772 238
210 3300030522 Ga0307512_10147533 Ga0307512_101475332 238
211 3300031251 Ga0265327_10144276 Ga0265327_101442761 238
212 3300031456 Ga0307513_10333598 Ga0307513_103335982 238
213 3300031507 Ga0307509_10141256 Ga0307509_101412562 238
214 3300031595 Ga0265313_10036991 Ga0265313_100369913 238
215 3300032002 Ga0307416_101469237 Ga0307416_1014692371 238
216 3300039437 Ga0436365_0773211 Ga0436365_0773211_1237_1956 238
217 3300039437 Ga0436365_1089979 Ga0436365_1089979_13811_14527 238
218 3300041406 Ga0439439_0017565 Ga0439439_0017565_191_907 238
219 3300042007 Ga0439449_0032789 Ga0439449_0032789_1041_1757 238
220 3300042007 Ga0439449_0063955 Ga0439449_0063955_260_976 238
221 3300042007 Ga0439449_0118294 Ga0439449_0118294_179_895 238
222 3300042014 Ga0439457_005153 Ga0439457_005153_2078_2794 238
223 3300042014 Ga0439457_015693 Ga0439457_015693_943_1659 238
224 3300042015 Ga0439462_0005229 Ga0439462_0005229_1901_2617 238
225 3300042015 Ga0439462_0045911 Ga0439462_0045911_194_910 238
226 3300044656 Ga0466969_0000746 Ga0466969_0000746_984_1700 238
227 3300044658 Ga0466972_0000038 Ga0466972_0000038_135137_135853 238
228 3300044658 Ga0466972_0010101 Ga0466972_0010101_3983_4699 238
229 3300044658 Ga0466972_0100253 Ga0466972_0100253_86_802 238
230 3300044684 Ga0466966_0001759 Ga0466966_0001759_4259_4975 238
231 3300044712 Ga0453684_0349573 Ga0453684_0349573_683_1399 238
232 3300044719 Ga0466971_0094657 Ga0466971_0094657_384_1100 238
233 3300044719 Ga0466971_0136812 Ga0466971_0136812_68_784 238
234 3300044842 Ga0466957_0001679 Ga0466957_0001679_2356_3072 238
235 3300045049 Ga0466959_0000056 Ga0466959_0000056_21339_22055 238
236 3300046557 Ga0495622_0041194 Ga0495622_0041194_1330_2046 238
237 3300046616 Ga0495668_0002497 Ga0495668_0002497_8235_8951 238
238 3300047472 Ga0495686_0000004 Ga0495686_0000004_309142_309858 238
239 3300049581 Ga0501047_0249985 Ga0501047_0249985_112_828 238
240 3300049686 Ga0501257_042554 Ga0501257_042554_245_961 238
241 3300049703 Ga0501219_000074 Ga0501219_000074_2782_3498 238
242 3300049705 Ga0501225_0002607 Ga0501225_0002607_1640_2356 238
243 3300049705 Ga0501225_0077422 Ga0501225_0077422_161_877 238
244 3300049758 Ga0501241_005898 Ga0501241_005898_737_1453 238
245 3300049822 Ga0501035_0100158 Ga0501035_0100158_1761_2477 238
246 3300049823 Ga0501044_0003293 Ga0501044_0003293_4633_5349 238
247 3300050005 Ga0501284_00029 Ga0501284_00029_66295_67011 238
248 3300050493 nmdc:mga0k408_183517_c1 nmdc:mga0k408_183517_c1_516_1232 238
249 3300050493 nmdc:mga0k408_62043_c1 nmdc:mga0k408_62043_c1_541_1257 238
250 3300050507 nmdc:mga05p37_4450_c1 nmdc:mga05p37_4450_c1_3874_4590 238
251 3300053086 Ga0500578_0036117 Ga0500578_0036117_2133_2882 238
252 3300053090 Ga0500646_0003030 Ga0500646_0003030_1320_2036 238
253 3300053092 Ga0500583_0000047 Ga0500583_0000047_69525_70241 238
254 3300053092 Ga0500583_0007722 Ga0500583_0007722_2603_3319 238
255 3300053093 Ga0500651_0362188 Ga0500651_0362188_87_803 238
256 3300053136 Ga0500559_0025729 Ga0500559_0025729_597_1313 238
257 3300053139 Ga0500568_0001204 Ga0500568_0001204_12242_12958 238
258 3300053147 Ga0500589_069955 Ga0500589_069955_458_1174 238
259 3300053151 Ga0500604_0004694 Ga0500604_0004694_1364_2080 238
260 3300053151 Ga0500604_0040572 Ga0500604_0040572_441_1157 238
261 3300053154 Ga0500619_031757 Ga0500619_031757_403_1119 238
262 3300053163 Ga0500639_166892 Ga0500639_166892_16_732 238
263 3300053177 Ga0500636_0073241 Ga0500636_0073241_773_1489 238
264 3300061719 Ga0466962_0197519 Ga0466962_0197519_216_932 238
265 2162886007 SwRhRL2b_contig_1763716 SwRhRL2b_0236.00000680 239
266 3300001979 JGI24740J21852_10009246 JGI24740J21852_100092462 239
267 3300002738 JGI25154J39366_1000014 JGI25154J39366_1000014179 239
268 3300003203 JGI25406J46586_10010665 JGI25406J46586_100106655 239
269 3300003215 JGI25153J46596_10018336 JGI25153J46596_100183363 239
270 3300003215 JGI25153J46596_10048003 JGI25153J46596_100480032 239
271 3300003320 rootH2_10008932 rootH2_1000893227 239
272 3300003320 rootH2_10009459 rootH2_100094592 239
273 3300003320 rootH2_10009460 rootH2_100094602 239
274 3300003320 rootH2_10014077 rootH2_100140775 239
275 3300003320 rootH2_10041861 rootH2_100418615 239
276 3300003320 rootH2_10097088 rootH2_100970883 239
277 3300003320 rootH2_10133384 rootH2_101333841 239
278 3300003320 rootH2_10187341 rootH2_101873411 239
279 3300003322 rootL2_10066602 rootL2_100666021 239
280 3300003322 rootL2_10110627 rootL2_101106272 239
281 3300003322 rootL2_10178503 rootL2_101785032 239
282 3300003322 rootL2_10252348 rootL2_102523481 239
283 3300003323 rootH1_10092711 rootH1_100927113 239
284 3300003323 rootH1_10149908 rootH1_101499082 239
285 3300003323 rootH1_10156460 rootH1_101564602 239
286 3300003323 rootH1_10309255 rootH1_103092553 239
287 3300003354 JGI25160J50197_1008916 JGI25160J50197_10089164 239
288 3300003354 JGI25160J50197_1015038 JGI25160J50197_10150382 239
289 3300003354 JGI25160J50197_1025790 JGI25160J50197_10257902 239
290 3300003762 Ga0055542_1004837 Ga0055542_10048374 239
291 3300003790 Ga0055528_1001076 Ga0055528_10010764 239
292 3300003791 Ga0055530_10000707 Ga0055530_100007076 239
293 3300003794 Ga0055531_10000093 Ga0055531_1000009335 239
294 3300004625 Ga0055543_1019289 Ga0055543_10192892 239
295 3300005262 Ga0065165_1000036 Ga0065165_100003641 239
296 3300005262 Ga0065165_1024369 Ga0065165_10243694 239
297 3300005262 Ga0065165_1061452 Ga0065165_10614522 239
298 3300005289 Ga0065704_10121130 Ga0065704_101211301 239
299 3300005290 Ga0065712_10029724 Ga0065712_100297242 239
300 3300005293 Ga0065715_10106144 Ga0065715_101061442 239
301 3300005295 Ga0065707_10156284 Ga0065707_101562842 239
302 3300005327 Ga0070658_10005453 Ga0070658_100054539 239
303 3300005327 Ga0070658_10020168 Ga0070658_100201683 239
304 3300005328 Ga0070676_10001904 Ga0070676_100019048 239
305 3300005329 Ga0070683_100006532 Ga0070683_1000065329 239
306 3300005330 Ga0070690_100415821 Ga0070690_1004158211 239
307 3300005331 Ga0070670_100031739 Ga0070670_1000317396 239
308 3300005331 Ga0070670_100063065 Ga0070670_1000630652 239
309 3300005331 Ga0070670_100185995 Ga0070670_1001859952 239
310 3300005331 Ga0070670_100355289 Ga0070670_1003552892 239
311 3300005331 Ga0070670_100714569 Ga0070670_1007145691 239
312 3300005334 Ga0068869_100031459 Ga0068869_1000314591 239
313 3300005334 Ga0068869_100109898 Ga0068869_1001098983 239
314 3300005334 Ga0068869_100130791 Ga0068869_1001307912 239
315 3300005334 Ga0068869_100442492 Ga0068869_1004424921 239
316 3300005334 Ga0068869_100869694 Ga0068869_1008696941 239
317 3300005335 Ga0070666_10000247 Ga0070666_100002476 239
318 3300005335 Ga0070666_10000885 Ga0070666_100008858 239
319 3300005335 Ga0070666_10057807 Ga0070666_100578071 239
320 3300005335 Ga0070666_10167108 Ga0070666_101671082 239
321 3300005336 Ga0070680_100002380 Ga0070680_10000238012 239
322 3300005337 Ga0070682_100010074 Ga0070682_1000100743 239
323 3300005337 Ga0070682_100013374 Ga0070682_1000133745 239
324 3300005337 Ga0070682_100230413 Ga0070682_1002304131 239
325 3300005337 Ga0070682_100290170 Ga0070682_1002901701 239
326 3300005338 Ga0068868_100000075 Ga0068868_10000007513 239
327 3300005338 Ga0068868_100013056 Ga0068868_1000130562 239
328 3300005338 Ga0068868_100068306 Ga0068868_1000683062 239
329 3300005338 Ga0068868_100088975 Ga0068868_1000889753 239
330 3300005338 Ga0068868_100102340 Ga0068868_1001023402 239
331 3300005338 Ga0068868_100238090 Ga0068868_1002380902 239
332 3300005339 Ga0070660_100142760 Ga0070660_1001427602 239
333 3300005340 Ga0070689_100027122 Ga0070689_1000271224 239
334 3300005340 Ga0070689_100074988 Ga0070689_1000749883 239
335 3300005340 Ga0070689_100583446 Ga0070689_1005834461 239
336 3300005341 Ga0070691_10040723 Ga0070691_100407233 239
337 3300005344 Ga0070661_100083927 Ga0070661_1000839271 239
338 3300005344 Ga0070661_100218436 Ga0070661_1002184362 239
339 3300005347 Ga0070668_100000859 Ga0070668_10000085910 239
340 3300005347 Ga0070668_100138352 Ga0070668_1001383522 239
341 3300005353 Ga0070669_100243810 Ga0070669_1002438102 239
342 3300005354 Ga0070675_100261587 Ga0070675_1002615872 239
343 3300005354 Ga0070675_100304470 Ga0070675_1003044701 239
344 3300005354 Ga0070675_100393707 Ga0070675_1003937071 239
345 3300005354 Ga0070675_100621897 Ga0070675_1006218971 239
346 3300005355 Ga0070671_100011147 Ga0070671_1000111473 239
347 3300005355 Ga0070671_100059311 Ga0070671_1000593112 239
348 3300005355 Ga0070671_100540540 Ga0070671_1005405401 239
349 3300005356 Ga0070674_100141000 Ga0070674_1001410002 239
350 3300005356 Ga0070674_100355722 Ga0070674_1003557222 239
351 3300005364 Ga0070673_100000448 Ga0070673_1000004488 239
352 3300005364 Ga0070673_100060234 Ga0070673_1000602342 239
353 3300005364 Ga0070673_100113380 Ga0070673_1001133803 239
354 3300005364 Ga0070673_100129828 Ga0070673_1001298281 239
355 3300005365 Ga0070688_100141765 Ga0070688_1001417652 239
356 3300005365 Ga0070688_100282480 Ga0070688_1002824801 239
357 3300005366 Ga0070659_100001692 Ga0070659_10000169210 239
358 3300005366 Ga0070659_100156699 Ga0070659_1001566991 239
359 3300005367 Ga0070667_100000482 Ga0070667_10000048230 239
360 3300005367 Ga0070667_100003979 Ga0070667_1000039797 239
361 3300005367 Ga0070667_100042511 Ga0070667_1000425114 239
362 3300005367 Ga0070667_100066306 Ga0070667_1000663062 239
363 3300005367 Ga0070667_100460163 Ga0070667_1004601631 239
364 3300005441 Ga0070700_100143578 Ga0070700_1001435783 239
365 3300005455 Ga0070663_100042799 Ga0070663_1000427992 239
366 3300005456 Ga0070678_100084340 Ga0070678_1000843401 239
367 3300005456 Ga0070678_100220271 Ga0070678_1002202711 239
368 3300005456 Ga0070678_100389306 Ga0070678_1003893062 239
369 3300005456 Ga0070678_100487863 Ga0070678_1004878631 239
370 3300005456 Ga0070678_100495465 Ga0070678_1004954651 239
371 3300005456 Ga0070678_100504184 Ga0070678_1005041841 239
372 3300005456 Ga0070678_100613397 Ga0070678_1006133971 239
373 3300005457 Ga0070662_100002983 Ga0070662_10000298310 239
374 3300005457 Ga0070662_100029479 Ga0070662_1000294792 239
375 3300005458 Ga0070681_10059457 Ga0070681_100594571 239
376 3300005458 Ga0070681_10115068 Ga0070681_101150682 239
377 3300005458 Ga0070681_10527626 Ga0070681_105276261 239
378 3300005459 Ga0068867_100005606 Ga0068867_1000056068 239
379 3300005459 Ga0068867_100013182 Ga0068867_1000131822 239
380 3300005459 Ga0068867_100103322 Ga0068867_1001033222 239
381 3300005459 Ga0068867_100176404 Ga0068867_1001764042 239
382 3300005459 Ga0068867_100378076 Ga0068867_1003780763 239
383 3300005466 Ga0070685_10001175 Ga0070685_100011759 239
384 3300005466 Ga0070685_10047256 Ga0070685_100472562 239
385 3300005467 Ga0070706_100478269 Ga0070706_1004782692 239
386 3300005471 Ga0070698_100001454 Ga0070698_1000014547 239
387 3300005471 Ga0070698_100188702 Ga0070698_1001887022 239
388 3300005471 Ga0070698_100287347 Ga0070698_1002873472 239
389 3300005530 Ga0070679_100026151 Ga0070679_1000261516 239
390 3300005530 Ga0070679_100632879 Ga0070679_1006328791 239
391 3300005535 Ga0070684_100002043 Ga0070684_1000020439 239
392 3300005535 Ga0070684_100002647 Ga0070684_1000026474 239
393 3300005539 Ga0068853_100006239 Ga0068853_1000062396 239
394 3300005539 Ga0068853_100007967 Ga0068853_1000079675 239
395 3300005539 Ga0068853_100029438 Ga0068853_1000294381 239
396 3300005539 Ga0068853_100038435 Ga0068853_1000384351 239
397 3300005539 Ga0068853_100043831 Ga0068853_1000438312 239
398 3300005539 Ga0068853_100450622 Ga0068853_1004506222 239
399 3300005543 Ga0070672_100000361 Ga0070672_10000036123 239
400 3300005543 Ga0070672_100179153 Ga0070672_1001791531 239
401 3300005543 Ga0070672_100421243 Ga0070672_1004212431 239
402 3300005543 Ga0070672_100580201 Ga0070672_1005802011 239
403 3300005544 Ga0070686_100131878 Ga0070686_1001318782 239
404 3300005547 Ga0070693_100030023 Ga0070693_1000300232 239
405 3300005547 Ga0070693_100392077 Ga0070693_1003920771 239
406 3300005548 Ga0070665_100000001 Ga0070665_100000001607 239
407 3300005548 Ga0070665_100002163 Ga0070665_10000216310 239
408 3300005548 Ga0070665_100362726 Ga0070665_1003627262 239
409 3300005549 Ga0070704_100091979 Ga0070704_1000919793 239
410 3300005563 Ga0068855_100000089 Ga0068855_10000008977 239
411 3300005563 Ga0068855_100018669 Ga0068855_1000186694 239
412 3300005563 Ga0068855_100164681 Ga0068855_1001646812 239
413 3300005563 Ga0068855_100177211 Ga0068855_1001772112 239
414 3300005563 Ga0068855_100181633 Ga0068855_1001816332 239
415 3300005563 Ga0068855_100484639 Ga0068855_1004846392 239
416 3300005564 Ga0070664_100031477 Ga0070664_1000314772 239
417 3300005564 Ga0070664_100058013 Ga0070664_1000580133 239
418 3300005564 Ga0070664_100097591 Ga0070664_1000975912 239
419 3300005577 Ga0068857_100025308 Ga0068857_1000253085 239
420 3300005577 Ga0068857_100078843 Ga0068857_1000788432 239
421 3300005577 Ga0068857_100155484 Ga0068857_1001554842 239
422 3300005577 Ga0068857_100301295 Ga0068857_1003012952 239
423 3300005578 Ga0068854_100052769 Ga0068854_1000527692 239
424 3300005578 Ga0068854_100766387 Ga0068854_1007663871 239
425 3300005614 Ga0068856_100003735 Ga0068856_10000373510 239
426 3300005614 Ga0068856_100025703 Ga0068856_1000257032 239
427 3300005615 Ga0070702_100105931 Ga0070702_1001059312 239
428 3300005615 Ga0070702_100212383 Ga0070702_1002123832 239
429 3300005616 Ga0068852_100019362 Ga0068852_1000193626 239
430 3300005616 Ga0068852_100039630 Ga0068852_1000396303 239
431 3300005616 Ga0068852_100151063 Ga0068852_1001510632 239
432 3300005616 Ga0068852_100178390 Ga0068852_1001783901 239
433 3300005616 Ga0068852_100183670 Ga0068852_1001836702 239
434 3300005616 Ga0068852_100338617 Ga0068852_1003386172 239
435 3300005617 Ga0068859_100000012 Ga0068859_1000000126 239
436 3300005617 Ga0068859_100158154 Ga0068859_1001581542 239
437 3300005617 Ga0068859_100174460 Ga0068859_1001744602 239
438 3300005617 Ga0068859_100554889 Ga0068859_1005548892 239
439 3300005617 Ga0068859_100673995 Ga0068859_1006739951 239
440 3300005618 Ga0068864_100000785 Ga0068864_1000007853 239
441 3300005618 Ga0068864_100007484 Ga0068864_1000074844 239
442 3300005618 Ga0068864_100046783 Ga0068864_1000467834 239
443 3300005618 Ga0068864_100121314 Ga0068864_1001213144 239
444 3300005618 Ga0068864_100230121 Ga0068864_1002301212 239
445 3300005718 Ga0068866_10138905 Ga0068866_101389052 239
446 3300005719 Ga0068861_100005861 Ga0068861_1000058617 239
447 3300005719 Ga0068861_100369858 Ga0068861_1003698583 239
448 3300005719 Ga0068861_100434340 Ga0068861_1004343402 239
449 3300005834 Ga0068851_10001706 Ga0068851_100017067 239
450 3300005834 Ga0068851_10062786 Ga0068851_100627862 239
451 3300005840 Ga0068870_10316628 Ga0068870_103166281 239
452 3300005840 Ga0068870_10419458 Ga0068870_104194581 239
453 3300005841 Ga0068863_100001993 Ga0068863_10000199320 239
454 3300005841 Ga0068863_100007688 Ga0068863_10000768810 239
455 3300005841 Ga0068863_100017853 Ga0068863_1000178533 239
456 3300005841 Ga0068863_100064072 Ga0068863_1000640722 239
457 3300005841 Ga0068863_100615262 Ga0068863_1006152621 239
458 3300005841 Ga0068863_100636357 Ga0068863_1006363571 239
459 3300005842 Ga0068858_100001413 Ga0068858_10000141319 239
460 3300005842 Ga0068858_100003623 Ga0068858_1000036232 239
461 3300005842 Ga0068858_100106825 Ga0068858_1001068252 239
462 3300005842 Ga0068858_100365833 Ga0068858_1003658332 239
463 3300005842 Ga0068858_100530105 Ga0068858_1005301051 239
464 3300005843 Ga0068860_100000111 Ga0068860_10000011114 239
465 3300005843 Ga0068860_100001074 Ga0068860_10000107422 239
466 3300005843 Ga0068860_100002836 Ga0068860_10000283612 239
467 3300005843 Ga0068860_100003730 Ga0068860_10000373011 239
468 3300005843 Ga0068860_100359310 Ga0068860_1003593102 239
469 3300005983 Ga0081540_1039418 Ga0081540_10394183 239
470 3300005985 Ga0081539_10000337 Ga0081539_1000033785 239
471 3300005985 Ga0081539_10200780 Ga0081539_102007801 239
472 3300006195 Ga0075366_10009448 Ga0075366_100094482 239
473 3300006195 Ga0075366_10039932 Ga0075366_100399323 239
474 3300006237 Ga0097621_100000063 Ga0097621_10000006319 239
475 3300006237 Ga0097621_100003845 Ga0097621_1000038457 239
476 3300006237 Ga0097621_100004135 Ga0097621_1000041355 239
477 3300006237 Ga0097621_100031558 Ga0097621_1000315582 239
478 3300006237 Ga0097621_100063054 Ga0097621_1000630543 239
479 3300006237 Ga0097621_100122957 Ga0097621_1001229573 239
480 3300006237 Ga0097621_100598157 Ga0097621_1005981571 239
481 3300006358 Ga0068871_100000981 Ga0068871_1000009815 239
482 3300006358 Ga0068871_100001569 Ga0068871_1000015693 239
483 3300006358 Ga0068871_100005200 Ga0068871_1000052008 239
484 3300006358 Ga0068871_100008715 Ga0068871_1000087156 239
485 3300006358 Ga0068871_100009289 Ga0068871_1000092891 239
486 3300006358 Ga0068871_100128248 Ga0068871_1001282483 239
487 3300006358 Ga0068871_100157109 Ga0068871_1001571092 239
488 3300006358 Ga0068871_100299036 Ga0068871_1002990362 239
489 3300006358 Ga0068871_100746485 Ga0068871_1007464851 239
490 3300006844 Ga0075428_100049669 Ga0075428_1000496693 239
491 3300006846 Ga0075430_100004854 Ga0075430_1000048548 239
492 3300006846 Ga0075430_100121445 Ga0075430_1001214452 239
493 3300006880 Ga0075429_100004948 Ga0075429_1000049487 239
494 3300006881 Ga0068865_100029986 Ga0068865_1000299862 239
495 3300006931 Ga0097620_100000012 Ga0097620_1000000126 239
496 3300006931 Ga0097620_100158144 Ga0097620_1001581442 239
497 3300006931 Ga0097620_100174468 Ga0097620_1001744682 239
498 3300006931 Ga0097620_100554979 Ga0097620_1005549792 239
499 3300006931 Ga0097620_100673994 Ga0097620_1006739942 239
500 3300009093 Ga0105240_10000074 Ga0105240_1000007428 239
501 3300009093 Ga0105240_10003320 Ga0105240_1000332022 239
502 3300009093 Ga0105240_10004846 Ga0105240_100048464 239
503 3300009093 Ga0105240_10005940 Ga0105240_1000594011 239
504 3300009093 Ga0105240_10022330 Ga0105240_100223302 239
505 3300009093 Ga0105240_10025898 Ga0105240_100258985 239
506 3300009093 Ga0105240_10054314 Ga0105240_100543144 239
507 3300009093 Ga0105240_10062591 Ga0105240_100625912 239
508 3300009093 Ga0105240_10143372 Ga0105240_101433723 239
509 3300009093 Ga0105240_10943553 Ga0105240_109435531 239
510 3300009094 Ga0111539_10268897 Ga0111539_102688972 239
511 3300009094 Ga0111539_10308220 Ga0111539_103082202 239
512 3300009094 Ga0111539_10311274 Ga0111539_103112742 239
513 3300009094 Ga0111539_11382818 Ga0111539_113828181 239
514 3300009098 Ga0105245_10108552 Ga0105245_101085523 239
515 3300009098 Ga0105245_10516949 Ga0105245_105169491 239
516 3300009101 Ga0105247_10002080 Ga0105247_100020803 239
517 3300009101 Ga0105247_10019554 Ga0105247_100195543 239
518 3300009148 Ga0105243_10440509 Ga0105243_104405091 239
519 3300009174 Ga0105241_10001370 Ga0105241_1000137017 239
520 3300009174 Ga0105241_10127913 Ga0105241_101279131 239
521 3300009174 Ga0105241_10153083 Ga0105241_101530832 239
522 3300009174 Ga0105241_10158698 Ga0105241_101586982 239
523 3300009174 Ga0105241_10261798 Ga0105241_102617981 239
524 3300009176 Ga0105242_10067512 Ga0105242_100675122 239
525 3300009176 Ga0105242_10095326 Ga0105242_100953263 239
526 3300009176 Ga0105242_10111690 Ga0105242_101116902 239
527 3300009176 Ga0105242_10186313 Ga0105242_101863132 239
528 3300009177 Ga0105248_10008799 Ga0105248_100087993 239
529 3300009177 Ga0105248_10208314 Ga0105248_102083142 239
530 3300009545 Ga0105237_10010659 Ga0105237_1001065910 239
531 3300009545 Ga0105237_10032799 Ga0105237_100327993 239
532 3300009545 Ga0105237_10039892 Ga0105237_100398923 239
533 3300009545 Ga0105237_10077957 Ga0105237_100779574 239
534 3300009545 Ga0105237_10092997 Ga0105237_100929973 239
535 3300009545 Ga0105237_10206872 Ga0105237_102068723 239
536 3300009545 Ga0105237_10233038 Ga0105237_102330382 239
537 3300009545 Ga0105237_10263919 Ga0105237_102639192 239
538 3300009545 Ga0105237_10488081 Ga0105237_104880812 239
539 3300009551 Ga0105238_10011152 Ga0105238_100111528 239
540 3300009551 Ga0105238_10052644 Ga0105238_100526444 239
541 3300009551 Ga0105238_10204680 Ga0105238_102046802 239
542 3300009551 Ga0105238_10269065 Ga0105238_102690652 239
543 3300009551 Ga0105238_10565361 Ga0105238_105653611 239
544 3300009551 Ga0105238_10714467 Ga0105238_107144671 239
545 3300009553 Ga0105249_10001749 Ga0105249_100017493 239
546 3300009553 Ga0105249_10003402 Ga0105249_1000340210 239
547 3300009553 Ga0105249_10003442 Ga0105249_100034427 239
548 3300009553 Ga0105249_10006330 Ga0105249_100063302 239
549 3300009553 Ga0105249_10031375 Ga0105249_100313751 239
550 3300009553 Ga0105249_10184275 Ga0105249_101842753 239
551 3300009553 Ga0105249_10372969 Ga0105249_103729692 239
552 3300009553 Ga0105249_10726482 Ga0105249_107264821 239
553 3300010375 Ga0105239_10000529 Ga0105239_1000052933 239
554 3300010375 Ga0105239_10000905 Ga0105239_1000090516 239
555 3300010375 Ga0105239_10005517 Ga0105239_100055172 239
556 3300010375 Ga0105239_10083078 Ga0105239_100830782 239
557 3300010375 Ga0105239_10095150 Ga0105239_100951503 239
558 3300010375 Ga0105239_10142518 Ga0105239_101425182 239
559 3300010375 Ga0105239_10198587 Ga0105239_101985872 239
560 3300010375 Ga0105239_10339876 Ga0105239_103398762 239
561 3300011119 Ga0105246_10036356 Ga0105246_100363563 239
562 3300011119 Ga0105246_10215285 Ga0105246_102152852 239
563 3300011119 Ga0105246_10473631 Ga0105246_104736311 239
564 3300013100 Ga0157373_10009945 Ga0157373_100099457 239
565 3300013100 Ga0157373_10420627 Ga0157373_104206271 239
566 3300013104 Ga0157370_10009011 Ga0157370_100090112 239
567 3300013104 Ga0157370_10088618 Ga0157370_100886182 239
568 3300013104 Ga0157370_10102402 Ga0157370_101024023 239
569 3300013104 Ga0157370_10711999 Ga0157370_107119991 239
570 3300013105 Ga0157369_10099672 Ga0157369_100996723 239
571 3300013105 Ga0157369_10212800 Ga0157369_102128001 239
572 3300013105 Ga0157369_10212931 Ga0157369_102129312 239
573 3300013105 Ga0157369_10360925 Ga0157369_103609252 239
574 3300013296 Ga0157374_10000001 Ga0157374_10000001315 239
575 3300013296 Ga0157374_10002589 Ga0157374_1000258910 239
576 3300013296 Ga0157374_10003428 Ga0157374_1000342811 239
577 3300013296 Ga0157374_10379282 Ga0157374_103792822 239
578 3300013297 Ga0157378_10004677 Ga0157378_1000467711 239
579 3300013297 Ga0157378_10039378 Ga0157378_100393782 239
580 3300013297 Ga0157378_10039860 Ga0157378_100398601 239
581 3300013297 Ga0157378_10114878 Ga0157378_101148782 239
582 3300013297 Ga0157378_10351564 Ga0157378_103515642 239
583 3300013297 Ga0157378_10578478 Ga0157378_105784782 239
584 3300013306 Ga0163162_10000158 Ga0163162_1000015834 239
585 3300013306 Ga0163162_10000328 Ga0163162_100003282 239
586 3300013306 Ga0163162_10000377 Ga0163162_1000037710 239
587 3300013306 Ga0163162_10002130 Ga0163162_100021302 239
588 3300013306 Ga0163162_10016844 Ga0163162_100168442 239
589 3300013306 Ga0163162_10029831 Ga0163162_100298314 239
590 3300013306 Ga0163162_10211501 Ga0163162_102115012 239
591 3300013306 Ga0163162_10216519 Ga0163162_102165192 239
592 3300013306 Ga0163162_10253270 Ga0163162_102532703 239
593 3300013306 Ga0163162_10548084 Ga0163162_105480842 239
594 3300013306 Ga0163162_10576699 Ga0163162_105766992 239
595 3300013307 Ga0157372_10001344 Ga0157372_1000134415 239
596 3300013307 Ga0157372_10002881 Ga0157372_100028812 239
597 3300013307 Ga0157372_10132250 Ga0157372_101322503 239
598 3300013307 Ga0157372_10138602 Ga0157372_101386023 239
599 3300013307 Ga0157372_10154931 Ga0157372_101549312 239
600 3300013307 Ga0157372_10156451 Ga0157372_101564513 239
601 3300013307 Ga0157372_10226401 Ga0157372_102264011 239
602 3300013307 Ga0157372_10316135 Ga0157372_103161353 239
603 3300013307 Ga0157372_10423072 Ga0157372_104230723 239
604 3300013307 Ga0157372_10878493 Ga0157372_108784931 239
605 3300013307 Ga0157372_10900873 Ga0157372_109008732 239
606 3300013308 Ga0157375_10000228 Ga0157375_1000022834 239
607 3300013308 Ga0157375_10004745 Ga0157375_1000474511 239
608 3300013308 Ga0157375_10084393 Ga0157375_100843933 239
609 3300013308 Ga0157375_10097458 Ga0157375_100974582 239
610 3300013308 Ga0157375_10214820 Ga0157375_102148201 239
611 3300013308 Ga0157375_10224496 Ga0157375_102244962 239
612 3300013308 Ga0157375_10264623 Ga0157375_102646232 239
613 3300013308 Ga0157375_10295455 Ga0157375_102954552 239
614 3300014325 Ga0163163_10000712 Ga0163163_100007128 239
615 3300014325 Ga0163163_10000752 Ga0163163_1000075212 239
616 3300014325 Ga0163163_10031622 Ga0163163_100316223 239
617 3300014325 Ga0163163_10059076 Ga0163163_100590763 239
618 3300014326 Ga0157380_10295405 Ga0157380_102954051 239
619 3300014326 Ga0157380_10312973 Ga0157380_103129732 239
620 3300014745 Ga0157377_10027455 Ga0157377_100274552 239
621 3300014968 Ga0157379_10000440 Ga0157379_100004409 239
622 3300014968 Ga0157379_10028369 Ga0157379_100283695 239
623 3300014968 Ga0157379_10152648 Ga0157379_101526482 239
624 3300014968 Ga0157379_10193105 Ga0157379_101931052 239
625 3300014968 Ga0157379_10288422 Ga0157379_102884222 239
626 3300014969 Ga0157376_10000381 Ga0157376_1000038110 239
627 3300014969 Ga0157376_10001773 Ga0157376_100017737 239
628 3300014969 Ga0157376_10002491 Ga0157376_100024913 239
629 3300014969 Ga0157376_10003377 Ga0157376_100033775 239
630 3300014969 Ga0157376_10029578 Ga0157376_100295782 239
631 3300014969 Ga0157376_10048370 Ga0157376_100483704 239
632 3300014969 Ga0157376_10109093 Ga0157376_101090931 239
633 3300014969 Ga0157376_10122083 Ga0157376_101220832 239
634 3300014969 Ga0157376_10252328 Ga0157376_102523282 239
635 3300014969 Ga0157376_10490978 Ga0157376_104909781 239
636 3300015265 Ga0182005_1000039 Ga0182005_100003973 239
637 3300017792 Ga0163161_10003038 Ga0163161_100030381 239
638 3300017792 Ga0163161_10018054 Ga0163161_100180542 239
639 3300017792 Ga0163161_10056909 Ga0163161_100569093 239
640 3300017792 Ga0163161_10102284 Ga0163161_101022842 239
641 3300025208 Ga0209436_101598 Ga0209436_1015984 239
642 3300025208 Ga0209436_102525 Ga0209436_1025257 239
643 3300025242 Ga0209258_100195 Ga0209258_10019520 239
644 3300025246 Ga0209646_1000002 Ga0209646_1000002946 239
645 3300025250 Ga0209026_1000178 Ga0209026_100017831 239
646 3300025254 Ga0209148_1000515 Ga0209148_10005159 239
647 3300025258 Ga0209129_1006332 Ga0209129_10063322 239
648 3300025273 Ga0209673_1000261 Ga0209673_100026183 239
649 3300025295 Ga0209564_1002640 Ga0209564_10026402 239
650 3300025295 Ga0209564_1003255 Ga0209564_10032558 239
651 3300025297 Ga0209758_1002812 Ga0209758_100281212 239
652 3300025297 Ga0209758_1004501 Ga0209758_10045011 239
653 3300025297 Ga0209758_1004617 Ga0209758_10046177 239
654 3300025298 Ga0209050_1000160 Ga0209050_100016031 239
655 3300025302 Ga0207426_1000318 Ga0207426_100031846 239
656 3300025302 Ga0207426_1000360 Ga0207426_100036016 239
657 3300025302 Ga0207426_1001116 Ga0207426_100111610 239
658 3300025304 Ga0209257_1000001 Ga0209257_1000001925 239
659 3300025304 Ga0209257_1003010 Ga0209257_10030106 239
660 3300025315 Ga0207697_10034636 Ga0207697_100346362 239
661 3300025321 Ga0207656_10000424 Ga0207656_100004247 239
662 3300025321 Ga0207656_10060613 Ga0207656_100606132 239
663 3300025893 Ga0207682_10150865 Ga0207682_101508652 239
664 3300025899 Ga0207642_10119293 Ga0207642_101192932 239
665 3300025900 Ga0207710_10023114 Ga0207710_100231143 239
666 3300025903 Ga0207680_10000031 Ga0207680_1000003149 239
667 3300025903 Ga0207680_10001363 Ga0207680_100013639 239
668 3300025903 Ga0207680_10028330 Ga0207680_100283302 239
669 3300025903 Ga0207680_10046942 Ga0207680_100469422 239
670 3300025903 Ga0207680_10056804 Ga0207680_100568043 239
671 3300025904 Ga0207647_10026185 Ga0207647_100261852 239
672 3300025904 Ga0207647_10038494 Ga0207647_100384942 239
673 3300025904 Ga0207647_10052486 Ga0207647_100524863 239
674 3300025907 Ga0207645_10000949 Ga0207645_1000094915 239
675 3300025907 Ga0207645_10136641 Ga0207645_101366412 239
676 3300025908 Ga0207643_10019993 Ga0207643_100199932 239
677 3300025908 Ga0207643_10194996 Ga0207643_101949962 239
678 3300025908 Ga0207643_10239042 Ga0207643_102390422 239
679 3300025909 Ga0207705_10023675 Ga0207705_100236753 239
680 3300025910 Ga0207684_10779694 Ga0207684_107796941 239
681 3300025911 Ga0207654_10008187 Ga0207654_100081873 239
682 3300025911 Ga0207654_10250453 Ga0207654_102504532 239
683 3300025912 Ga0207707_10013305 Ga0207707_100133056 239
684 3300025913 Ga0207695_10000071 Ga0207695_10000071161 239
685 3300025913 Ga0207695_10000084 Ga0207695_10000084111 239
686 3300025913 Ga0207695_10000515 Ga0207695_1000051575 239
687 3300025913 Ga0207695_10002195 Ga0207695_100021955 239
688 3300025913 Ga0207695_10006026 Ga0207695_100060268 239
689 3300025913 Ga0207695_10066633 Ga0207695_100666332 239
690 3300025913 Ga0207695_10102521 Ga0207695_101025212 239
691 3300025913 Ga0207695_10188505 Ga0207695_101885052 239
692 3300025914 Ga0207671_10000981 Ga0207671_100009814 239
693 3300025914 Ga0207671_10001871 Ga0207671_100018712 239
694 3300025914 Ga0207671_10003538 Ga0207671_100035386 239
695 3300025914 Ga0207671_10007411 Ga0207671_100074119 239
696 3300025914 Ga0207671_10017355 Ga0207671_100173553 239
697 3300025914 Ga0207671_10029600 Ga0207671_100296002 239
698 3300025914 Ga0207671_10056341 Ga0207671_100563413 239
699 3300025914 Ga0207671_10160536 Ga0207671_101605362 239
700 3300025914 Ga0207671_10223928 Ga0207671_102239282 239
701 3300025917 Ga0207660_10079904 Ga0207660_100799042 239
702 3300025917 Ga0207660_10081653 Ga0207660_100816533 239
703 3300025918 Ga0207662_10066277 Ga0207662_100662772 239
704 3300025919 Ga0207657_10301692 Ga0207657_103016921 239
705 3300025920 Ga0207649_10152000 Ga0207649_101520002 239
706 3300025920 Ga0207649_10337386 Ga0207649_103373861 239
707 3300025921 Ga0207652_10255578 Ga0207652_102555781 239
708 3300025924 Ga0207694_10045035 Ga0207694_100450352 239
709 3300025924 Ga0207694_10097947 Ga0207694_100979472 239
710 3300025924 Ga0207694_10451294 Ga0207694_104512941 239
711 3300025925 Ga0207650_10025832 Ga0207650_100258322 239
712 3300025925 Ga0207650_10075554 Ga0207650_100755543 239
713 3300025925 Ga0207650_10128661 Ga0207650_101286612 239
714 3300025925 Ga0207650_10193494 Ga0207650_101934941 239
715 3300025925 Ga0207650_10296737 Ga0207650_102967371 239
716 3300025926 Ga0207659_10050982 Ga0207659_100509822 239
717 3300025926 Ga0207659_10094095 Ga0207659_100940952 239
718 3300025926 Ga0207659_10356397 Ga0207659_103563971 239
719 3300025926 Ga0207659_10452665 Ga0207659_104526652 239
720 3300025931 Ga0207644_10015110 Ga0207644_100151103 239
721 3300025931 Ga0207644_10358775 Ga0207644_103587752 239
722 3300025931 Ga0207644_10541834 Ga0207644_105418341 239
723 3300025932 Ga0207690_10119886 Ga0207690_101198861 239
724 3300025933 Ga0207706_10002788 Ga0207706_100027888 239
725 3300025933 Ga0207706_10011186 Ga0207706_100111866 239
726 3300025934 Ga0207686_10001258 Ga0207686_100012586 239
727 3300025934 Ga0207686_10068276 Ga0207686_100682762 239
728 3300025934 Ga0207686_10181112 Ga0207686_101811122 239
729 3300025936 Ga0207670_10019460 Ga0207670_100194602 239
730 3300025936 Ga0207670_10179885 Ga0207670_101798852 239
731 3300025936 Ga0207670_10603259 Ga0207670_106032591 239
732 3300025937 Ga0207669_10010995 Ga0207669_100109952 239
733 3300025937 Ga0207669_10186175 Ga0207669_101861752 239
734 3300025937 Ga0207669_10301958 Ga0207669_103019582 239
735 3300025937 Ga0207669_10696637 Ga0207669_106966371 239
736 3300025938 Ga0207704_10268152 Ga0207704_102681522 239
737 3300025938 Ga0207704_10438155 Ga0207704_104381551 239
738 3300025940 Ga0207691_10000037 Ga0207691_1000003783 239
739 3300025940 Ga0207691_10165053 Ga0207691_101650532 239
740 3300025940 Ga0207691_10177818 Ga0207691_101778181 239
741 3300025940 Ga0207691_10444575 Ga0207691_104445751 239
742 3300025940 Ga0207691_10450186 Ga0207691_104501861 239
743 3300025940 Ga0207691_10609711 Ga0207691_106097111 239
744 3300025941 Ga0207711_10141669 Ga0207711_101416692 239
745 3300025941 Ga0207711_10264135 Ga0207711_102641352 239
746 3300025942 Ga0207689_10014782 Ga0207689_100147823 239
747 3300025942 Ga0207689_10025181 Ga0207689_100251812 239
748 3300025942 Ga0207689_10087990 Ga0207689_100879903 239
749 3300025942 Ga0207689_10181501 Ga0207689_101815013 239
750 3300025942 Ga0207689_10381058 Ga0207689_103810582 239
751 3300025944 Ga0207661_10005710 Ga0207661_100057107 239
752 3300025944 Ga0207661_10109119 Ga0207661_101091192 239
753 3300025945 Ga0207679_10075284 Ga0207679_100752842 239
754 3300025945 Ga0207679_10209756 Ga0207679_102097562 239
755 3300025945 Ga0207679_10622513 Ga0207679_106225131 239
756 3300025949 Ga0207667_10000209 Ga0207667_100002095 239
757 3300025949 Ga0207667_10001238 Ga0207667_1000123820 239
758 3300025949 Ga0207667_10022196 Ga0207667_100221964 239
759 3300025949 Ga0207667_10152416 Ga0207667_101524162 239
760 3300025949 Ga0207667_10168669 Ga0207667_101686692 239
761 3300025949 Ga0207667_10456282 Ga0207667_104562821 239
762 3300025960 Ga0207651_10000443 Ga0207651_100004434 239
763 3300025960 Ga0207651_10041938 Ga0207651_100419383 239
764 3300025960 Ga0207651_10059015 Ga0207651_100590153 239
765 3300025960 Ga0207651_10355749 Ga0207651_103557491 239
766 3300025961 Ga0207712_10003355 Ga0207712_1000335511 239
767 3300025961 Ga0207712_10004607 Ga0207712_100046079 239
768 3300025961 Ga0207712_10005091 Ga0207712_100050916 239
769 3300025961 Ga0207712_10114190 Ga0207712_101141902 239
770 3300025972 Ga0207668_10001307 Ga0207668_100013074 239
771 3300025972 Ga0207668_10081464 Ga0207668_100814642 239
772 3300025972 Ga0207668_10478402 Ga0207668_104784022 239
773 3300025972 Ga0207668_10609087 Ga0207668_106090872 239
774 3300025981 Ga0207640_10013350 Ga0207640_100133502 239
775 3300025986 Ga0207658_10000629 Ga0207658_1000062911 239
776 3300025986 Ga0207658_10007220 Ga0207658_100072204 239
777 3300025986 Ga0207658_10043522 Ga0207658_100435223 239
778 3300025986 Ga0207658_10089862 Ga0207658_100898622 239
779 3300025986 Ga0207658_10354041 Ga0207658_103540412 239
780 3300025986 Ga0207658_10533985 Ga0207658_105339851 239
781 3300026023 Ga0207677_10005907 Ga0207677_100059076 239
782 3300026023 Ga0207677_10119659 Ga0207677_101196593 239
783 3300026023 Ga0207677_10132512 Ga0207677_101325122 239
784 3300026023 Ga0207677_10133440 Ga0207677_101334402 239
785 3300026023 Ga0207677_10133809 Ga0207677_101338092 239
786 3300026023 Ga0207677_10422919 Ga0207677_104229191 239
787 3300026023 Ga0207677_10483752 Ga0207677_104837522 239
788 3300026023 Ga0207677_10736357 Ga0207677_107363571 239
789 3300026035 Ga0207703_10004145 Ga0207703_1000414511 239
790 3300026035 Ga0207703_10009241 Ga0207703_100092416 239
791 3300026035 Ga0207703_10103200 Ga0207703_101032003 239
792 3300026035 Ga0207703_10231510 Ga0207703_102315102 239
793 3300026035 Ga0207703_10331517 Ga0207703_103315172 239
794 3300026035 Ga0207703_10335318 Ga0207703_103353182 239
795 3300026041 Ga0207639_10012262 Ga0207639_100122627 239
796 3300026041 Ga0207639_10042141 Ga0207639_100421413 239
797 3300026041 Ga0207639_10045458 Ga0207639_100454581 239
798 3300026041 Ga0207639_10112154 Ga0207639_101121542 239
799 3300026041 Ga0207639_10425988 Ga0207639_104259882 239
800 3300026041 Ga0207639_10737766 Ga0207639_107377661 239
801 3300026067 Ga0207678_10177411 Ga0207678_101774112 239
802 3300026067 Ga0207678_10209599 Ga0207678_102095991 239
803 3300026075 Ga0207708_10031445 Ga0207708_100314453 239
804 3300026078 Ga0207702_10662725 Ga0207702_106627252 239
805 3300026078 Ga0207702_10823524 Ga0207702_108235241 239
806 3300026088 Ga0207641_10000048 Ga0207641_10000048141 239
807 3300026088 Ga0207641_10000253 Ga0207641_1000025314 239
808 3300026088 Ga0207641_10014740 Ga0207641_100147402 239
809 3300026088 Ga0207641_10092372 Ga0207641_100923723 239
810 3300026088 Ga0207641_10323166 Ga0207641_103231661 239
811 3300026088 Ga0207641_10464825 Ga0207641_104648252 239
812 3300026089 Ga0207648_10001276 Ga0207648_1000127612 239
813 3300026089 Ga0207648_10002983 Ga0207648_1000298312 239
814 3300026089 Ga0207648_10046709 Ga0207648_100467093 239
815 3300026089 Ga0207648_10127146 Ga0207648_101271463 239
816 3300026089 Ga0207648_10129143 Ga0207648_101291432 239
817 3300026089 Ga0207648_10215866 Ga0207648_102158662 239
818 3300026095 Ga0207676_10002535 Ga0207676_1000253511 239
819 3300026095 Ga0207676_10013593 Ga0207676_100135932 239
820 3300026095 Ga0207676_10148146 Ga0207676_101481462 239
821 3300026095 Ga0207676_10184364 Ga0207676_101843642 239
822 3300026095 Ga0207676_10501915 Ga0207676_105019152 239
823 3300026116 Ga0207674_10027023 Ga0207674_100270234 239
824 3300026116 Ga0207674_10047001 Ga0207674_100470015 239
825 3300026116 Ga0207674_10184015 Ga0207674_101840151 239
826 3300026116 Ga0207674_10463346 Ga0207674_104633462 239
827 3300026118 Ga0207675_100011688 Ga0207675_1000116882 239
828 3300026118 Ga0207675_100086055 Ga0207675_1000860553 239
829 3300026118 Ga0207675_100534232 Ga0207675_1005342321 239
830 3300026121 Ga0207683_10021593 Ga0207683_100215935 239
831 3300026121 Ga0207683_10344952 Ga0207683_103449522 239
832 3300026142 Ga0207698_10001674 Ga0207698_100016747 239
833 3300026142 Ga0207698_10004963 Ga0207698_100049636 239
834 3300026142 Ga0207698_10066040 Ga0207698_100660402 239
835 3300026142 Ga0207698_10181912 Ga0207698_101819122 239
836 3300026142 Ga0207698_10385425 Ga0207698_103854252 239
837 3300026142 Ga0207698_10716631 Ga0207698_107166312 239
838 3300027907 Ga0207428_10422732 Ga0207428_104227321 239
839 3300028379 Ga0268266_10000038 Ga0268266_1000003834 239
840 3300028379 Ga0268266_10004818 Ga0268266_1000481810 239
841 3300028381 Ga0268264_10000167 Ga0268264_10000167117 239
842 3300028381 Ga0268264_10001271 Ga0268264_1000127114 239
843 3300028381 Ga0268264_10017828 Ga0268264_100178284 239
844 3300028381 Ga0268264_10056056 Ga0268264_100560562 239
845 3300028786 Ga0307517_10009245 Ga0307517_1000924510 239
846 3300028794 Ga0307515_10000072 Ga0307515_1000007250 239
847 3300030521 Ga0307511_10003621 Ga0307511_100036213 239
848 3300031456 Ga0307513_10233026 Ga0307513_102330262 239
849 3300031507 Ga0307509_10030533 Ga0307509_100305332 239
850 3300031507 Ga0307509_10061200 Ga0307509_100612003 239
851 3300031548 Ga0307408_100756664 Ga0307408_1007566641 239
852 3300031616 Ga0307508_10002859 Ga0307508_100028592 239
853 3300031616 Ga0307508_10266846 Ga0307508_102668462 239
854 3300031730 Ga0307516_10001231 Ga0307516_100012311 239
855 3300031824 Ga0307413_10049606 Ga0307413_100496062 239
856 3300031852 Ga0307410_10023713 Ga0307410_100237132 239
857 3300031911 Ga0307412_10072787 Ga0307412_100727872 239
858 3300032002 Ga0307416_100113769 Ga0307416_1001137692 239
859 3300032004 Ga0307414_10224178 Ga0307414_102241782 239
860 3300032005 Ga0307411_10104084 Ga0307411_101040842 239
861 3300032126 Ga0307415_100021613 Ga0307415_1000216132 239
862 3300033180 Ga0307510_10000528 Ga0307510_1000052825 239
863 3300033180 Ga0307510_10135555 Ga0307510_101355552 239
864 3300037471 Ga0395905_0232234 Ga0395905_0232234_959_1687 239
865 3300041406 Ga0439439_0012499 Ga0439439_0012499_1084_1803 239
866 3300041413 Ga0439465_0021139 Ga0439465_0021139_702_1421 239
867 3300041512 Ga0451853_2959559 Ga0451853_2959559_107_826 239
868 3300041512 Ga0451853_4098937 Ga0451853_4098937_221_940 239
869 3300042004 Ga0439445_0003921 Ga0439445_0003921_1835_2584 239
870 3300042007 Ga0439449_0030282 Ga0439449_0030282_778_1497 239
871 3300042011 Ga0439454_018308 Ga0439454_018308_102_821 239
872 3300042125 Ga0450923_058260 Ga0450923_058260_38_757 239
873 3300042133 Ga0450896_017370 Ga0450896_017370_124_843 239
874 3300042134 Ga0450898_002673 Ga0450898_002673_33_752 239
875 3300042435 Ga0439434_0022823 Ga0439434_0022823_780_1499 239
876 3300042532 Ga0450893_0031840 Ga0450893_0031840_86_805 239
877 3300044658 Ga0466972_0138714 Ga0466972_0138714_187_906 239
878 3300044693 Ga0466961_0025984 Ga0466961_0025984_359_1078 239
879 3300045049 Ga0466959_0004213 Ga0466959_0004213_7492_8217 239
880 3300045049 Ga0466959_0014943 Ga0466959_0014943_2325_3044 239
881 3300045836 Ga0466958_0066685 Ga0466958_0066685_260_985 239
882 3300045976 Ga0466967_0107825 Ga0466967_0107825_1120_1839 239
883 3300045976 Ga0466967_0175518 Ga0466967_0175518_36_755 239
884 3300046453 Ga0495627_002875 Ga0495627_002875_900_1619 239
885 3300046460 Ga0495638_0129567 Ga0495638_0129567_258_977 239
886 3300046472 Ga0495580_0159903 Ga0495580_0159903_642_1361 239
887 3300046475 Ga0495639_0133904 Ga0495639_0133904_419_1138 239
888 3300046507 Ga0495606_0017959 Ga0495606_0017959_3110_3829 239
889 3300046517 Ga0495630_0140407 Ga0495630_0140407_1067_1786 239
890 3300046517 Ga0495630_0224691 Ga0495630_0224691_244_963 239
891 3300046524 Ga0495648_0122239 Ga0495648_0122239_137_856 239
892 3300046537 Ga0495598_0084955 Ga0495598_0084955_54_773 239
893 3300046539 Ga0495621_0083863 Ga0495621_0083863_453_1172 239
894 3300046558 Ga0495633_0000005 Ga0495633_0000005_191812_192531 239
895 3300046648 Ga0495611_0000278 Ga0495611_0000278_10209_10928 239
896 3300047320 Ga0495672_0020115 Ga0495672_0020115_2118_2837 239
897 3300047320 Ga0495672_0060891 Ga0495672_0060891_1060_1779 239
898 3300047321 Ga0495676_0085516 Ga0495676_0085516_538_1257 239
899 3300047443 Ga0495687_000001 Ga0495687_000001_500231_500950 239
900 3300047472 Ga0495686_0194672 Ga0495686_0194672_224_943 239
901 3300048912 Ga0496109_0071641 Ga0496109_0071641_640_1359 239
902 3300048924 Ga0496121_0000020 Ga0496121_0000020_34_753 239
903 3300048924 Ga0496121_0482897 Ga0496121_0482897_49_768 239
904 3300048928 Ga0496125_0259894 Ga0496125_0259894_247_966 239
905 3300048929 Ga0496126_0007895 Ga0496126_0007895_9897_10616 239
906 3300049515 Ga0501292_001056 Ga0501292_001056_1491_2210 239
907 3300049521 Ga0501298_000064 Ga0501298_000064_3121_3840 239
908 3300049569 Ga0501032_0049879 Ga0501032_0049879_1048_1767 239
909 3300049571 Ga0501034_0091347 Ga0501034_0091347_2040_2759 239
910 3300049571 Ga0501034_0173582 Ga0501034_0173582_682_1401 239
911 3300049571 Ga0501034_0333990 Ga0501034_0333990_574_1293 239
912 3300049572 Ga0501036_0054709 Ga0501036_0054709_2534_3253 239
913 3300049573 Ga0501037_0007406 Ga0501037_0007406_2887_3606 239
914 3300049573 Ga0501037_0163701 Ga0501037_0163701_628_1350 239
915 3300049575 Ga0501039_0082677 Ga0501039_0082677_595_1314 239
916 3300049575 Ga0501039_0181995 Ga0501039_0181995_391_1110 239
917 3300049579 Ga0501043_0060404 Ga0501043_0060404_96_815 239
918 3300049579 Ga0501043_0149539 Ga0501043_0149539_307_1029 239
919 3300049580 Ga0501046_0010399 Ga0501046_0010399_749_1468 239
920 3300049580 Ga0501046_0327802 Ga0501046_0327802_286_1005 239
921 3300049580 Ga0501046_0365587 Ga0501046_0365587_120_842 239
922 3300049581 Ga0501047_0053692 Ga0501047_0053692_96_815 239
923 3300049582 Ga0501048_0069252 Ga0501048_0069252_1370_2089 239
924 3300049583 Ga0501067_0123912 Ga0501067_0123912_64_783 239
925 3300049583 Ga0501067_0172694 Ga0501067_0172694_251_970 239
926 3300049585 Ga0501069_0145123 Ga0501069_0145123_224_943 239
927 3300049586 Ga0501070_0096581 Ga0501070_0096581_1290_2009 239
928 3300049588 Ga0501072_0530928 Ga0501072_0530928_90_809 239
929 3300049589 Ga0501073_0004845 Ga0501073_0004845_1976_2695 239
930 3300049589 Ga0501073_0193939 Ga0501073_0193939_367_1086 239
931 3300049590 Ga0501074_0065938 Ga0501074_0065938_1798_2517 239
932 3300049651 Ga0501201_000527 Ga0501201_000527_1378_2097 239
933 3300049652 Ga0501202_000744 Ga0501202_000744_3208_3927 239
934 3300049652 Ga0501202_008310 Ga0501202_008310_749_1468 239
935 3300049653 Ga0501206_000832 Ga0501206_000832_1259_1978 239
936 3300049654 Ga0501207_004627 Ga0501207_004627_155_874 239
937 3300049661 Ga0501217_000216 Ga0501217_000216_6249_6968 239
938 3300049662 Ga0501222_002054 Ga0501222_002054_1396_2115 239
939 3300049664 Ga0501224_003158 Ga0501224_003158_466_1185 239
940 3300049665 Ga0501227_010002 Ga0501227_010002_1226_1945 239
941 3300049669 Ga0501235_000267 Ga0501235_000267_3557_4276 239
942 3300049671 Ga0501238_018655 Ga0501238_018655_83_805 239
943 3300049674 Ga0501242_000198 Ga0501242_000198_3173_3892 239
944 3300049674 Ga0501242_002573 Ga0501242_002573_404_1123 239
945 3300049675 Ga0501243_002944 Ga0501243_002944_1144_1863 239
946 3300049680 Ga0501250_007642 Ga0501250_007642_230_949 239
947 3300049682 Ga0501252_000167 Ga0501252_000167_294_1013 239
948 3300049683 Ga0501253_001083 Ga0501253_001083_1425_2144 239
949 3300049686 Ga0501257_022523 Ga0501257_022523_675_1394 239
950 3300049689 Ga0501260_003704 Ga0501260_003704_506_1225 239
951 3300049690 Ga0501261_000281 Ga0501261_000281_4528_5247 239
952 3300049704 Ga0501221_001294 Ga0501221_001294_914_1633 239
953 3300049705 Ga0501225_0005062 Ga0501225_0005062_3113_3832 239
954 3300049705 Ga0501225_0005570 Ga0501225_0005570_1622_2341 239
955 3300049707 Ga0501234_004702 Ga0501234_004702_805_1524 239
956 3300049708 Ga0501245_000671 Ga0501245_000671_606_1325 239
957 3300049741 Ga0501079_0212590 Ga0501079_0212590_471_1190 239
958 3300049742 Ga0501080_0022014 Ga0501080_0022014_1981_2700 239
959 3300049742 Ga0501080_0564532 Ga0501080_0564532_19_738 239
960 3300049744 Ga0501083_0068438 Ga0501083_0068438_858_1577 239
961 3300049763 Ga0501266_002278 Ga0501266_002278_1118_1837 239
962 3300049822 Ga0501035_0032518 Ga0501035_0032518_788_1507 239
963 3300049822 Ga0501035_0548247 Ga0501035_0548247_92_811 239
964 3300050493 nmdc:mga0k408_37004_c1 nmdc:mga0k408_37004_c1_573_1292 239
965 3300050493 nmdc:mga0k408_6193_c1 nmdc:mga0k408_6193_c1_4521_5240 239
966 3300050508 nmdc:mga09592_20389_c1 nmdc:mga09592_20389_c1_612_1331 239
967 3300050509 nmdc:mga0qj67_178793_c1 nmdc:mga0qj67_178793_c1_398_1117 239
968 3300050509 nmdc:mga0qj67_37014_c1 nmdc:mga0qj67_37014_c1_2774_3493 239
969 3300050511 nmdc:mga08y16_305799_c1 nmdc:mga08y16_305799_c1_98_817 239
970 3300050511 nmdc:mga08y16_439882_c1 nmdc:mga08y16_439882_c1_111_830 239
971 3300053088 Ga0500644_0000184 Ga0500644_0000184_29592_30311 239
972 3300053090 Ga0500646_0015258 Ga0500646_0015258_1016_1735 239
973 3300053090 Ga0500646_0016948 Ga0500646_0016948_887_1606 239
974 3300053092 Ga0500583_0004533 Ga0500583_0004533_1661_2380 239
975 3300053092 Ga0500583_0005677 Ga0500583_0005677_3295_4014 239
976 3300053093 Ga0500651_0019215 Ga0500651_0019215_1698_2417 239
977 3300053093 Ga0500651_0109110 Ga0500651_0109110_295_1014 239
978 3300053109 Ga0500569_000886 Ga0500569_000886_3849_4568 239
979 3300053118 Ga0500594_0035071 Ga0500594_0035071_265_984 239
980 3300053131 Ga0500652_000909 Ga0500652_000909_3679_4479 239
981 3300053139 Ga0500568_0011377 Ga0500568_0011377_2484_3203 239
982 3300053139 Ga0500568_0078890 Ga0500568_0078890_337_1056 239
983 3300053142 Ga0500577_0001440 Ga0500577_0001440_4458_5177 239
984 3300053153 Ga0500616_0009438 Ga0500616_0009438_888_1607 239
985 3300053156 Ga0500622_0001887 Ga0500622_0001887_3748_4467 239
986 3300053156 Ga0500622_0009069 Ga0500622_0009069_1160_1879 239
987 3300053160 Ga0500633_0013134 Ga0500633_0013134_963_1682 239
988 3300053727 Ga0500611_000022 Ga0500611_000022_73829_74548 239
989 3300053732 Ga0500656_004668 Ga0500656_004668_199_918 239
990 3300054114 Ga0501084_0082222 Ga0501084_0082222_629_1348 239
991 3300061719 Ga0466962_0028059 Ga0466962_0028059_1856_2581 239

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cqo-assembly3.cif.gz_D crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae (semet labeled), rim1 (form2) 0.7191 151 181
4lgv-assembly1.cif.gz_B x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.672 151 178
5i4a-assembly2.cif.gz_C x-ray crystal structure of marinitoga piezophila argonaute in complex with 5' oh guide rna 0.6627 149 176
3pjq-assembly1.cif.gz_A trypanosoma cruzi trans-sialidase-like inactive isoform (including the natural mutation tyr342his) in complex with lactose 0.5933 151 181
5ux0-assembly2.cif.gz_D x-ray crystal structure of marinitoga piezophila argonaute in complex with 5' oh guide rna and target dna 0.5864 150 181
ID Description Score Start End Superfamily
af_A0A0R0HSA0_2_92_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7416 16 115 1.20.58.90
af_A0A0R0HSA0_2_92_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6885 16 115 1.20.58.90
af_Q24151_343_485_2.60.40.630 Mainly Beta;Sandwich;Immunoglobulin-like;STAT transcription factor, DNA-binding domain 0.6652 152 174 2.60.40.630
af_Q9ZQ60_46_277_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6541 152 174 2.130.10.10
af_E1JIM6_261_375_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6337 152 178 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A6J4TG48-F1-model_v4 Uncharacterized protein 0.9758 137 235
AF-A0A4Q3W8S8-F1-model_v4 Uncharacterized protein 0.968 108 239
AF-A0A6J4TG48-F1-model_v4 Uncharacterized protein 0.9569 137 235
AF-A0A4Q3W8S8-F1-model_v4 Uncharacterized protein 0.9403 108 239
AF-A0A7C7BMF9-F1-model_v4 Uncharacterized protein 0.9318 151 237

Feature Viewer

pLDDT pTM Quality
78.98 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map