F487626
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 991 | 355 | 976 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10110627|rootL2_101106272 |
| Length | 272 |
| Sequence | MKTLSETWFADGYIDFELKKYTLLAYLQEIHQHFSQNKLYPQLSDIIFHYNNLVAFRENKKYLQEQFPKKLTGVQIEKLQVLYELLIEDDELMQELEDIINYASQEMKSAISSGTEIYEFVEDKLTIFPVGLIPLDNHEGYFFLSEGSYSDTRVYQYRLSFFEKHDERYRSIRTEYIDSWTRNMVNTYENIKAELIRVKTAMPNPAVYSIETELKFPVDETLLPIAKRSLVRYISTPVISLHQGIFFIFMKWCIAINKIDQPEFNFVSFPFK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 4 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 5 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 6 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 7 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 8 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 9 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 10 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 11 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 12 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 13 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 14 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 15 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 16 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 17 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 20 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 212 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 233 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 236 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 237 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 238 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 239 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 240 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 241 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 242 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 243 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 244 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 245 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 246 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 278 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 296 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 297 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 298 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 299 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 300 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 301 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 305 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 306 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 307 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 308 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 309 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 310 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 311 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 312 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 313 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 314 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 315 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 322 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 326 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 333 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 335 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 336 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 337 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 338 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 339 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 340 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 343 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 344 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 345 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 347 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 348 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 349 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 350 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 352 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 355 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 0 |
| Isolates | 1.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.06 |
| Nodule | 0 |
| Rhizoplane | 0.2 |
| Rhizosphere | 86.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1763716 | 2162886007 | Unclassified | 1771 |
| 2 | JGI24736J21556_1010067 | 3300001904 | Bacteria | 1549 |
| 3 | JGI24740J21852_10009246 | 3300001979 | Bacteria | 3868 |
| 4 | JGI24740J21852_10027647 | 3300001979 | Bacteria | 1885 |
| 5 | JGI24751J29686_10043817 | 3300002459 | Bacteria | 925 |
| 6 | JGI25154J39366_1000014 | 3300002738 | Bacteria | 265287 |
| 7 | JGI25406J46586_10010665 | 3300003203 | Bacteria | 4067 |
| 8 | JGI25153J46596_10018336 | 3300003215 | Bacteria | 2723 |
| 9 | JGI25153J46596_10048003 | 3300003215 | Bacteria | 1251 |
| 10 | rootH2_10008932 | 3300003320 | Bacteria | 37271 |
| 11 | rootH2_10009459 | 3300003320 | Bacteria | 2099 |
| 12 | rootH2_10009460 | 3300003320 | Bacteria | 1248 |
| 13 | rootH2_10014077 | 3300003320 | Bacteria | 4191 |
| 14 | rootH2_10041861 | 3300003320 | Bacteria | 17793 |
| 15 | rootH2_10097088 | 3300003320 | Bacteria | 5060 |
| 16 | rootH2_10133384 | 3300003320 | Bacteria | 1526 |
| 17 | rootH2_10187341 | 3300003320 | Bacteria | 2901 |
| 18 | rootH2_10287768 | 3300003320 | Bacteria | 1573 |
| 19 | rootL2_10066602 | 3300003322 | Bacteria | 3899 |
| 20 | rootL2_10110627 | 3300003322 | Bacteria | 4370 |
| 21 | rootL2_10178503 | 3300003322 | Bacteria | 2274 |
| 22 | rootL2_10252348 | 3300003322 | Bacteria | 1178 |
| 23 | rootL2_10296671 | 3300003322 | Bacteria | 1416 |
| 24 | rootH1_10091661 | 3300003323 | Bacteria | 6486 |
| 25 | rootH1_10092711 | 3300003323 | Bacteria | 1942 |
| 26 | rootH1_10146227 | 3300003323 | Bacteria | 10114 |
| 27 | rootH1_10149908 | 3300003323 | Bacteria | 2031 |
| 28 | rootH1_10156460 | 3300003323 | Bacteria | 1805 |
| 29 | rootH1_10309255 | 3300003323 | Bacteria | 1323 |
| 30 | JGI25160J50197_1008228 | 3300003354 | Bacteria | 3991 |
| 31 | JGI25160J50197_1008916 | 3300003354 | Bacteria | 3770 |
| 32 | JGI25160J50197_1015038 | 3300003354 | Bacteria | 2559 |
| 33 | JGI25160J50197_1025790 | 3300003354 | Bacteria | 1635 |
| 34 | Ga0055542_1004837 | 3300003762 | Bacteria | 3156 |
| 35 | Ga0055528_1001076 | 3300003790 | Bacteria | 18002 |
| 36 | Ga0055530_10000707 | 3300003791 | Bacteria | 28075 |
| 37 | Ga0055531_10000093 | 3300003794 | Bacteria | 97901 |
| 38 | Ga0055543_1019289 | 3300004625 | Unclassified | 1263 |
| 39 | Ga0065165_1000036 | 3300005262 | Bacteria | 212900 |
| 40 | Ga0065165_1024369 | 3300005262 | Bacteria | 2034 |
| 41 | Ga0065165_1061452 | 3300005262 | Bacteria | 1028 |
| 42 | Ga0065704_10121130 | 3300005289 | Unclassified | 1771 |
| 43 | Ga0065712_10029724 | 3300005290 | Bacteria | 1940 |
| 44 | Ga0065715_10106144 | 3300005293 | Bacteria | 2842 |
| 45 | Ga0065707_10156284 | 3300005295 | Bacteria | 1606 |
| 46 | Ga0070658_10002948 | 3300005327 | Bacteria | 14112 |
| 47 | Ga0070658_10005453 | 3300005327 | Bacteria | 10313 |
| 48 | Ga0070658_10020168 | 3300005327 | Bacteria | 5340 |
| 49 | Ga0070658_10266824 | 3300005327 | Bacteria | 1455 |
| 50 | Ga0070658_10758694 | 3300005327 | Bacteria | 842 |
| 51 | Ga0070676_10001904 | 3300005328 | Bacteria | 10604 |
| 52 | Ga0070676_10062169 | 3300005328 | Unclassified | 2221 |
| 53 | Ga0070683_100006532 | 3300005329 | Bacteria | 9793 |
| 54 | Ga0070683_100045232 | 3300005329 | Bacteria | 4063 |
| 55 | Ga0070683_100064309 | 3300005329 | Bacteria | 3415 |
| 56 | Ga0070683_100070065 | 3300005329 | Bacteria | 3271 |
| 57 | Ga0070683_100396763 | 3300005329 | Bacteria | 1315 |
| 58 | Ga0070683_100652963 | 3300005329 | Unclassified | 1007 |
| 59 | Ga0070690_100415821 | 3300005330 | Unclassified | 990 |
| 60 | Ga0070670_100031739 | 3300005331 | Bacteria | 4550 |
| 61 | Ga0070670_100063065 | 3300005331 | Bacteria | 3180 |
| 62 | Ga0070670_100133226 | 3300005331 | Unclassified | 2147 |
| 63 | Ga0070670_100185995 | 3300005331 | Bacteria | 1804 |
| 64 | Ga0070670_100340430 | 3300005331 | Unclassified | 1316 |
| 65 | Ga0070670_100355289 | 3300005331 | Bacteria | 1288 |
| 66 | Ga0070670_100373312 | 3300005331 | Bacteria | 1256 |
| 67 | Ga0070670_100431894 | 3300005331 | Unclassified | 1165 |
| 68 | Ga0070670_100714569 | 3300005331 | Bacteria | 902 |
| 69 | Ga0070677_10262856 | 3300005333 | Bacteria | 862 |
| 70 | Ga0068869_100031459 | 3300005334 | Bacteria | 3733 |
| 71 | Ga0068869_100109898 | 3300005334 | Bacteria | 2096 |
| 72 | Ga0068869_100130791 | 3300005334 | Bacteria | 1929 |
| 73 | Ga0068869_100442492 | 3300005334 | Bacteria | 1076 |
| 74 | Ga0068869_100869694 | 3300005334 | Unclassified | 778 |
| 75 | Ga0070666_10000247 | 3300005335 | Bacteria | 36276 |
| 76 | Ga0070666_10000885 | 3300005335 | Bacteria | 18201 |
| 77 | Ga0070666_10057807 | 3300005335 | Bacteria | 2621 |
| 78 | Ga0070666_10167108 | 3300005335 | Bacteria | 1539 |
| 79 | Ga0070680_100002380 | 3300005336 | Bacteria | 13907 |
| 80 | Ga0070680_100023180 | 3300005336 | Bacteria | 4948 |
| 81 | Ga0070680_100258005 | 3300005336 | Bacteria | 1474 |
| 82 | Ga0070682_100010074 | 3300005337 | Bacteria | 5357 |
| 83 | Ga0070682_100013374 | 3300005337 | Bacteria | 4719 |
| 84 | Ga0070682_100230413 | 3300005337 | Bacteria | 1324 |
| 85 | Ga0070682_100290170 | 3300005337 | Bacteria | 1196 |
| 86 | Ga0070682_100323963 | 3300005337 | Bacteria | 1139 |
| 87 | Ga0068868_100000075 | 3300005338 | Bacteria | 58452 |
| 88 | Ga0068868_100013056 | 3300005338 | Bacteria | 6081 |
| 89 | Ga0068868_100068306 | 3300005338 | Bacteria | 2830 |
| 90 | Ga0068868_100088975 | 3300005338 | Bacteria | 2485 |
| 91 | Ga0068868_100102340 | 3300005338 | Bacteria | 2319 |
| 92 | Ga0068868_100213039 | 3300005338 | Bacteria | 1615 |
| 93 | Ga0068868_100238090 | 3300005338 | Unclassified | 1528 |
| 94 | Ga0068868_100734692 | 3300005338 | Unclassified | 886 |
| 95 | Ga0070660_100142760 | 3300005339 | Bacteria | 1922 |
| 96 | Ga0070660_100249257 | 3300005339 | Bacteria | 1448 |
| 97 | Ga0070689_100027122 | 3300005340 | Bacteria | 4316 |
| 98 | Ga0070689_100074988 | 3300005340 | Bacteria | 2647 |
| 99 | Ga0070689_100583446 | 3300005340 | Unclassified | 966 |
| 100 | Ga0070691_10040723 | 3300005341 | Bacteria | 2196 |
| 101 | Ga0070661_100083927 | 3300005344 | Bacteria | 2353 |
| 102 | Ga0070661_100218436 | 3300005344 | Bacteria | 1461 |
| 103 | Ga0070661_100239428 | 3300005344 | Bacteria | 1397 |
| 104 | Ga0070661_100474396 | 3300005344 | Unclassified | 998 |
| 105 | Ga0070668_100000859 | 3300005347 | Bacteria | 21121 |
| 106 | Ga0070668_100138352 | 3300005347 | Bacteria | 1960 |
| 107 | Ga0070668_100300827 | 3300005347 | Bacteria | 1345 |
| 108 | Ga0070669_100115704 | 3300005353 | Bacteria | 2040 |
| 109 | Ga0070669_100243810 | 3300005353 | Bacteria | 1429 |
| 110 | Ga0070669_100312009 | 3300005353 | Bacteria | 1268 |
| 111 | Ga0070675_100002335 | 3300005354 | Bacteria | 14099 |
| 112 | Ga0070675_100261587 | 3300005354 | Bacteria | 1516 |
| 113 | Ga0070675_100304470 | 3300005354 | Bacteria | 1405 |
| 114 | Ga0070675_100393707 | 3300005354 | Bacteria | 1235 |
| 115 | Ga0070675_100621897 | 3300005354 | Bacteria | 980 |
| 116 | Ga0070671_100011147 | 3300005355 | Bacteria | 7219 |
| 117 | Ga0070671_100059311 | 3300005355 | Bacteria | 3184 |
| 118 | Ga0070671_100082473 | 3300005355 | Unclassified | 2688 |
| 119 | Ga0070671_100540540 | 3300005355 | Bacteria | 1004 |
| 120 | Ga0070674_100141000 | 3300005356 | Bacteria | 1809 |
| 121 | Ga0070674_100355722 | 3300005356 | Bacteria | 1184 |
| 122 | Ga0070673_100000448 | 3300005364 | Bacteria | 21839 |
| 123 | Ga0070673_100060234 | 3300005364 | Bacteria | 3007 |
| 124 | Ga0070673_100113380 | 3300005364 | Bacteria | 2251 |
| 125 | Ga0070673_100129828 | 3300005364 | Bacteria | 2113 |
| 126 | Ga0070688_100141765 | 3300005365 | Bacteria | 1633 |
| 127 | Ga0070688_100282480 | 3300005365 | Bacteria | 1193 |
| 128 | Ga0070659_100000828 | 3300005366 | Bacteria | 22546 |
| 129 | Ga0070659_100001692 | 3300005366 | Bacteria | 15868 |
| 130 | Ga0070659_100156699 | 3300005366 | Bacteria | 1860 |
| 131 | Ga0070667_100000482 | 3300005367 | Bacteria | 40557 |
| 132 | Ga0070667_100003979 | 3300005367 | Bacteria | 12525 |
| 133 | Ga0070667_100042511 | 3300005367 | Bacteria | 3813 |
| 134 | Ga0070667_100066306 | 3300005367 | Bacteria | 3067 |
| 135 | Ga0070667_100460163 | 3300005367 | Bacteria | 1163 |
| 136 | Ga0070700_100143578 | 3300005441 | Bacteria | 1625 |
| 137 | Ga0070663_100042799 | 3300005455 | Bacteria | 3184 |
| 138 | Ga0070663_100664288 | 3300005455 | Bacteria | 883 |
| 139 | Ga0070678_100084340 | 3300005456 | Bacteria | 2418 |
| 140 | Ga0070678_100220271 | 3300005456 | Bacteria | 1577 |
| 141 | Ga0070678_100389306 | 3300005456 | Bacteria | 1208 |
| 142 | Ga0070678_100487863 | 3300005456 | Bacteria | 1085 |
| 143 | Ga0070678_100495465 | 3300005456 | Bacteria | 1077 |
| 144 | Ga0070678_100504184 | 3300005456 | Bacteria | 1068 |
| 145 | Ga0070678_100613397 | 3300005456 | Bacteria | 972 |
| 146 | Ga0070662_100002983 | 3300005457 | Bacteria | 10519 |
| 147 | Ga0070662_100029479 | 3300005457 | Bacteria | 3830 |
| 148 | Ga0070662_100369440 | 3300005457 | Bacteria | 1179 |
| 149 | Ga0070681_10059457 | 3300005458 | Bacteria | 3802 |
| 150 | Ga0070681_10115068 | 3300005458 | Bacteria | 2628 |
| 151 | Ga0070681_10527626 | 3300005458 | Bacteria | 1094 |
| 152 | Ga0068867_100005606 | 3300005459 | Bacteria | 8895 |
| 153 | Ga0068867_100013182 | 3300005459 | Bacteria | 5855 |
| 154 | Ga0068867_100103322 | 3300005459 | Bacteria | 2179 |
| 155 | Ga0068867_100176404 | 3300005459 | Bacteria | 1696 |
| 156 | Ga0068867_100191364 | 3300005459 | Bacteria | 1633 |
| 157 | Ga0068867_100233512 | 3300005459 | Unclassified | 1488 |
| 158 | Ga0068867_100378076 | 3300005459 | Bacteria | 1189 |
| 159 | Ga0070685_10001175 | 3300005466 | Bacteria | 14009 |
| 160 | Ga0070685_10047256 | 3300005466 | Bacteria | 2474 |
| 161 | Ga0070706_100403127 | 3300005467 | Bacteria | 1273 |
| 162 | Ga0070706_100478269 | 3300005467 | Bacteria | 1159 |
| 163 | Ga0070698_100001454 | 3300005471 | Bacteria | 26303 |
| 164 | Ga0070698_100188702 | 3300005471 | Bacteria | 1999 |
| 165 | Ga0070698_100287347 | 3300005471 | Bacteria | 1576 |
| 166 | Ga0070679_100001831 | 3300005530 | Bacteria | 19163 |
| 167 | Ga0070679_100026151 | 3300005530 | Bacteria | 5729 |
| 168 | Ga0070679_100632879 | 3300005530 | Bacteria | 1013 |
| 169 | Ga0070684_100002043 | 3300005535 | Bacteria | 14865 |
| 170 | Ga0070684_100002647 | 3300005535 | Bacteria | 13212 |
| 171 | Ga0070684_100036799 | 3300005535 | Bacteria | 4195 |
| 172 | Ga0070684_100066025 | 3300005535 | Bacteria | 3176 |
| 173 | Ga0068853_100006239 | 3300005539 | Bacteria | 9446 |
| 174 | Ga0068853_100007967 | 3300005539 | Bacteria | 8495 |
| 175 | Ga0068853_100029438 | 3300005539 | Bacteria | 4630 |
| 176 | Ga0068853_100038435 | 3300005539 | Bacteria | 4076 |
| 177 | Ga0068853_100043831 | 3300005539 | Bacteria | 3828 |
| 178 | Ga0068853_100304429 | 3300005539 | Bacteria | 1474 |
| 179 | Ga0068853_100450622 | 3300005539 | Bacteria | 1210 |
| 180 | Ga0070672_100000361 | 3300005543 | Bacteria | 26202 |
| 181 | Ga0070672_100082710 | 3300005543 | Bacteria | 2576 |
| 182 | Ga0070672_100179153 | 3300005543 | Bacteria | 1765 |
| 183 | Ga0070672_100421243 | 3300005543 | Unclassified | 1147 |
| 184 | Ga0070672_100580201 | 3300005543 | Unclassified | 975 |
| 185 | Ga0070686_100131878 | 3300005544 | Bacteria | 1729 |
| 186 | Ga0070693_100030023 | 3300005547 | Bacteria | 2969 |
| 187 | Ga0070693_100368666 | 3300005547 | Bacteria | 987 |
| 188 | Ga0070693_100392077 | 3300005547 | Unclassified | 960 |
| 189 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 190 | Ga0070665_100002163 | 3300005548 | Bacteria | 21925 |
| 191 | Ga0070665_100362726 | 3300005548 | Bacteria | 1455 |
| 192 | Ga0070704_100091979 | 3300005549 | Bacteria | 2263 |
| 193 | Ga0068855_100000089 | 3300005563 | Bacteria | 110845 |
| 194 | Ga0068855_100018669 | 3300005563 | Bacteria | 8340 |
| 195 | Ga0068855_100022692 | 3300005563 | Bacteria | 7520 |
| 196 | Ga0068855_100164681 | 3300005563 | Bacteria | 2514 |
| 197 | Ga0068855_100177211 | 3300005563 | Bacteria | 2411 |
| 198 | Ga0068855_100181633 | 3300005563 | Bacteria | 2378 |
| 199 | Ga0068855_100484639 | 3300005563 | Bacteria | 1346 |
| 200 | Ga0070664_100022709 | 3300005564 | Bacteria | 5174 |
| 201 | Ga0070664_100031477 | 3300005564 | Unclassified | 4433 |
| 202 | Ga0070664_100058013 | 3300005564 | Bacteria | 3292 |
| 203 | Ga0070664_100097591 | 3300005564 | Bacteria | 2551 |
| 204 | Ga0070664_100255772 | 3300005564 | Unclassified | 1575 |
| 205 | Ga0070664_100456359 | 3300005564 | Unclassified | 1174 |
| 206 | Ga0068857_100025308 | 3300005577 | Bacteria | 5227 |
| 207 | Ga0068857_100078843 | 3300005577 | Bacteria | 2940 |
| 208 | Ga0068857_100155484 | 3300005577 | Bacteria | 2073 |
| 209 | Ga0068857_100246793 | 3300005577 | Bacteria | 1636 |
| 210 | Ga0068857_100301295 | 3300005577 | Unclassified | 1478 |
| 211 | Ga0068857_100663516 | 3300005577 | Bacteria | 989 |
| 212 | Ga0068854_100047350 | 3300005578 | Unclassified | 3064 |
| 213 | Ga0068854_100052769 | 3300005578 | Bacteria | 2917 |
| 214 | Ga0068854_100130636 | 3300005578 | Bacteria | 1917 |
| 215 | Ga0068854_100766387 | 3300005578 | Unclassified | 838 |
| 216 | Ga0068856_100003735 | 3300005614 | Bacteria | 15264 |
| 217 | Ga0068856_100023059 | 3300005614 | Bacteria | 6053 |
| 218 | Ga0068856_100025703 | 3300005614 | Bacteria | 5741 |
| 219 | Ga0068856_100258618 | 3300005614 | Bacteria | 1756 |
| 220 | Ga0068856_100797272 | 3300005614 | Unclassified | 964 |
| 221 | Ga0070702_100105931 | 3300005615 | Bacteria | 1734 |
| 222 | Ga0070702_100212383 | 3300005615 | Bacteria | 1289 |
| 223 | Ga0068852_100004440 | 3300005616 | Bacteria | 9918 |
| 224 | Ga0068852_100006386 | 3300005616 | Bacteria | 8515 |
| 225 | Ga0068852_100019362 | 3300005616 | Bacteria | 5385 |
| 226 | Ga0068852_100039630 | 3300005616 | Bacteria | 3968 |
| 227 | Ga0068852_100086040 | 3300005616 | Bacteria | 2801 |
| 228 | Ga0068852_100147688 | 3300005616 | Bacteria | 2183 |
| 229 | Ga0068852_100151063 | 3300005616 | Bacteria | 2160 |
| 230 | Ga0068852_100178390 | 3300005616 | Bacteria | 1996 |
| 231 | Ga0068852_100183670 | 3300005616 | Unclassified | 1968 |
| 232 | Ga0068852_100338617 | 3300005616 | Bacteria | 1465 |
| 233 | Ga0068852_100586270 | 3300005616 | Bacteria | 1118 |
| 234 | Ga0068852_100718569 | 3300005616 | Bacteria | 1010 |
| 235 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 236 | Ga0068859_100158154 | 3300005617 | Bacteria | 2344 |
| 237 | Ga0068859_100174460 | 3300005617 | Unclassified | 2231 |
| 238 | Ga0068859_100554889 | 3300005617 | Bacteria | 1243 |
| 239 | Ga0068859_100673995 | 3300005617 | Bacteria | 1125 |
| 240 | Ga0068859_101181071 | 3300005617 | Bacteria | 843 |
| 241 | Ga0068864_100000785 | 3300005618 | Bacteria | 26636 |
| 242 | Ga0068864_100007484 | 3300005618 | Bacteria | 8996 |
| 243 | Ga0068864_100046783 | 3300005618 | Bacteria | 3713 |
| 244 | Ga0068864_100121314 | 3300005618 | Bacteria | 2337 |
| 245 | Ga0068864_100230121 | 3300005618 | Bacteria | 1714 |
| 246 | Ga0068866_10138905 | 3300005718 | Bacteria | 1392 |
| 247 | Ga0068861_100005861 | 3300005719 | Bacteria | 8349 |
| 248 | Ga0068861_100025336 | 3300005719 | Bacteria | 4301 |
| 249 | Ga0068861_100369858 | 3300005719 | Bacteria | 1263 |
| 250 | Ga0068861_100434340 | 3300005719 | Bacteria | 1173 |
| 251 | Ga0068861_100657574 | 3300005719 | Bacteria | 969 |
| 252 | Ga0068851_10001706 | 3300005834 | Bacteria | 9614 |
| 253 | Ga0068851_10062786 | 3300005834 | Bacteria | 1907 |
| 254 | Ga0068870_10316628 | 3300005840 | Bacteria | 990 |
| 255 | Ga0068870_10419458 | 3300005840 | Bacteria | 875 |
| 256 | Ga0068863_100001993 | 3300005841 | Bacteria | 20286 |
| 257 | Ga0068863_100007688 | 3300005841 | Bacteria | 10544 |
| 258 | Ga0068863_100017853 | 3300005841 | Bacteria | 6789 |
| 259 | Ga0068863_100064072 | 3300005841 | Bacteria | 3476 |
| 260 | Ga0068863_100615262 | 3300005841 | Bacteria | 1076 |
| 261 | Ga0068863_100636357 | 3300005841 | Bacteria | 1057 |
| 262 | Ga0068858_100001413 | 3300005842 | Bacteria | 24658 |
| 263 | Ga0068858_100003623 | 3300005842 | Bacteria | 15279 |
| 264 | Ga0068858_100106825 | 3300005842 | Bacteria | 2613 |
| 265 | Ga0068858_100365833 | 3300005842 | Unclassified | 1382 |
| 266 | Ga0068858_100530105 | 3300005842 | Bacteria | 1139 |
| 267 | Ga0068860_100000111 | 3300005843 | Bacteria | 131004 |
| 268 | Ga0068860_100001074 | 3300005843 | Bacteria | 30126 |
| 269 | Ga0068860_100002836 | 3300005843 | Bacteria | 18019 |
| 270 | Ga0068860_100003730 | 3300005843 | Bacteria | 15673 |
| 271 | Ga0068860_100359310 | 3300005843 | Bacteria | 1434 |
| 272 | Ga0068862_100168094 | 3300005844 | Unclassified | 1962 |
| 273 | Ga0068862_100310139 | 3300005844 | Bacteria | 1454 |
| 274 | Ga0081540_1039418 | 3300005983 | Unclassified | 2476 |
| 275 | Ga0081539_10000337 | 3300005985 | Bacteria | 103868 |
| 276 | Ga0081539_10200780 | 3300005985 | Unclassified | 921 |
| 277 | Ga0075366_10009448 | 3300006195 | Bacteria | 5442 |
| 278 | Ga0075366_10039932 | 3300006195 | Bacteria | 2774 |
| 279 | Ga0097621_100000063 | 3300006237 | Bacteria | 55571 |
| 280 | Ga0097621_100003845 | 3300006237 | Bacteria | 10402 |
| 281 | Ga0097621_100004135 | 3300006237 | Bacteria | 10062 |
| 282 | Ga0097621_100031558 | 3300006237 | Bacteria | 4205 |
| 283 | Ga0097621_100063054 | 3300006237 | Bacteria | 3045 |
| 284 | Ga0097621_100122957 | 3300006237 | Bacteria | 2203 |
| 285 | Ga0097621_100525959 | 3300006237 | Unclassified | 1074 |
| 286 | Ga0097621_100598157 | 3300006237 | Bacteria | 1008 |
| 287 | Ga0068871_100000981 | 3300006358 | Bacteria | 19104 |
| 288 | Ga0068871_100001569 | 3300006358 | Bacteria | 15347 |
| 289 | Ga0068871_100005200 | 3300006358 | Bacteria | 9099 |
| 290 | Ga0068871_100008715 | 3300006358 | Bacteria | 7295 |
| 291 | Ga0068871_100009289 | 3300006358 | Bacteria | 7116 |
| 292 | Ga0068871_100128248 | 3300006358 | Bacteria | 2149 |
| 293 | Ga0068871_100157109 | 3300006358 | Bacteria | 1942 |
| 294 | Ga0068871_100299036 | 3300006358 | Bacteria | 1412 |
| 295 | Ga0068871_100554954 | 3300006358 | Bacteria | 1041 |
| 296 | Ga0068871_100746485 | 3300006358 | Unclassified | 899 |
| 297 | Ga0075428_100049669 | 3300006844 | Bacteria | 4602 |
| 298 | Ga0075430_100004854 | 3300006846 | Bacteria | 11313 |
| 299 | Ga0075430_100121445 | 3300006846 | Bacteria | 2178 |
| 300 | Ga0075431_100009279 | 3300006847 | Bacteria | 9869 |
| 301 | Ga0075429_100004948 | 3300006880 | Bacteria | 11476 |
| 302 | Ga0068865_100029986 | 3300006881 | Bacteria | 3614 |
| 303 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 304 | Ga0097620_100158144 | 3300006931 | Bacteria | 2344 |
| 305 | Ga0097620_100174468 | 3300006931 | Unclassified | 2231 |
| 306 | Ga0097620_100554979 | 3300006931 | Bacteria | 1243 |
| 307 | Ga0097620_100673994 | 3300006931 | Bacteria | 1125 |
| 308 | Ga0097620_101181033 | 3300006931 | Bacteria | 843 |
| 309 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 310 | Ga0105240_10003320 | 3300009093 | Bacteria | 25129 |
| 311 | Ga0105240_10004846 | 3300009093 | Bacteria | 20276 |
| 312 | Ga0105240_10005940 | 3300009093 | Bacteria | 18085 |
| 313 | Ga0105240_10022330 | 3300009093 | Bacteria | 8390 |
| 314 | Ga0105240_10025898 | 3300009093 | Bacteria | 7702 |
| 315 | Ga0105240_10054314 | 3300009093 | Bacteria | 5021 |
| 316 | Ga0105240_10062591 | 3300009093 | Bacteria | 4632 |
| 317 | Ga0105240_10062996 | 3300009093 | Bacteria | 4615 |
| 318 | Ga0105240_10137778 | 3300009093 | Bacteria | 2921 |
| 319 | Ga0105240_10143372 | 3300009093 | Bacteria | 2854 |
| 320 | Ga0105240_10402284 | 3300009093 | Bacteria | 1542 |
| 321 | Ga0105240_10943553 | 3300009093 | Bacteria | 926 |
| 322 | Ga0111539_10268897 | 3300009094 | Bacteria | 1984 |
| 323 | Ga0111539_10308220 | 3300009094 | Bacteria | 1842 |
| 324 | Ga0111539_10311274 | 3300009094 | Bacteria | 1833 |
| 325 | Ga0111539_11382818 | 3300009094 | Bacteria | 817 |
| 326 | Ga0105245_10108552 | 3300009098 | Bacteria | 2578 |
| 327 | Ga0105245_10516949 | 3300009098 | Bacteria | 1212 |
| 328 | Ga0105247_10002080 | 3300009101 | Bacteria | 13849 |
| 329 | Ga0105247_10019554 | 3300009101 | Bacteria | 4067 |
| 330 | Ga0114129_10006710 | 3300009147 | Bacteria | 16344 |
| 331 | Ga0114129_10072252 | 3300009147 | Bacteria | 4810 |
| 332 | Ga0105243_10440509 | 3300009148 | Bacteria | 1220 |
| 333 | Ga0105241_10001370 | 3300009174 | Bacteria | 18574 |
| 334 | Ga0105241_10006316 | 3300009174 | Bacteria | 8743 |
| 335 | Ga0105241_10127913 | 3300009174 | Bacteria | 2053 |
| 336 | Ga0105241_10153083 | 3300009174 | Bacteria | 1888 |
| 337 | Ga0105241_10158698 | 3300009174 | Bacteria | 1857 |
| 338 | Ga0105241_10261798 | 3300009174 | Bacteria | 1470 |
| 339 | Ga0105242_10067512 | 3300009176 | Bacteria | 2957 |
| 340 | Ga0105242_10095326 | 3300009176 | Bacteria | 2512 |
| 341 | Ga0105242_10111690 | 3300009176 | Bacteria | 2331 |
| 342 | Ga0105242_10186313 | 3300009176 | Bacteria | 1834 |
| 343 | Ga0105248_10008799 | 3300009177 | Bacteria | 11087 |
| 344 | Ga0105248_10208314 | 3300009177 | Unclassified | 2203 |
| 345 | Ga0105237_10004958 | 3300009545 | Bacteria | 15198 |
| 346 | Ga0105237_10007143 | 3300009545 | Bacteria | 12270 |
| 347 | Ga0105237_10010659 | 3300009545 | Bacteria | 9766 |
| 348 | Ga0105237_10032799 | 3300009545 | Bacteria | 5258 |
| 349 | Ga0105237_10039892 | 3300009545 | Bacteria | 4737 |
| 350 | Ga0105237_10077957 | 3300009545 | Bacteria | 3303 |
| 351 | Ga0105237_10092997 | 3300009545 | Bacteria | 3005 |
| 352 | Ga0105237_10137697 | 3300009545 | Bacteria | 2436 |
| 353 | Ga0105237_10206872 | 3300009545 | Bacteria | 1963 |
| 354 | Ga0105237_10233038 | 3300009545 | Bacteria | 1842 |
| 355 | Ga0105237_10263919 | 3300009545 | Bacteria | 1725 |
| 356 | Ga0105237_10488081 | 3300009545 | Bacteria | 1238 |
| 357 | Ga0105238_10011152 | 3300009551 | Bacteria | 9038 |
| 358 | Ga0105238_10052644 | 3300009551 | Unclassified | 4092 |
| 359 | Ga0105238_10204680 | 3300009551 | Bacteria | 1949 |
| 360 | Ga0105238_10269065 | 3300009551 | Bacteria | 1684 |
| 361 | Ga0105238_10565361 | 3300009551 | Bacteria | 1142 |
| 362 | Ga0105238_10714467 | 3300009551 | Bacteria | 1014 |
| 363 | Ga0105249_10001749 | 3300009553 | Bacteria | 18941 |
| 364 | Ga0105249_10003402 | 3300009553 | Bacteria | 13780 |
| 365 | Ga0105249_10003442 | 3300009553 | Bacteria | 13704 |
| 366 | Ga0105249_10006330 | 3300009553 | Bacteria | 10290 |
| 367 | Ga0105249_10031375 | 3300009553 | Bacteria | 4806 |
| 368 | Ga0105249_10067135 | 3300009553 | Bacteria | 3304 |
| 369 | Ga0105249_10184275 | 3300009553 | Bacteria | 2033 |
| 370 | Ga0105249_10372969 | 3300009553 | Unclassified | 1451 |
| 371 | Ga0105249_10726482 | 3300009553 | Bacteria | 1054 |
| 372 | Ga0105239_10000529 | 3300010375 | Bacteria | 55233 |
| 373 | Ga0105239_10000905 | 3300010375 | Bacteria | 42180 |
| 374 | Ga0105239_10005517 | 3300010375 | Bacteria | 14819 |
| 375 | Ga0105239_10007318 | 3300010375 | Bacteria | 12672 |
| 376 | Ga0105239_10083078 | 3300010375 | Bacteria | 3527 |
| 377 | Ga0105239_10095150 | 3300010375 | Bacteria | 3290 |
| 378 | Ga0105239_10134775 | 3300010375 | Bacteria | 2749 |
| 379 | Ga0105239_10134852 | 3300010375 | Bacteria | 2748 |
| 380 | Ga0105239_10142518 | 3300010375 | Unclassified | 2671 |
| 381 | Ga0105239_10198587 | 3300010375 | Bacteria | 2247 |
| 382 | Ga0105239_10339876 | 3300010375 | Bacteria | 1694 |
| 383 | Ga0105239_10679370 | 3300010375 | Bacteria | 1177 |
| 384 | Ga0105246_10036356 | 3300011119 | Bacteria | 3298 |
| 385 | Ga0105246_10215285 | 3300011119 | Bacteria | 1502 |
| 386 | Ga0105246_10473631 | 3300011119 | Bacteria | 1058 |
| 387 | Ga0157373_10009945 | 3300013100 | Bacteria | 7010 |
| 388 | Ga0157373_10103997 | 3300013100 | Bacteria | 1997 |
| 389 | Ga0157373_10420627 | 3300013100 | Unclassified | 959 |
| 390 | Ga0157371_10220435 | 3300013102 | Unclassified | 1362 |
| 391 | Ga0157371_10240641 | 3300013102 | Bacteria | 1302 |
| 392 | Ga0157371_10375771 | 3300013102 | Bacteria | 1037 |
| 393 | Ga0157370_10004650 | 3300013104 | Bacteria | 15684 |
| 394 | Ga0157370_10009011 | 3300013104 | Bacteria | 10710 |
| 395 | Ga0157370_10088618 | 3300013104 | Bacteria | 2906 |
| 396 | Ga0157370_10102402 | 3300013104 | Bacteria | 2681 |
| 397 | Ga0157370_10106612 | 3300013104 | Bacteria | 2622 |
| 398 | Ga0157370_10140852 | 3300013104 | Bacteria | 2247 |
| 399 | Ga0157370_10540286 | 3300013104 | Bacteria | 1069 |
| 400 | Ga0157370_10708659 | 3300013104 | Bacteria | 918 |
| 401 | Ga0157370_10711999 | 3300013104 | Unclassified | 916 |
| 402 | Ga0157369_10064707 | 3300013105 | Bacteria | 3938 |
| 403 | Ga0157369_10099672 | 3300013105 | Bacteria | 3097 |
| 404 | Ga0157369_10164989 | 3300013105 | Bacteria | 2337 |
| 405 | Ga0157369_10212800 | 3300013105 | Bacteria | 2025 |
| 406 | Ga0157369_10212931 | 3300013105 | Bacteria | 2025 |
| 407 | Ga0157369_10277145 | 3300013105 | Bacteria | 1747 |
| 408 | Ga0157369_10360925 | 3300013105 | Bacteria | 1508 |
| 409 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 410 | Ga0157374_10002589 | 3300013296 | Bacteria | 15240 |
| 411 | Ga0157374_10003428 | 3300013296 | Bacteria | 13327 |
| 412 | Ga0157374_10030755 | 3300013296 | Bacteria | 4877 |
| 413 | Ga0157374_10224309 | 3300013296 | Bacteria | 1845 |
| 414 | Ga0157374_10379282 | 3300013296 | Unclassified | 1408 |
| 415 | Ga0157374_10393503 | 3300013296 | Bacteria | 1382 |
| 416 | Ga0157374_10890623 | 3300013296 | Bacteria | 907 |
| 417 | Ga0157378_10004677 | 3300013297 | Bacteria | 12010 |
| 418 | Ga0157378_10008896 | 3300013297 | Bacteria | 8739 |
| 419 | Ga0157378_10039378 | 3300013297 | Bacteria | 4192 |
| 420 | Ga0157378_10039860 | 3300013297 | Bacteria | 4166 |
| 421 | Ga0157378_10114878 | 3300013297 | Unclassified | 2473 |
| 422 | Ga0157378_10351564 | 3300013297 | Bacteria | 1440 |
| 423 | Ga0157378_10578478 | 3300013297 | Bacteria | 1132 |
| 424 | Ga0163162_10000158 | 3300013306 | Bacteria | 62514 |
| 425 | Ga0163162_10000328 | 3300013306 | Bacteria | 43763 |
| 426 | Ga0163162_10000377 | 3300013306 | Bacteria | 40533 |
| 427 | Ga0163162_10002130 | 3300013306 | Bacteria | 18568 |
| 428 | Ga0163162_10016844 | 3300013306 | Bacteria | 7144 |
| 429 | Ga0163162_10029831 | 3300013306 | Bacteria | 5399 |
| 430 | Ga0163162_10066818 | 3300013306 | Bacteria | 3645 |
| 431 | Ga0163162_10083684 | 3300013306 | Bacteria | 3265 |
| 432 | Ga0163162_10211501 | 3300013306 | Bacteria | 2069 |
| 433 | Ga0163162_10216519 | 3300013306 | Bacteria | 2045 |
| 434 | Ga0163162_10253270 | 3300013306 | Bacteria | 1892 |
| 435 | Ga0163162_10548084 | 3300013306 | Bacteria | 1285 |
| 436 | Ga0163162_10576699 | 3300013306 | Bacteria | 1252 |
| 437 | Ga0157372_10001344 | 3300013307 | Bacteria | 26596 |
| 438 | Ga0157372_10002881 | 3300013307 | Bacteria | 18600 |
| 439 | Ga0157372_10016802 | 3300013307 | Bacteria | 7855 |
| 440 | Ga0157372_10104080 | 3300013307 | Bacteria | 3244 |
| 441 | Ga0157372_10132250 | 3300013307 | Bacteria | 2871 |
| 442 | Ga0157372_10138602 | 3300013307 | Bacteria | 2802 |
| 443 | Ga0157372_10142018 | 3300013307 | Bacteria | 2767 |
| 444 | Ga0157372_10154931 | 3300013307 | Bacteria | 2646 |
| 445 | Ga0157372_10156451 | 3300013307 | Bacteria | 2633 |
| 446 | Ga0157372_10217256 | 3300013307 | Bacteria | 2216 |
| 447 | Ga0157372_10226401 | 3300013307 | Bacteria | 2168 |
| 448 | Ga0157372_10316135 | 3300013307 | Bacteria | 1818 |
| 449 | Ga0157372_10423072 | 3300013307 | Bacteria | 1552 |
| 450 | Ga0157372_10748626 | 3300013307 | Bacteria | 1136 |
| 451 | Ga0157372_10849972 | 3300013307 | Bacteria | 1059 |
| 452 | Ga0157372_10878493 | 3300013307 | Bacteria | 1040 |
| 453 | Ga0157372_10900873 | 3300013307 | Unclassified | 1026 |
| 454 | Ga0157372_11016303 | 3300013307 | Bacteria | 960 |
| 455 | Ga0157372_11141087 | 3300013307 | Bacteria | 901 |
| 456 | Ga0157375_10000228 | 3300013308 | Bacteria | 52278 |
| 457 | Ga0157375_10004745 | 3300013308 | Bacteria | 11813 |
| 458 | Ga0157375_10052910 | 3300013308 | Bacteria | 3994 |
| 459 | Ga0157375_10084393 | 3300013308 | Bacteria | 3225 |
| 460 | Ga0157375_10097458 | 3300013308 | Bacteria | 3015 |
| 461 | Ga0157375_10214820 | 3300013308 | Bacteria | 2081 |
| 462 | Ga0157375_10224496 | 3300013308 | Bacteria | 2037 |
| 463 | Ga0157375_10264623 | 3300013308 | Bacteria | 1881 |
| 464 | Ga0157375_10295455 | 3300013308 | Bacteria | 1783 |
| 465 | Ga0163163_10000712 | 3300014325 | Bacteria | 28219 |
| 466 | Ga0163163_10000752 | 3300014325 | Bacteria | 27543 |
| 467 | Ga0163163_10026537 | 3300014325 | Bacteria | 5539 |
| 468 | Ga0163163_10031622 | 3300014325 | Bacteria | 5109 |
| 469 | Ga0163163_10059076 | 3300014325 | Bacteria | 3792 |
| 470 | Ga0157380_10295405 | 3300014326 | Bacteria | 1490 |
| 471 | Ga0157380_10312973 | 3300014326 | Bacteria | 1452 |
| 472 | Ga0157377_10009590 | 3300014745 | Bacteria | 4758 |
| 473 | Ga0157377_10027455 | 3300014745 | Unclassified | 3057 |
| 474 | Ga0157379_10000440 | 3300014968 | Bacteria | 33697 |
| 475 | Ga0157379_10028369 | 3300014968 | Bacteria | 4979 |
| 476 | Ga0157379_10152648 | 3300014968 | Bacteria | 2083 |
| 477 | Ga0157379_10193105 | 3300014968 | Bacteria | 1840 |
| 478 | Ga0157379_10288422 | 3300014968 | Unclassified | 1494 |
| 479 | Ga0157376_10000381 | 3300014969 | Bacteria | 28821 |
| 480 | Ga0157376_10001773 | 3300014969 | Bacteria | 14357 |
| 481 | Ga0157376_10002491 | 3300014969 | Bacteria | 12466 |
| 482 | Ga0157376_10003377 | 3300014969 | Bacteria | 10986 |
| 483 | Ga0157376_10029578 | 3300014969 | Bacteria | 4364 |
| 484 | Ga0157376_10048370 | 3300014969 | Bacteria | 3516 |
| 485 | Ga0157376_10109093 | 3300014969 | Unclassified | 2433 |
| 486 | Ga0157376_10122083 | 3300014969 | Bacteria | 2311 |
| 487 | Ga0157376_10252328 | 3300014969 | Bacteria | 1648 |
| 488 | Ga0157376_10490978 | 3300014969 | Bacteria | 1205 |
| 489 | Ga0182005_1000039 | 3300015265 | Bacteria | 155210 |
| 490 | Ga0163161_10003038 | 3300017792 | Bacteria | 11852 |
| 491 | Ga0163161_10018054 | 3300017792 | Bacteria | 4944 |
| 492 | Ga0163161_10056909 | 3300017792 | Bacteria | 2841 |
| 493 | Ga0163161_10102284 | 3300017792 | Bacteria | 2134 |
| 494 | Ga0213876_10003898 | 3300021384 | Bacteria | 8432 |
| 495 | Ga0213876_10004533 | 3300021384 | Bacteria | 7760 |
| 496 | Ga0209436_101598 | 3300025208 | Bacteria | 7605 |
| 497 | Ga0209436_102525 | 3300025208 | Bacteria | 5435 |
| 498 | Ga0209258_100195 | 3300025242 | Bacteria | 124409 |
| 499 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 500 | Ga0209646_1001511 | 3300025246 | Bacteria | 6167 |
| 501 | Ga0209026_1000178 | 3300025250 | Bacteria | 96368 |
| 502 | Ga0209148_1000515 | 3300025254 | Bacteria | 38582 |
| 503 | Ga0209129_1006332 | 3300025258 | Bacteria | 3864 |
| 504 | Ga0209673_1000261 | 3300025273 | Bacteria | 99491 |
| 505 | Ga0209564_1002640 | 3300025295 | Bacteria | 13694 |
| 506 | Ga0209564_1003255 | 3300025295 | Bacteria | 11350 |
| 507 | Ga0209758_1002812 | 3300025297 | Bacteria | 16942 |
| 508 | Ga0209758_1004501 | 3300025297 | Bacteria | 11560 |
| 509 | Ga0209758_1004617 | 3300025297 | Bacteria | 11305 |
| 510 | Ga0209050_1000160 | 3300025298 | Bacteria | 157000 |
| 511 | Ga0207426_1000023 | 3300025302 | Bacteria | 545465 |
| 512 | Ga0207426_1000318 | 3300025302 | Bacteria | 93692 |
| 513 | Ga0207426_1000360 | 3300025302 | Bacteria | 82007 |
| 514 | Ga0207426_1001116 | 3300025302 | Bacteria | 24631 |
| 515 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 516 | Ga0209257_1003010 | 3300025304 | Bacteria | 15255 |
| 517 | Ga0207697_10034636 | 3300025315 | Bacteria | 2067 |
| 518 | Ga0207656_10000424 | 3300025321 | Bacteria | 14223 |
| 519 | Ga0207656_10060613 | 3300025321 | Bacteria | 1659 |
| 520 | Ga0207682_10150865 | 3300025893 | Unclassified | 1048 |
| 521 | Ga0207642_10119293 | 3300025899 | Bacteria | 1358 |
| 522 | Ga0207710_10023114 | 3300025900 | Bacteria | 2670 |
| 523 | Ga0207680_10000031 | 3300025903 | Bacteria | 77871 |
| 524 | Ga0207680_10001363 | 3300025903 | Bacteria | 11575 |
| 525 | Ga0207680_10028330 | 3300025903 | Bacteria | 3132 |
| 526 | Ga0207680_10046942 | 3300025903 | Bacteria | 2556 |
| 527 | Ga0207680_10056804 | 3300025903 | Bacteria | 2366 |
| 528 | Ga0207647_10000045 | 3300025904 | Bacteria | 90413 |
| 529 | Ga0207647_10002250 | 3300025904 | Bacteria | 14710 |
| 530 | Ga0207647_10026185 | 3300025904 | Bacteria | 3819 |
| 531 | Ga0207647_10038494 | 3300025904 | Bacteria | 3023 |
| 532 | Ga0207647_10052486 | 3300025904 | Unclassified | 2516 |
| 533 | Ga0207645_10000949 | 3300025907 | Bacteria | 24072 |
| 534 | Ga0207645_10136641 | 3300025907 | Bacteria | 1597 |
| 535 | Ga0207643_10019993 | 3300025908 | Bacteria | 3672 |
| 536 | Ga0207643_10194996 | 3300025908 | Bacteria | 1231 |
| 537 | Ga0207643_10239042 | 3300025908 | Bacteria | 1116 |
| 538 | Ga0207705_10023675 | 3300025909 | Bacteria | 4381 |
| 539 | Ga0207705_10077545 | 3300025909 | Bacteria | 2417 |
| 540 | Ga0207705_10363306 | 3300025909 | Bacteria | 1117 |
| 541 | Ga0207684_10779694 | 3300025910 | Unclassified | 809 |
| 542 | Ga0207654_10008187 | 3300025911 | Bacteria | 5272 |
| 543 | Ga0207654_10089572 | 3300025911 | Bacteria | 1872 |
| 544 | Ga0207654_10250453 | 3300025911 | Bacteria | 1187 |
| 545 | Ga0207707_10013305 | 3300025912 | Bacteria | 7172 |
| 546 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 547 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 548 | Ga0207695_10000515 | 3300025913 | Bacteria | 82285 |
| 549 | Ga0207695_10002195 | 3300025913 | Bacteria | 29420 |
| 550 | Ga0207695_10006026 | 3300025913 | Bacteria | 15840 |
| 551 | Ga0207695_10028771 | 3300025913 | Bacteria | 6153 |
| 552 | Ga0207695_10066633 | 3300025913 | Bacteria | 3697 |
| 553 | Ga0207695_10102521 | 3300025913 | Bacteria | 2854 |
| 554 | Ga0207695_10118835 | 3300025913 | Bacteria | 2614 |
| 555 | Ga0207695_10188505 | 3300025913 | Bacteria | 1981 |
| 556 | Ga0207671_10000318 | 3300025914 | Bacteria | 71076 |
| 557 | Ga0207671_10000981 | 3300025914 | Bacteria | 35291 |
| 558 | Ga0207671_10001871 | 3300025914 | Bacteria | 23410 |
| 559 | Ga0207671_10003538 | 3300025914 | Bacteria | 15491 |
| 560 | Ga0207671_10007411 | 3300025914 | Bacteria | 9520 |
| 561 | Ga0207671_10017355 | 3300025914 | Bacteria | 5553 |
| 562 | Ga0207671_10029600 | 3300025914 | Bacteria | 4088 |
| 563 | Ga0207671_10056341 | 3300025914 | Bacteria | 2912 |
| 564 | Ga0207671_10095614 | 3300025914 | Bacteria | 2244 |
| 565 | Ga0207671_10160536 | 3300025914 | Bacteria | 1740 |
| 566 | Ga0207671_10223928 | 3300025914 | Bacteria | 1474 |
| 567 | Ga0207660_10079904 | 3300025917 | Bacteria | 2400 |
| 568 | Ga0207660_10081653 | 3300025917 | Bacteria | 2376 |
| 569 | Ga0207660_10177864 | 3300025917 | Bacteria | 1651 |
| 570 | Ga0207662_10066277 | 3300025918 | Bacteria | 2175 |
| 571 | Ga0207657_10122946 | 3300025919 | Bacteria | 2134 |
| 572 | Ga0207657_10301692 | 3300025919 | Bacteria | 1269 |
| 573 | Ga0207657_10376892 | 3300025919 | Unclassified | 1118 |
| 574 | Ga0207649_10152000 | 3300025920 | Bacteria | 1595 |
| 575 | Ga0207649_10191723 | 3300025920 | Bacteria | 1438 |
| 576 | Ga0207649_10212117 | 3300025920 | Bacteria | 1374 |
| 577 | Ga0207649_10337386 | 3300025920 | Bacteria | 1112 |
| 578 | Ga0207652_10005894 | 3300025921 | Bacteria | 9916 |
| 579 | Ga0207652_10255578 | 3300025921 | Bacteria | 1580 |
| 580 | Ga0207681_10126139 | 3300025923 | Bacteria | 1885 |
| 581 | Ga0207694_10045035 | 3300025924 | Bacteria | 3408 |
| 582 | Ga0207694_10097947 | 3300025924 | Unclassified | 2321 |
| 583 | Ga0207694_10451294 | 3300025924 | Bacteria | 1073 |
| 584 | Ga0207650_10025832 | 3300025925 | Bacteria | 4186 |
| 585 | Ga0207650_10075554 | 3300025925 | Bacteria | 2543 |
| 586 | Ga0207650_10113726 | 3300025925 | Bacteria | 2099 |
| 587 | Ga0207650_10128661 | 3300025925 | Bacteria | 1979 |
| 588 | Ga0207650_10152951 | 3300025925 | Bacteria | 1822 |
| 589 | Ga0207650_10193494 | 3300025925 | Bacteria | 1626 |
| 590 | Ga0207650_10296737 | 3300025925 | Bacteria | 1319 |
| 591 | Ga0207650_10338186 | 3300025925 | Bacteria | 1236 |
| 592 | Ga0207650_10698208 | 3300025925 | Bacteria | 857 |
| 593 | Ga0207659_10050982 | 3300025926 | Bacteria | 2941 |
| 594 | Ga0207659_10094095 | 3300025926 | Bacteria | 2245 |
| 595 | Ga0207659_10113156 | 3300025926 | Bacteria | 2066 |
| 596 | Ga0207659_10356397 | 3300025926 | Bacteria | 1215 |
| 597 | Ga0207659_10452665 | 3300025926 | Bacteria | 1081 |
| 598 | Ga0207644_10015110 | 3300025931 | Bacteria | 5179 |
| 599 | Ga0207644_10141830 | 3300025931 | Bacteria | 1851 |
| 600 | Ga0207644_10358775 | 3300025931 | Bacteria | 1185 |
| 601 | Ga0207644_10541834 | 3300025931 | Bacteria | 963 |
| 602 | Ga0207690_10011286 | 3300025932 | Bacteria | 5337 |
| 603 | Ga0207690_10119886 | 3300025932 | Bacteria | 1909 |
| 604 | Ga0207706_10002788 | 3300025933 | Bacteria | 16975 |
| 605 | Ga0207706_10011186 | 3300025933 | Bacteria | 8182 |
| 606 | Ga0207686_10001258 | 3300025934 | Bacteria | 14622 |
| 607 | Ga0207686_10068276 | 3300025934 | Bacteria | 2277 |
| 608 | Ga0207686_10181112 | 3300025934 | Bacteria | 1494 |
| 609 | Ga0207670_10019460 | 3300025936 | Bacteria | 4148 |
| 610 | Ga0207670_10179885 | 3300025936 | Bacteria | 1592 |
| 611 | Ga0207670_10603259 | 3300025936 | Unclassified | 902 |
| 612 | Ga0207669_10010995 | 3300025937 | Bacteria | 4383 |
| 613 | Ga0207669_10186175 | 3300025937 | Bacteria | 1493 |
| 614 | Ga0207669_10301958 | 3300025937 | Bacteria | 1217 |
| 615 | Ga0207669_10696637 | 3300025937 | Bacteria | 835 |
| 616 | Ga0207704_10268152 | 3300025938 | Bacteria | 1291 |
| 617 | Ga0207704_10438155 | 3300025938 | Bacteria | 1040 |
| 618 | Ga0207691_10000037 | 3300025940 | Bacteria | 108385 |
| 619 | Ga0207691_10165053 | 3300025940 | Bacteria | 1941 |
| 620 | Ga0207691_10177818 | 3300025940 | Bacteria | 1860 |
| 621 | Ga0207691_10444575 | 3300025940 | Unclassified | 1103 |
| 622 | Ga0207691_10450186 | 3300025940 | Bacteria | 1096 |
| 623 | Ga0207691_10609711 | 3300025940 | Bacteria | 924 |
| 624 | Ga0207711_10141669 | 3300025941 | Unclassified | 2164 |
| 625 | Ga0207711_10264135 | 3300025941 | Bacteria | 1583 |
| 626 | Ga0207689_10013283 | 3300025942 | Bacteria | 7024 |
| 627 | Ga0207689_10014782 | 3300025942 | Bacteria | 6627 |
| 628 | Ga0207689_10025181 | 3300025942 | Bacteria | 4987 |
| 629 | Ga0207689_10087990 | 3300025942 | Bacteria | 2551 |
| 630 | Ga0207689_10181501 | 3300025942 | Bacteria | 1735 |
| 631 | Ga0207689_10381058 | 3300025942 | Bacteria | 1174 |
| 632 | Ga0207661_10005710 | 3300025944 | Bacteria | 8780 |
| 633 | Ga0207661_10109119 | 3300025944 | Bacteria | 2337 |
| 634 | Ga0207661_10490001 | 3300025944 | Unclassified | 1123 |
| 635 | Ga0207679_10012240 | 3300025945 | Bacteria | 5590 |
| 636 | Ga0207679_10075284 | 3300025945 | Bacteria | 2561 |
| 637 | Ga0207679_10209756 | 3300025945 | Bacteria | 1633 |
| 638 | Ga0207679_10226153 | 3300025945 | Unclassified | 1577 |
| 639 | Ga0207679_10622513 | 3300025945 | Bacteria | 974 |
| 640 | Ga0207667_10000209 | 3300025949 | Bacteria | 83277 |
| 641 | Ga0207667_10001238 | 3300025949 | Bacteria | 32040 |
| 642 | Ga0207667_10022196 | 3300025949 | Bacteria | 7019 |
| 643 | Ga0207667_10152416 | 3300025949 | Bacteria | 2379 |
| 644 | Ga0207667_10168669 | 3300025949 | Bacteria | 2250 |
| 645 | Ga0207667_10391755 | 3300025949 | Bacteria | 1415 |
| 646 | Ga0207667_10456282 | 3300025949 | Bacteria | 1298 |
| 647 | Ga0207651_10000443 | 3300025960 | Bacteria | 17529 |
| 648 | Ga0207651_10041938 | 3300025960 | Bacteria | 3042 |
| 649 | Ga0207651_10059015 | 3300025960 | Bacteria | 2654 |
| 650 | Ga0207651_10179134 | 3300025960 | Bacteria | 1680 |
| 651 | Ga0207651_10355749 | 3300025960 | Bacteria | 1234 |
| 652 | Ga0207712_10003355 | 3300025961 | Bacteria | 10136 |
| 653 | Ga0207712_10004607 | 3300025961 | Bacteria | 8711 |
| 654 | Ga0207712_10005091 | 3300025961 | Bacteria | 8312 |
| 655 | Ga0207712_10114190 | 3300025961 | Bacteria | 2031 |
| 656 | Ga0207668_10001307 | 3300025972 | Bacteria | 14792 |
| 657 | Ga0207668_10064884 | 3300025972 | Bacteria | 2583 |
| 658 | Ga0207668_10081464 | 3300025972 | Bacteria | 2348 |
| 659 | Ga0207668_10478402 | 3300025972 | Bacteria | 1068 |
| 660 | Ga0207668_10609087 | 3300025972 | Bacteria | 952 |
| 661 | Ga0207640_10013350 | 3300025981 | Bacteria | 4704 |
| 662 | Ga0207640_10031093 | 3300025981 | Unclassified | 3295 |
| 663 | Ga0207658_10000629 | 3300025986 | Bacteria | 31155 |
| 664 | Ga0207658_10007220 | 3300025986 | Bacteria | 7576 |
| 665 | Ga0207658_10043522 | 3300025986 | Bacteria | 3264 |
| 666 | Ga0207658_10089862 | 3300025986 | Bacteria | 2379 |
| 667 | Ga0207658_10354041 | 3300025986 | Unclassified | 1279 |
| 668 | Ga0207658_10533985 | 3300025986 | Bacteria | 1048 |
| 669 | Ga0207677_10005907 | 3300026023 | Bacteria | 6662 |
| 670 | Ga0207677_10119659 | 3300026023 | Bacteria | 1978 |
| 671 | Ga0207677_10132512 | 3300026023 | Bacteria | 1895 |
| 672 | Ga0207677_10133440 | 3300026023 | Bacteria | 1889 |
| 673 | Ga0207677_10133809 | 3300026023 | Unclassified | 1887 |
| 674 | Ga0207677_10350671 | 3300026023 | Bacteria | 1237 |
| 675 | Ga0207677_10422919 | 3300026023 | Bacteria | 1135 |
| 676 | Ga0207677_10483752 | 3300026023 | Bacteria | 1067 |
| 677 | Ga0207677_10659996 | 3300026023 | Bacteria | 924 |
| 678 | Ga0207677_10736357 | 3300026023 | Unclassified | 878 |
| 679 | Ga0207703_10004145 | 3300026035 | Bacteria | 11957 |
| 680 | Ga0207703_10009241 | 3300026035 | Bacteria | 7751 |
| 681 | Ga0207703_10103200 | 3300026035 | Bacteria | 2420 |
| 682 | Ga0207703_10231510 | 3300026035 | Bacteria | 1657 |
| 683 | Ga0207703_10331517 | 3300026035 | Bacteria | 1396 |
| 684 | Ga0207703_10335318 | 3300026035 | Bacteria | 1388 |
| 685 | Ga0207639_10012262 | 3300026041 | Bacteria | 5968 |
| 686 | Ga0207639_10042141 | 3300026041 | Bacteria | 3420 |
| 687 | Ga0207639_10045458 | 3300026041 | Bacteria | 3307 |
| 688 | Ga0207639_10105023 | 3300026041 | Bacteria | 2291 |
| 689 | Ga0207639_10112154 | 3300026041 | Unclassified | 2225 |
| 690 | Ga0207639_10425988 | 3300026041 | Bacteria | 1201 |
| 691 | Ga0207639_10737766 | 3300026041 | Bacteria | 915 |
| 692 | Ga0207678_10177411 | 3300026067 | Bacteria | 1819 |
| 693 | Ga0207678_10209599 | 3300026067 | Bacteria | 1667 |
| 694 | Ga0207708_10031445 | 3300026075 | Bacteria | 4028 |
| 695 | Ga0207702_10174569 | 3300026078 | Bacteria | 1973 |
| 696 | Ga0207702_10662725 | 3300026078 | Bacteria | 1027 |
| 697 | Ga0207702_10823524 | 3300026078 | Unclassified | 918 |
| 698 | Ga0207641_10000048 | 3300026088 | Bacteria | 178206 |
| 699 | Ga0207641_10000253 | 3300026088 | Bacteria | 67848 |
| 700 | Ga0207641_10014740 | 3300026088 | Bacteria | 6409 |
| 701 | Ga0207641_10092372 | 3300026088 | Bacteria | 2650 |
| 702 | Ga0207641_10323166 | 3300026088 | Bacteria | 1464 |
| 703 | Ga0207641_10464825 | 3300026088 | Bacteria | 1224 |
| 704 | Ga0207648_10001276 | 3300026089 | Bacteria | 28144 |
| 705 | Ga0207648_10002983 | 3300026089 | Bacteria | 17886 |
| 706 | Ga0207648_10046709 | 3300026089 | Bacteria | 3796 |
| 707 | Ga0207648_10127146 | 3300026089 | Unclassified | 2242 |
| 708 | Ga0207648_10129143 | 3300026089 | Bacteria | 2224 |
| 709 | Ga0207648_10215866 | 3300026089 | Bacteria | 1704 |
| 710 | Ga0207648_10347242 | 3300026089 | Unclassified | 1337 |
| 711 | Ga0207676_10002535 | 3300026095 | Bacteria | 13033 |
| 712 | Ga0207676_10013593 | 3300026095 | Bacteria | 5842 |
| 713 | Ga0207676_10148146 | 3300026095 | Bacteria | 2018 |
| 714 | Ga0207676_10184364 | 3300026095 | Bacteria | 1830 |
| 715 | Ga0207676_10302096 | 3300026095 | Bacteria | 1462 |
| 716 | Ga0207676_10501915 | 3300026095 | Bacteria | 1152 |
| 717 | Ga0207674_10027023 | 3300026116 | Bacteria | 6081 |
| 718 | Ga0207674_10047001 | 3300026116 | Bacteria | 4428 |
| 719 | Ga0207674_10097318 | 3300026116 | Bacteria | 2926 |
| 720 | Ga0207674_10184015 | 3300026116 | Bacteria | 2040 |
| 721 | Ga0207674_10204912 | 3300026116 | Unclassified | 1922 |
| 722 | Ga0207674_10463346 | 3300026116 | Bacteria | 1225 |
| 723 | Ga0207674_10651125 | 3300026116 | Bacteria | 1017 |
| 724 | Ga0207675_100011688 | 3300026118 | Bacteria | 8208 |
| 725 | Ga0207675_100080094 | 3300026118 | Bacteria | 3061 |
| 726 | Ga0207675_100086055 | 3300026118 | Bacteria | 2951 |
| 727 | Ga0207675_100534232 | 3300026118 | Bacteria | 1170 |
| 728 | Ga0207675_101068917 | 3300026118 | Bacteria | 826 |
| 729 | Ga0207683_10021593 | 3300026121 | Bacteria | 5516 |
| 730 | Ga0207683_10344952 | 3300026121 | Bacteria | 1366 |
| 731 | Ga0207698_10001674 | 3300026142 | Bacteria | 12934 |
| 732 | Ga0207698_10004014 | 3300026142 | Bacteria | 8933 |
| 733 | Ga0207698_10004963 | 3300026142 | Bacteria | 8157 |
| 734 | Ga0207698_10013497 | 3300026142 | Bacteria | 5391 |
| 735 | Ga0207698_10066040 | 3300026142 | Bacteria | 2846 |
| 736 | Ga0207698_10181912 | 3300026142 | Bacteria | 1863 |
| 737 | Ga0207698_10213394 | 3300026142 | Bacteria | 1738 |
| 738 | Ga0207698_10253376 | 3300026142 | Bacteria | 1612 |
| 739 | Ga0207698_10385425 | 3300026142 | Bacteria | 1335 |
| 740 | Ga0207698_10716631 | 3300026142 | Bacteria | 997 |
| 741 | Ga0209968_1015309 | 3300027526 | Bacteria | 1213 |
| 742 | Ga0209974_10034900 | 3300027876 | Bacteria | 1670 |
| 743 | Ga0207428_10422732 | 3300027907 | Bacteria | 974 |
| 744 | Ga0268266_10000038 | 3300028379 | Bacteria | 325729 |
| 745 | Ga0268266_10004818 | 3300028379 | Bacteria | 12818 |
| 746 | Ga0268266_10005123 | 3300028379 | Bacteria | 12353 |
| 747 | Ga0268265_10439011 | 3300028380 | Bacteria | 1216 |
| 748 | Ga0268264_10000167 | 3300028381 | Bacteria | 146190 |
| 749 | Ga0268264_10001271 | 3300028381 | Bacteria | 23942 |
| 750 | Ga0268264_10017828 | 3300028381 | Bacteria | 5811 |
| 751 | Ga0268264_10056056 | 3300028381 | Bacteria | 3294 |
| 752 | Ga0268264_10221177 | 3300028381 | Bacteria | 1743 |
| 753 | Ga0307517_10009245 | 3300028786 | Bacteria | 14011 |
| 754 | Ga0307515_10000072 | 3300028794 | Bacteria | 237798 |
| 755 | Ga0307511_10003621 | 3300030521 | Bacteria | 15822 |
| 756 | Ga0307512_10147533 | 3300030522 | Bacteria | 1418 |
| 757 | Ga0265327_10000030 | 3300031251 | Bacteria | 333531 |
| 758 | Ga0265327_10144276 | 3300031251 | Bacteria | 1110 |
| 759 | Ga0307513_10233026 | 3300031456 | Bacteria | 1653 |
| 760 | Ga0307513_10333598 | 3300031456 | Bacteria | 1270 |
| 761 | Ga0307509_10030533 | 3300031507 | Bacteria | 5959 |
| 762 | Ga0307509_10061200 | 3300031507 | Unclassified | 3976 |
| 763 | Ga0307509_10141256 | 3300031507 | Bacteria | 2343 |
| 764 | Ga0307408_100756664 | 3300031548 | Bacteria | 878 |
| 765 | Ga0265313_10036991 | 3300031595 | Bacteria | 2446 |
| 766 | Ga0307508_10002859 | 3300031616 | Bacteria | 17909 |
| 767 | Ga0307508_10266846 | 3300031616 | Bacteria | 1306 |
| 768 | Ga0307516_10001231 | 3300031730 | Bacteria | 35640 |
| 769 | Ga0307413_10049606 | 3300031824 | Bacteria | 2517 |
| 770 | Ga0307410_10023713 | 3300031852 | Bacteria | 3821 |
| 771 | Ga0307412_10072787 | 3300031911 | Bacteria | 2350 |
| 772 | Ga0307416_100113769 | 3300032002 | Bacteria | 2392 |
| 773 | Ga0307416_101128801 | 3300032002 | Unclassified | 889 |
| 774 | Ga0307416_101469237 | 3300032002 | Bacteria | 787 |
| 775 | Ga0307414_10224178 | 3300032004 | Bacteria | 1545 |
| 776 | Ga0307411_10104084 | 3300032005 | Bacteria | 2015 |
| 777 | Ga0307415_100021613 | 3300032126 | Bacteria | 3959 |
| 778 | Ga0307415_100147730 | 3300032126 | Bacteria | 1805 |
| 779 | Ga0307510_10000528 | 3300033180 | Bacteria | 38156 |
| 780 | Ga0307510_10135555 | 3300033180 | Bacteria | 2121 |
| 781 | Ga0395898_0245968 | 3300037466 | Unclassified | 1706 |
| 782 | Ga0395905_0002094 | 3300037471 | Bacteria | 22677 |
| 783 | Ga0395905_0232234 | 3300037471 | Bacteria | 1725 |
| 784 | Ga0395901_0294991 | 3300038443 | Bacteria | 1682 |
| 785 | Ga0436365_0773211 | 3300039437 | Bacteria | 2127 |
| 786 | Ga0436365_1089979 | 3300039437 | Bacteria | 20099 |
| 787 | Ga0436365_1777169 | 3300039437 | Bacteria | 24248 |
| 788 | Ga0439439_0012499 | 3300041406 | Bacteria | 2054 |
| 789 | Ga0439439_0017565 | 3300041406 | Bacteria | 1761 |
| 790 | Ga0439465_0021139 | 3300041413 | Bacteria | 2041 |
| 791 | Ga0451853_2959559 | 3300041512 | Bacteria | 874 |
| 792 | Ga0451853_4098937 | 3300041512 | Bacteria | 987 |
| 793 | Ga0439445_0003921 | 3300042004 | Bacteria | 3354 |
| 794 | Ga0439449_0030282 | 3300042007 | Bacteria | 2017 |
| 795 | Ga0439449_0032789 | 3300042007 | Bacteria | 1936 |
| 796 | Ga0439449_0063955 | 3300042007 | Bacteria | 1357 |
| 797 | Ga0439449_0118294 | 3300042007 | Bacteria | 983 |
| 798 | Ga0439454_018308 | 3300042011 | Bacteria | 1009 |
| 799 | Ga0439457_005153 | 3300042014 | Unclassified | 3322 |
| 800 | Ga0439457_015693 | 3300042014 | Bacteria | 1690 |
| 801 | Ga0439462_0005229 | 3300042015 | Bacteria | 3193 |
| 802 | Ga0439462_0045911 | 3300042015 | Bacteria | 1170 |
| 803 | Ga0450923_058260 | 3300042125 | Bacteria | 839 |
| 804 | Ga0450896_017370 | 3300042133 | Bacteria | 1038 |
| 805 | Ga0450898_002673 | 3300042134 | Bacteria | 2497 |
| 806 | Ga0439434_0022823 | 3300042435 | Bacteria | 1882 |
| 807 | Ga0450893_0031840 | 3300042532 | Bacteria | 942 |
| 808 | Ga0466969_0000746 | 3300044656 | Bacteria | 17610 |
| 809 | Ga0466972_0000038 | 3300044658 | Bacteria | 135937 |
| 810 | Ga0466972_0010101 | 3300044658 | Bacteria | 4744 |
| 811 | Ga0466972_0100253 | 3300044658 | Bacteria | 1371 |
| 812 | Ga0466972_0138714 | 3300044658 | Bacteria | 1144 |
| 813 | Ga0466966_0001759 | 3300044684 | Bacteria | 14029 |
| 814 | Ga0466961_0025984 | 3300044693 | Bacteria | 3764 |
| 815 | Ga0453684_0349573 | 3300044712 | Bacteria | 1667 |
| 816 | Ga0466971_0094657 | 3300044719 | Bacteria | 1369 |
| 817 | Ga0466971_0136812 | 3300044719 | Bacteria | 1140 |
| 818 | Ga0466957_0001679 | 3300044842 | Bacteria | 11631 |
| 819 | Ga0466959_0000056 | 3300045049 | Bacteria | 78465 |
| 820 | Ga0466959_0004213 | 3300045049 | Bacteria | 9584 |
| 821 | Ga0466959_0014943 | 3300045049 | Bacteria | 5657 |
| 822 | Ga0466958_0066685 | 3300045836 | Bacteria | 2198 |
| 823 | Ga0466967_0107825 | 3300045976 | Bacteria | 2555 |
| 824 | Ga0466967_0175518 | 3300045976 | Bacteria | 2019 |
| 825 | Ga0495627_002875 | 3300046453 | Bacteria | 7939 |
| 826 | Ga0495638_0129567 | 3300046460 | Bacteria | 1483 |
| 827 | Ga0495580_0159903 | 3300046472 | Unclassified | 1559 |
| 828 | Ga0495639_0133904 | 3300046475 | Bacteria | 1188 |
| 829 | Ga0495606_0017959 | 3300046507 | Bacteria | 5322 |
| 830 | Ga0495630_0140407 | 3300046517 | Unclassified | 1837 |
| 831 | Ga0495630_0224691 | 3300046517 | Bacteria | 1434 |
| 832 | Ga0495648_0122239 | 3300046524 | Bacteria | 1397 |
| 833 | Ga0495598_0084955 | 3300046537 | Bacteria | 1022 |
| 834 | Ga0495621_0083863 | 3300046539 | Unclassified | 1192 |
| 835 | Ga0495622_0041194 | 3300046557 | Bacteria | 2148 |
| 836 | Ga0495633_0000005 | 3300046558 | Bacteria | 357644 |
| 837 | Ga0495668_0002497 | 3300046616 | Bacteria | 15047 |
| 838 | Ga0495611_0000278 | 3300046648 | Bacteria | 34852 |
| 839 | Ga0495672_0020115 | 3300047320 | Bacteria | 4383 |
| 840 | Ga0495672_0060891 | 3300047320 | Unclassified | 2178 |
| 841 | Ga0495676_0085516 | 3300047321 | Unclassified | 2376 |
| 842 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 843 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 844 | Ga0495686_0194672 | 3300047472 | Bacteria | 1166 |
| 845 | Ga0496101_0093126 | 3300048904 | Bacteria | 2244 |
| 846 | Ga0496109_0071641 | 3300048912 | Bacteria | 3183 |
| 847 | Ga0496121_0000020 | 3300048924 | Bacteria | 498732 |
| 848 | Ga0496121_0482897 | 3300048924 | Bacteria | 791 |
| 849 | Ga0496125_0259894 | 3300048928 | Bacteria | 1089 |
| 850 | Ga0496126_0007895 | 3300048929 | Bacteria | 11585 |
| 851 | Ga0501292_001056 | 3300049515 | Bacteria | 3367 |
| 852 | Ga0501298_000064 | 3300049521 | Bacteria | 11334 |
| 853 | Ga0501032_0009464 | 3300049569 | Bacteria | 7063 |
| 854 | Ga0501032_0049879 | 3300049569 | Unclassified | 2823 |
| 855 | Ga0501033_0011813 | 3300049570 | Bacteria | 6675 |
| 856 | Ga0501034_0004387 | 3300049571 | Bacteria | 15716 |
| 857 | Ga0501034_0091347 | 3300049571 | Unclassified | 3042 |
| 858 | Ga0501034_0173582 | 3300049571 | Bacteria | 2122 |
| 859 | Ga0501034_0333990 | 3300049571 | Bacteria | 1447 |
| 860 | Ga0501036_0054709 | 3300049572 | Bacteria | 3381 |
| 861 | Ga0501037_0007406 | 3300049573 | Bacteria | 8024 |
| 862 | Ga0501037_0046918 | 3300049573 | Bacteria | 3167 |
| 863 | Ga0501037_0163701 | 3300049573 | Bacteria | 1585 |
| 864 | Ga0501039_0015162 | 3300049575 | Bacteria | 5898 |
| 865 | Ga0501039_0082677 | 3300049575 | Bacteria | 2500 |
| 866 | Ga0501039_0181995 | 3300049575 | Bacteria | 1652 |
| 867 | Ga0501043_0015695 | 3300049579 | Bacteria | 5938 |
| 868 | Ga0501043_0060404 | 3300049579 | Bacteria | 2975 |
| 869 | Ga0501043_0077780 | 3300049579 | Bacteria | 2606 |
| 870 | Ga0501043_0149539 | 3300049579 | Bacteria | 1828 |
| 871 | Ga0501046_0010399 | 3300049580 | Bacteria | 7994 |
| 872 | Ga0501046_0327802 | 3300049580 | Bacteria | 1115 |
| 873 | Ga0501046_0365587 | 3300049580 | Bacteria | 1046 |
| 874 | Ga0501047_0009790 | 3300049581 | Bacteria | 9056 |
| 875 | Ga0501047_0053692 | 3300049581 | Bacteria | 3897 |
| 876 | Ga0501047_0249985 | 3300049581 | Bacteria | 1621 |
| 877 | Ga0501048_0069252 | 3300049582 | Unclassified | 2492 |
| 878 | Ga0501067_0123912 | 3300049583 | Bacteria | 1438 |
| 879 | Ga0501067_0172694 | 3300049583 | Unclassified | 1204 |
| 880 | Ga0501069_0145123 | 3300049585 | Bacteria | 1362 |
| 881 | Ga0501070_0096581 | 3300049586 | Bacteria | 2444 |
| 882 | Ga0501072_0530928 | 3300049588 | Unclassified | 930 |
| 883 | Ga0501073_0004845 | 3300049589 | Bacteria | 10100 |
| 884 | Ga0501073_0193939 | 3300049589 | Bacteria | 1405 |
| 885 | Ga0501074_0065938 | 3300049590 | Bacteria | 2605 |
| 886 | Ga0501201_000527 | 3300049651 | Bacteria | 3536 |
| 887 | Ga0501202_000744 | 3300049652 | Bacteria | 4874 |
| 888 | Ga0501202_008310 | 3300049652 | Bacteria | 1890 |
| 889 | Ga0501206_000832 | 3300049653 | Bacteria | 3781 |
| 890 | Ga0501207_004627 | 3300049654 | Bacteria | 1880 |
| 891 | Ga0501217_000216 | 3300049661 | Bacteria | 8713 |
| 892 | Ga0501217_007529 | 3300049661 | Bacteria | 2337 |
| 893 | Ga0501222_002054 | 3300049662 | Bacteria | 2786 |
| 894 | Ga0501224_003158 | 3300049664 | Bacteria | 2289 |
| 895 | Ga0501227_010002 | 3300049665 | Bacteria | 2052 |
| 896 | Ga0501235_000267 | 3300049669 | Bacteria | 9671 |
| 897 | Ga0501238_018655 | 3300049671 | Bacteria | 972 |
| 898 | Ga0501242_000198 | 3300049674 | Bacteria | 4677 |
| 899 | Ga0501242_002573 | 3300049674 | Bacteria | 1914 |
| 900 | Ga0501243_002944 | 3300049675 | Bacteria | 2509 |
| 901 | Ga0501250_007642 | 3300049680 | Bacteria | 1173 |
| 902 | Ga0501252_000167 | 3300049682 | Bacteria | 4191 |
| 903 | Ga0501253_001083 | 3300049683 | Bacteria | 2645 |
| 904 | Ga0501257_022523 | 3300049686 | Bacteria | 1491 |
| 905 | Ga0501257_042554 | 3300049686 | Bacteria | 1118 |
| 906 | Ga0501260_003704 | 3300049689 | Bacteria | 1384 |
| 907 | Ga0501261_000281 | 3300049690 | Bacteria | 6962 |
| 908 | Ga0501219_000074 | 3300049703 | Bacteria | 17135 |
| 909 | Ga0501221_001294 | 3300049704 | Bacteria | 4134 |
| 910 | Ga0501225_0002607 | 3300049705 | Bacteria | 5541 |
| 911 | Ga0501225_0005062 | 3300049705 | Bacteria | 3886 |
| 912 | Ga0501225_0005570 | 3300049705 | Bacteria | 3693 |
| 913 | Ga0501225_0077422 | 3300049705 | Bacteria | 952 |
| 914 | Ga0501234_004702 | 3300049707 | Bacteria | 2141 |
| 915 | Ga0501245_000671 | 3300049708 | Bacteria | 4224 |
| 916 | Ga0501079_0212590 | 3300049741 | Bacteria | 1511 |
| 917 | Ga0501080_0022014 | 3300049742 | Bacteria | 5904 |
| 918 | Ga0501080_0564532 | 3300049742 | Bacteria | 1013 |
| 919 | Ga0501083_0068438 | 3300049744 | Bacteria | 2363 |
| 920 | Ga0501241_005898 | 3300049758 | Bacteria | 2273 |
| 921 | Ga0501266_002278 | 3300049763 | Unclassified | 2430 |
| 922 | Ga0501035_0009939 | 3300049822 | Bacteria | 8834 |
| 923 | Ga0501035_0032518 | 3300049822 | Bacteria | 4745 |
| 924 | Ga0501035_0100158 | 3300049822 | Bacteria | 2544 |
| 925 | Ga0501035_0548247 | 3300049822 | Unclassified | 947 |
| 926 | Ga0501044_0003293 | 3300049823 | Bacteria | 18191 |
| 927 | Ga0501044_0004254 | 3300049823 | Bacteria | 16062 |
| 928 | Ga0501284_00029 | 3300050005 | Bacteria | 74818 |
| 929 | nmdc:mga0k408_183517_c1 | 3300050493 | Bacteria | 1248 |
| 930 | nmdc:mga0k408_37004_c1 | 3300050493 | Unclassified | 2801 |
| 931 | nmdc:mga0k408_6193_c1 | 3300050493 | Bacteria | 6380 |
| 932 | nmdc:mga0k408_62043_c1 | 3300050493 | Bacteria | 2173 |
| 933 | nmdc:mga05p37_4450_c1 | 3300050507 | Bacteria | 16377 |
| 934 | nmdc:mga05p37_62080_c1 | 3300050507 | Bacteria | 4599 |
| 935 | nmdc:mga09592_20389_c1 | 3300050508 | Bacteria | 5450 |
| 936 | nmdc:mga09592_675256_c1 | 3300050508 | Bacteria | 881 |
| 937 | nmdc:mga0qj67_178793_c1 | 3300050509 | Bacteria | 1723 |
| 938 | nmdc:mga0qj67_37014_c1 | 3300050509 | Bacteria | 3821 |
| 939 | nmdc:mga06r32_368086_c1 | 3300050510 | Bacteria | 1421 |
| 940 | nmdc:mga08y16_305799_c1 | 3300050511 | Bacteria | 1638 |
| 941 | nmdc:mga08y16_439882_c1 | 3300050511 | Bacteria | 1331 |
| 942 | Ga0500578_0036117 | 3300053086 | Bacteria | 3175 |
| 943 | Ga0500644_0000184 | 3300053088 | Bacteria | 39747 |
| 944 | Ga0500646_0003030 | 3300053090 | Bacteria | 4312 |
| 945 | Ga0500646_0015258 | 3300053090 | Bacteria | 2000 |
| 946 | Ga0500646_0016948 | 3300053090 | Unclassified | 1906 |
| 947 | Ga0500583_0000047 | 3300053092 | Bacteria | 78958 |
| 948 | Ga0500583_0004533 | 3300053092 | Bacteria | 4544 |
| 949 | Ga0500583_0005677 | 3300053092 | Bacteria | 4207 |
| 950 | Ga0500583_0007722 | 3300053092 | Bacteria | 3807 |
| 951 | Ga0500651_0019215 | 3300053093 | Bacteria | 4242 |
| 952 | Ga0500651_0109110 | 3300053093 | Bacteria | 1690 |
| 953 | Ga0500651_0362188 | 3300053093 | Bacteria | 821 |
| 954 | Ga0500569_000886 | 3300053109 | Bacteria | 5341 |
| 955 | Ga0500594_0035071 | 3300053118 | Bacteria | 1344 |
| 956 | Ga0500652_000909 | 3300053131 | Bacteria | 9751 |
| 957 | Ga0500559_0025729 | 3300053136 | Bacteria | 2505 |
| 958 | Ga0500568_0001204 | 3300053139 | Bacteria | 17268 |
| 959 | Ga0500568_0011377 | 3300053139 | Bacteria | 4135 |
| 960 | Ga0500568_0078890 | 3300053139 | Bacteria | 1252 |
| 961 | Ga0500577_0001440 | 3300053142 | Bacteria | 6089 |
| 962 | Ga0500589_069955 | 3300053147 | Bacteria | 1590 |
| 963 | Ga0500604_0004694 | 3300053151 | Bacteria | 3618 |
| 964 | Ga0500604_0040572 | 3300053151 | Bacteria | 1404 |
| 965 | Ga0500616_0009438 | 3300053153 | Bacteria | 5935 |
| 966 | Ga0500619_031757 | 3300053154 | Bacteria | 1615 |
| 967 | Ga0500622_0001887 | 3300053156 | Bacteria | 15831 |
| 968 | Ga0500622_0009069 | 3300053156 | Bacteria | 5523 |
| 969 | Ga0500633_0013134 | 3300053160 | Bacteria | 2310 |
| 970 | Ga0500639_166892 | 3300053163 | Bacteria | 993 |
| 971 | Ga0500636_0073241 | 3300053177 | Bacteria | 1984 |
| 972 | Ga0500611_000022 | 3300053727 | Bacteria | 102349 |
| 973 | Ga0500656_004668 | 3300053732 | Bacteria | 1330 |
| 974 | Ga0501084_0082222 | 3300054114 | Bacteria | 2702 |
| 975 | Ga0466962_0028059 | 3300061719 | Bacteria | 2698 |
| 976 | Ga0466962_0197519 | 3300061719 | Bacteria | 982 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10266824 | Ga0070658_102668241 | 218 |
| 2 | 3300025925 | Ga0207650_10338186 | Ga0207650_103381862 | 220 |
| 3 | 3300005459 | Ga0068867_100233512 | Ga0068867_1002335122 | 222 |
| 4 | 3300005719 | Ga0068861_100025336 | Ga0068861_1000253363 | 222 |
| 5 | 3300005844 | Ga0068862_100168094 | Ga0068862_1001680942 | 222 |
| 6 | 3300025942 | Ga0207689_10013283 | Ga0207689_100132832 | 222 |
| 7 | 3300026089 | Ga0207648_10347242 | Ga0207648_103472421 | 222 |
| 8 | 3300026118 | Ga0207675_100080094 | Ga0207675_1000800942 | 222 |
| 9 | 3300049573 | Ga0501037_0046918 | Ga0501037_0046918_882_1601 | 226 |
| 10 | 3300005331 | Ga0070670_100373312 | Ga0070670_1003733121 | 227 |
| 11 | 3300006358 | Ga0068871_100554954 | Ga0068871_1005549541 | 227 |
| 12 | 3300025925 | Ga0207650_10113726 | Ga0207650_101137262 | 227 |
| 13 | 3300005337 | Ga0070682_100323963 | Ga0070682_1003239631 | 228 |
| 14 | 3300005455 | Ga0070663_100664288 | Ga0070663_1006642881 | 228 |
| 15 | 3300005547 | Ga0070693_100368666 | Ga0070693_1003686661 | 228 |
| 16 | 3300001979 | JGI24740J21852_10027647 | JGI24740J21852_100276472 | 229 |
| 17 | 3300005616 | Ga0068852_100718569 | Ga0068852_1007185692 | 229 |
| 18 | 3300009545 | Ga0105237_10007143 | Ga0105237_100071432 | 229 |
| 19 | 3300025914 | Ga0207671_10095614 | Ga0207671_100956142 | 229 |
| 20 | 3300026142 | Ga0207698_10253376 | Ga0207698_102533761 | 229 |
| 21 | 3300003354 | JGI25160J50197_1008228 | JGI25160J50197_10082285 | 230 |
| 22 | 3300009093 | Ga0105240_10062996 | Ga0105240_100629962 | 230 |
| 23 | 3300009093 | Ga0105240_10137778 | Ga0105240_101377782 | 230 |
| 24 | 3300010375 | Ga0105239_10134775 | Ga0105239_101347752 | 230 |
| 25 | 3300010375 | Ga0105239_10134852 | Ga0105239_101348522 | 230 |
| 26 | 3300013105 | Ga0157369_10064707 | Ga0157369_100647072 | 230 |
| 27 | 3300025302 | Ga0207426_1000023 | Ga0207426_1000023231 | 230 |
| 28 | 3300005329 | Ga0070683_100070065 | Ga0070683_1000700652 | 231 |
| 29 | 3300005457 | Ga0070662_100369440 | Ga0070662_1003694401 | 231 |
| 30 | 3300005535 | Ga0070684_100066025 | Ga0070684_1000660252 | 231 |
| 31 | 3300013296 | Ga0157374_10224309 | Ga0157374_102243091 | 231 |
| 32 | 3300013306 | Ga0163162_10083684 | Ga0163162_100836842 | 231 |
| 33 | 3300025920 | Ga0207649_10212117 | Ga0207649_102121171 | 231 |
| 34 | iso_pu_bacteria | 2738541278 | 2738726462 | 234 |
| 35 | iso_pu_bacteria | 2818991442 | 2819574042 | 235 |
| 36 | iso_pu_bacteria | 2818991460 | 2819680253 | 235 |
| 37 | iso_pu_bacteria | 2821136567 | 2821137359 | 235 |
| 38 | iso_pu_bacteria | 2840677318 | 2840677366 | 235 |
| 39 | iso_pu_bacteria | 2883068021 | 2883072799 | 235 |
| 40 | iso_pu_bacteria | 2884791551 | 2884798413 | 235 |
| 41 | iso_pu_bacteria | 2896085136 | 2896085184 | 235 |
| 42 | iso_pu_bacteria | 2896109856 | 2896115109 | 235 |
| 43 | iso_pu_bacteria | 2904467357 | 2904467900 | 235 |
| 44 | iso_pu_bacteria | 2929177148 | 2929182592 | 235 |
| 45 | iso_pu_bacteria | 2929921140 | 2929923629 | 235 |
| 46 | iso_pu_bacteria | 2945977869 | 2945978517 | 235 |
| 47 | iso_pu_bacteria | 2946013367 | 2946015621 | 235 |
| 48 | iso_pu_bacteria | 8003151029 | 8003155237 | 235 |
| 49 | 3300005327 | Ga0070658_10758694 | Ga0070658_107586941 | 236 |
| 50 | 3300005329 | Ga0070683_100045232 | Ga0070683_1000452322 | 236 |
| 51 | 3300005329 | Ga0070683_100652963 | Ga0070683_1006529631 | 236 |
| 52 | 3300005331 | Ga0070670_100340430 | Ga0070670_1003404301 | 236 |
| 53 | 3300005336 | Ga0070680_100023180 | Ga0070680_1000231806 | 236 |
| 54 | 3300005338 | Ga0068868_100213039 | Ga0068868_1002130391 | 236 |
| 55 | 3300005338 | Ga0068868_100734692 | Ga0068868_1007346922 | 236 |
| 56 | 3300005339 | Ga0070660_100249257 | Ga0070660_1002492571 | 236 |
| 57 | 3300005344 | Ga0070661_100239428 | Ga0070661_1002394281 | 236 |
| 58 | 3300005344 | Ga0070661_100474396 | Ga0070661_1004743961 | 236 |
| 59 | 3300005355 | Ga0070671_100082473 | Ga0070671_1000824733 | 236 |
| 60 | 3300005530 | Ga0070679_100001831 | Ga0070679_10000183114 | 236 |
| 61 | 3300005535 | Ga0070684_100036799 | Ga0070684_1000367992 | 236 |
| 62 | 3300005564 | Ga0070664_100022709 | Ga0070664_1000227094 | 236 |
| 63 | 3300005564 | Ga0070664_100255772 | Ga0070664_1002557721 | 236 |
| 64 | 3300005564 | Ga0070664_100456359 | Ga0070664_1004563592 | 236 |
| 65 | 3300005578 | Ga0068854_100130636 | Ga0068854_1001306362 | 236 |
| 66 | 3300005616 | Ga0068852_100006386 | Ga0068852_1000063861 | 236 |
| 67 | 3300005616 | Ga0068852_100086040 | Ga0068852_1000860403 | 236 |
| 68 | 3300013102 | Ga0157371_10220435 | Ga0157371_102204352 | 236 |
| 69 | 3300013104 | Ga0157370_10004650 | Ga0157370_100046504 | 236 |
| 70 | 3300013104 | Ga0157370_10140852 | Ga0157370_101408521 | 236 |
| 71 | 3300013104 | Ga0157370_10540286 | Ga0157370_105402862 | 236 |
| 72 | 3300013104 | Ga0157370_10708659 | Ga0157370_107086591 | 236 |
| 73 | 3300013105 | Ga0157369_10164989 | Ga0157369_101649892 | 236 |
| 74 | 3300013105 | Ga0157369_10277145 | Ga0157369_102771451 | 236 |
| 75 | 3300013296 | Ga0157374_10890623 | Ga0157374_108906231 | 236 |
| 76 | 3300013307 | Ga0157372_10104080 | Ga0157372_101040802 | 236 |
| 77 | 3300013307 | Ga0157372_10217256 | Ga0157372_102172562 | 236 |
| 78 | 3300013307 | Ga0157372_10748626 | Ga0157372_107486262 | 236 |
| 79 | 3300014325 | Ga0163163_10026537 | Ga0163163_100265373 | 236 |
| 80 | 3300014745 | Ga0157377_10009590 | Ga0157377_100095902 | 236 |
| 81 | 3300021384 | Ga0213876_10003898 | Ga0213876_100038983 | 236 |
| 82 | 3300025909 | Ga0207705_10363306 | Ga0207705_103633062 | 236 |
| 83 | 3300025917 | Ga0207660_10177864 | Ga0207660_101778641 | 236 |
| 84 | 3300025919 | Ga0207657_10122946 | Ga0207657_101229462 | 236 |
| 85 | 3300025919 | Ga0207657_10376892 | Ga0207657_103768922 | 236 |
| 86 | 3300025920 | Ga0207649_10191723 | Ga0207649_101917232 | 236 |
| 87 | 3300025921 | Ga0207652_10005894 | Ga0207652_100058947 | 236 |
| 88 | 3300025925 | Ga0207650_10698208 | Ga0207650_106982082 | 236 |
| 89 | 3300025931 | Ga0207644_10141830 | Ga0207644_101418301 | 236 |
| 90 | 3300025944 | Ga0207661_10490001 | Ga0207661_104900012 | 236 |
| 91 | 3300025945 | Ga0207679_10012240 | Ga0207679_100122402 | 236 |
| 92 | 3300025945 | Ga0207679_10226153 | Ga0207679_102261531 | 236 |
| 93 | 3300025960 | Ga0207651_10179134 | Ga0207651_101791342 | 236 |
| 94 | 3300026023 | Ga0207677_10350671 | Ga0207677_103506711 | 236 |
| 95 | 3300026023 | Ga0207677_10659996 | Ga0207677_106599962 | 236 |
| 96 | 3300026095 | Ga0207676_10302096 | Ga0207676_103020962 | 236 |
| 97 | 3300026142 | Ga0207698_10013497 | Ga0207698_100134974 | 236 |
| 98 | 3300039437 | Ga0436365_1777169 | Ga0436365_1777169_2268_2978 | 236 |
| 99 | 3300003320 | rootH2_10287768 | rootH2_102877682 | 237 |
| 100 | 3300003323 | rootH1_10091661 | rootH1_100916616 | 237 |
| 101 | 3300005336 | Ga0070680_100258005 | Ga0070680_1002580052 | 237 |
| 102 | 3300005353 | Ga0070669_100115704 | Ga0070669_1001157043 | 237 |
| 103 | 3300005354 | Ga0070675_100002335 | Ga0070675_1000023357 | 237 |
| 104 | 3300005543 | Ga0070672_100082710 | Ga0070672_1000827102 | 237 |
| 105 | 3300005614 | Ga0068856_100797272 | Ga0068856_1007972721 | 237 |
| 106 | 3300006847 | Ga0075431_100009279 | Ga0075431_1000092798 | 237 |
| 107 | 3300009147 | Ga0114129_10072252 | Ga0114129_100722522 | 237 |
| 108 | 3300013100 | Ga0157373_10103997 | Ga0157373_101039972 | 237 |
| 109 | 3300013102 | Ga0157371_10240641 | Ga0157371_102406412 | 237 |
| 110 | 3300013306 | Ga0163162_10066818 | Ga0163162_100668183 | 237 |
| 111 | 3300025923 | Ga0207681_10126139 | Ga0207681_101261391 | 237 |
| 112 | 3300025926 | Ga0207659_10113156 | Ga0207659_101131562 | 237 |
| 113 | 3300027526 | Ga0209968_1015309 | Ga0209968_10153092 | 237 |
| 114 | 3300027876 | Ga0209974_10034900 | Ga0209974_100349002 | 237 |
| 115 | 3300031251 | Ga0265327_10000030 | Ga0265327_10000030190 | 237 |
| 116 | 3300032002 | Ga0307416_101128801 | Ga0307416_1011288011 | 237 |
| 117 | 3300032126 | Ga0307415_100147730 | Ga0307415_1001477301 | 237 |
| 118 | 3300037466 | Ga0395898_0245968 | Ga0395898_0245968_46_759 | 237 |
| 119 | 3300037471 | Ga0395905_0002094 | Ga0395905_0002094_5966_6679 | 237 |
| 120 | 3300038443 | Ga0395901_0294991 | Ga0395901_0294991_919_1632 | 237 |
| 121 | 3300048904 | Ga0496101_0093126 | Ga0496101_0093126_33_746 | 237 |
| 122 | 3300049569 | Ga0501032_0009464 | Ga0501032_0009464_3134_3847 | 237 |
| 123 | 3300049570 | Ga0501033_0011813 | Ga0501033_0011813_3341_4054 | 237 |
| 124 | 3300049571 | Ga0501034_0004387 | Ga0501034_0004387_2527_3240 | 237 |
| 125 | 3300049575 | Ga0501039_0015162 | Ga0501039_0015162_3445_4158 | 237 |
| 126 | 3300049579 | Ga0501043_0015695 | Ga0501043_0015695_3640_4353 | 237 |
| 127 | 3300049579 | Ga0501043_0077780 | Ga0501043_0077780_934_1647 | 237 |
| 128 | 3300049581 | Ga0501047_0009790 | Ga0501047_0009790_4531_5244 | 237 |
| 129 | 3300049661 | Ga0501217_007529 | Ga0501217_007529_1232_1945 | 237 |
| 130 | 3300049822 | Ga0501035_0009939 | Ga0501035_0009939_1176_1889 | 237 |
| 131 | 3300049823 | Ga0501044_0004254 | Ga0501044_0004254_2660_3373 | 237 |
| 132 | 3300050507 | nmdc:mga05p37_62080_c1 | nmdc:mga05p37_62080_c1_2291_3004 | 237 |
| 133 | 3300050508 | nmdc:mga09592_675256_c1 | nmdc:mga09592_675256_c1_150_863 | 237 |
| 134 | 3300050510 | nmdc:mga06r32_368086_c1 | nmdc:mga06r32_368086_c1_499_1212 | 237 |
| 135 | 3300001904 | JGI24736J21556_1010067 | JGI24736J21556_10100673 | 238 |
| 136 | 3300002459 | JGI24751J29686_10043817 | JGI24751J29686_100438171 | 238 |
| 137 | 3300003322 | rootL2_10296671 | rootL2_102966712 | 238 |
| 138 | 3300003323 | rootH1_10146227 | rootH1_101462273 | 238 |
| 139 | 3300005327 | Ga0070658_10002948 | Ga0070658_100029488 | 238 |
| 140 | 3300005328 | Ga0070676_10062169 | Ga0070676_100621692 | 238 |
| 141 | 3300005329 | Ga0070683_100064309 | Ga0070683_1000643094 | 238 |
| 142 | 3300005329 | Ga0070683_100396763 | Ga0070683_1003967632 | 238 |
| 143 | 3300005331 | Ga0070670_100133226 | Ga0070670_1001332262 | 238 |
| 144 | 3300005331 | Ga0070670_100431894 | Ga0070670_1004318941 | 238 |
| 145 | 3300005333 | Ga0070677_10262856 | Ga0070677_102628561 | 238 |
| 146 | 3300005347 | Ga0070668_100300827 | Ga0070668_1003008272 | 238 |
| 147 | 3300005353 | Ga0070669_100312009 | Ga0070669_1003120092 | 238 |
| 148 | 3300005366 | Ga0070659_100000828 | Ga0070659_1000008289 | 238 |
| 149 | 3300005459 | Ga0068867_100191364 | Ga0068867_1001913642 | 238 |
| 150 | 3300005467 | Ga0070706_100403127 | Ga0070706_1004031272 | 238 |
| 151 | 3300005539 | Ga0068853_100304429 | Ga0068853_1003044292 | 238 |
| 152 | 3300005563 | Ga0068855_100022692 | Ga0068855_1000226924 | 238 |
| 153 | 3300005577 | Ga0068857_100246793 | Ga0068857_1002467932 | 238 |
| 154 | 3300005577 | Ga0068857_100663516 | Ga0068857_1006635162 | 238 |
| 155 | 3300005578 | Ga0068854_100047350 | Ga0068854_1000473503 | 238 |
| 156 | 3300005614 | Ga0068856_100023059 | Ga0068856_1000230592 | 238 |
| 157 | 3300005614 | Ga0068856_100258618 | Ga0068856_1002586182 | 238 |
| 158 | 3300005616 | Ga0068852_100004440 | Ga0068852_1000044403 | 238 |
| 159 | 3300005616 | Ga0068852_100147688 | Ga0068852_1001476883 | 238 |
| 160 | 3300005616 | Ga0068852_100586270 | Ga0068852_1005862702 | 238 |
| 161 | 3300005617 | Ga0068859_101181071 | Ga0068859_1011810712 | 238 |
| 162 | 3300005719 | Ga0068861_100657574 | Ga0068861_1006575742 | 238 |
| 163 | 3300005844 | Ga0068862_100310139 | Ga0068862_1003101392 | 238 |
| 164 | 3300006237 | Ga0097621_100525959 | Ga0097621_1005259591 | 238 |
| 165 | 3300006931 | Ga0097620_101181033 | Ga0097620_1011810332 | 238 |
| 166 | 3300009093 | Ga0105240_10402284 | Ga0105240_104022842 | 238 |
| 167 | 3300009147 | Ga0114129_10006710 | Ga0114129_1000671011 | 238 |
| 168 | 3300009174 | Ga0105241_10006316 | Ga0105241_100063161 | 238 |
| 169 | 3300009545 | Ga0105237_10004958 | Ga0105237_1000495810 | 238 |
| 170 | 3300009545 | Ga0105237_10137697 | Ga0105237_101376972 | 238 |
| 171 | 3300009553 | Ga0105249_10067135 | Ga0105249_100671352 | 238 |
| 172 | 3300010375 | Ga0105239_10007318 | Ga0105239_1000731811 | 238 |
| 173 | 3300010375 | Ga0105239_10679370 | Ga0105239_106793701 | 238 |
| 174 | 3300013102 | Ga0157371_10375771 | Ga0157371_103757711 | 238 |
| 175 | 3300013104 | Ga0157370_10106612 | Ga0157370_101066122 | 238 |
| 176 | 3300013296 | Ga0157374_10030755 | Ga0157374_100307551 | 238 |
| 177 | 3300013296 | Ga0157374_10393503 | Ga0157374_103935032 | 238 |
| 178 | 3300013297 | Ga0157378_10008896 | Ga0157378_100088962 | 238 |
| 179 | 3300013307 | Ga0157372_10016802 | Ga0157372_100168025 | 238 |
| 180 | 3300013307 | Ga0157372_10142018 | Ga0157372_101420181 | 238 |
| 181 | 3300013307 | Ga0157372_10849972 | Ga0157372_108499721 | 238 |
| 182 | 3300013307 | Ga0157372_11016303 | Ga0157372_110163031 | 238 |
| 183 | 3300013307 | Ga0157372_11141087 | Ga0157372_111410871 | 238 |
| 184 | 3300013308 | Ga0157375_10052910 | Ga0157375_100529102 | 238 |
| 185 | 3300021384 | Ga0213876_10004533 | Ga0213876_100045333 | 238 |
| 186 | 3300025246 | Ga0209646_1001511 | Ga0209646_10015114 | 238 |
| 187 | 3300025904 | Ga0207647_10000045 | Ga0207647_1000004571 | 238 |
| 188 | 3300025904 | Ga0207647_10002250 | Ga0207647_100022502 | 238 |
| 189 | 3300025909 | Ga0207705_10077545 | Ga0207705_100775453 | 238 |
| 190 | 3300025911 | Ga0207654_10089572 | Ga0207654_100895722 | 238 |
| 191 | 3300025913 | Ga0207695_10028771 | Ga0207695_100287713 | 238 |
| 192 | 3300025913 | Ga0207695_10118835 | Ga0207695_101188352 | 238 |
| 193 | 3300025914 | Ga0207671_10000318 | Ga0207671_1000031854 | 238 |
| 194 | 3300025925 | Ga0207650_10152951 | Ga0207650_101529512 | 238 |
| 195 | 3300025932 | Ga0207690_10011286 | Ga0207690_100112863 | 238 |
| 196 | 3300025949 | Ga0207667_10391755 | Ga0207667_103917552 | 238 |
| 197 | 3300025972 | Ga0207668_10064884 | Ga0207668_100648842 | 238 |
| 198 | 3300025981 | Ga0207640_10031093 | Ga0207640_100310932 | 238 |
| 199 | 3300026041 | Ga0207639_10105023 | Ga0207639_101050233 | 238 |
| 200 | 3300026078 | Ga0207702_10174569 | Ga0207702_101745692 | 238 |
| 201 | 3300026116 | Ga0207674_10097318 | Ga0207674_100973182 | 238 |
| 202 | 3300026116 | Ga0207674_10204912 | Ga0207674_102049122 | 238 |
| 203 | 3300026116 | Ga0207674_10651125 | Ga0207674_106511252 | 238 |
| 204 | 3300026118 | Ga0207675_101068917 | Ga0207675_1010689171 | 238 |
| 205 | 3300026142 | Ga0207698_10004014 | Ga0207698_100040142 | 238 |
| 206 | 3300026142 | Ga0207698_10213394 | Ga0207698_102133941 | 238 |
| 207 | 3300028379 | Ga0268266_10005123 | Ga0268266_100051233 | 238 |
| 208 | 3300028380 | Ga0268265_10439011 | Ga0268265_104390112 | 238 |
| 209 | 3300028381 | Ga0268264_10221177 | Ga0268264_102211772 | 238 |
| 210 | 3300030522 | Ga0307512_10147533 | Ga0307512_101475332 | 238 |
| 211 | 3300031251 | Ga0265327_10144276 | Ga0265327_101442761 | 238 |
| 212 | 3300031456 | Ga0307513_10333598 | Ga0307513_103335982 | 238 |
| 213 | 3300031507 | Ga0307509_10141256 | Ga0307509_101412562 | 238 |
| 214 | 3300031595 | Ga0265313_10036991 | Ga0265313_100369913 | 238 |
| 215 | 3300032002 | Ga0307416_101469237 | Ga0307416_1014692371 | 238 |
| 216 | 3300039437 | Ga0436365_0773211 | Ga0436365_0773211_1237_1956 | 238 |
| 217 | 3300039437 | Ga0436365_1089979 | Ga0436365_1089979_13811_14527 | 238 |
| 218 | 3300041406 | Ga0439439_0017565 | Ga0439439_0017565_191_907 | 238 |
| 219 | 3300042007 | Ga0439449_0032789 | Ga0439449_0032789_1041_1757 | 238 |
| 220 | 3300042007 | Ga0439449_0063955 | Ga0439449_0063955_260_976 | 238 |
| 221 | 3300042007 | Ga0439449_0118294 | Ga0439449_0118294_179_895 | 238 |
| 222 | 3300042014 | Ga0439457_005153 | Ga0439457_005153_2078_2794 | 238 |
| 223 | 3300042014 | Ga0439457_015693 | Ga0439457_015693_943_1659 | 238 |
| 224 | 3300042015 | Ga0439462_0005229 | Ga0439462_0005229_1901_2617 | 238 |
| 225 | 3300042015 | Ga0439462_0045911 | Ga0439462_0045911_194_910 | 238 |
| 226 | 3300044656 | Ga0466969_0000746 | Ga0466969_0000746_984_1700 | 238 |
| 227 | 3300044658 | Ga0466972_0000038 | Ga0466972_0000038_135137_135853 | 238 |
| 228 | 3300044658 | Ga0466972_0010101 | Ga0466972_0010101_3983_4699 | 238 |
| 229 | 3300044658 | Ga0466972_0100253 | Ga0466972_0100253_86_802 | 238 |
| 230 | 3300044684 | Ga0466966_0001759 | Ga0466966_0001759_4259_4975 | 238 |
| 231 | 3300044712 | Ga0453684_0349573 | Ga0453684_0349573_683_1399 | 238 |
| 232 | 3300044719 | Ga0466971_0094657 | Ga0466971_0094657_384_1100 | 238 |
| 233 | 3300044719 | Ga0466971_0136812 | Ga0466971_0136812_68_784 | 238 |
| 234 | 3300044842 | Ga0466957_0001679 | Ga0466957_0001679_2356_3072 | 238 |
| 235 | 3300045049 | Ga0466959_0000056 | Ga0466959_0000056_21339_22055 | 238 |
| 236 | 3300046557 | Ga0495622_0041194 | Ga0495622_0041194_1330_2046 | 238 |
| 237 | 3300046616 | Ga0495668_0002497 | Ga0495668_0002497_8235_8951 | 238 |
| 238 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_309142_309858 | 238 |
| 239 | 3300049581 | Ga0501047_0249985 | Ga0501047_0249985_112_828 | 238 |
| 240 | 3300049686 | Ga0501257_042554 | Ga0501257_042554_245_961 | 238 |
| 241 | 3300049703 | Ga0501219_000074 | Ga0501219_000074_2782_3498 | 238 |
| 242 | 3300049705 | Ga0501225_0002607 | Ga0501225_0002607_1640_2356 | 238 |
| 243 | 3300049705 | Ga0501225_0077422 | Ga0501225_0077422_161_877 | 238 |
| 244 | 3300049758 | Ga0501241_005898 | Ga0501241_005898_737_1453 | 238 |
| 245 | 3300049822 | Ga0501035_0100158 | Ga0501035_0100158_1761_2477 | 238 |
| 246 | 3300049823 | Ga0501044_0003293 | Ga0501044_0003293_4633_5349 | 238 |
| 247 | 3300050005 | Ga0501284_00029 | Ga0501284_00029_66295_67011 | 238 |
| 248 | 3300050493 | nmdc:mga0k408_183517_c1 | nmdc:mga0k408_183517_c1_516_1232 | 238 |
| 249 | 3300050493 | nmdc:mga0k408_62043_c1 | nmdc:mga0k408_62043_c1_541_1257 | 238 |
| 250 | 3300050507 | nmdc:mga05p37_4450_c1 | nmdc:mga05p37_4450_c1_3874_4590 | 238 |
| 251 | 3300053086 | Ga0500578_0036117 | Ga0500578_0036117_2133_2882 | 238 |
| 252 | 3300053090 | Ga0500646_0003030 | Ga0500646_0003030_1320_2036 | 238 |
| 253 | 3300053092 | Ga0500583_0000047 | Ga0500583_0000047_69525_70241 | 238 |
| 254 | 3300053092 | Ga0500583_0007722 | Ga0500583_0007722_2603_3319 | 238 |
| 255 | 3300053093 | Ga0500651_0362188 | Ga0500651_0362188_87_803 | 238 |
| 256 | 3300053136 | Ga0500559_0025729 | Ga0500559_0025729_597_1313 | 238 |
| 257 | 3300053139 | Ga0500568_0001204 | Ga0500568_0001204_12242_12958 | 238 |
| 258 | 3300053147 | Ga0500589_069955 | Ga0500589_069955_458_1174 | 238 |
| 259 | 3300053151 | Ga0500604_0004694 | Ga0500604_0004694_1364_2080 | 238 |
| 260 | 3300053151 | Ga0500604_0040572 | Ga0500604_0040572_441_1157 | 238 |
| 261 | 3300053154 | Ga0500619_031757 | Ga0500619_031757_403_1119 | 238 |
| 262 | 3300053163 | Ga0500639_166892 | Ga0500639_166892_16_732 | 238 |
| 263 | 3300053177 | Ga0500636_0073241 | Ga0500636_0073241_773_1489 | 238 |
| 264 | 3300061719 | Ga0466962_0197519 | Ga0466962_0197519_216_932 | 238 |
| 265 | 2162886007 | SwRhRL2b_contig_1763716 | SwRhRL2b_0236.00000680 | 239 |
| 266 | 3300001979 | JGI24740J21852_10009246 | JGI24740J21852_100092462 | 239 |
| 267 | 3300002738 | JGI25154J39366_1000014 | JGI25154J39366_1000014179 | 239 |
| 268 | 3300003203 | JGI25406J46586_10010665 | JGI25406J46586_100106655 | 239 |
| 269 | 3300003215 | JGI25153J46596_10018336 | JGI25153J46596_100183363 | 239 |
| 270 | 3300003215 | JGI25153J46596_10048003 | JGI25153J46596_100480032 | 239 |
| 271 | 3300003320 | rootH2_10008932 | rootH2_1000893227 | 239 |
| 272 | 3300003320 | rootH2_10009459 | rootH2_100094592 | 239 |
| 273 | 3300003320 | rootH2_10009460 | rootH2_100094602 | 239 |
| 274 | 3300003320 | rootH2_10014077 | rootH2_100140775 | 239 |
| 275 | 3300003320 | rootH2_10041861 | rootH2_100418615 | 239 |
| 276 | 3300003320 | rootH2_10097088 | rootH2_100970883 | 239 |
| 277 | 3300003320 | rootH2_10133384 | rootH2_101333841 | 239 |
| 278 | 3300003320 | rootH2_10187341 | rootH2_101873411 | 239 |
| 279 | 3300003322 | rootL2_10066602 | rootL2_100666021 | 239 |
| 280 | 3300003322 | rootL2_10110627 | rootL2_101106272 | 239 |
| 281 | 3300003322 | rootL2_10178503 | rootL2_101785032 | 239 |
| 282 | 3300003322 | rootL2_10252348 | rootL2_102523481 | 239 |
| 283 | 3300003323 | rootH1_10092711 | rootH1_100927113 | 239 |
| 284 | 3300003323 | rootH1_10149908 | rootH1_101499082 | 239 |
| 285 | 3300003323 | rootH1_10156460 | rootH1_101564602 | 239 |
| 286 | 3300003323 | rootH1_10309255 | rootH1_103092553 | 239 |
| 287 | 3300003354 | JGI25160J50197_1008916 | JGI25160J50197_10089164 | 239 |
| 288 | 3300003354 | JGI25160J50197_1015038 | JGI25160J50197_10150382 | 239 |
| 289 | 3300003354 | JGI25160J50197_1025790 | JGI25160J50197_10257902 | 239 |
| 290 | 3300003762 | Ga0055542_1004837 | Ga0055542_10048374 | 239 |
| 291 | 3300003790 | Ga0055528_1001076 | Ga0055528_10010764 | 239 |
| 292 | 3300003791 | Ga0055530_10000707 | Ga0055530_100007076 | 239 |
| 293 | 3300003794 | Ga0055531_10000093 | Ga0055531_1000009335 | 239 |
| 294 | 3300004625 | Ga0055543_1019289 | Ga0055543_10192892 | 239 |
| 295 | 3300005262 | Ga0065165_1000036 | Ga0065165_100003641 | 239 |
| 296 | 3300005262 | Ga0065165_1024369 | Ga0065165_10243694 | 239 |
| 297 | 3300005262 | Ga0065165_1061452 | Ga0065165_10614522 | 239 |
| 298 | 3300005289 | Ga0065704_10121130 | Ga0065704_101211301 | 239 |
| 299 | 3300005290 | Ga0065712_10029724 | Ga0065712_100297242 | 239 |
| 300 | 3300005293 | Ga0065715_10106144 | Ga0065715_101061442 | 239 |
| 301 | 3300005295 | Ga0065707_10156284 | Ga0065707_101562842 | 239 |
| 302 | 3300005327 | Ga0070658_10005453 | Ga0070658_100054539 | 239 |
| 303 | 3300005327 | Ga0070658_10020168 | Ga0070658_100201683 | 239 |
| 304 | 3300005328 | Ga0070676_10001904 | Ga0070676_100019048 | 239 |
| 305 | 3300005329 | Ga0070683_100006532 | Ga0070683_1000065329 | 239 |
| 306 | 3300005330 | Ga0070690_100415821 | Ga0070690_1004158211 | 239 |
| 307 | 3300005331 | Ga0070670_100031739 | Ga0070670_1000317396 | 239 |
| 308 | 3300005331 | Ga0070670_100063065 | Ga0070670_1000630652 | 239 |
| 309 | 3300005331 | Ga0070670_100185995 | Ga0070670_1001859952 | 239 |
| 310 | 3300005331 | Ga0070670_100355289 | Ga0070670_1003552892 | 239 |
| 311 | 3300005331 | Ga0070670_100714569 | Ga0070670_1007145691 | 239 |
| 312 | 3300005334 | Ga0068869_100031459 | Ga0068869_1000314591 | 239 |
| 313 | 3300005334 | Ga0068869_100109898 | Ga0068869_1001098983 | 239 |
| 314 | 3300005334 | Ga0068869_100130791 | Ga0068869_1001307912 | 239 |
| 315 | 3300005334 | Ga0068869_100442492 | Ga0068869_1004424921 | 239 |
| 316 | 3300005334 | Ga0068869_100869694 | Ga0068869_1008696941 | 239 |
| 317 | 3300005335 | Ga0070666_10000247 | Ga0070666_100002476 | 239 |
| 318 | 3300005335 | Ga0070666_10000885 | Ga0070666_100008858 | 239 |
| 319 | 3300005335 | Ga0070666_10057807 | Ga0070666_100578071 | 239 |
| 320 | 3300005335 | Ga0070666_10167108 | Ga0070666_101671082 | 239 |
| 321 | 3300005336 | Ga0070680_100002380 | Ga0070680_10000238012 | 239 |
| 322 | 3300005337 | Ga0070682_100010074 | Ga0070682_1000100743 | 239 |
| 323 | 3300005337 | Ga0070682_100013374 | Ga0070682_1000133745 | 239 |
| 324 | 3300005337 | Ga0070682_100230413 | Ga0070682_1002304131 | 239 |
| 325 | 3300005337 | Ga0070682_100290170 | Ga0070682_1002901701 | 239 |
| 326 | 3300005338 | Ga0068868_100000075 | Ga0068868_10000007513 | 239 |
| 327 | 3300005338 | Ga0068868_100013056 | Ga0068868_1000130562 | 239 |
| 328 | 3300005338 | Ga0068868_100068306 | Ga0068868_1000683062 | 239 |
| 329 | 3300005338 | Ga0068868_100088975 | Ga0068868_1000889753 | 239 |
| 330 | 3300005338 | Ga0068868_100102340 | Ga0068868_1001023402 | 239 |
| 331 | 3300005338 | Ga0068868_100238090 | Ga0068868_1002380902 | 239 |
| 332 | 3300005339 | Ga0070660_100142760 | Ga0070660_1001427602 | 239 |
| 333 | 3300005340 | Ga0070689_100027122 | Ga0070689_1000271224 | 239 |
| 334 | 3300005340 | Ga0070689_100074988 | Ga0070689_1000749883 | 239 |
| 335 | 3300005340 | Ga0070689_100583446 | Ga0070689_1005834461 | 239 |
| 336 | 3300005341 | Ga0070691_10040723 | Ga0070691_100407233 | 239 |
| 337 | 3300005344 | Ga0070661_100083927 | Ga0070661_1000839271 | 239 |
| 338 | 3300005344 | Ga0070661_100218436 | Ga0070661_1002184362 | 239 |
| 339 | 3300005347 | Ga0070668_100000859 | Ga0070668_10000085910 | 239 |
| 340 | 3300005347 | Ga0070668_100138352 | Ga0070668_1001383522 | 239 |
| 341 | 3300005353 | Ga0070669_100243810 | Ga0070669_1002438102 | 239 |
| 342 | 3300005354 | Ga0070675_100261587 | Ga0070675_1002615872 | 239 |
| 343 | 3300005354 | Ga0070675_100304470 | Ga0070675_1003044701 | 239 |
| 344 | 3300005354 | Ga0070675_100393707 | Ga0070675_1003937071 | 239 |
| 345 | 3300005354 | Ga0070675_100621897 | Ga0070675_1006218971 | 239 |
| 346 | 3300005355 | Ga0070671_100011147 | Ga0070671_1000111473 | 239 |
| 347 | 3300005355 | Ga0070671_100059311 | Ga0070671_1000593112 | 239 |
| 348 | 3300005355 | Ga0070671_100540540 | Ga0070671_1005405401 | 239 |
| 349 | 3300005356 | Ga0070674_100141000 | Ga0070674_1001410002 | 239 |
| 350 | 3300005356 | Ga0070674_100355722 | Ga0070674_1003557222 | 239 |
| 351 | 3300005364 | Ga0070673_100000448 | Ga0070673_1000004488 | 239 |
| 352 | 3300005364 | Ga0070673_100060234 | Ga0070673_1000602342 | 239 |
| 353 | 3300005364 | Ga0070673_100113380 | Ga0070673_1001133803 | 239 |
| 354 | 3300005364 | Ga0070673_100129828 | Ga0070673_1001298281 | 239 |
| 355 | 3300005365 | Ga0070688_100141765 | Ga0070688_1001417652 | 239 |
| 356 | 3300005365 | Ga0070688_100282480 | Ga0070688_1002824801 | 239 |
| 357 | 3300005366 | Ga0070659_100001692 | Ga0070659_10000169210 | 239 |
| 358 | 3300005366 | Ga0070659_100156699 | Ga0070659_1001566991 | 239 |
| 359 | 3300005367 | Ga0070667_100000482 | Ga0070667_10000048230 | 239 |
| 360 | 3300005367 | Ga0070667_100003979 | Ga0070667_1000039797 | 239 |
| 361 | 3300005367 | Ga0070667_100042511 | Ga0070667_1000425114 | 239 |
| 362 | 3300005367 | Ga0070667_100066306 | Ga0070667_1000663062 | 239 |
| 363 | 3300005367 | Ga0070667_100460163 | Ga0070667_1004601631 | 239 |
| 364 | 3300005441 | Ga0070700_100143578 | Ga0070700_1001435783 | 239 |
| 365 | 3300005455 | Ga0070663_100042799 | Ga0070663_1000427992 | 239 |
| 366 | 3300005456 | Ga0070678_100084340 | Ga0070678_1000843401 | 239 |
| 367 | 3300005456 | Ga0070678_100220271 | Ga0070678_1002202711 | 239 |
| 368 | 3300005456 | Ga0070678_100389306 | Ga0070678_1003893062 | 239 |
| 369 | 3300005456 | Ga0070678_100487863 | Ga0070678_1004878631 | 239 |
| 370 | 3300005456 | Ga0070678_100495465 | Ga0070678_1004954651 | 239 |
| 371 | 3300005456 | Ga0070678_100504184 | Ga0070678_1005041841 | 239 |
| 372 | 3300005456 | Ga0070678_100613397 | Ga0070678_1006133971 | 239 |
| 373 | 3300005457 | Ga0070662_100002983 | Ga0070662_10000298310 | 239 |
| 374 | 3300005457 | Ga0070662_100029479 | Ga0070662_1000294792 | 239 |
| 375 | 3300005458 | Ga0070681_10059457 | Ga0070681_100594571 | 239 |
| 376 | 3300005458 | Ga0070681_10115068 | Ga0070681_101150682 | 239 |
| 377 | 3300005458 | Ga0070681_10527626 | Ga0070681_105276261 | 239 |
| 378 | 3300005459 | Ga0068867_100005606 | Ga0068867_1000056068 | 239 |
| 379 | 3300005459 | Ga0068867_100013182 | Ga0068867_1000131822 | 239 |
| 380 | 3300005459 | Ga0068867_100103322 | Ga0068867_1001033222 | 239 |
| 381 | 3300005459 | Ga0068867_100176404 | Ga0068867_1001764042 | 239 |
| 382 | 3300005459 | Ga0068867_100378076 | Ga0068867_1003780763 | 239 |
| 383 | 3300005466 | Ga0070685_10001175 | Ga0070685_100011759 | 239 |
| 384 | 3300005466 | Ga0070685_10047256 | Ga0070685_100472562 | 239 |
| 385 | 3300005467 | Ga0070706_100478269 | Ga0070706_1004782692 | 239 |
| 386 | 3300005471 | Ga0070698_100001454 | Ga0070698_1000014547 | 239 |
| 387 | 3300005471 | Ga0070698_100188702 | Ga0070698_1001887022 | 239 |
| 388 | 3300005471 | Ga0070698_100287347 | Ga0070698_1002873472 | 239 |
| 389 | 3300005530 | Ga0070679_100026151 | Ga0070679_1000261516 | 239 |
| 390 | 3300005530 | Ga0070679_100632879 | Ga0070679_1006328791 | 239 |
| 391 | 3300005535 | Ga0070684_100002043 | Ga0070684_1000020439 | 239 |
| 392 | 3300005535 | Ga0070684_100002647 | Ga0070684_1000026474 | 239 |
| 393 | 3300005539 | Ga0068853_100006239 | Ga0068853_1000062396 | 239 |
| 394 | 3300005539 | Ga0068853_100007967 | Ga0068853_1000079675 | 239 |
| 395 | 3300005539 | Ga0068853_100029438 | Ga0068853_1000294381 | 239 |
| 396 | 3300005539 | Ga0068853_100038435 | Ga0068853_1000384351 | 239 |
| 397 | 3300005539 | Ga0068853_100043831 | Ga0068853_1000438312 | 239 |
| 398 | 3300005539 | Ga0068853_100450622 | Ga0068853_1004506222 | 239 |
| 399 | 3300005543 | Ga0070672_100000361 | Ga0070672_10000036123 | 239 |
| 400 | 3300005543 | Ga0070672_100179153 | Ga0070672_1001791531 | 239 |
| 401 | 3300005543 | Ga0070672_100421243 | Ga0070672_1004212431 | 239 |
| 402 | 3300005543 | Ga0070672_100580201 | Ga0070672_1005802011 | 239 |
| 403 | 3300005544 | Ga0070686_100131878 | Ga0070686_1001318782 | 239 |
| 404 | 3300005547 | Ga0070693_100030023 | Ga0070693_1000300232 | 239 |
| 405 | 3300005547 | Ga0070693_100392077 | Ga0070693_1003920771 | 239 |
| 406 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001607 | 239 |
| 407 | 3300005548 | Ga0070665_100002163 | Ga0070665_10000216310 | 239 |
| 408 | 3300005548 | Ga0070665_100362726 | Ga0070665_1003627262 | 239 |
| 409 | 3300005549 | Ga0070704_100091979 | Ga0070704_1000919793 | 239 |
| 410 | 3300005563 | Ga0068855_100000089 | Ga0068855_10000008977 | 239 |
| 411 | 3300005563 | Ga0068855_100018669 | Ga0068855_1000186694 | 239 |
| 412 | 3300005563 | Ga0068855_100164681 | Ga0068855_1001646812 | 239 |
| 413 | 3300005563 | Ga0068855_100177211 | Ga0068855_1001772112 | 239 |
| 414 | 3300005563 | Ga0068855_100181633 | Ga0068855_1001816332 | 239 |
| 415 | 3300005563 | Ga0068855_100484639 | Ga0068855_1004846392 | 239 |
| 416 | 3300005564 | Ga0070664_100031477 | Ga0070664_1000314772 | 239 |
| 417 | 3300005564 | Ga0070664_100058013 | Ga0070664_1000580133 | 239 |
| 418 | 3300005564 | Ga0070664_100097591 | Ga0070664_1000975912 | 239 |
| 419 | 3300005577 | Ga0068857_100025308 | Ga0068857_1000253085 | 239 |
| 420 | 3300005577 | Ga0068857_100078843 | Ga0068857_1000788432 | 239 |
| 421 | 3300005577 | Ga0068857_100155484 | Ga0068857_1001554842 | 239 |
| 422 | 3300005577 | Ga0068857_100301295 | Ga0068857_1003012952 | 239 |
| 423 | 3300005578 | Ga0068854_100052769 | Ga0068854_1000527692 | 239 |
| 424 | 3300005578 | Ga0068854_100766387 | Ga0068854_1007663871 | 239 |
| 425 | 3300005614 | Ga0068856_100003735 | Ga0068856_10000373510 | 239 |
| 426 | 3300005614 | Ga0068856_100025703 | Ga0068856_1000257032 | 239 |
| 427 | 3300005615 | Ga0070702_100105931 | Ga0070702_1001059312 | 239 |
| 428 | 3300005615 | Ga0070702_100212383 | Ga0070702_1002123832 | 239 |
| 429 | 3300005616 | Ga0068852_100019362 | Ga0068852_1000193626 | 239 |
| 430 | 3300005616 | Ga0068852_100039630 | Ga0068852_1000396303 | 239 |
| 431 | 3300005616 | Ga0068852_100151063 | Ga0068852_1001510632 | 239 |
| 432 | 3300005616 | Ga0068852_100178390 | Ga0068852_1001783901 | 239 |
| 433 | 3300005616 | Ga0068852_100183670 | Ga0068852_1001836702 | 239 |
| 434 | 3300005616 | Ga0068852_100338617 | Ga0068852_1003386172 | 239 |
| 435 | 3300005617 | Ga0068859_100000012 | Ga0068859_1000000126 | 239 |
| 436 | 3300005617 | Ga0068859_100158154 | Ga0068859_1001581542 | 239 |
| 437 | 3300005617 | Ga0068859_100174460 | Ga0068859_1001744602 | 239 |
| 438 | 3300005617 | Ga0068859_100554889 | Ga0068859_1005548892 | 239 |
| 439 | 3300005617 | Ga0068859_100673995 | Ga0068859_1006739951 | 239 |
| 440 | 3300005618 | Ga0068864_100000785 | Ga0068864_1000007853 | 239 |
| 441 | 3300005618 | Ga0068864_100007484 | Ga0068864_1000074844 | 239 |
| 442 | 3300005618 | Ga0068864_100046783 | Ga0068864_1000467834 | 239 |
| 443 | 3300005618 | Ga0068864_100121314 | Ga0068864_1001213144 | 239 |
| 444 | 3300005618 | Ga0068864_100230121 | Ga0068864_1002301212 | 239 |
| 445 | 3300005718 | Ga0068866_10138905 | Ga0068866_101389052 | 239 |
| 446 | 3300005719 | Ga0068861_100005861 | Ga0068861_1000058617 | 239 |
| 447 | 3300005719 | Ga0068861_100369858 | Ga0068861_1003698583 | 239 |
| 448 | 3300005719 | Ga0068861_100434340 | Ga0068861_1004343402 | 239 |
| 449 | 3300005834 | Ga0068851_10001706 | Ga0068851_100017067 | 239 |
| 450 | 3300005834 | Ga0068851_10062786 | Ga0068851_100627862 | 239 |
| 451 | 3300005840 | Ga0068870_10316628 | Ga0068870_103166281 | 239 |
| 452 | 3300005840 | Ga0068870_10419458 | Ga0068870_104194581 | 239 |
| 453 | 3300005841 | Ga0068863_100001993 | Ga0068863_10000199320 | 239 |
| 454 | 3300005841 | Ga0068863_100007688 | Ga0068863_10000768810 | 239 |
| 455 | 3300005841 | Ga0068863_100017853 | Ga0068863_1000178533 | 239 |
| 456 | 3300005841 | Ga0068863_100064072 | Ga0068863_1000640722 | 239 |
| 457 | 3300005841 | Ga0068863_100615262 | Ga0068863_1006152621 | 239 |
| 458 | 3300005841 | Ga0068863_100636357 | Ga0068863_1006363571 | 239 |
| 459 | 3300005842 | Ga0068858_100001413 | Ga0068858_10000141319 | 239 |
| 460 | 3300005842 | Ga0068858_100003623 | Ga0068858_1000036232 | 239 |
| 461 | 3300005842 | Ga0068858_100106825 | Ga0068858_1001068252 | 239 |
| 462 | 3300005842 | Ga0068858_100365833 | Ga0068858_1003658332 | 239 |
| 463 | 3300005842 | Ga0068858_100530105 | Ga0068858_1005301051 | 239 |
| 464 | 3300005843 | Ga0068860_100000111 | Ga0068860_10000011114 | 239 |
| 465 | 3300005843 | Ga0068860_100001074 | Ga0068860_10000107422 | 239 |
| 466 | 3300005843 | Ga0068860_100002836 | Ga0068860_10000283612 | 239 |
| 467 | 3300005843 | Ga0068860_100003730 | Ga0068860_10000373011 | 239 |
| 468 | 3300005843 | Ga0068860_100359310 | Ga0068860_1003593102 | 239 |
| 469 | 3300005983 | Ga0081540_1039418 | Ga0081540_10394183 | 239 |
| 470 | 3300005985 | Ga0081539_10000337 | Ga0081539_1000033785 | 239 |
| 471 | 3300005985 | Ga0081539_10200780 | Ga0081539_102007801 | 239 |
| 472 | 3300006195 | Ga0075366_10009448 | Ga0075366_100094482 | 239 |
| 473 | 3300006195 | Ga0075366_10039932 | Ga0075366_100399323 | 239 |
| 474 | 3300006237 | Ga0097621_100000063 | Ga0097621_10000006319 | 239 |
| 475 | 3300006237 | Ga0097621_100003845 | Ga0097621_1000038457 | 239 |
| 476 | 3300006237 | Ga0097621_100004135 | Ga0097621_1000041355 | 239 |
| 477 | 3300006237 | Ga0097621_100031558 | Ga0097621_1000315582 | 239 |
| 478 | 3300006237 | Ga0097621_100063054 | Ga0097621_1000630543 | 239 |
| 479 | 3300006237 | Ga0097621_100122957 | Ga0097621_1001229573 | 239 |
| 480 | 3300006237 | Ga0097621_100598157 | Ga0097621_1005981571 | 239 |
| 481 | 3300006358 | Ga0068871_100000981 | Ga0068871_1000009815 | 239 |
| 482 | 3300006358 | Ga0068871_100001569 | Ga0068871_1000015693 | 239 |
| 483 | 3300006358 | Ga0068871_100005200 | Ga0068871_1000052008 | 239 |
| 484 | 3300006358 | Ga0068871_100008715 | Ga0068871_1000087156 | 239 |
| 485 | 3300006358 | Ga0068871_100009289 | Ga0068871_1000092891 | 239 |
| 486 | 3300006358 | Ga0068871_100128248 | Ga0068871_1001282483 | 239 |
| 487 | 3300006358 | Ga0068871_100157109 | Ga0068871_1001571092 | 239 |
| 488 | 3300006358 | Ga0068871_100299036 | Ga0068871_1002990362 | 239 |
| 489 | 3300006358 | Ga0068871_100746485 | Ga0068871_1007464851 | 239 |
| 490 | 3300006844 | Ga0075428_100049669 | Ga0075428_1000496693 | 239 |
| 491 | 3300006846 | Ga0075430_100004854 | Ga0075430_1000048548 | 239 |
| 492 | 3300006846 | Ga0075430_100121445 | Ga0075430_1001214452 | 239 |
| 493 | 3300006880 | Ga0075429_100004948 | Ga0075429_1000049487 | 239 |
| 494 | 3300006881 | Ga0068865_100029986 | Ga0068865_1000299862 | 239 |
| 495 | 3300006931 | Ga0097620_100000012 | Ga0097620_1000000126 | 239 |
| 496 | 3300006931 | Ga0097620_100158144 | Ga0097620_1001581442 | 239 |
| 497 | 3300006931 | Ga0097620_100174468 | Ga0097620_1001744682 | 239 |
| 498 | 3300006931 | Ga0097620_100554979 | Ga0097620_1005549792 | 239 |
| 499 | 3300006931 | Ga0097620_100673994 | Ga0097620_1006739942 | 239 |
| 500 | 3300009093 | Ga0105240_10000074 | Ga0105240_1000007428 | 239 |
| 501 | 3300009093 | Ga0105240_10003320 | Ga0105240_1000332022 | 239 |
| 502 | 3300009093 | Ga0105240_10004846 | Ga0105240_100048464 | 239 |
| 503 | 3300009093 | Ga0105240_10005940 | Ga0105240_1000594011 | 239 |
| 504 | 3300009093 | Ga0105240_10022330 | Ga0105240_100223302 | 239 |
| 505 | 3300009093 | Ga0105240_10025898 | Ga0105240_100258985 | 239 |
| 506 | 3300009093 | Ga0105240_10054314 | Ga0105240_100543144 | 239 |
| 507 | 3300009093 | Ga0105240_10062591 | Ga0105240_100625912 | 239 |
| 508 | 3300009093 | Ga0105240_10143372 | Ga0105240_101433723 | 239 |
| 509 | 3300009093 | Ga0105240_10943553 | Ga0105240_109435531 | 239 |
| 510 | 3300009094 | Ga0111539_10268897 | Ga0111539_102688972 | 239 |
| 511 | 3300009094 | Ga0111539_10308220 | Ga0111539_103082202 | 239 |
| 512 | 3300009094 | Ga0111539_10311274 | Ga0111539_103112742 | 239 |
| 513 | 3300009094 | Ga0111539_11382818 | Ga0111539_113828181 | 239 |
| 514 | 3300009098 | Ga0105245_10108552 | Ga0105245_101085523 | 239 |
| 515 | 3300009098 | Ga0105245_10516949 | Ga0105245_105169491 | 239 |
| 516 | 3300009101 | Ga0105247_10002080 | Ga0105247_100020803 | 239 |
| 517 | 3300009101 | Ga0105247_10019554 | Ga0105247_100195543 | 239 |
| 518 | 3300009148 | Ga0105243_10440509 | Ga0105243_104405091 | 239 |
| 519 | 3300009174 | Ga0105241_10001370 | Ga0105241_1000137017 | 239 |
| 520 | 3300009174 | Ga0105241_10127913 | Ga0105241_101279131 | 239 |
| 521 | 3300009174 | Ga0105241_10153083 | Ga0105241_101530832 | 239 |
| 522 | 3300009174 | Ga0105241_10158698 | Ga0105241_101586982 | 239 |
| 523 | 3300009174 | Ga0105241_10261798 | Ga0105241_102617981 | 239 |
| 524 | 3300009176 | Ga0105242_10067512 | Ga0105242_100675122 | 239 |
| 525 | 3300009176 | Ga0105242_10095326 | Ga0105242_100953263 | 239 |
| 526 | 3300009176 | Ga0105242_10111690 | Ga0105242_101116902 | 239 |
| 527 | 3300009176 | Ga0105242_10186313 | Ga0105242_101863132 | 239 |
| 528 | 3300009177 | Ga0105248_10008799 | Ga0105248_100087993 | 239 |
| 529 | 3300009177 | Ga0105248_10208314 | Ga0105248_102083142 | 239 |
| 530 | 3300009545 | Ga0105237_10010659 | Ga0105237_1001065910 | 239 |
| 531 | 3300009545 | Ga0105237_10032799 | Ga0105237_100327993 | 239 |
| 532 | 3300009545 | Ga0105237_10039892 | Ga0105237_100398923 | 239 |
| 533 | 3300009545 | Ga0105237_10077957 | Ga0105237_100779574 | 239 |
| 534 | 3300009545 | Ga0105237_10092997 | Ga0105237_100929973 | 239 |
| 535 | 3300009545 | Ga0105237_10206872 | Ga0105237_102068723 | 239 |
| 536 | 3300009545 | Ga0105237_10233038 | Ga0105237_102330382 | 239 |
| 537 | 3300009545 | Ga0105237_10263919 | Ga0105237_102639192 | 239 |
| 538 | 3300009545 | Ga0105237_10488081 | Ga0105237_104880812 | 239 |
| 539 | 3300009551 | Ga0105238_10011152 | Ga0105238_100111528 | 239 |
| 540 | 3300009551 | Ga0105238_10052644 | Ga0105238_100526444 | 239 |
| 541 | 3300009551 | Ga0105238_10204680 | Ga0105238_102046802 | 239 |
| 542 | 3300009551 | Ga0105238_10269065 | Ga0105238_102690652 | 239 |
| 543 | 3300009551 | Ga0105238_10565361 | Ga0105238_105653611 | 239 |
| 544 | 3300009551 | Ga0105238_10714467 | Ga0105238_107144671 | 239 |
| 545 | 3300009553 | Ga0105249_10001749 | Ga0105249_100017493 | 239 |
| 546 | 3300009553 | Ga0105249_10003402 | Ga0105249_1000340210 | 239 |
| 547 | 3300009553 | Ga0105249_10003442 | Ga0105249_100034427 | 239 |
| 548 | 3300009553 | Ga0105249_10006330 | Ga0105249_100063302 | 239 |
| 549 | 3300009553 | Ga0105249_10031375 | Ga0105249_100313751 | 239 |
| 550 | 3300009553 | Ga0105249_10184275 | Ga0105249_101842753 | 239 |
| 551 | 3300009553 | Ga0105249_10372969 | Ga0105249_103729692 | 239 |
| 552 | 3300009553 | Ga0105249_10726482 | Ga0105249_107264821 | 239 |
| 553 | 3300010375 | Ga0105239_10000529 | Ga0105239_1000052933 | 239 |
| 554 | 3300010375 | Ga0105239_10000905 | Ga0105239_1000090516 | 239 |
| 555 | 3300010375 | Ga0105239_10005517 | Ga0105239_100055172 | 239 |
| 556 | 3300010375 | Ga0105239_10083078 | Ga0105239_100830782 | 239 |
| 557 | 3300010375 | Ga0105239_10095150 | Ga0105239_100951503 | 239 |
| 558 | 3300010375 | Ga0105239_10142518 | Ga0105239_101425182 | 239 |
| 559 | 3300010375 | Ga0105239_10198587 | Ga0105239_101985872 | 239 |
| 560 | 3300010375 | Ga0105239_10339876 | Ga0105239_103398762 | 239 |
| 561 | 3300011119 | Ga0105246_10036356 | Ga0105246_100363563 | 239 |
| 562 | 3300011119 | Ga0105246_10215285 | Ga0105246_102152852 | 239 |
| 563 | 3300011119 | Ga0105246_10473631 | Ga0105246_104736311 | 239 |
| 564 | 3300013100 | Ga0157373_10009945 | Ga0157373_100099457 | 239 |
| 565 | 3300013100 | Ga0157373_10420627 | Ga0157373_104206271 | 239 |
| 566 | 3300013104 | Ga0157370_10009011 | Ga0157370_100090112 | 239 |
| 567 | 3300013104 | Ga0157370_10088618 | Ga0157370_100886182 | 239 |
| 568 | 3300013104 | Ga0157370_10102402 | Ga0157370_101024023 | 239 |
| 569 | 3300013104 | Ga0157370_10711999 | Ga0157370_107119991 | 239 |
| 570 | 3300013105 | Ga0157369_10099672 | Ga0157369_100996723 | 239 |
| 571 | 3300013105 | Ga0157369_10212800 | Ga0157369_102128001 | 239 |
| 572 | 3300013105 | Ga0157369_10212931 | Ga0157369_102129312 | 239 |
| 573 | 3300013105 | Ga0157369_10360925 | Ga0157369_103609252 | 239 |
| 574 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001315 | 239 |
| 575 | 3300013296 | Ga0157374_10002589 | Ga0157374_1000258910 | 239 |
| 576 | 3300013296 | Ga0157374_10003428 | Ga0157374_1000342811 | 239 |
| 577 | 3300013296 | Ga0157374_10379282 | Ga0157374_103792822 | 239 |
| 578 | 3300013297 | Ga0157378_10004677 | Ga0157378_1000467711 | 239 |
| 579 | 3300013297 | Ga0157378_10039378 | Ga0157378_100393782 | 239 |
| 580 | 3300013297 | Ga0157378_10039860 | Ga0157378_100398601 | 239 |
| 581 | 3300013297 | Ga0157378_10114878 | Ga0157378_101148782 | 239 |
| 582 | 3300013297 | Ga0157378_10351564 | Ga0157378_103515642 | 239 |
| 583 | 3300013297 | Ga0157378_10578478 | Ga0157378_105784782 | 239 |
| 584 | 3300013306 | Ga0163162_10000158 | Ga0163162_1000015834 | 239 |
| 585 | 3300013306 | Ga0163162_10000328 | Ga0163162_100003282 | 239 |
| 586 | 3300013306 | Ga0163162_10000377 | Ga0163162_1000037710 | 239 |
| 587 | 3300013306 | Ga0163162_10002130 | Ga0163162_100021302 | 239 |
| 588 | 3300013306 | Ga0163162_10016844 | Ga0163162_100168442 | 239 |
| 589 | 3300013306 | Ga0163162_10029831 | Ga0163162_100298314 | 239 |
| 590 | 3300013306 | Ga0163162_10211501 | Ga0163162_102115012 | 239 |
| 591 | 3300013306 | Ga0163162_10216519 | Ga0163162_102165192 | 239 |
| 592 | 3300013306 | Ga0163162_10253270 | Ga0163162_102532703 | 239 |
| 593 | 3300013306 | Ga0163162_10548084 | Ga0163162_105480842 | 239 |
| 594 | 3300013306 | Ga0163162_10576699 | Ga0163162_105766992 | 239 |
| 595 | 3300013307 | Ga0157372_10001344 | Ga0157372_1000134415 | 239 |
| 596 | 3300013307 | Ga0157372_10002881 | Ga0157372_100028812 | 239 |
| 597 | 3300013307 | Ga0157372_10132250 | Ga0157372_101322503 | 239 |
| 598 | 3300013307 | Ga0157372_10138602 | Ga0157372_101386023 | 239 |
| 599 | 3300013307 | Ga0157372_10154931 | Ga0157372_101549312 | 239 |
| 600 | 3300013307 | Ga0157372_10156451 | Ga0157372_101564513 | 239 |
| 601 | 3300013307 | Ga0157372_10226401 | Ga0157372_102264011 | 239 |
| 602 | 3300013307 | Ga0157372_10316135 | Ga0157372_103161353 | 239 |
| 603 | 3300013307 | Ga0157372_10423072 | Ga0157372_104230723 | 239 |
| 604 | 3300013307 | Ga0157372_10878493 | Ga0157372_108784931 | 239 |
| 605 | 3300013307 | Ga0157372_10900873 | Ga0157372_109008732 | 239 |
| 606 | 3300013308 | Ga0157375_10000228 | Ga0157375_1000022834 | 239 |
| 607 | 3300013308 | Ga0157375_10004745 | Ga0157375_1000474511 | 239 |
| 608 | 3300013308 | Ga0157375_10084393 | Ga0157375_100843933 | 239 |
| 609 | 3300013308 | Ga0157375_10097458 | Ga0157375_100974582 | 239 |
| 610 | 3300013308 | Ga0157375_10214820 | Ga0157375_102148201 | 239 |
| 611 | 3300013308 | Ga0157375_10224496 | Ga0157375_102244962 | 239 |
| 612 | 3300013308 | Ga0157375_10264623 | Ga0157375_102646232 | 239 |
| 613 | 3300013308 | Ga0157375_10295455 | Ga0157375_102954552 | 239 |
| 614 | 3300014325 | Ga0163163_10000712 | Ga0163163_100007128 | 239 |
| 615 | 3300014325 | Ga0163163_10000752 | Ga0163163_1000075212 | 239 |
| 616 | 3300014325 | Ga0163163_10031622 | Ga0163163_100316223 | 239 |
| 617 | 3300014325 | Ga0163163_10059076 | Ga0163163_100590763 | 239 |
| 618 | 3300014326 | Ga0157380_10295405 | Ga0157380_102954051 | 239 |
| 619 | 3300014326 | Ga0157380_10312973 | Ga0157380_103129732 | 239 |
| 620 | 3300014745 | Ga0157377_10027455 | Ga0157377_100274552 | 239 |
| 621 | 3300014968 | Ga0157379_10000440 | Ga0157379_100004409 | 239 |
| 622 | 3300014968 | Ga0157379_10028369 | Ga0157379_100283695 | 239 |
| 623 | 3300014968 | Ga0157379_10152648 | Ga0157379_101526482 | 239 |
| 624 | 3300014968 | Ga0157379_10193105 | Ga0157379_101931052 | 239 |
| 625 | 3300014968 | Ga0157379_10288422 | Ga0157379_102884222 | 239 |
| 626 | 3300014969 | Ga0157376_10000381 | Ga0157376_1000038110 | 239 |
| 627 | 3300014969 | Ga0157376_10001773 | Ga0157376_100017737 | 239 |
| 628 | 3300014969 | Ga0157376_10002491 | Ga0157376_100024913 | 239 |
| 629 | 3300014969 | Ga0157376_10003377 | Ga0157376_100033775 | 239 |
| 630 | 3300014969 | Ga0157376_10029578 | Ga0157376_100295782 | 239 |
| 631 | 3300014969 | Ga0157376_10048370 | Ga0157376_100483704 | 239 |
| 632 | 3300014969 | Ga0157376_10109093 | Ga0157376_101090931 | 239 |
| 633 | 3300014969 | Ga0157376_10122083 | Ga0157376_101220832 | 239 |
| 634 | 3300014969 | Ga0157376_10252328 | Ga0157376_102523282 | 239 |
| 635 | 3300014969 | Ga0157376_10490978 | Ga0157376_104909781 | 239 |
| 636 | 3300015265 | Ga0182005_1000039 | Ga0182005_100003973 | 239 |
| 637 | 3300017792 | Ga0163161_10003038 | Ga0163161_100030381 | 239 |
| 638 | 3300017792 | Ga0163161_10018054 | Ga0163161_100180542 | 239 |
| 639 | 3300017792 | Ga0163161_10056909 | Ga0163161_100569093 | 239 |
| 640 | 3300017792 | Ga0163161_10102284 | Ga0163161_101022842 | 239 |
| 641 | 3300025208 | Ga0209436_101598 | Ga0209436_1015984 | 239 |
| 642 | 3300025208 | Ga0209436_102525 | Ga0209436_1025257 | 239 |
| 643 | 3300025242 | Ga0209258_100195 | Ga0209258_10019520 | 239 |
| 644 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002946 | 239 |
| 645 | 3300025250 | Ga0209026_1000178 | Ga0209026_100017831 | 239 |
| 646 | 3300025254 | Ga0209148_1000515 | Ga0209148_10005159 | 239 |
| 647 | 3300025258 | Ga0209129_1006332 | Ga0209129_10063322 | 239 |
| 648 | 3300025273 | Ga0209673_1000261 | Ga0209673_100026183 | 239 |
| 649 | 3300025295 | Ga0209564_1002640 | Ga0209564_10026402 | 239 |
| 650 | 3300025295 | Ga0209564_1003255 | Ga0209564_10032558 | 239 |
| 651 | 3300025297 | Ga0209758_1002812 | Ga0209758_100281212 | 239 |
| 652 | 3300025297 | Ga0209758_1004501 | Ga0209758_10045011 | 239 |
| 653 | 3300025297 | Ga0209758_1004617 | Ga0209758_10046177 | 239 |
| 654 | 3300025298 | Ga0209050_1000160 | Ga0209050_100016031 | 239 |
| 655 | 3300025302 | Ga0207426_1000318 | Ga0207426_100031846 | 239 |
| 656 | 3300025302 | Ga0207426_1000360 | Ga0207426_100036016 | 239 |
| 657 | 3300025302 | Ga0207426_1001116 | Ga0207426_100111610 | 239 |
| 658 | 3300025304 | Ga0209257_1000001 | Ga0209257_1000001925 | 239 |
| 659 | 3300025304 | Ga0209257_1003010 | Ga0209257_10030106 | 239 |
| 660 | 3300025315 | Ga0207697_10034636 | Ga0207697_100346362 | 239 |
| 661 | 3300025321 | Ga0207656_10000424 | Ga0207656_100004247 | 239 |
| 662 | 3300025321 | Ga0207656_10060613 | Ga0207656_100606132 | 239 |
| 663 | 3300025893 | Ga0207682_10150865 | Ga0207682_101508652 | 239 |
| 664 | 3300025899 | Ga0207642_10119293 | Ga0207642_101192932 | 239 |
| 665 | 3300025900 | Ga0207710_10023114 | Ga0207710_100231143 | 239 |
| 666 | 3300025903 | Ga0207680_10000031 | Ga0207680_1000003149 | 239 |
| 667 | 3300025903 | Ga0207680_10001363 | Ga0207680_100013639 | 239 |
| 668 | 3300025903 | Ga0207680_10028330 | Ga0207680_100283302 | 239 |
| 669 | 3300025903 | Ga0207680_10046942 | Ga0207680_100469422 | 239 |
| 670 | 3300025903 | Ga0207680_10056804 | Ga0207680_100568043 | 239 |
| 671 | 3300025904 | Ga0207647_10026185 | Ga0207647_100261852 | 239 |
| 672 | 3300025904 | Ga0207647_10038494 | Ga0207647_100384942 | 239 |
| 673 | 3300025904 | Ga0207647_10052486 | Ga0207647_100524863 | 239 |
| 674 | 3300025907 | Ga0207645_10000949 | Ga0207645_1000094915 | 239 |
| 675 | 3300025907 | Ga0207645_10136641 | Ga0207645_101366412 | 239 |
| 676 | 3300025908 | Ga0207643_10019993 | Ga0207643_100199932 | 239 |
| 677 | 3300025908 | Ga0207643_10194996 | Ga0207643_101949962 | 239 |
| 678 | 3300025908 | Ga0207643_10239042 | Ga0207643_102390422 | 239 |
| 679 | 3300025909 | Ga0207705_10023675 | Ga0207705_100236753 | 239 |
| 680 | 3300025910 | Ga0207684_10779694 | Ga0207684_107796941 | 239 |
| 681 | 3300025911 | Ga0207654_10008187 | Ga0207654_100081873 | 239 |
| 682 | 3300025911 | Ga0207654_10250453 | Ga0207654_102504532 | 239 |
| 683 | 3300025912 | Ga0207707_10013305 | Ga0207707_100133056 | 239 |
| 684 | 3300025913 | Ga0207695_10000071 | Ga0207695_10000071161 | 239 |
| 685 | 3300025913 | Ga0207695_10000084 | Ga0207695_10000084111 | 239 |
| 686 | 3300025913 | Ga0207695_10000515 | Ga0207695_1000051575 | 239 |
| 687 | 3300025913 | Ga0207695_10002195 | Ga0207695_100021955 | 239 |
| 688 | 3300025913 | Ga0207695_10006026 | Ga0207695_100060268 | 239 |
| 689 | 3300025913 | Ga0207695_10066633 | Ga0207695_100666332 | 239 |
| 690 | 3300025913 | Ga0207695_10102521 | Ga0207695_101025212 | 239 |
| 691 | 3300025913 | Ga0207695_10188505 | Ga0207695_101885052 | 239 |
| 692 | 3300025914 | Ga0207671_10000981 | Ga0207671_100009814 | 239 |
| 693 | 3300025914 | Ga0207671_10001871 | Ga0207671_100018712 | 239 |
| 694 | 3300025914 | Ga0207671_10003538 | Ga0207671_100035386 | 239 |
| 695 | 3300025914 | Ga0207671_10007411 | Ga0207671_100074119 | 239 |
| 696 | 3300025914 | Ga0207671_10017355 | Ga0207671_100173553 | 239 |
| 697 | 3300025914 | Ga0207671_10029600 | Ga0207671_100296002 | 239 |
| 698 | 3300025914 | Ga0207671_10056341 | Ga0207671_100563413 | 239 |
| 699 | 3300025914 | Ga0207671_10160536 | Ga0207671_101605362 | 239 |
| 700 | 3300025914 | Ga0207671_10223928 | Ga0207671_102239282 | 239 |
| 701 | 3300025917 | Ga0207660_10079904 | Ga0207660_100799042 | 239 |
| 702 | 3300025917 | Ga0207660_10081653 | Ga0207660_100816533 | 239 |
| 703 | 3300025918 | Ga0207662_10066277 | Ga0207662_100662772 | 239 |
| 704 | 3300025919 | Ga0207657_10301692 | Ga0207657_103016921 | 239 |
| 705 | 3300025920 | Ga0207649_10152000 | Ga0207649_101520002 | 239 |
| 706 | 3300025920 | Ga0207649_10337386 | Ga0207649_103373861 | 239 |
| 707 | 3300025921 | Ga0207652_10255578 | Ga0207652_102555781 | 239 |
| 708 | 3300025924 | Ga0207694_10045035 | Ga0207694_100450352 | 239 |
| 709 | 3300025924 | Ga0207694_10097947 | Ga0207694_100979472 | 239 |
| 710 | 3300025924 | Ga0207694_10451294 | Ga0207694_104512941 | 239 |
| 711 | 3300025925 | Ga0207650_10025832 | Ga0207650_100258322 | 239 |
| 712 | 3300025925 | Ga0207650_10075554 | Ga0207650_100755543 | 239 |
| 713 | 3300025925 | Ga0207650_10128661 | Ga0207650_101286612 | 239 |
| 714 | 3300025925 | Ga0207650_10193494 | Ga0207650_101934941 | 239 |
| 715 | 3300025925 | Ga0207650_10296737 | Ga0207650_102967371 | 239 |
| 716 | 3300025926 | Ga0207659_10050982 | Ga0207659_100509822 | 239 |
| 717 | 3300025926 | Ga0207659_10094095 | Ga0207659_100940952 | 239 |
| 718 | 3300025926 | Ga0207659_10356397 | Ga0207659_103563971 | 239 |
| 719 | 3300025926 | Ga0207659_10452665 | Ga0207659_104526652 | 239 |
| 720 | 3300025931 | Ga0207644_10015110 | Ga0207644_100151103 | 239 |
| 721 | 3300025931 | Ga0207644_10358775 | Ga0207644_103587752 | 239 |
| 722 | 3300025931 | Ga0207644_10541834 | Ga0207644_105418341 | 239 |
| 723 | 3300025932 | Ga0207690_10119886 | Ga0207690_101198861 | 239 |
| 724 | 3300025933 | Ga0207706_10002788 | Ga0207706_100027888 | 239 |
| 725 | 3300025933 | Ga0207706_10011186 | Ga0207706_100111866 | 239 |
| 726 | 3300025934 | Ga0207686_10001258 | Ga0207686_100012586 | 239 |
| 727 | 3300025934 | Ga0207686_10068276 | Ga0207686_100682762 | 239 |
| 728 | 3300025934 | Ga0207686_10181112 | Ga0207686_101811122 | 239 |
| 729 | 3300025936 | Ga0207670_10019460 | Ga0207670_100194602 | 239 |
| 730 | 3300025936 | Ga0207670_10179885 | Ga0207670_101798852 | 239 |
| 731 | 3300025936 | Ga0207670_10603259 | Ga0207670_106032591 | 239 |
| 732 | 3300025937 | Ga0207669_10010995 | Ga0207669_100109952 | 239 |
| 733 | 3300025937 | Ga0207669_10186175 | Ga0207669_101861752 | 239 |
| 734 | 3300025937 | Ga0207669_10301958 | Ga0207669_103019582 | 239 |
| 735 | 3300025937 | Ga0207669_10696637 | Ga0207669_106966371 | 239 |
| 736 | 3300025938 | Ga0207704_10268152 | Ga0207704_102681522 | 239 |
| 737 | 3300025938 | Ga0207704_10438155 | Ga0207704_104381551 | 239 |
| 738 | 3300025940 | Ga0207691_10000037 | Ga0207691_1000003783 | 239 |
| 739 | 3300025940 | Ga0207691_10165053 | Ga0207691_101650532 | 239 |
| 740 | 3300025940 | Ga0207691_10177818 | Ga0207691_101778181 | 239 |
| 741 | 3300025940 | Ga0207691_10444575 | Ga0207691_104445751 | 239 |
| 742 | 3300025940 | Ga0207691_10450186 | Ga0207691_104501861 | 239 |
| 743 | 3300025940 | Ga0207691_10609711 | Ga0207691_106097111 | 239 |
| 744 | 3300025941 | Ga0207711_10141669 | Ga0207711_101416692 | 239 |
| 745 | 3300025941 | Ga0207711_10264135 | Ga0207711_102641352 | 239 |
| 746 | 3300025942 | Ga0207689_10014782 | Ga0207689_100147823 | 239 |
| 747 | 3300025942 | Ga0207689_10025181 | Ga0207689_100251812 | 239 |
| 748 | 3300025942 | Ga0207689_10087990 | Ga0207689_100879903 | 239 |
| 749 | 3300025942 | Ga0207689_10181501 | Ga0207689_101815013 | 239 |
| 750 | 3300025942 | Ga0207689_10381058 | Ga0207689_103810582 | 239 |
| 751 | 3300025944 | Ga0207661_10005710 | Ga0207661_100057107 | 239 |
| 752 | 3300025944 | Ga0207661_10109119 | Ga0207661_101091192 | 239 |
| 753 | 3300025945 | Ga0207679_10075284 | Ga0207679_100752842 | 239 |
| 754 | 3300025945 | Ga0207679_10209756 | Ga0207679_102097562 | 239 |
| 755 | 3300025945 | Ga0207679_10622513 | Ga0207679_106225131 | 239 |
| 756 | 3300025949 | Ga0207667_10000209 | Ga0207667_100002095 | 239 |
| 757 | 3300025949 | Ga0207667_10001238 | Ga0207667_1000123820 | 239 |
| 758 | 3300025949 | Ga0207667_10022196 | Ga0207667_100221964 | 239 |
| 759 | 3300025949 | Ga0207667_10152416 | Ga0207667_101524162 | 239 |
| 760 | 3300025949 | Ga0207667_10168669 | Ga0207667_101686692 | 239 |
| 761 | 3300025949 | Ga0207667_10456282 | Ga0207667_104562821 | 239 |
| 762 | 3300025960 | Ga0207651_10000443 | Ga0207651_100004434 | 239 |
| 763 | 3300025960 | Ga0207651_10041938 | Ga0207651_100419383 | 239 |
| 764 | 3300025960 | Ga0207651_10059015 | Ga0207651_100590153 | 239 |
| 765 | 3300025960 | Ga0207651_10355749 | Ga0207651_103557491 | 239 |
| 766 | 3300025961 | Ga0207712_10003355 | Ga0207712_1000335511 | 239 |
| 767 | 3300025961 | Ga0207712_10004607 | Ga0207712_100046079 | 239 |
| 768 | 3300025961 | Ga0207712_10005091 | Ga0207712_100050916 | 239 |
| 769 | 3300025961 | Ga0207712_10114190 | Ga0207712_101141902 | 239 |
| 770 | 3300025972 | Ga0207668_10001307 | Ga0207668_100013074 | 239 |
| 771 | 3300025972 | Ga0207668_10081464 | Ga0207668_100814642 | 239 |
| 772 | 3300025972 | Ga0207668_10478402 | Ga0207668_104784022 | 239 |
| 773 | 3300025972 | Ga0207668_10609087 | Ga0207668_106090872 | 239 |
| 774 | 3300025981 | Ga0207640_10013350 | Ga0207640_100133502 | 239 |
| 775 | 3300025986 | Ga0207658_10000629 | Ga0207658_1000062911 | 239 |
| 776 | 3300025986 | Ga0207658_10007220 | Ga0207658_100072204 | 239 |
| 777 | 3300025986 | Ga0207658_10043522 | Ga0207658_100435223 | 239 |
| 778 | 3300025986 | Ga0207658_10089862 | Ga0207658_100898622 | 239 |
| 779 | 3300025986 | Ga0207658_10354041 | Ga0207658_103540412 | 239 |
| 780 | 3300025986 | Ga0207658_10533985 | Ga0207658_105339851 | 239 |
| 781 | 3300026023 | Ga0207677_10005907 | Ga0207677_100059076 | 239 |
| 782 | 3300026023 | Ga0207677_10119659 | Ga0207677_101196593 | 239 |
| 783 | 3300026023 | Ga0207677_10132512 | Ga0207677_101325122 | 239 |
| 784 | 3300026023 | Ga0207677_10133440 | Ga0207677_101334402 | 239 |
| 785 | 3300026023 | Ga0207677_10133809 | Ga0207677_101338092 | 239 |
| 786 | 3300026023 | Ga0207677_10422919 | Ga0207677_104229191 | 239 |
| 787 | 3300026023 | Ga0207677_10483752 | Ga0207677_104837522 | 239 |
| 788 | 3300026023 | Ga0207677_10736357 | Ga0207677_107363571 | 239 |
| 789 | 3300026035 | Ga0207703_10004145 | Ga0207703_1000414511 | 239 |
| 790 | 3300026035 | Ga0207703_10009241 | Ga0207703_100092416 | 239 |
| 791 | 3300026035 | Ga0207703_10103200 | Ga0207703_101032003 | 239 |
| 792 | 3300026035 | Ga0207703_10231510 | Ga0207703_102315102 | 239 |
| 793 | 3300026035 | Ga0207703_10331517 | Ga0207703_103315172 | 239 |
| 794 | 3300026035 | Ga0207703_10335318 | Ga0207703_103353182 | 239 |
| 795 | 3300026041 | Ga0207639_10012262 | Ga0207639_100122627 | 239 |
| 796 | 3300026041 | Ga0207639_10042141 | Ga0207639_100421413 | 239 |
| 797 | 3300026041 | Ga0207639_10045458 | Ga0207639_100454581 | 239 |
| 798 | 3300026041 | Ga0207639_10112154 | Ga0207639_101121542 | 239 |
| 799 | 3300026041 | Ga0207639_10425988 | Ga0207639_104259882 | 239 |
| 800 | 3300026041 | Ga0207639_10737766 | Ga0207639_107377661 | 239 |
| 801 | 3300026067 | Ga0207678_10177411 | Ga0207678_101774112 | 239 |
| 802 | 3300026067 | Ga0207678_10209599 | Ga0207678_102095991 | 239 |
| 803 | 3300026075 | Ga0207708_10031445 | Ga0207708_100314453 | 239 |
| 804 | 3300026078 | Ga0207702_10662725 | Ga0207702_106627252 | 239 |
| 805 | 3300026078 | Ga0207702_10823524 | Ga0207702_108235241 | 239 |
| 806 | 3300026088 | Ga0207641_10000048 | Ga0207641_10000048141 | 239 |
| 807 | 3300026088 | Ga0207641_10000253 | Ga0207641_1000025314 | 239 |
| 808 | 3300026088 | Ga0207641_10014740 | Ga0207641_100147402 | 239 |
| 809 | 3300026088 | Ga0207641_10092372 | Ga0207641_100923723 | 239 |
| 810 | 3300026088 | Ga0207641_10323166 | Ga0207641_103231661 | 239 |
| 811 | 3300026088 | Ga0207641_10464825 | Ga0207641_104648252 | 239 |
| 812 | 3300026089 | Ga0207648_10001276 | Ga0207648_1000127612 | 239 |
| 813 | 3300026089 | Ga0207648_10002983 | Ga0207648_1000298312 | 239 |
| 814 | 3300026089 | Ga0207648_10046709 | Ga0207648_100467093 | 239 |
| 815 | 3300026089 | Ga0207648_10127146 | Ga0207648_101271463 | 239 |
| 816 | 3300026089 | Ga0207648_10129143 | Ga0207648_101291432 | 239 |
| 817 | 3300026089 | Ga0207648_10215866 | Ga0207648_102158662 | 239 |
| 818 | 3300026095 | Ga0207676_10002535 | Ga0207676_1000253511 | 239 |
| 819 | 3300026095 | Ga0207676_10013593 | Ga0207676_100135932 | 239 |
| 820 | 3300026095 | Ga0207676_10148146 | Ga0207676_101481462 | 239 |
| 821 | 3300026095 | Ga0207676_10184364 | Ga0207676_101843642 | 239 |
| 822 | 3300026095 | Ga0207676_10501915 | Ga0207676_105019152 | 239 |
| 823 | 3300026116 | Ga0207674_10027023 | Ga0207674_100270234 | 239 |
| 824 | 3300026116 | Ga0207674_10047001 | Ga0207674_100470015 | 239 |
| 825 | 3300026116 | Ga0207674_10184015 | Ga0207674_101840151 | 239 |
| 826 | 3300026116 | Ga0207674_10463346 | Ga0207674_104633462 | 239 |
| 827 | 3300026118 | Ga0207675_100011688 | Ga0207675_1000116882 | 239 |
| 828 | 3300026118 | Ga0207675_100086055 | Ga0207675_1000860553 | 239 |
| 829 | 3300026118 | Ga0207675_100534232 | Ga0207675_1005342321 | 239 |
| 830 | 3300026121 | Ga0207683_10021593 | Ga0207683_100215935 | 239 |
| 831 | 3300026121 | Ga0207683_10344952 | Ga0207683_103449522 | 239 |
| 832 | 3300026142 | Ga0207698_10001674 | Ga0207698_100016747 | 239 |
| 833 | 3300026142 | Ga0207698_10004963 | Ga0207698_100049636 | 239 |
| 834 | 3300026142 | Ga0207698_10066040 | Ga0207698_100660402 | 239 |
| 835 | 3300026142 | Ga0207698_10181912 | Ga0207698_101819122 | 239 |
| 836 | 3300026142 | Ga0207698_10385425 | Ga0207698_103854252 | 239 |
| 837 | 3300026142 | Ga0207698_10716631 | Ga0207698_107166312 | 239 |
| 838 | 3300027907 | Ga0207428_10422732 | Ga0207428_104227321 | 239 |
| 839 | 3300028379 | Ga0268266_10000038 | Ga0268266_1000003834 | 239 |
| 840 | 3300028379 | Ga0268266_10004818 | Ga0268266_1000481810 | 239 |
| 841 | 3300028381 | Ga0268264_10000167 | Ga0268264_10000167117 | 239 |
| 842 | 3300028381 | Ga0268264_10001271 | Ga0268264_1000127114 | 239 |
| 843 | 3300028381 | Ga0268264_10017828 | Ga0268264_100178284 | 239 |
| 844 | 3300028381 | Ga0268264_10056056 | Ga0268264_100560562 | 239 |
| 845 | 3300028786 | Ga0307517_10009245 | Ga0307517_1000924510 | 239 |
| 846 | 3300028794 | Ga0307515_10000072 | Ga0307515_1000007250 | 239 |
| 847 | 3300030521 | Ga0307511_10003621 | Ga0307511_100036213 | 239 |
| 848 | 3300031456 | Ga0307513_10233026 | Ga0307513_102330262 | 239 |
| 849 | 3300031507 | Ga0307509_10030533 | Ga0307509_100305332 | 239 |
| 850 | 3300031507 | Ga0307509_10061200 | Ga0307509_100612003 | 239 |
| 851 | 3300031548 | Ga0307408_100756664 | Ga0307408_1007566641 | 239 |
| 852 | 3300031616 | Ga0307508_10002859 | Ga0307508_100028592 | 239 |
| 853 | 3300031616 | Ga0307508_10266846 | Ga0307508_102668462 | 239 |
| 854 | 3300031730 | Ga0307516_10001231 | Ga0307516_100012311 | 239 |
| 855 | 3300031824 | Ga0307413_10049606 | Ga0307413_100496062 | 239 |
| 856 | 3300031852 | Ga0307410_10023713 | Ga0307410_100237132 | 239 |
| 857 | 3300031911 | Ga0307412_10072787 | Ga0307412_100727872 | 239 |
| 858 | 3300032002 | Ga0307416_100113769 | Ga0307416_1001137692 | 239 |
| 859 | 3300032004 | Ga0307414_10224178 | Ga0307414_102241782 | 239 |
| 860 | 3300032005 | Ga0307411_10104084 | Ga0307411_101040842 | 239 |
| 861 | 3300032126 | Ga0307415_100021613 | Ga0307415_1000216132 | 239 |
| 862 | 3300033180 | Ga0307510_10000528 | Ga0307510_1000052825 | 239 |
| 863 | 3300033180 | Ga0307510_10135555 | Ga0307510_101355552 | 239 |
| 864 | 3300037471 | Ga0395905_0232234 | Ga0395905_0232234_959_1687 | 239 |
| 865 | 3300041406 | Ga0439439_0012499 | Ga0439439_0012499_1084_1803 | 239 |
| 866 | 3300041413 | Ga0439465_0021139 | Ga0439465_0021139_702_1421 | 239 |
| 867 | 3300041512 | Ga0451853_2959559 | Ga0451853_2959559_107_826 | 239 |
| 868 | 3300041512 | Ga0451853_4098937 | Ga0451853_4098937_221_940 | 239 |
| 869 | 3300042004 | Ga0439445_0003921 | Ga0439445_0003921_1835_2584 | 239 |
| 870 | 3300042007 | Ga0439449_0030282 | Ga0439449_0030282_778_1497 | 239 |
| 871 | 3300042011 | Ga0439454_018308 | Ga0439454_018308_102_821 | 239 |
| 872 | 3300042125 | Ga0450923_058260 | Ga0450923_058260_38_757 | 239 |
| 873 | 3300042133 | Ga0450896_017370 | Ga0450896_017370_124_843 | 239 |
| 874 | 3300042134 | Ga0450898_002673 | Ga0450898_002673_33_752 | 239 |
| 875 | 3300042435 | Ga0439434_0022823 | Ga0439434_0022823_780_1499 | 239 |
| 876 | 3300042532 | Ga0450893_0031840 | Ga0450893_0031840_86_805 | 239 |
| 877 | 3300044658 | Ga0466972_0138714 | Ga0466972_0138714_187_906 | 239 |
| 878 | 3300044693 | Ga0466961_0025984 | Ga0466961_0025984_359_1078 | 239 |
| 879 | 3300045049 | Ga0466959_0004213 | Ga0466959_0004213_7492_8217 | 239 |
| 880 | 3300045049 | Ga0466959_0014943 | Ga0466959_0014943_2325_3044 | 239 |
| 881 | 3300045836 | Ga0466958_0066685 | Ga0466958_0066685_260_985 | 239 |
| 882 | 3300045976 | Ga0466967_0107825 | Ga0466967_0107825_1120_1839 | 239 |
| 883 | 3300045976 | Ga0466967_0175518 | Ga0466967_0175518_36_755 | 239 |
| 884 | 3300046453 | Ga0495627_002875 | Ga0495627_002875_900_1619 | 239 |
| 885 | 3300046460 | Ga0495638_0129567 | Ga0495638_0129567_258_977 | 239 |
| 886 | 3300046472 | Ga0495580_0159903 | Ga0495580_0159903_642_1361 | 239 |
| 887 | 3300046475 | Ga0495639_0133904 | Ga0495639_0133904_419_1138 | 239 |
| 888 | 3300046507 | Ga0495606_0017959 | Ga0495606_0017959_3110_3829 | 239 |
| 889 | 3300046517 | Ga0495630_0140407 | Ga0495630_0140407_1067_1786 | 239 |
| 890 | 3300046517 | Ga0495630_0224691 | Ga0495630_0224691_244_963 | 239 |
| 891 | 3300046524 | Ga0495648_0122239 | Ga0495648_0122239_137_856 | 239 |
| 892 | 3300046537 | Ga0495598_0084955 | Ga0495598_0084955_54_773 | 239 |
| 893 | 3300046539 | Ga0495621_0083863 | Ga0495621_0083863_453_1172 | 239 |
| 894 | 3300046558 | Ga0495633_0000005 | Ga0495633_0000005_191812_192531 | 239 |
| 895 | 3300046648 | Ga0495611_0000278 | Ga0495611_0000278_10209_10928 | 239 |
| 896 | 3300047320 | Ga0495672_0020115 | Ga0495672_0020115_2118_2837 | 239 |
| 897 | 3300047320 | Ga0495672_0060891 | Ga0495672_0060891_1060_1779 | 239 |
| 898 | 3300047321 | Ga0495676_0085516 | Ga0495676_0085516_538_1257 | 239 |
| 899 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_500231_500950 | 239 |
| 900 | 3300047472 | Ga0495686_0194672 | Ga0495686_0194672_224_943 | 239 |
| 901 | 3300048912 | Ga0496109_0071641 | Ga0496109_0071641_640_1359 | 239 |
| 902 | 3300048924 | Ga0496121_0000020 | Ga0496121_0000020_34_753 | 239 |
| 903 | 3300048924 | Ga0496121_0482897 | Ga0496121_0482897_49_768 | 239 |
| 904 | 3300048928 | Ga0496125_0259894 | Ga0496125_0259894_247_966 | 239 |
| 905 | 3300048929 | Ga0496126_0007895 | Ga0496126_0007895_9897_10616 | 239 |
| 906 | 3300049515 | Ga0501292_001056 | Ga0501292_001056_1491_2210 | 239 |
| 907 | 3300049521 | Ga0501298_000064 | Ga0501298_000064_3121_3840 | 239 |
| 908 | 3300049569 | Ga0501032_0049879 | Ga0501032_0049879_1048_1767 | 239 |
| 909 | 3300049571 | Ga0501034_0091347 | Ga0501034_0091347_2040_2759 | 239 |
| 910 | 3300049571 | Ga0501034_0173582 | Ga0501034_0173582_682_1401 | 239 |
| 911 | 3300049571 | Ga0501034_0333990 | Ga0501034_0333990_574_1293 | 239 |
| 912 | 3300049572 | Ga0501036_0054709 | Ga0501036_0054709_2534_3253 | 239 |
| 913 | 3300049573 | Ga0501037_0007406 | Ga0501037_0007406_2887_3606 | 239 |
| 914 | 3300049573 | Ga0501037_0163701 | Ga0501037_0163701_628_1350 | 239 |
| 915 | 3300049575 | Ga0501039_0082677 | Ga0501039_0082677_595_1314 | 239 |
| 916 | 3300049575 | Ga0501039_0181995 | Ga0501039_0181995_391_1110 | 239 |
| 917 | 3300049579 | Ga0501043_0060404 | Ga0501043_0060404_96_815 | 239 |
| 918 | 3300049579 | Ga0501043_0149539 | Ga0501043_0149539_307_1029 | 239 |
| 919 | 3300049580 | Ga0501046_0010399 | Ga0501046_0010399_749_1468 | 239 |
| 920 | 3300049580 | Ga0501046_0327802 | Ga0501046_0327802_286_1005 | 239 |
| 921 | 3300049580 | Ga0501046_0365587 | Ga0501046_0365587_120_842 | 239 |
| 922 | 3300049581 | Ga0501047_0053692 | Ga0501047_0053692_96_815 | 239 |
| 923 | 3300049582 | Ga0501048_0069252 | Ga0501048_0069252_1370_2089 | 239 |
| 924 | 3300049583 | Ga0501067_0123912 | Ga0501067_0123912_64_783 | 239 |
| 925 | 3300049583 | Ga0501067_0172694 | Ga0501067_0172694_251_970 | 239 |
| 926 | 3300049585 | Ga0501069_0145123 | Ga0501069_0145123_224_943 | 239 |
| 927 | 3300049586 | Ga0501070_0096581 | Ga0501070_0096581_1290_2009 | 239 |
| 928 | 3300049588 | Ga0501072_0530928 | Ga0501072_0530928_90_809 | 239 |
| 929 | 3300049589 | Ga0501073_0004845 | Ga0501073_0004845_1976_2695 | 239 |
| 930 | 3300049589 | Ga0501073_0193939 | Ga0501073_0193939_367_1086 | 239 |
| 931 | 3300049590 | Ga0501074_0065938 | Ga0501074_0065938_1798_2517 | 239 |
| 932 | 3300049651 | Ga0501201_000527 | Ga0501201_000527_1378_2097 | 239 |
| 933 | 3300049652 | Ga0501202_000744 | Ga0501202_000744_3208_3927 | 239 |
| 934 | 3300049652 | Ga0501202_008310 | Ga0501202_008310_749_1468 | 239 |
| 935 | 3300049653 | Ga0501206_000832 | Ga0501206_000832_1259_1978 | 239 |
| 936 | 3300049654 | Ga0501207_004627 | Ga0501207_004627_155_874 | 239 |
| 937 | 3300049661 | Ga0501217_000216 | Ga0501217_000216_6249_6968 | 239 |
| 938 | 3300049662 | Ga0501222_002054 | Ga0501222_002054_1396_2115 | 239 |
| 939 | 3300049664 | Ga0501224_003158 | Ga0501224_003158_466_1185 | 239 |
| 940 | 3300049665 | Ga0501227_010002 | Ga0501227_010002_1226_1945 | 239 |
| 941 | 3300049669 | Ga0501235_000267 | Ga0501235_000267_3557_4276 | 239 |
| 942 | 3300049671 | Ga0501238_018655 | Ga0501238_018655_83_805 | 239 |
| 943 | 3300049674 | Ga0501242_000198 | Ga0501242_000198_3173_3892 | 239 |
| 944 | 3300049674 | Ga0501242_002573 | Ga0501242_002573_404_1123 | 239 |
| 945 | 3300049675 | Ga0501243_002944 | Ga0501243_002944_1144_1863 | 239 |
| 946 | 3300049680 | Ga0501250_007642 | Ga0501250_007642_230_949 | 239 |
| 947 | 3300049682 | Ga0501252_000167 | Ga0501252_000167_294_1013 | 239 |
| 948 | 3300049683 | Ga0501253_001083 | Ga0501253_001083_1425_2144 | 239 |
| 949 | 3300049686 | Ga0501257_022523 | Ga0501257_022523_675_1394 | 239 |
| 950 | 3300049689 | Ga0501260_003704 | Ga0501260_003704_506_1225 | 239 |
| 951 | 3300049690 | Ga0501261_000281 | Ga0501261_000281_4528_5247 | 239 |
| 952 | 3300049704 | Ga0501221_001294 | Ga0501221_001294_914_1633 | 239 |
| 953 | 3300049705 | Ga0501225_0005062 | Ga0501225_0005062_3113_3832 | 239 |
| 954 | 3300049705 | Ga0501225_0005570 | Ga0501225_0005570_1622_2341 | 239 |
| 955 | 3300049707 | Ga0501234_004702 | Ga0501234_004702_805_1524 | 239 |
| 956 | 3300049708 | Ga0501245_000671 | Ga0501245_000671_606_1325 | 239 |
| 957 | 3300049741 | Ga0501079_0212590 | Ga0501079_0212590_471_1190 | 239 |
| 958 | 3300049742 | Ga0501080_0022014 | Ga0501080_0022014_1981_2700 | 239 |
| 959 | 3300049742 | Ga0501080_0564532 | Ga0501080_0564532_19_738 | 239 |
| 960 | 3300049744 | Ga0501083_0068438 | Ga0501083_0068438_858_1577 | 239 |
| 961 | 3300049763 | Ga0501266_002278 | Ga0501266_002278_1118_1837 | 239 |
| 962 | 3300049822 | Ga0501035_0032518 | Ga0501035_0032518_788_1507 | 239 |
| 963 | 3300049822 | Ga0501035_0548247 | Ga0501035_0548247_92_811 | 239 |
| 964 | 3300050493 | nmdc:mga0k408_37004_c1 | nmdc:mga0k408_37004_c1_573_1292 | 239 |
| 965 | 3300050493 | nmdc:mga0k408_6193_c1 | nmdc:mga0k408_6193_c1_4521_5240 | 239 |
| 966 | 3300050508 | nmdc:mga09592_20389_c1 | nmdc:mga09592_20389_c1_612_1331 | 239 |
| 967 | 3300050509 | nmdc:mga0qj67_178793_c1 | nmdc:mga0qj67_178793_c1_398_1117 | 239 |
| 968 | 3300050509 | nmdc:mga0qj67_37014_c1 | nmdc:mga0qj67_37014_c1_2774_3493 | 239 |
| 969 | 3300050511 | nmdc:mga08y16_305799_c1 | nmdc:mga08y16_305799_c1_98_817 | 239 |
| 970 | 3300050511 | nmdc:mga08y16_439882_c1 | nmdc:mga08y16_439882_c1_111_830 | 239 |
| 971 | 3300053088 | Ga0500644_0000184 | Ga0500644_0000184_29592_30311 | 239 |
| 972 | 3300053090 | Ga0500646_0015258 | Ga0500646_0015258_1016_1735 | 239 |
| 973 | 3300053090 | Ga0500646_0016948 | Ga0500646_0016948_887_1606 | 239 |
| 974 | 3300053092 | Ga0500583_0004533 | Ga0500583_0004533_1661_2380 | 239 |
| 975 | 3300053092 | Ga0500583_0005677 | Ga0500583_0005677_3295_4014 | 239 |
| 976 | 3300053093 | Ga0500651_0019215 | Ga0500651_0019215_1698_2417 | 239 |
| 977 | 3300053093 | Ga0500651_0109110 | Ga0500651_0109110_295_1014 | 239 |
| 978 | 3300053109 | Ga0500569_000886 | Ga0500569_000886_3849_4568 | 239 |
| 979 | 3300053118 | Ga0500594_0035071 | Ga0500594_0035071_265_984 | 239 |
| 980 | 3300053131 | Ga0500652_000909 | Ga0500652_000909_3679_4479 | 239 |
| 981 | 3300053139 | Ga0500568_0011377 | Ga0500568_0011377_2484_3203 | 239 |
| 982 | 3300053139 | Ga0500568_0078890 | Ga0500568_0078890_337_1056 | 239 |
| 983 | 3300053142 | Ga0500577_0001440 | Ga0500577_0001440_4458_5177 | 239 |
| 984 | 3300053153 | Ga0500616_0009438 | Ga0500616_0009438_888_1607 | 239 |
| 985 | 3300053156 | Ga0500622_0001887 | Ga0500622_0001887_3748_4467 | 239 |
| 986 | 3300053156 | Ga0500622_0009069 | Ga0500622_0009069_1160_1879 | 239 |
| 987 | 3300053160 | Ga0500633_0013134 | Ga0500633_0013134_963_1682 | 239 |
| 988 | 3300053727 | Ga0500611_000022 | Ga0500611_000022_73829_74548 | 239 |
| 989 | 3300053732 | Ga0500656_004668 | Ga0500656_004668_199_918 | 239 |
| 990 | 3300054114 | Ga0501084_0082222 | Ga0501084_0082222_629_1348 | 239 |
| 991 | 3300061719 | Ga0466962_0028059 | Ga0466962_0028059_1856_2581 | 239 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cqo-assembly3.cif.gz_D | crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae (semet labeled), rim1 (form2) | 0.7191 | 151 | 181 |
| 4lgv-assembly1.cif.gz_B | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.672 | 151 | 178 |
| 5i4a-assembly2.cif.gz_C | x-ray crystal structure of marinitoga piezophila argonaute in complex with 5' oh guide rna | 0.6627 | 149 | 176 |
| 3pjq-assembly1.cif.gz_A | trypanosoma cruzi trans-sialidase-like inactive isoform (including the natural mutation tyr342his) in complex with lactose | 0.5933 | 151 | 181 |
| 5ux0-assembly2.cif.gz_D | x-ray crystal structure of marinitoga piezophila argonaute in complex with 5' oh guide rna and target dna | 0.5864 | 150 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0HSA0_2_92_1.20.58.90 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7416 | 16 | 115 | 1.20.58.90 |
| af_A0A0R0HSA0_2_92_1.20.58.90 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.6885 | 16 | 115 | 1.20.58.90 |
| af_Q24151_343_485_2.60.40.630 | Mainly Beta;Sandwich;Immunoglobulin-like;STAT transcription factor, DNA-binding domain | 0.6652 | 152 | 174 | 2.60.40.630 |
| af_Q9ZQ60_46_277_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6541 | 152 | 174 | 2.130.10.10 |
| af_E1JIM6_261_375_3.30.450.20 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain | 0.6337 | 152 | 178 | 3.30.450.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4TG48-F1-model_v4 | Uncharacterized protein | 0.9758 | 137 | 235 |
|
| AF-A0A4Q3W8S8-F1-model_v4 | Uncharacterized protein | 0.968 | 108 | 239 |
|
| AF-A0A6J4TG48-F1-model_v4 | Uncharacterized protein | 0.9569 | 137 | 235 |
|
| AF-A0A4Q3W8S8-F1-model_v4 | Uncharacterized protein | 0.9403 | 108 | 239 |
|
| AF-A0A7C7BMF9-F1-model_v4 | Uncharacterized protein | 0.9318 | 151 | 237 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar