F487627
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 991 | 496 | 831 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10000901|Ga0065714_100009012 |
| Length | 280 |
| Sequence | MHFWSRHNRRQTHENNDIQDVIFEHSVNCPKPAPHHGDGGGIQPRTQRGYTVSVSLSRLERQLGYTFKDQELMVLALTHRSFAGRNNERLEFLGDAILNFVAGEALFDRFPLAREGXLSRLRARLVKGETLAVLARGFDLGEYLRLGSGELKSGGFRRESILADALEALIGAIYLDAGMDMARERVLAWLAGEFEGLTLVDTNKDPKTRLQEFLQSRGCELPRYEVVDIQGEPHCRTFFVECEITLLNEKSRGQGVSRRIAEQVAAAAALIALGVENGHD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 4 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 5 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 6 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 7 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 8 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 9 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 10 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 11 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 12 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 13 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 14 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 15 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 16 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 17 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 18 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 19 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 20 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 21 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 22 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 23 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 24 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 25 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 26 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 27 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 28 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 29 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 30 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 31 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 32 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 33 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 34 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 35 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 36 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 37 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 38 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 39 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 40 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 41 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 42 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 43 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 44 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 45 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 46 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 47 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 48 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 49 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 50 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 51 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 52 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 53 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 54 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 55 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 56 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 57 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 58 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 59 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 60 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 61 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 62 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 63 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 64 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 65 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 66 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 67 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 68 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 69 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 70 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 71 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 72 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 73 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 74 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 75 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 76 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 77 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 78 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 79 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 80 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 81 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 82 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 83 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 84 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 85 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 86 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 87 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 88 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 89 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 90 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 91 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 92 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 93 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 94 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 95 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 96 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 97 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 98 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 99 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 100 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 101 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 102 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 103 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 104 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 105 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 106 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 107 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 108 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 109 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 110 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 111 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 112 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 113 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 114 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 115 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 116 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 117 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 118 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 119 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 120 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 121 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 122 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 123 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 124 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 125 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 126 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 127 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 128 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 129 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 130 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 131 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 132 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 133 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 134 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 135 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 136 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 137 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 138 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 139 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 140 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 141 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 142 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 143 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 144 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 145 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 146 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 147 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 148 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 149 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 152 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 159 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 166 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 167 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 168 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 169 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 170 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 174 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 175 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 176 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 177 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 178 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 179 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 180 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 181 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 182 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 183 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 185 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 186 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 188 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 189 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 201 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 210 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 212 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 213 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 214 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 216 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 225 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 227 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 267 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 268 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 277 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 280 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 281 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 283 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 284 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 285 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 286 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 287 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 288 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 289 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 290 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 291 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 292 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 293 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 294 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 295 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 296 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 297 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 298 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 300 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 301 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 302 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 303 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 305 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 306 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 307 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 308 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 309 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 310 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 311 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 312 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 313 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 314 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 315 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 318 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 319 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 320 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 321 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 322 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 323 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 324 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 325 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 326 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 327 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 328 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 329 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 330 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 331 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 332 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 333 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 334 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 335 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 336 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 337 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 338 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 339 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 340 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 341 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 342 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 343 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 344 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 417 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 418 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 419 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 420 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 421 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 422 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 423 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 424 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 425 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 426 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 427 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 428 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 429 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 430 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 431 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 432 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 459 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 460 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 461 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 463 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 465 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 466 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 467 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 469 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 470 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 471 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 472 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 473 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 474 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 475 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 476 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 477 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 478 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 479 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 480 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 481 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 482 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 483 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 484 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 485 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 486 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 487 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 488 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 489 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 490 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 491 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 492 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 493 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 494 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 495 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 496 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.35 |
| Metatranscriptomes | 0.5 |
| Isolates | 16.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 4.04 |
| Nodule | 1.11 |
| Rhizoplane | 3.23 |
| Rhizosphere | 77.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_171 | 2124908027 | Bacteria | 22045 |
| 2 | SwRhRL2b_contig_836207 | 2162886007 | Bacteria | 1203 |
| 3 | JGI25162J39368_1000126 | 3300002737 | Bacteria | 84404 |
| 4 | JGI25164J39214_1000100 | 3300002772 | Bacteria | 84404 |
| 5 | JGI25165J46597_1000207 | 3300003214 | Bacteria | 84404 |
| 6 | Ga0055539_1000039 | 3300003752 | Bacteria | 203858 |
| 7 | Ga0055533_1000049 | 3300003756 | Bacteria | 203858 |
| 8 | Ga0055532_1000049 | 3300003758 | Bacteria | 174079 |
| 9 | Ga0055525_1000077 | 3300003759 | Bacteria | 166608 |
| 10 | Ga0055536_1005866 | 3300003781 | Bacteria | 5893 |
| 11 | Ga0055536_1016124 | 3300003781 | Bacteria | 2516 |
| 12 | Ga0055530_10003906 | 3300003791 | Bacteria | 8114 |
| 13 | Ga0055540_1001086 | 3300003792 | Bacteria | 17251 |
| 14 | Ga0055540_1002667 | 3300003792 | Bacteria | 9212 |
| 15 | Ga0055541_1000026 | 3300003841 | Bacteria | 203858 |
| 16 | Ga0058692_1014272 | 3300003856 | Bacteria | 1825 |
| 17 | Ga0065714_10000901 | 3300005288 | Bacteria | 2139 |
| 18 | Ga0065714_10004098 | 3300005288 | Bacteria | 9895 |
| 19 | Ga0065714_10007073 | 3300005288 | Bacteria | 3007 |
| 20 | Ga0065704_10082904 | 3300005289 | Bacteria | 3536 |
| 21 | Ga0065704_10083049 | 3300005289 | Bacteria | 3515 |
| 22 | Ga0065704_10110576 | 3300005289 | Bacteria | 1970 |
| 23 | Ga0065712_10000436 | 3300005290 | Bacteria | 11353 |
| 24 | Ga0065712_10067895 | 3300005290 | Bacteria | 22221 |
| 25 | Ga0070670_100039675 | 3300005331 | Bacteria | 4048 |
| 26 | Ga0070670_100061804 | 3300005331 | Bacteria | 3215 |
| 27 | Ga0070677_10008755 | 3300005333 | Bacteria | 3415 |
| 28 | Ga0070682_100112133 | 3300005337 | Bacteria | 1819 |
| 29 | Ga0070682_100137545 | 3300005337 | Bacteria | 1661 |
| 30 | Ga0070661_100187131 | 3300005344 | Bacteria | 1578 |
| 31 | Ga0070668_100079640 | 3300005347 | Bacteria | 2565 |
| 32 | Ga0070669_100000292 | 3300005353 | Bacteria | 39324 |
| 33 | Ga0070669_100002278 | 3300005353 | Bacteria | 13917 |
| 34 | Ga0070669_100106952 | 3300005353 | Bacteria | 2118 |
| 35 | Ga0070675_100004279 | 3300005354 | Bacteria | 10872 |
| 36 | Ga0070675_100029716 | 3300005354 | Bacteria | 4409 |
| 37 | Ga0070675_100266241 | 3300005354 | Bacteria | 1503 |
| 38 | Ga0070675_100438502 | 3300005354 | Bacteria | 1170 |
| 39 | Ga0070674_100024236 | 3300005356 | Bacteria | 3936 |
| 40 | Ga0070674_100065806 | 3300005356 | Bacteria | 2545 |
| 41 | Ga0070673_100010143 | 3300005364 | Bacteria | 6361 |
| 42 | Ga0070688_100035678 | 3300005365 | Bacteria | 3021 |
| 43 | Ga0070659_100859398 | 3300005366 | Bacteria | 791 |
| 44 | Ga0070705_100284555 | 3300005440 | Bacteria | 1177 |
| 45 | Ga0070700_100230606 | 3300005441 | Bacteria | 1317 |
| 46 | Ga0070663_100540934 | 3300005455 | Bacteria | 972 |
| 47 | Ga0070678_100068023 | 3300005456 | Bacteria | 2654 |
| 48 | Ga0070678_100079035 | 3300005456 | Bacteria | 2486 |
| 49 | Ga0070662_100000560 | 3300005457 | Bacteria | 22585 |
| 50 | Ga0070662_100321900 | 3300005457 | Bacteria | 1261 |
| 51 | Ga0070681_10301329 | 3300005458 | Bacteria | 1512 |
| 52 | Ga0068867_100141430 | 3300005459 | Bacteria | 1881 |
| 53 | Ga0070685_10023831 | 3300005466 | Bacteria | 3355 |
| 54 | Ga0070685_10053201 | 3300005466 | Bacteria | 2345 |
| 55 | Ga0070685_10183733 | 3300005466 | Bacteria | 1348 |
| 56 | Ga0070679_100081979 | 3300005530 | Bacteria | 3216 |
| 57 | Ga0068853_100006406 | 3300005539 | Bacteria | 9353 |
| 58 | Ga0070672_100005085 | 3300005543 | Bacteria | 8679 |
| 59 | Ga0070672_100068414 | 3300005543 | Bacteria | 2816 |
| 60 | Ga0070672_100089962 | 3300005543 | Bacteria | 2474 |
| 61 | Ga0070672_100229971 | 3300005543 | Bacteria | 1557 |
| 62 | Ga0070665_100002619 | 3300005548 | Bacteria | 19629 |
| 63 | Ga0070664_100030848 | 3300005564 | Bacteria | 4474 |
| 64 | Ga0070664_100641769 | 3300005564 | Bacteria | 986 |
| 65 | Ga0068854_100004163 | 3300005578 | Bacteria | 9096 |
| 66 | Ga0068859_100067363 | 3300005617 | Bacteria | 3615 |
| 67 | Ga0068859_100233488 | 3300005617 | Bacteria | 1928 |
| 68 | Ga0068859_100862854 | 3300005617 | Bacteria | 991 |
| 69 | Ga0068864_100642716 | 3300005618 | Bacteria | 1032 |
| 70 | Ga0068861_100287238 | 3300005719 | Bacteria | 1419 |
| 71 | Ga0068851_10000006 | 3300005834 | Bacteria | 258116 |
| 72 | Ga0068870_10003293 | 3300005840 | Bacteria | 6825 |
| 73 | Ga0068863_100375408 | 3300005841 | Bacteria | 1388 |
| 74 | Ga0068862_100240770 | 3300005844 | Bacteria | 1645 |
| 75 | Ga0068862_100420169 | 3300005844 | Bacteria | 1254 |
| 76 | Ga0075364_10121181 | 3300006051 | Bacteria | 1751 |
| 77 | Ga0075432_10049305 | 3300006058 | Bacteria | 1483 |
| 78 | Ga0097621_100551519 | 3300006237 | Bacteria | 1049 |
| 79 | Ga0068871_100097715 | 3300006358 | Bacteria | 2455 |
| 80 | Ga0068865_100161982 | 3300006881 | Bacteria | 1707 |
| 81 | Ga0068865_100232472 | 3300006881 | Bacteria | 1447 |
| 82 | Ga0097620_100067364 | 3300006931 | Bacteria | 3615 |
| 83 | Ga0097620_100233478 | 3300006931 | Bacteria | 1928 |
| 84 | Ga0097620_100328601 | 3300006931 | Bacteria | 1623 |
| 85 | Ga0097620_100862849 | 3300006931 | Bacteria | 991 |
| 86 | Ga0099823_1000054 | 3300006944 | Bacteria | 55085 |
| 87 | Ga0079104_1000917 | 3300006946 | Bacteria | 23727 |
| 88 | Ga0105251_10000004 | 3300009011 | Bacteria | 285212 |
| 89 | Ga0105251_10000149 | 3300009011 | Bacteria | 71244 |
| 90 | Ga0105251_10000935 | 3300009011 | Bacteria | 26139 |
| 91 | Ga0105251_10006259 | 3300009011 | Bacteria | 7629 |
| 92 | Ga0105251_10008504 | 3300009011 | Bacteria | 6165 |
| 93 | Ga0105251_10013238 | 3300009011 | Bacteria | 4624 |
| 94 | Ga0105251_10072706 | 3300009011 | Bacteria | 1598 |
| 95 | Ga0105251_10092040 | 3300009011 | Bacteria | 1392 |
| 96 | Ga0105251_10163534 | 3300009011 | Bacteria | 1003 |
| 97 | Ga0105251_10271248 | 3300009011 | Bacteria | 766 |
| 98 | Ga0105244_10000031 | 3300009036 | Bacteria | 177606 |
| 99 | Ga0105244_10000922 | 3300009036 | Bacteria | 24861 |
| 100 | Ga0105244_10004903 | 3300009036 | Bacteria | 9067 |
| 101 | Ga0105244_10006728 | 3300009036 | Bacteria | 7395 |
| 102 | Ga0105244_10010706 | 3300009036 | Bacteria | 5544 |
| 103 | Ga0105244_10015168 | 3300009036 | Bacteria | 4426 |
| 104 | Ga0105244_10016206 | 3300009036 | Bacteria | 4252 |
| 105 | Ga0105244_10025677 | 3300009036 | Bacteria | 3198 |
| 106 | Ga0105244_10030254 | 3300009036 | Bacteria | 2882 |
| 107 | Ga0105244_10047337 | 3300009036 | Bacteria | 2206 |
| 108 | Ga0105244_10054694 | 3300009036 | Bacteria | 2024 |
| 109 | Ga0105244_10063867 | 3300009036 | Bacteria | 1848 |
| 110 | Ga0105244_10087762 | 3300009036 | Bacteria | 1532 |
| 111 | Ga0105244_10279559 | 3300009036 | Bacteria | 774 |
| 112 | Ga0105244_10303763 | 3300009036 | Bacteria | 738 |
| 113 | Ga0105250_10000235 | 3300009092 | Bacteria | 46317 |
| 114 | Ga0105250_10003383 | 3300009092 | Bacteria | 7565 |
| 115 | Ga0105250_10004328 | 3300009092 | Bacteria | 6551 |
| 116 | Ga0105250_10024448 | 3300009092 | Bacteria | 2434 |
| 117 | Ga0105250_10042350 | 3300009092 | Bacteria | 1825 |
| 118 | Ga0105250_10077221 | 3300009092 | Bacteria | 1348 |
| 119 | Ga0105250_10079672 | 3300009092 | Bacteria | 1327 |
| 120 | Ga0105240_10019805 | 3300009093 | Bacteria | 8987 |
| 121 | Ga0105247_10000048 | 3300009101 | Bacteria | 150745 |
| 122 | Ga0105243_10001292 | 3300009148 | Bacteria | 22446 |
| 123 | Ga0105243_10001767 | 3300009148 | Bacteria | 18576 |
| 124 | Ga0105243_10039035 | 3300009148 | Bacteria | 3700 |
| 125 | Ga0105243_10064661 | 3300009148 | Bacteria | 2936 |
| 126 | Ga0105243_10206080 | 3300009148 | Bacteria | 1728 |
| 127 | Ga0105243_10542411 | 3300009148 | Bacteria | 1110 |
| 128 | Ga0105242_10000233 | 3300009176 | Bacteria | 43902 |
| 129 | Ga0105237_10000160 | 3300009545 | Bacteria | 95183 |
| 130 | Ga0105238_11323403 | 3300009551 | Bacteria | 747 |
| 131 | Ga0105249_10475853 | 3300009553 | Bacteria | 1291 |
| 132 | Ga0105246_10000822 | 3300011119 | Bacteria | 17660 |
| 133 | Ga0105246_10125641 | 3300011119 | Bacteria | 1908 |
| 134 | Ga0105246_10288591 | 3300011119 | Bacteria | 1319 |
| 135 | Ga0157345_1000347 | 3300012498 | Bacteria | 5414 |
| 136 | Ga0157373_10000473 | 3300013100 | Bacteria | 31857 |
| 137 | Ga0157373_10001605 | 3300013100 | Bacteria | 17261 |
| 138 | Ga0157373_10004828 | 3300013100 | Bacteria | 10143 |
| 139 | Ga0157373_10060224 | 3300013100 | Bacteria | 2690 |
| 140 | Ga0157373_10222780 | 3300013100 | Bacteria | 1331 |
| 141 | Ga0157373_10261841 | 3300013100 | Bacteria | 1224 |
| 142 | Ga0157373_10345603 | 3300013100 | Bacteria | 1061 |
| 143 | Ga0157371_10000460 | 3300013102 | Bacteria | 49750 |
| 144 | Ga0157371_10001529 | 3300013102 | Bacteria | 23814 |
| 145 | Ga0157371_10003068 | 3300013102 | Bacteria | 15502 |
| 146 | Ga0157371_10007535 | 3300013102 | Bacteria | 8798 |
| 147 | Ga0157371_10024923 | 3300013102 | Bacteria | 4365 |
| 148 | Ga0157371_10030541 | 3300013102 | Bacteria | 3887 |
| 149 | Ga0157371_10108493 | 3300013102 | Bacteria | 1970 |
| 150 | Ga0157371_10143168 | 3300013102 | Bacteria | 1703 |
| 151 | Ga0157370_10000572 | 3300013104 | Bacteria | 45922 |
| 152 | Ga0157370_10165536 | 3300013104 | Bacteria | 2056 |
| 153 | Ga0157370_10398975 | 3300013104 | Bacteria | 1266 |
| 154 | Ga0157369_10035640 | 3300013105 | Bacteria | 5453 |
| 155 | Ga0157369_10073948 | 3300013105 | Bacteria | 3655 |
| 156 | Ga0157369_10144236 | 3300013105 | Bacteria | 2518 |
| 157 | Ga0157369_10174391 | 3300013105 | Bacteria | 2264 |
| 158 | Ga0157369_10234656 | 3300013105 | Bacteria | 1917 |
| 159 | Ga0157369_10467425 | 3300013105 | Bacteria | 1306 |
| 160 | Ga0163162_10004406 | 3300013306 | Bacteria | 13546 |
| 161 | Ga0157372_10000815 | 3300013307 | Bacteria | 33774 |
| 162 | Ga0157372_10059115 | 3300013307 | Bacteria | 4287 |
| 163 | Ga0157372_10165575 | 3300013307 | Bacteria | 2556 |
| 164 | Ga0157372_10627579 | 3300013307 | Bacteria | 1252 |
| 165 | Ga0157375_10043888 | 3300013308 | Bacteria | 4338 |
| 166 | Ga0157375_10270891 | 3300013308 | Bacteria | 1860 |
| 167 | Ga0157380_10004215 | 3300014326 | Bacteria | 9944 |
| 168 | Ga0157380_10037459 | 3300014326 | Bacteria | 3758 |
| 169 | Ga0157380_10145508 | 3300014326 | Bacteria | 2042 |
| 170 | Ga0157380_10295877 | 3300014326 | Bacteria | 1488 |
| 171 | Ga0182008_10000570 | 3300014497 | Bacteria | 27277 |
| 172 | Ga0182008_10009461 | 3300014497 | Bacteria | 5257 |
| 173 | Ga0182008_10031014 | 3300014497 | Bacteria | 2693 |
| 174 | Ga0157376_10301049 | 3300014969 | Bacteria | 1518 |
| 175 | Ga0157376_10489937 | 3300014969 | Bacteria | 1206 |
| 176 | Ga0182006_1062988 | 3300015261 | Bacteria | 1394 |
| 177 | Ga0182006_1108278 | 3300015261 | Bacteria | 978 |
| 178 | Ga0182006_1115165 | 3300015261 | Bacteria | 940 |
| 179 | Ga0182007_10006004 | 3300015262 | Bacteria | 5264 |
| 180 | Ga0182005_1017434 | 3300015265 | Bacteria | 1988 |
| 181 | Ga0163161_10000005 | 3300017792 | Bacteria | 327860 |
| 182 | Ga0163161_10605337 | 3300017792 | Bacteria | 904 |
| 183 | Ga0209435_100669 | 3300025206 | Bacteria | 6033 |
| 184 | Ga0209784_100045 | 3300025224 | Bacteria | 203911 |
| 185 | Ga0209566_100057 | 3300025225 | Bacteria | 203960 |
| 186 | Ga0209674_100080 | 3300025226 | Bacteria | 203960 |
| 187 | Ga0209147_100079 | 3300025229 | Bacteria | 203960 |
| 188 | Ga0209563_100078 | 3300025230 | Bacteria | 203960 |
| 189 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 190 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 191 | Ga0209258_100178 | 3300025242 | Bacteria | 138843 |
| 192 | Ga0209646_1000311 | 3300025246 | Bacteria | 38501 |
| 193 | Ga0209677_100045 | 3300025253 | Bacteria | 203960 |
| 194 | Ga0209759_1003165 | 3300025256 | Bacteria | 6711 |
| 195 | Ga0209759_1006779 | 3300025256 | Bacteria | 3796 |
| 196 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 197 | Ga0209676_1000056 | 3300025292 | Bacteria | 361329 |
| 198 | Ga0209676_1000721 | 3300025292 | Bacteria | 45474 |
| 199 | Ga0209676_1004156 | 3300025292 | Bacteria | 8235 |
| 200 | Ga0209050_1000027 | 3300025298 | Bacteria | 483261 |
| 201 | Ga0209050_1000181 | 3300025298 | Bacteria | 142533 |
| 202 | Ga0209050_1002328 | 3300025298 | Bacteria | 16701 |
| 203 | Ga0209051_1000061 | 3300025303 | Bacteria | 253485 |
| 204 | Ga0209051_1000065 | 3300025303 | Bacteria | 231445 |
| 205 | Ga0209051_1023515 | 3300025303 | Bacteria | 2558 |
| 206 | Ga0207656_10000017 | 3300025321 | Bacteria | 117646 |
| 207 | Ga0207696_1000022 | 3300025711 | Bacteria | 427529 |
| 208 | Ga0207696_1000035 | 3300025711 | Bacteria | 339626 |
| 209 | Ga0207696_1000039 | 3300025711 | Bacteria | 324954 |
| 210 | Ga0207696_1000044 | 3300025711 | Bacteria | 300953 |
| 211 | Ga0207696_1003748 | 3300025711 | Bacteria | 6792 |
| 212 | Ga0207696_1003920 | 3300025711 | Bacteria | 6561 |
| 213 | Ga0207696_1015171 | 3300025711 | Bacteria | 2618 |
| 214 | Ga0207696_1037561 | 3300025711 | Bacteria | 1433 |
| 215 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 216 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 217 | Ga0207655_1000240 | 3300025728 | Bacteria | 90267 |
| 218 | Ga0207655_1000462 | 3300025728 | Bacteria | 53331 |
| 219 | Ga0207655_1001511 | 3300025728 | Bacteria | 21214 |
| 220 | Ga0207655_1002564 | 3300025728 | Bacteria | 14532 |
| 221 | Ga0207655_1003475 | 3300025728 | Bacteria | 11712 |
| 222 | Ga0207655_1004133 | 3300025728 | Bacteria | 10427 |
| 223 | Ga0207655_1010955 | 3300025728 | Bacteria | 5447 |
| 224 | Ga0207655_1012202 | 3300025728 | Bacteria | 5045 |
| 225 | Ga0207655_1015532 | 3300025728 | Bacteria | 4224 |
| 226 | Ga0207655_1022327 | 3300025728 | Bacteria | 3178 |
| 227 | Ga0207655_1036554 | 3300025728 | Bacteria | 2175 |
| 228 | Ga0207655_1050350 | 3300025728 | Bacteria | 1694 |
| 229 | Ga0207713_1000013 | 3300025735 | Bacteria | 475751 |
| 230 | Ga0207713_1000086 | 3300025735 | Bacteria | 157106 |
| 231 | Ga0207713_1000104 | 3300025735 | Bacteria | 138310 |
| 232 | Ga0207713_1000454 | 3300025735 | Bacteria | 42911 |
| 233 | Ga0207713_1003950 | 3300025735 | Bacteria | 9850 |
| 234 | Ga0207713_1005892 | 3300025735 | Bacteria | 7568 |
| 235 | Ga0207713_1011540 | 3300025735 | Bacteria | 4792 |
| 236 | Ga0207713_1024556 | 3300025735 | Bacteria | 2807 |
| 237 | Ga0207713_1031185 | 3300025735 | Bacteria | 2360 |
| 238 | Ga0207713_1039599 | 3300025735 | Bacteria | 1986 |
| 239 | Ga0207713_1072527 | 3300025735 | Bacteria | 1267 |
| 240 | Ga0207682_10000686 | 3300025893 | Bacteria | 15721 |
| 241 | Ga0207682_10006464 | 3300025893 | Bacteria | 4718 |
| 242 | Ga0207682_10042409 | 3300025893 | Bacteria | 1859 |
| 243 | Ga0207642_10282934 | 3300025899 | Bacteria | 955 |
| 244 | Ga0207710_10000026 | 3300025900 | Bacteria | 307644 |
| 245 | Ga0207643_10017116 | 3300025908 | Bacteria | 3958 |
| 246 | Ga0207643_10153430 | 3300025908 | Bacteria | 1382 |
| 247 | Ga0207707_10052767 | 3300025912 | Bacteria | 3538 |
| 248 | Ga0207707_10293602 | 3300025912 | Bacteria | 1406 |
| 249 | Ga0207695_10040478 | 3300025913 | Bacteria | 4995 |
| 250 | Ga0207693_10339662 | 3300025915 | Bacteria | 1175 |
| 251 | Ga0207663_10506160 | 3300025916 | Bacteria | 939 |
| 252 | Ga0207652_10034747 | 3300025921 | Bacteria | 4251 |
| 253 | Ga0207681_10000679 | 3300025923 | Bacteria | 22341 |
| 254 | Ga0207681_10027485 | 3300025923 | Bacteria | 3679 |
| 255 | Ga0207650_10000668 | 3300025925 | Bacteria | 26952 |
| 256 | Ga0207650_10001102 | 3300025925 | Bacteria | 19910 |
| 257 | Ga0207659_10008076 | 3300025926 | Bacteria | 6515 |
| 258 | Ga0207659_10023389 | 3300025926 | Bacteria | 4123 |
| 259 | Ga0207659_10128848 | 3300025926 | Bacteria | 1950 |
| 260 | Ga0207659_10322124 | 3300025926 | Bacteria | 1275 |
| 261 | Ga0207706_10001474 | 3300025933 | Bacteria | 23502 |
| 262 | Ga0207709_10028404 | 3300025935 | Bacteria | 3233 |
| 263 | Ga0207709_10034539 | 3300025935 | Bacteria | 2981 |
| 264 | Ga0207709_10077797 | 3300025935 | Bacteria | 2128 |
| 265 | Ga0207709_10616165 | 3300025935 | Bacteria | 861 |
| 266 | Ga0207670_10085861 | 3300025936 | Bacteria | 2213 |
| 267 | Ga0207669_10009009 | 3300025937 | Bacteria | 4723 |
| 268 | Ga0207669_10037715 | 3300025937 | Bacteria | 2775 |
| 269 | Ga0207669_10048097 | 3300025937 | Bacteria | 2531 |
| 270 | Ga0207704_10031354 | 3300025938 | Bacteria | 2993 |
| 271 | Ga0207704_10142299 | 3300025938 | Bacteria | 1680 |
| 272 | Ga0207691_10016948 | 3300025940 | Bacteria | 6913 |
| 273 | Ga0207691_10023826 | 3300025940 | Bacteria | 5761 |
| 274 | Ga0207689_10109731 | 3300025942 | Bacteria | 2267 |
| 275 | Ga0207679_10086668 | 3300025945 | Bacteria | 2409 |
| 276 | Ga0207651_10005709 | 3300025960 | Bacteria | 6424 |
| 277 | Ga0207668_10073304 | 3300025972 | Bacteria | 2453 |
| 278 | Ga0207668_10273018 | 3300025972 | Bacteria | 1383 |
| 279 | Ga0207640_10031633 | 3300025981 | Bacteria | 3272 |
| 280 | Ga0207639_10003002 | 3300026041 | Bacteria | 11354 |
| 281 | Ga0207678_10131305 | 3300026067 | Bacteria | 2137 |
| 282 | Ga0207678_10624398 | 3300026067 | Bacteria | 946 |
| 283 | Ga0207708_10023462 | 3300026075 | Bacteria | 4663 |
| 284 | Ga0207708_10124399 | 3300026075 | Bacteria | 2012 |
| 285 | Ga0207641_10077604 | 3300026088 | Bacteria | 2875 |
| 286 | Ga0207648_10268718 | 3300026089 | Bacteria | 1523 |
| 287 | Ga0207648_10606762 | 3300026089 | Bacteria | 1009 |
| 288 | Ga0207676_10601188 | 3300026095 | Bacteria | 1056 |
| 289 | Ga0207675_100068850 | 3300026118 | Bacteria | 3307 |
| 290 | Ga0207675_100327998 | 3300026118 | Bacteria | 1495 |
| 291 | Ga0207683_10039155 | 3300026121 | Bacteria | 4135 |
| 292 | Ga0207683_10127202 | 3300026121 | Bacteria | 2290 |
| 293 | Ga0207683_10710897 | 3300026121 | Bacteria | 932 |
| 294 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 295 | Ga0209389_1000002 | 3300027296 | Bacteria | 333932 |
| 296 | Ga0209371_1000239 | 3300027312 | Bacteria | 68842 |
| 297 | Ga0209371_1000253 | 3300027312 | Bacteria | 65388 |
| 298 | Ga0209371_1003222 | 3300027312 | Bacteria | 8190 |
| 299 | Ga0209371_1005194 | 3300027312 | Bacteria | 5287 |
| 300 | Ga0209995_1000414 | 3300027471 | Bacteria | 6643 |
| 301 | Ga0209968_1003561 | 3300027526 | Bacteria | 2335 |
| 302 | Ga0209999_1003846 | 3300027543 | Bacteria | 2699 |
| 303 | Ga0210002_1009337 | 3300027617 | Bacteria | 1497 |
| 304 | Ga0209983_1000325 | 3300027665 | Bacteria | 9954 |
| 305 | Ga0209971_1001262 | 3300027682 | Bacteria | 6315 |
| 306 | Ga0209974_10007126 | 3300027876 | Bacteria | 3864 |
| 307 | Ga0207428_10249763 | 3300027907 | Bacteria | 1323 |
| 308 | Ga0268266_10041404 | 3300028379 | Bacteria | 3930 |
| 309 | Ga0268265_10069157 | 3300028380 | Bacteria | 2741 |
| 310 | Ga0268256_1000199 | 3300030500 | Bacteria | 68849 |
| 311 | Ga0268256_1000367 | 3300030500 | Bacteria | 42860 |
| 312 | Ga0268256_1004916 | 3300030500 | Bacteria | 5392 |
| 313 | Ga0314311_1224394 | 3300030733 | Bacteria | 3180 |
| 314 | Ga0265339_10226017 | 3300031249 | Bacteria | 913 |
| 315 | Ga0265331_10156701 | 3300031250 | Bacteria | 1033 |
| 316 | Ga0307513_10007954 | 3300031456 | Bacteria | 13642 |
| 317 | Ga0307509_10008745 | 3300031507 | Bacteria | 12810 |
| 318 | Ga0307408_100000081 | 3300031548 | Bacteria | 106920 |
| 319 | Ga0307408_100191555 | 3300031548 | Bacteria | 1648 |
| 320 | Ga0316575_10039977 | 3300031665 | Bacteria | 1852 |
| 321 | Ga0316579_10000057 | 3300031691 | Bacteria | 26877 |
| 322 | Ga0316578_10115257 | 3300031728 | Bacteria | 1614 |
| 323 | Ga0316577_10007619 | 3300031733 | Bacteria | 5776 |
| 324 | Ga0307406_10012977 | 3300031901 | Bacteria | 4762 |
| 325 | Ga0307407_10283524 | 3300031903 | Bacteria | 1148 |
| 326 | Ga0307409_100008553 | 3300031995 | Bacteria | 6221 |
| 327 | Ga0307409_100069783 | 3300031995 | Bacteria | 2786 |
| 328 | Ga0307409_100070786 | 3300031995 | Bacteria | 2770 |
| 329 | Ga0307416_100006820 | 3300032002 | Bacteria | 7186 |
| 330 | Ga0307414_10048055 | 3300032004 | Bacteria | 2941 |
| 331 | Ga0307414_10409439 | 3300032004 | Bacteria | 1180 |
| 332 | Ga0307411_10067409 | 3300032005 | Bacteria | 2408 |
| 333 | Ga0307415_100313280 | 3300032126 | Bacteria | 1305 |
| 334 | Ga0316585_10003715 | 3300032137 | Bacteria | 4211 |
| 335 | Ga0316585_10006649 | 3300032137 | Bacteria | 3309 |
| 336 | Ga0316585_10029843 | 3300032137 | Bacteria | 1709 |
| 337 | Ga0316593_10001028 | 3300032168 | Bacteria | 5788 |
| 338 | Ga0316593_10003019 | 3300032168 | Bacteria | 4102 |
| 339 | Ga0316593_10055671 | 3300032168 | Bacteria | 1345 |
| 340 | Ga0316593_10128852 | 3300032168 | Bacteria | 912 |
| 341 | Ga0373934_0074571 | 3300035086 | Bacteria | 1359 |
| 342 | Ga0373955_0054195 | 3300035172 | Bacteria | 2192 |
| 343 | Ga0316574_0224641 | 3300035398 | Bacteria | 1202 |
| 344 | Ga0373933_0038554 | 3300035724 | Bacteria | 2808 |
| 345 | Ga0373937_0002058 | 3300036401 | Bacteria | 16806 |
| 346 | Ga0316582_0001289 | 3300036647 | Bacteria | 10845 |
| 347 | Ga0316582_0147306 | 3300036647 | Bacteria | 1590 |
| 348 | Ga0316582_0215001 | 3300036647 | Bacteria | 1314 |
| 349 | Ga0316584_0001968 | 3300036712 | Bacteria | 12826 |
| 350 | Ga0316584_0015811 | 3300036712 | Bacteria | 5403 |
| 351 | Ga0316584_0138709 | 3300036712 | Bacteria | 1814 |
| 352 | Ga0316584_0542910 | 3300036712 | Bacteria | 812 |
| 353 | Ga0316581_0019261 | 3300037588 | Bacteria | 1988 |
| 354 | Ga0316581_0060986 | 3300037588 | Bacteria | 1157 |
| 355 | Ga0237819_03246 | 3300038705 | Bacteria | 2946 |
| 356 | Ga0400483_004725 | 3300039062 | Bacteria | 184421 |
| 357 | Ga0400483_067590 | 3300039062 | Bacteria | 70090 |
| 358 | Ga0400483_113686 | 3300039062 | Bacteria | 71883 |
| 359 | Ga0400489_01548 | 3300039093 | Bacteria | 3187 |
| 360 | Ga0400487_32164 | 3300039110 | Bacteria | 36666 |
| 361 | Ga0439436_0000833 | 3300041404 | Bacteria | 8396 |
| 362 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 363 | Ga0439438_001224 | 3300041405 | Bacteria | 11394 |
| 364 | Ga0439438_001311 | 3300041405 | Bacteria | 11020 |
| 365 | Ga0439438_001549 | 3300041405 | Bacteria | 10138 |
| 366 | Ga0439438_004008 | 3300041405 | Bacteria | 5784 |
| 367 | Ga0439438_005594 | 3300041405 | Bacteria | 4588 |
| 368 | Ga0439438_010939 | 3300041405 | Bacteria | 2847 |
| 369 | Ga0439438_021145 | 3300041405 | Bacteria | 1818 |
| 370 | Ga0439438_024202 | 3300041405 | Bacteria | 1664 |
| 371 | Ga0439438_024411 | 3300041405 | Bacteria | 1655 |
| 372 | Ga0439447_002008 | 3300041407 | Bacteria | 7477 |
| 373 | Ga0439447_017403 | 3300041407 | Bacteria | 1957 |
| 374 | Ga0439447_021944 | 3300041407 | Bacteria | 1676 |
| 375 | Ga0439466_0000342 | 3300041411 | Bacteria | 17912 |
| 376 | Ga0439466_0003474 | 3300041411 | Bacteria | 6107 |
| 377 | Ga0439466_0008671 | 3300041411 | Bacteria | 3830 |
| 378 | Ga0439466_0017990 | 3300041411 | Bacteria | 2539 |
| 379 | Ga0439466_0018321 | 3300041411 | Bacteria | 2512 |
| 380 | Ga0439466_0032593 | 3300041411 | Bacteria | 1775 |
| 381 | Ga0439466_0054106 | 3300041411 | Bacteria | 1308 |
| 382 | Ga0451797_0851571 | 3300041453 | Bacteria | 2218 |
| 383 | Ga0451807_0342670 | 3300041486 | Bacteria | 1908 |
| 384 | Ga0451807_0343574 | 3300041486 | Bacteria | 1796 |
| 385 | Ga0451807_1464927 | 3300041486 | Bacteria | 6723 |
| 386 | Ga0451853_1748554 | 3300041512 | Bacteria | 1434 |
| 387 | Ga0439431_0030722 | 3300041997 | Bacteria | 1332 |
| 388 | Ga0439437_001017 | 3300042000 | Bacteria | 2932 |
| 389 | Ga0439432_001917 | 3300042006 | Bacteria | 7854 |
| 390 | Ga0439432_002272 | 3300042006 | Bacteria | 7244 |
| 391 | Ga0439432_012067 | 3300042006 | Bacteria | 2965 |
| 392 | Ga0439432_041463 | 3300042006 | Bacteria | 1457 |
| 393 | Ga0439432_077801 | 3300042006 | Bacteria | 1006 |
| 394 | Ga0439451_007452 | 3300042009 | Bacteria | 2229 |
| 395 | Ga0439452_003201 | 3300042010 | Bacteria | 5790 |
| 396 | Ga0439452_003645 | 3300042010 | Bacteria | 5346 |
| 397 | Ga0439452_040989 | 3300042010 | Bacteria | 1090 |
| 398 | Ga0439456_013404 | 3300042013 | Bacteria | 1705 |
| 399 | Ga0439463_000853 | 3300042016 | Bacteria | 8362 |
| 400 | Ga0439463_002002 | 3300042016 | Bacteria | 5301 |
| 401 | Ga0439463_005102 | 3300042016 | Bacteria | 3267 |
| 402 | Ga0450911_000037 | 3300042115 | Bacteria | 60341 |
| 403 | Ga0450911_001642 | 3300042115 | Bacteria | 4967 |
| 404 | Ga0450911_013889 | 3300042115 | Bacteria | 1074 |
| 405 | Ga0450919_013351 | 3300042121 | Bacteria | 929 |
| 406 | Ga0450923_006052 | 3300042125 | Bacteria | 1984 |
| 407 | Ga0450890_004602 | 3300042127 | Bacteria | 1799 |
| 408 | Ga0450900_014018 | 3300042136 | Bacteria | 1066 |
| 409 | Ga0450902_006795 | 3300042137 | Bacteria | 1757 |
| 410 | Ga0450903_015907 | 3300042138 | Bacteria | 1182 |
| 411 | Ga0450904_000010 | 3300042139 | Bacteria | 43301 |
| 412 | Ga0450905_004233 | 3300042142 | Bacteria | 1895 |
| 413 | Ga0450905_038071 | 3300042142 | Bacteria | 758 |
| 414 | Ga0450907_002271 | 3300042146 | Bacteria | 3729 |
| 415 | Ga0450907_002488 | 3300042146 | Bacteria | 3503 |
| 416 | Ga0450910_000828 | 3300042147 | Bacteria | 3745 |
| 417 | Ga0439446_0007265 | 3300042156 | Bacteria | 2909 |
| 418 | Ga0439446_0085730 | 3300042156 | Bacteria | 980 |
| 419 | Ga0450909_005848 | 3300042185 | Bacteria | 1772 |
| 420 | Ga0439434_0005198 | 3300042435 | Bacteria | 3806 |
| 421 | Ga0439464_0004718 | 3300042439 | Bacteria | 3492 |
| 422 | Ga0439464_0008158 | 3300042439 | Bacteria | 2745 |
| 423 | Ga0439464_0099538 | 3300042439 | Bacteria | 882 |
| 424 | Ga0439460_0002311 | 3300042461 | Bacteria | 4585 |
| 425 | Ga0450893_0007907 | 3300042532 | Bacteria | 1728 |
| 426 | Ga0450901_001715 | 3300042533 | Bacteria | 2470 |
| 427 | Ga0439440_0035470 | 3300042993 | Bacteria | 1196 |
| 428 | Ga0495617_006990 | 3300046452 | Bacteria | 3934 |
| 429 | Ga0495617_020318 | 3300046452 | Bacteria | 2244 |
| 430 | Ga0495617_039050 | 3300046452 | Bacteria | 1587 |
| 431 | Ga0495617_060399 | 3300046452 | Bacteria | 1254 |
| 432 | Ga0495627_000021 | 3300046453 | Bacteria | 282454 |
| 433 | Ga0495627_000128 | 3300046453 | Bacteria | 92036 |
| 434 | Ga0495627_000279 | 3300046453 | Bacteria | 51531 |
| 435 | Ga0495627_002877 | 3300046453 | Bacteria | 7932 |
| 436 | Ga0495627_017992 | 3300046453 | Bacteria | 2392 |
| 437 | Ga0495627_032243 | 3300046453 | Bacteria | 1649 |
| 438 | Ga0495603_0126094 | 3300046455 | Bacteria | 1492 |
| 439 | Ga0495590_0005949 | 3300046457 | Bacteria | 4783 |
| 440 | Ga0495590_0068414 | 3300046457 | Bacteria | 1244 |
| 441 | Ga0495591_000015 | 3300046458 | Bacteria | 252107 |
| 442 | Ga0495591_001669 | 3300046458 | Bacteria | 13384 |
| 443 | Ga0495591_002885 | 3300046458 | Bacteria | 9218 |
| 444 | Ga0495591_004439 | 3300046458 | Bacteria | 6880 |
| 445 | Ga0495591_008158 | 3300046458 | Bacteria | 4322 |
| 446 | Ga0495591_008588 | 3300046458 | Bacteria | 4167 |
| 447 | Ga0495591_013373 | 3300046458 | Bacteria | 3007 |
| 448 | Ga0495591_021189 | 3300046458 | Bacteria | 2127 |
| 449 | Ga0495591_053892 | 3300046458 | Bacteria | 1089 |
| 450 | Ga0495629_0303336 | 3300046459 | Bacteria | 1093 |
| 451 | Ga0495638_0004299 | 3300046460 | Bacteria | 10811 |
| 452 | Ga0495638_0007372 | 3300046460 | Bacteria | 7894 |
| 453 | Ga0495638_0056195 | 3300046460 | Bacteria | 2442 |
| 454 | Ga0495638_0067200 | 3300046460 | Bacteria | 2201 |
| 455 | Ga0495638_0205775 | 3300046460 | Bacteria | 1108 |
| 456 | Ga0495653_0043552 | 3300046463 | Bacteria | 3489 |
| 457 | Ga0495653_0064101 | 3300046463 | Bacteria | 2769 |
| 458 | Ga0495653_0071493 | 3300046463 | Bacteria | 2593 |
| 459 | Ga0495650_0000672 | 3300046471 | Bacteria | 44486 |
| 460 | Ga0495650_0008514 | 3300046471 | Bacteria | 5968 |
| 461 | Ga0495650_0010244 | 3300046471 | Bacteria | 5243 |
| 462 | Ga0495650_0014847 | 3300046471 | Bacteria | 4023 |
| 463 | Ga0495650_0025885 | 3300046471 | Bacteria | 2739 |
| 464 | Ga0495650_0040686 | 3300046471 | Bacteria | 1993 |
| 465 | Ga0495582_0140242 | 3300046473 | Bacteria | 1369 |
| 466 | Ga0495605_0000016 | 3300046474 | Bacteria | 289508 |
| 467 | Ga0495605_0000031 | 3300046474 | Bacteria | 213242 |
| 468 | Ga0495605_0009557 | 3300046474 | Bacteria | 5443 |
| 469 | Ga0495605_0012810 | 3300046474 | Bacteria | 4640 |
| 470 | Ga0495605_0020101 | 3300046474 | Bacteria | 3552 |
| 471 | Ga0495605_0028704 | 3300046474 | Bacteria | 2870 |
| 472 | Ga0495605_0052335 | 3300046474 | Bacteria | 1984 |
| 473 | Ga0495639_0002355 | 3300046475 | Bacteria | 8263 |
| 474 | Ga0495584_0012531 | 3300046491 | Bacteria | 4328 |
| 475 | Ga0495584_0070675 | 3300046491 | Bacteria | 1754 |
| 476 | Ga0495584_0246861 | 3300046491 | Bacteria | 907 |
| 477 | Ga0495585_0021995 | 3300046492 | Bacteria | 3660 |
| 478 | Ga0495585_0036292 | 3300046492 | Bacteria | 2781 |
| 479 | Ga0495594_0040103 | 3300046499 | Bacteria | 2561 |
| 480 | Ga0495596_0005366 | 3300046500 | Bacteria | 6065 |
| 481 | Ga0495596_0016371 | 3300046500 | Bacteria | 3082 |
| 482 | Ga0495596_0114782 | 3300046500 | Bacteria | 1046 |
| 483 | Ga0495607_0000213 | 3300046501 | Bacteria | 61906 |
| 484 | Ga0495607_0000248 | 3300046501 | Bacteria | 57955 |
| 485 | Ga0495607_0000780 | 3300046501 | Bacteria | 30486 |
| 486 | Ga0495607_0002842 | 3300046501 | Bacteria | 13733 |
| 487 | Ga0495607_0006701 | 3300046501 | Bacteria | 8065 |
| 488 | Ga0495607_0009954 | 3300046501 | Bacteria | 6402 |
| 489 | Ga0495607_0035190 | 3300046501 | Bacteria | 3031 |
| 490 | Ga0495607_0049776 | 3300046501 | Bacteria | 2441 |
| 491 | Ga0495607_0107693 | 3300046501 | Bacteria | 1482 |
| 492 | Ga0495607_0137813 | 3300046501 | Bacteria | 1262 |
| 493 | Ga0495607_0194454 | 3300046501 | Bacteria | 1008 |
| 494 | Ga0495607_0209265 | 3300046501 | Bacteria | 960 |
| 495 | Ga0495607_0216479 | 3300046501 | Bacteria | 939 |
| 496 | Ga0495583_0000041 | 3300046506 | Bacteria | 234707 |
| 497 | Ga0495583_0000698 | 3300046506 | Bacteria | 43244 |
| 498 | Ga0495583_0003486 | 3300046506 | Bacteria | 11919 |
| 499 | Ga0495583_0007614 | 3300046506 | Bacteria | 6759 |
| 500 | Ga0495583_0023108 | 3300046506 | Bacteria | 3152 |
| 501 | Ga0495583_0072323 | 3300046506 | Bacteria | 1513 |
| 502 | Ga0495583_0095210 | 3300046506 | Bacteria | 1277 |
| 503 | Ga0495606_0000055 | 3300046507 | Bacteria | 199348 |
| 504 | Ga0495606_0002535 | 3300046507 | Bacteria | 21017 |
| 505 | Ga0495606_0021122 | 3300046507 | Bacteria | 4774 |
| 506 | Ga0495606_0025179 | 3300046507 | Bacteria | 4268 |
| 507 | Ga0495606_0047702 | 3300046507 | Bacteria | 2822 |
| 508 | Ga0495606_0048476 | 3300046507 | Bacteria | 2794 |
| 509 | Ga0495610_0011574 | 3300046512 | Bacteria | 5380 |
| 510 | Ga0495610_0037130 | 3300046512 | Bacteria | 2482 |
| 511 | Ga0495610_0070752 | 3300046512 | Bacteria | 1628 |
| 512 | Ga0495616_0003504 | 3300046513 | Bacteria | 10039 |
| 513 | Ga0495616_0018287 | 3300046513 | Bacteria | 3850 |
| 514 | Ga0495616_0062591 | 3300046513 | Bacteria | 1821 |
| 515 | Ga0495616_0064862 | 3300046513 | Bacteria | 1781 |
| 516 | Ga0495616_0097381 | 3300046513 | Bacteria | 1384 |
| 517 | Ga0495616_0188867 | 3300046513 | Bacteria | 911 |
| 518 | Ga0495620_0000013 | 3300046515 | Bacteria | 160349 |
| 519 | Ga0495620_0000015 | 3300046515 | Bacteria | 154625 |
| 520 | Ga0495620_0005216 | 3300046515 | Bacteria | 7273 |
| 521 | Ga0495620_0007041 | 3300046515 | Bacteria | 6134 |
| 522 | Ga0495620_0031553 | 3300046515 | Bacteria | 2426 |
| 523 | Ga0495620_0057198 | 3300046515 | Bacteria | 1638 |
| 524 | Ga0495620_0062734 | 3300046515 | Bacteria | 1542 |
| 525 | Ga0495620_0090181 | 3300046515 | Bacteria | 1231 |
| 526 | Ga0495630_0114013 | 3300046517 | Bacteria | 2048 |
| 527 | Ga0495630_0177603 | 3300046517 | Bacteria | 1623 |
| 528 | Ga0495631_0005402 | 3300046518 | Bacteria | 6686 |
| 529 | Ga0495631_0012690 | 3300046518 | Bacteria | 4108 |
| 530 | Ga0495632_0000912 | 3300046519 | Bacteria | 25920 |
| 531 | Ga0495632_0000914 | 3300046519 | Bacteria | 25916 |
| 532 | Ga0495632_0004792 | 3300046519 | Bacteria | 9107 |
| 533 | Ga0495632_0006071 | 3300046519 | Bacteria | 7836 |
| 534 | Ga0495632_0054101 | 3300046519 | Bacteria | 1968 |
| 535 | Ga0495632_0081951 | 3300046519 | Bacteria | 1538 |
| 536 | Ga0495632_0093183 | 3300046519 | Bacteria | 1425 |
| 537 | Ga0495632_0094242 | 3300046519 | Bacteria | 1416 |
| 538 | Ga0495637_0002612 | 3300046520 | Bacteria | 9881 |
| 539 | Ga0495637_0004529 | 3300046520 | Bacteria | 7191 |
| 540 | Ga0495637_0005694 | 3300046520 | Bacteria | 6319 |
| 541 | Ga0495637_0013628 | 3300046520 | Bacteria | 3854 |
| 542 | Ga0495637_0034150 | 3300046520 | Bacteria | 2229 |
| 543 | Ga0495637_0061030 | 3300046520 | Bacteria | 1546 |
| 544 | Ga0495637_0093297 | 3300046520 | Bacteria | 1184 |
| 545 | Ga0495637_0133004 | 3300046520 | Bacteria | 948 |
| 546 | Ga0495643_0000223 | 3300046522 | Bacteria | 86920 |
| 547 | Ga0495643_0000903 | 3300046522 | Bacteria | 31380 |
| 548 | Ga0495643_0019550 | 3300046522 | Bacteria | 3916 |
| 549 | Ga0495643_0024183 | 3300046522 | Bacteria | 3448 |
| 550 | Ga0495644_0002168 | 3300046523 | Bacteria | 7885 |
| 551 | Ga0495644_0045454 | 3300046523 | Bacteria | 1651 |
| 552 | Ga0495644_0062484 | 3300046523 | Bacteria | 1399 |
| 553 | Ga0495648_0001423 | 3300046524 | Bacteria | 23410 |
| 554 | Ga0495648_0049543 | 3300046524 | Bacteria | 2573 |
| 555 | Ga0495648_0061188 | 3300046524 | Bacteria | 2237 |
| 556 | Ga0495648_0096057 | 3300046524 | Bacteria | 1647 |
| 557 | Ga0495648_0200171 | 3300046524 | Bacteria | 1000 |
| 558 | Ga0495666_0022867 | 3300046526 | Bacteria | 3094 |
| 559 | Ga0495666_0064542 | 3300046526 | Bacteria | 1747 |
| 560 | Ga0495642_0002131 | 3300046528 | Bacteria | 8166 |
| 561 | Ga0495642_0035623 | 3300046528 | Bacteria | 2008 |
| 562 | Ga0495652_0326822 | 3300046529 | Bacteria | 1106 |
| 563 | Ga0495654_0000033 | 3300046530 | Bacteria | 201799 |
| 564 | Ga0495654_0003357 | 3300046530 | Bacteria | 9863 |
| 565 | Ga0495654_0003364 | 3300046530 | Bacteria | 9852 |
| 566 | Ga0495654_0014186 | 3300046530 | Bacteria | 4246 |
| 567 | Ga0495654_0017170 | 3300046530 | Bacteria | 3809 |
| 568 | Ga0495654_0037853 | 3300046530 | Bacteria | 2415 |
| 569 | Ga0495654_0048994 | 3300046530 | Bacteria | 2070 |
| 570 | Ga0495654_0086018 | 3300046530 | Bacteria | 1465 |
| 571 | Ga0495654_0138884 | 3300046530 | Bacteria | 1084 |
| 572 | Ga0495654_0165479 | 3300046530 | Bacteria | 968 |
| 573 | Ga0495586_0079406 | 3300046535 | Bacteria | 1801 |
| 574 | Ga0495587_0021981 | 3300046536 | Bacteria | 3931 |
| 575 | Ga0495609_0000015 | 3300046538 | Bacteria | 322474 |
| 576 | Ga0495609_0000070 | 3300046538 | Bacteria | 128181 |
| 577 | Ga0495609_0003891 | 3300046538 | Bacteria | 8374 |
| 578 | Ga0495609_0022602 | 3300046538 | Bacteria | 2896 |
| 579 | Ga0495609_0091328 | 3300046538 | Bacteria | 1324 |
| 580 | Ga0495597_0000005 | 3300046542 | Bacteria | 286580 |
| 581 | Ga0495597_0011863 | 3300046542 | Bacteria | 4218 |
| 582 | Ga0495597_0074803 | 3300046542 | Bacteria | 1454 |
| 583 | Ga0495597_0155327 | 3300046542 | Bacteria | 936 |
| 584 | Ga0495645_0286967 | 3300046543 | Bacteria | 1080 |
| 585 | Ga0495622_0003963 | 3300046557 | Bacteria | 6912 |
| 586 | Ga0495622_0006164 | 3300046557 | Bacteria | 5570 |
| 587 | Ga0495622_0006468 | 3300046557 | Bacteria | 5435 |
| 588 | Ga0495622_0014077 | 3300046557 | Bacteria | 3712 |
| 589 | Ga0495622_0131555 | 3300046557 | Bacteria | 1139 |
| 590 | Ga0495633_0000060 | 3300046558 | Bacteria | 144561 |
| 591 | Ga0495668_0005973 | 3300046616 | Bacteria | 8089 |
| 592 | Ga0495668_0014935 | 3300046616 | Bacteria | 4543 |
| 593 | Ga0495668_0122682 | 3300046616 | Bacteria | 1421 |
| 594 | Ga0495668_0144806 | 3300046616 | Bacteria | 1300 |
| 595 | Ga0495634_0140357 | 3300046642 | Bacteria | 1534 |
| 596 | Ga0495611_0000817 | 3300046648 | Bacteria | 17225 |
| 597 | Ga0495611_0003416 | 3300046648 | Bacteria | 7005 |
| 598 | Ga0495611_0191946 | 3300046648 | Bacteria | 953 |
| 599 | Ga0495625_0001491 | 3300046660 | Bacteria | 28149 |
| 600 | Ga0495625_0019930 | 3300046660 | Bacteria | 5188 |
| 601 | Ga0495625_0126498 | 3300046660 | Bacteria | 1734 |
| 602 | Ga0495625_0252467 | 3300046660 | Bacteria | 1144 |
| 603 | Ga0495625_0425260 | 3300046660 | Bacteria | 825 |
| 604 | Ga0495635_0024927 | 3300046663 | Bacteria | 4167 |
| 605 | Ga0495659_0003433 | 3300046664 | Bacteria | 5057 |
| 606 | Ga0495659_0011603 | 3300046664 | Bacteria | 2838 |
| 607 | Ga0495661_0000110 | 3300046665 | Bacteria | 97854 |
| 608 | Ga0495661_0000139 | 3300046665 | Bacteria | 85160 |
| 609 | Ga0495661_0000194 | 3300046665 | Bacteria | 70173 |
| 610 | Ga0495661_0000304 | 3300046665 | Bacteria | 56019 |
| 611 | Ga0495661_0044658 | 3300046665 | Bacteria | 2714 |
| 612 | Ga0495661_0195824 | 3300046665 | Bacteria | 1061 |
| 613 | Ga0495661_0204943 | 3300046665 | Bacteria | 1030 |
| 614 | Ga0495588_0096414 | 3300046674 | Bacteria | 1551 |
| 615 | Ga0495588_0148363 | 3300046674 | Bacteria | 1239 |
| 616 | Ga0495623_0028796 | 3300046679 | Bacteria | 3574 |
| 617 | Ga0495623_0218928 | 3300046679 | Bacteria | 1086 |
| 618 | Ga0495669_0004936 | 3300046684 | Bacteria | 5538 |
| 619 | Ga0495613_0327929 | 3300046689 | Bacteria | 1055 |
| 620 | Ga0495624_0063633 | 3300046690 | Bacteria | 2306 |
| 621 | Ga0495670_0002014 | 3300046691 | Bacteria | 10003 |
| 622 | Ga0495670_0077080 | 3300046691 | Bacteria | 1694 |
| 623 | Ga0495670_0154114 | 3300046691 | Bacteria | 1205 |
| 624 | Ga0495670_0252846 | 3300046691 | Bacteria | 940 |
| 625 | Ga0495671_0009834 | 3300046692 | Bacteria | 5324 |
| 626 | Ga0495671_0012159 | 3300046692 | Bacteria | 4705 |
| 627 | Ga0495671_0014145 | 3300046692 | Bacteria | 4299 |
| 628 | Ga0495671_0040795 | 3300046692 | Bacteria | 2339 |
| 629 | Ga0495671_0064974 | 3300046692 | Bacteria | 1796 |
| 630 | Ga0495671_0146599 | 3300046692 | Bacteria | 1149 |
| 631 | Ga0495671_0175419 | 3300046692 | Bacteria | 1041 |
| 632 | Ga0495649_0005972 | 3300046694 | Bacteria | 7633 |
| 633 | Ga0495649_0038788 | 3300046694 | Bacteria | 2612 |
| 634 | Ga0495649_0039240 | 3300046694 | Bacteria | 2596 |
| 635 | Ga0495649_0058119 | 3300046694 | Bacteria | 2084 |
| 636 | Ga0495649_0278180 | 3300046694 | Bacteria | 855 |
| 637 | Ga0495589_0000855 | 3300046794 | Bacteria | 19099 |
| 638 | Ga0495589_0007319 | 3300046794 | Bacteria | 5784 |
| 639 | Ga0495589_0017167 | 3300046794 | Bacteria | 3716 |
| 640 | Ga0495589_0087818 | 3300046794 | Bacteria | 1510 |
| 641 | Ga0495600_0005020 | 3300046809 | Bacteria | 7955 |
| 642 | Ga0495660_0001756 | 3300046810 | Bacteria | 14444 |
| 643 | Ga0495660_0003768 | 3300046810 | Bacteria | 9298 |
| 644 | Ga0495660_0019277 | 3300046810 | Bacteria | 3916 |
| 645 | Ga0495660_0023430 | 3300046810 | Bacteria | 3520 |
| 646 | Ga0495660_0056189 | 3300046810 | Bacteria | 2128 |
| 647 | Ga0495660_0157692 | 3300046810 | Bacteria | 1115 |
| 648 | Ga0495604_0216665 | 3300047317 | Bacteria | 1320 |
| 649 | Ga0495636_0014835 | 3300047318 | Bacteria | 3100 |
| 650 | Ga0495636_0080700 | 3300047318 | Bacteria | 1400 |
| 651 | Ga0495672_0020211 | 3300047320 | Bacteria | 4371 |
| 652 | Ga0495672_0028649 | 3300047320 | Bacteria | 3519 |
| 653 | Ga0495672_0034225 | 3300047320 | Bacteria | 3141 |
| 654 | Ga0495672_0061584 | 3300047320 | Bacteria | 2162 |
| 655 | Ga0495672_0076723 | 3300047320 | Bacteria | 1875 |
| 656 | Ga0495672_0079440 | 3300047320 | Bacteria | 1832 |
| 657 | Ga0495672_0143183 | 3300047320 | Bacteria | 1246 |
| 658 | Ga0495676_0000013 | 3300047321 | Bacteria | 213031 |
| 659 | Ga0495676_0009626 | 3300047321 | Bacteria | 8793 |
| 660 | Ga0495683_0000027 | 3300047323 | Bacteria | 153730 |
| 661 | Ga0495683_0000261 | 3300047323 | Bacteria | 47209 |
| 662 | Ga0495683_0008434 | 3300047323 | Bacteria | 5512 |
| 663 | Ga0495683_0015414 | 3300047323 | Bacteria | 3978 |
| 664 | Ga0495683_0037791 | 3300047323 | Bacteria | 2445 |
| 665 | Ga0495683_0069159 | 3300047323 | Bacteria | 1735 |
| 666 | Ga0495687_010031 | 3300047443 | Bacteria | 5232 |
| 667 | Ga0495687_012754 | 3300047443 | Bacteria | 4426 |
| 668 | Ga0495679_000206 | 3300047446 | Bacteria | 51518 |
| 669 | Ga0495679_001765 | 3300047446 | Bacteria | 11865 |
| 670 | Ga0495673_0003090 | 3300047469 | Bacteria | 11196 |
| 671 | Ga0495673_0010910 | 3300047469 | Bacteria | 4916 |
| 672 | Ga0495673_0011603 | 3300047469 | Bacteria | 4727 |
| 673 | Ga0495673_0011642 | 3300047469 | Bacteria | 4718 |
| 674 | Ga0495673_0013537 | 3300047469 | Bacteria | 4279 |
| 675 | Ga0495673_0015361 | 3300047469 | Bacteria | 3947 |
| 676 | Ga0495673_0017519 | 3300047469 | Bacteria | 3632 |
| 677 | Ga0495673_0055784 | 3300047469 | Bacteria | 1712 |
| 678 | Ga0495681_0003664 | 3300047470 | Bacteria | 10667 |
| 679 | Ga0495681_0005466 | 3300047470 | Bacteria | 8496 |
| 680 | Ga0495681_0010709 | 3300047470 | Bacteria | 5528 |
| 681 | Ga0495681_0011975 | 3300047470 | Bacteria | 5122 |
| 682 | Ga0495681_0020315 | 3300047470 | Bacteria | 3606 |
| 683 | Ga0495681_0028153 | 3300047470 | Bacteria | 2895 |
| 684 | Ga0495681_0033280 | 3300047470 | Bacteria | 2584 |
| 685 | Ga0495681_0049006 | 3300047470 | Bacteria | 1999 |
| 686 | Ga0495681_0050445 | 3300047470 | Bacteria | 1961 |
| 687 | Ga0495681_0122153 | 3300047470 | Bacteria | 1116 |
| 688 | Ga0495681_0135867 | 3300047470 | Bacteria | 1043 |
| 689 | Ga0495686_0031369 | 3300047472 | Bacteria | 3446 |
| 690 | Ga0495686_0038525 | 3300047472 | Bacteria | 3057 |
| 691 | Ga0495686_0143798 | 3300047472 | Bacteria | 1405 |
| 692 | Ga0495593_0030808 | 3300047673 | Bacteria | 2932 |
| 693 | Ga0495602_0084979 | 3300048088 | Bacteria | 2646 |
| 694 | Ga0495626_0000056 | 3300048091 | Bacteria | 150654 |
| 695 | Ga0495626_0004948 | 3300048091 | Bacteria | 7991 |
| 696 | Ga0495626_0011052 | 3300048091 | Bacteria | 4788 |
| 697 | Ga0495626_0013013 | 3300048091 | Bacteria | 4337 |
| 698 | Ga0495626_0017070 | 3300048091 | Bacteria | 3671 |
| 699 | Ga0496101_0000120 | 3300048904 | Bacteria | 76357 |
| 700 | Ga0496102_0191890 | 3300048905 | Bacteria | 1925 |
| 701 | Ga0496102_0265742 | 3300048905 | Bacteria | 1617 |
| 702 | Ga0496110_0192502 | 3300048913 | Bacteria | 1852 |
| 703 | Ga0496111_0237833 | 3300048914 | Bacteria | 1353 |
| 704 | Ga0496112_0564801 | 3300048915 | Bacteria | 1071 |
| 705 | Ga0496114_0147898 | 3300048917 | Bacteria | 2037 |
| 706 | Ga0496116_0000007 | 3300048919 | Bacteria | 795464 |
| 707 | Ga0496116_0000283 | 3300048919 | Bacteria | 86431 |
| 708 | Ga0496116_0000999 | 3300048919 | Bacteria | 34585 |
| 709 | Ga0496116_0018019 | 3300048919 | Bacteria | 5457 |
| 710 | Ga0496116_0028363 | 3300048919 | Bacteria | 4057 |
| 711 | Ga0496116_0117967 | 3300048919 | Bacteria | 1543 |
| 712 | Ga0496117_0006411 | 3300048920 | Bacteria | 11929 |
| 713 | Ga0496117_0019055 | 3300048920 | Bacteria | 5653 |
| 714 | Ga0496117_0030232 | 3300048920 | Bacteria | 4159 |
| 715 | Ga0496117_0081587 | 3300048920 | Bacteria | 2121 |
| 716 | Ga0496117_0084328 | 3300048920 | Bacteria | 2073 |
| 717 | Ga0496117_0152088 | 3300048920 | Bacteria | 1368 |
| 718 | Ga0496117_0182483 | 3300048920 | Bacteria | 1204 |
| 719 | Ga0496118_0001807 | 3300048921 | Bacteria | 30813 |
| 720 | Ga0496118_0044060 | 3300048921 | Bacteria | 3497 |
| 721 | Ga0496118_0095878 | 3300048921 | Bacteria | 2023 |
| 722 | Ga0496118_0226515 | 3300048921 | Bacteria | 1083 |
| 723 | Ga0496118_0233500 | 3300048921 | Bacteria | 1059 |
| 724 | Ga0496118_0262216 | 3300048921 | Bacteria | 974 |
| 725 | Ga0496119_0000112 | 3300048922 | Bacteria | 114767 |
| 726 | Ga0496119_0000214 | 3300048922 | Bacteria | 82258 |
| 727 | Ga0496119_0005412 | 3300048922 | Bacteria | 12255 |
| 728 | Ga0496119_0060680 | 3300048922 | Bacteria | 2262 |
| 729 | Ga0496119_0230022 | 3300048922 | Bacteria | 944 |
| 730 | Ga0496120_0000035 | 3300048923 | Bacteria | 213992 |
| 731 | Ga0496120_0000064 | 3300048923 | Bacteria | 169462 |
| 732 | Ga0496120_0000826 | 3300048923 | Bacteria | 44233 |
| 733 | Ga0496120_0004409 | 3300048923 | Bacteria | 11819 |
| 734 | Ga0496121_0002354 | 3300048924 | Bacteria | 29143 |
| 735 | Ga0496121_0003009 | 3300048924 | Bacteria | 24478 |
| 736 | Ga0496121_0066285 | 3300048924 | Bacteria | 2933 |
| 737 | Ga0496121_0137771 | 3300048924 | Bacteria | 1816 |
| 738 | Ga0496121_0171305 | 3300048924 | Bacteria | 1576 |
| 739 | Ga0496122_0000122 | 3300048925 | Bacteria | 181491 |
| 740 | Ga0496122_0009298 | 3300048925 | Bacteria | 10388 |
| 741 | Ga0496122_0010760 | 3300048925 | Bacteria | 9384 |
| 742 | Ga0496122_0033077 | 3300048925 | Bacteria | 4260 |
| 743 | Ga0496122_0093864 | 3300048925 | Bacteria | 2034 |
| 744 | Ga0496122_0266663 | 3300048925 | Bacteria | 946 |
| 745 | Ga0496123_0000391 | 3300048926 | Bacteria | 82015 |
| 746 | Ga0496123_0001340 | 3300048926 | Bacteria | 34830 |
| 747 | Ga0496123_0008677 | 3300048926 | Bacteria | 9286 |
| 748 | Ga0496123_0012443 | 3300048926 | Bacteria | 7253 |
| 749 | Ga0496123_0139280 | 3300048926 | Bacteria | 1329 |
| 750 | Ga0496124_0000222 | 3300048927 | Bacteria | 110854 |
| 751 | Ga0496124_0034795 | 3300048927 | Bacteria | 4414 |
| 752 | Ga0496124_0051094 | 3300048927 | Bacteria | 3518 |
| 753 | Ga0496124_0053019 | 3300048927 | Bacteria | 3441 |
| 754 | Ga0496124_0081731 | 3300048927 | Bacteria | 2654 |
| 755 | Ga0496124_0084069 | 3300048927 | Bacteria | 2610 |
| 756 | Ga0496124_0093443 | 3300048927 | Bacteria | 2448 |
| 757 | Ga0496124_0127532 | 3300048927 | Bacteria | 2025 |
| 758 | Ga0496124_0135034 | 3300048927 | Bacteria | 1954 |
| 759 | Ga0496124_0139891 | 3300048927 | Bacteria | 1911 |
| 760 | Ga0496124_0170728 | 3300048927 | Bacteria | 1684 |
| 761 | Ga0496124_0248867 | 3300048927 | Bacteria | 1316 |
| 762 | Ga0496124_0296867 | 3300048927 | Bacteria | 1169 |
| 763 | Ga0496124_0334600 | 3300048927 | Bacteria | 1078 |
| 764 | Ga0496125_0000908 | 3300048928 | Bacteria | 46824 |
| 765 | Ga0496125_0044153 | 3300048928 | Bacteria | 3773 |
| 766 | Ga0496125_0084520 | 3300048928 | Bacteria | 2409 |
| 767 | Ga0496125_0123920 | 3300048928 | Bacteria | 1836 |
| 768 | Ga0496126_0134998 | 3300048929 | Bacteria | 2129 |
| 769 | Ga0495678_000031 | 3300049459 | Bacteria | 215528 |
| 770 | Ga0495678_000039 | 3300049459 | Bacteria | 191665 |
| 771 | Ga0495678_004626 | 3300049459 | Bacteria | 7900 |
| 772 | Ga0495678_008903 | 3300049459 | Bacteria | 5018 |
| 773 | Ga0495678_050737 | 3300049459 | Bacteria | 1606 |
| 774 | Ga0495678_085666 | 3300049459 | Bacteria | 1121 |
| 775 | Ga0495682_0000577 | 3300049460 | Bacteria | 24873 |
| 776 | Ga0495682_0001344 | 3300049460 | Bacteria | 13589 |
| 777 | Ga0495682_0027923 | 3300049460 | Bacteria | 2092 |
| 778 | Ga0495682_0070558 | 3300049460 | Bacteria | 1257 |
| 779 | Ga0501314_000184 | 3300049530 | Bacteria | 3372 |
| 780 | Ga0501032_0017099 | 3300049569 | Bacteria | 5096 |
| 781 | Ga0501032_0143071 | 3300049569 | Bacteria | 1575 |
| 782 | Ga0501033_0002742 | 3300049570 | Bacteria | 14770 |
| 783 | Ga0501034_0000137 | 3300049571 | Bacteria | 136592 |
| 784 | Ga0501034_0010942 | 3300049571 | Bacteria | 9427 |
| 785 | Ga0501034_0402076 | 3300049571 | Bacteria | 1292 |
| 786 | Ga0501034_0535707 | 3300049571 | Bacteria | 1081 |
| 787 | Ga0501036_0025136 | 3300049572 | Bacteria | 5023 |
| 788 | Ga0501037_0006118 | 3300049573 | Bacteria | 8793 |
| 789 | Ga0501037_0019740 | 3300049573 | Bacteria | 4973 |
| 790 | Ga0501037_0098256 | 3300049573 | Bacteria | 2115 |
| 791 | Ga0501037_0187385 | 3300049573 | Bacteria | 1466 |
| 792 | Ga0501038_0024540 | 3300049574 | Bacteria | 5379 |
| 793 | Ga0501038_0145172 | 3300049574 | Bacteria | 1938 |
| 794 | Ga0501039_0098402 | 3300049575 | Bacteria | 2282 |
| 795 | Ga0501039_0319704 | 3300049575 | Bacteria | 1220 |
| 796 | Ga0501039_0328273 | 3300049575 | Bacteria | 1202 |
| 797 | Ga0501042_0055528 | 3300049578 | Bacteria | 2827 |
| 798 | Ga0501042_0114273 | 3300049578 | Bacteria | 1944 |
| 799 | Ga0501043_0007906 | 3300049579 | Bacteria | 8405 |
| 800 | Ga0501046_0001861 | 3300049580 | Bacteria | 20092 |
| 801 | Ga0501046_0021216 | 3300049580 | Bacteria | 5363 |
| 802 | Ga0501047_0022290 | 3300049581 | Bacteria | 6084 |
| 803 | Ga0501067_0319823 | 3300049583 | Bacteria | 864 |
| 804 | Ga0501069_0045541 | 3300049585 | Bacteria | 2431 |
| 805 | Ga0501070_0007478 | 3300049586 | Bacteria | 9280 |
| 806 | Ga0501070_0010248 | 3300049586 | Bacteria | 7930 |
| 807 | Ga0501071_0027598 | 3300049587 | Bacteria | 3995 |
| 808 | Ga0501073_0000314 | 3300049589 | Bacteria | 32139 |
| 809 | Ga0501073_0001320 | 3300049589 | Bacteria | 18260 |
| 810 | Ga0501074_0016769 | 3300049590 | Bacteria | 5315 |
| 811 | Ga0501074_0426670 | 3300049590 | Bacteria | 940 |
| 812 | Ga0501077_0000591 | 3300049593 | Bacteria | 21943 |
| 813 | Ga0501079_0000274 | 3300049741 | Bacteria | 31680 |
| 814 | Ga0501079_0131953 | 3300049741 | Bacteria | 1944 |
| 815 | Ga0501080_0007557 | 3300049742 | Bacteria | 9823 |
| 816 | Ga0501080_0021156 | 3300049742 | Bacteria | 6020 |
| 817 | Ga0501083_0045222 | 3300049744 | Bacteria | 2979 |
| 818 | Ga0501083_0068627 | 3300049744 | Bacteria | 2359 |
| 819 | Ga0501035_0017408 | 3300049822 | Bacteria | 6628 |
| 820 | Ga0501044_0011188 | 3300049823 | Bacteria | 9731 |
| 821 | Ga0501226_000017 | 3300049853 | Bacteria | 150879 |
| 822 | nmdc:mga03683_87068_c1 | 3300050489 | Bacteria | 1357 |
| 823 | nmdc:mga00v17_7724_c1 | 3300050491 | Bacteria | 5759 |
| 824 | nmdc:mga08x19_193284_c1 | 3300050514 | Bacteria | 1393 |
| 825 | Ga0500643_033704 | 3300053087 | Bacteria | 1547 |
| 826 | Ga0500618_009345 | 3300053125 | Bacteria | 2681 |
| 827 | Ga0500659_0046867 | 3300053135 | Bacteria | 2338 |
| 828 | Ga0500573_0056391 | 3300053140 | Bacteria | 2255 |
| 829 | Ga0500611_046406 | 3300053727 | Bacteria | 977 |
| 830 | Ga0501082_0031337 | 3300060353 | Bacteria | 4584 |
| 831 | Ga0501082_0056798 | 3300060353 | Bacteria | 3372 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031995 | Ga0307409_100070786 | Ga0307409_1000707863 | 214 |
| 2 | 3300031250 | Ga0265331_10156701 | Ga0265331_101567012 | 223 |
| 3 | 3300009011 | Ga0105251_10013238 | Ga0105251_100132385 | 224 |
| 4 | 3300009036 | Ga0105244_10000031 | Ga0105244_1000003190 | 224 |
| 5 | 3300009092 | Ga0105250_10004328 | Ga0105250_100043288 | 224 |
| 6 | 3300009101 | Ga0105247_10000048 | Ga0105247_1000004867 | 224 |
| 7 | 3300013100 | Ga0157373_10000473 | Ga0157373_1000047314 | 224 |
| 8 | 3300013100 | Ga0157373_10004828 | Ga0157373_1000482811 | 224 |
| 9 | 3300013102 | Ga0157371_10001529 | Ga0157371_100015292 | 224 |
| 10 | 3300013102 | Ga0157371_10003068 | Ga0157371_1000306810 | 224 |
| 11 | 3300013104 | Ga0157370_10000572 | Ga0157370_100005729 | 224 |
| 12 | 3300017792 | Ga0163161_10000005 | Ga0163161_10000005201 | 224 |
| 13 | 3300025711 | Ga0207696_1000035 | Ga0207696_1000035156 | 224 |
| 14 | 3300025711 | Ga0207696_1000039 | Ga0207696_100003993 | 224 |
| 15 | 3300025728 | Ga0207655_1022327 | Ga0207655_10223273 | 224 |
| 16 | 3300025735 | Ga0207713_1000086 | Ga0207713_100008677 | 224 |
| 17 | 3300025735 | Ga0207713_1072527 | Ga0207713_10725272 | 224 |
| 18 | 3300025900 | Ga0207710_10000026 | Ga0207710_1000002677 | 224 |
| 19 | 3300027312 | Ga0209371_1003222 | Ga0209371_10032227 | 224 |
| 20 | 3300041405 | Ga0439438_000002 | Ga0439438_000002_562159_562839 | 224 |
| 21 | 3300041405 | Ga0439438_001311 | Ga0439438_001311_1542_2222 | 224 |
| 22 | 3300041407 | Ga0439447_002008 | Ga0439447_002008_6117_6797 | 224 |
| 23 | 3300041407 | Ga0439447_017403 | Ga0439447_017403_1091_1771 | 224 |
| 24 | 3300042006 | Ga0439432_001917 | Ga0439432_001917_2886_3566 | 224 |
| 25 | 3300046453 | Ga0495627_000128 | Ga0495627_000128_11698_12378 | 224 |
| 26 | 3300046500 | Ga0495596_0016371 | Ga0495596_0016371_546_1226 | 224 |
| 27 | 3300046519 | Ga0495632_0081951 | Ga0495632_0081951_51_731 | 224 |
| 28 | 3300046530 | Ga0495654_0000033 | Ga0495654_0000033_144577_145257 | 224 |
| 29 | 3300047470 | Ga0495681_0049006 | Ga0495681_0049006_1170_1850 | 224 |
| 30 | 3300048904 | Ga0496101_0000120 | Ga0496101_0000120_57612_58292 | 224 |
| 31 | 3300048919 | Ga0496116_0000007 | Ga0496116_0000007_721520_722200 | 224 |
| 32 | 3300048919 | Ga0496116_0000283 | Ga0496116_0000283_64624_65304 | 224 |
| 33 | 3300048919 | Ga0496116_0028363 | Ga0496116_0028363_1287_1967 | 224 |
| 34 | 3300048920 | Ga0496117_0019055 | Ga0496117_0019055_1975_2655 | 224 |
| 35 | 3300048921 | Ga0496118_0044060 | Ga0496118_0044060_1162_1842 | 224 |
| 36 | 3300048922 | Ga0496119_0000214 | Ga0496119_0000214_20314_20994 | 224 |
| 37 | 3300048922 | Ga0496119_0005412 | Ga0496119_0005412_1164_1844 | 224 |
| 38 | 3300048922 | Ga0496119_0060680 | Ga0496119_0060680_904_1584 | 224 |
| 39 | 3300048923 | Ga0496120_0000035 | Ga0496120_0000035_62539_63219 | 224 |
| 40 | 3300048923 | Ga0496120_0000064 | Ga0496120_0000064_74022_74702 | 224 |
| 41 | 3300048923 | Ga0496120_0000826 | Ga0496120_0000826_12133_12813 | 224 |
| 42 | 3300048925 | Ga0496122_0010760 | Ga0496122_0010760_7977_8657 | 224 |
| 43 | 3300048926 | Ga0496123_0008677 | Ga0496123_0008677_1746_2426 | 224 |
| 44 | 3300048927 | Ga0496124_0051094 | Ga0496124_0051094_198_878 | 224 |
| 45 | 3300048927 | Ga0496124_0093443 | Ga0496124_0093443_1030_1710 | 224 |
| 46 | 3300050491 | nmdc:mga00v17_7724_c1 | nmdc:mga00v17_7724_c1_4923_5603 | 224 |
| 47 | 3300002737 | JGI25162J39368_1000126 | JGI25162J39368_10001263 | 225 |
| 48 | 3300002772 | JGI25164J39214_1000100 | JGI25164J39214_10001003 | 225 |
| 49 | 3300003214 | JGI25165J46597_1000207 | JGI25165J46597_10002073 | 225 |
| 50 | 3300005289 | Ga0065704_10082904 | Ga0065704_100829041 | 225 |
| 51 | 3300005458 | Ga0070681_10301329 | Ga0070681_103013292 | 225 |
| 52 | 3300006237 | Ga0097621_100551519 | Ga0097621_1005515191 | 225 |
| 53 | 3300009148 | Ga0105243_10001767 | Ga0105243_1000176712 | 225 |
| 54 | 3300009551 | Ga0105238_11323403 | Ga0105238_113234031 | 225 |
| 55 | 3300014497 | Ga0182008_10000570 | Ga0182008_100005703 | 225 |
| 56 | 3300025231 | Ga0207427_100001 | Ga0207427_100001224 | 225 |
| 57 | 3300025233 | Ga0209437_100003 | Ga0209437_1000031148 | 225 |
| 58 | 3300025261 | Ga0209233_1000007 | Ga0209233_1000007224 | 225 |
| 59 | 3300025912 | Ga0207707_10293602 | Ga0207707_102936022 | 225 |
| 60 | 3300025935 | Ga0207709_10034539 | Ga0207709_100345393 | 225 |
| 61 | 3300031249 | Ga0265339_10226017 | Ga0265339_102260171 | 225 |
| 62 | 3300031691 | Ga0316579_10000057 | Ga0316579_100000573 | 225 |
| 63 | 3300031733 | Ga0316577_10007619 | Ga0316577_100076192 | 225 |
| 64 | 3300032137 | Ga0316585_10006649 | Ga0316585_100066494 | 225 |
| 65 | 3300032168 | Ga0316593_10001028 | Ga0316593_100010282 | 225 |
| 66 | 3300036647 | Ga0316582_0001289 | Ga0316582_0001289_3352_4029 | 225 |
| 67 | 3300036647 | Ga0316582_0147306 | Ga0316582_0147306_630_1307 | 225 |
| 68 | 3300036712 | Ga0316584_0001968 | Ga0316584_0001968_1574_2251 | 225 |
| 69 | 3300036712 | Ga0316584_0542910 | Ga0316584_0542910_47_724 | 225 |
| 70 | 3300037588 | Ga0316581_0060986 | Ga0316581_0060986_34_711 | 225 |
| 71 | 3300039062 | Ga0400483_067590 | Ga0400483_067590_31360_32037 | 225 |
| 72 | 3300039093 | Ga0400489_01548 | Ga0400489_01548_36_713 | 225 |
| 73 | 3300039110 | Ga0400487_32164 | Ga0400487_32164_29979_30659 | 225 |
| 74 | 3300041411 | Ga0439466_0003474 | Ga0439466_0003474_4448_5125 | 225 |
| 75 | 3300041411 | Ga0439466_0054106 | Ga0439466_0054106_359_1036 | 225 |
| 76 | 3300042439 | Ga0439464_0004718 | Ga0439464_0004718_1968_2645 | 225 |
| 77 | 3300046455 | Ga0495603_0126094 | Ga0495603_0126094_421_1098 | 225 |
| 78 | 3300046474 | Ga0495605_0020101 | Ga0495605_0020101_2537_3214 | 225 |
| 79 | 3300046501 | Ga0495607_0000213 | Ga0495607_0000213_2919_3596 | 225 |
| 80 | 3300046501 | Ga0495607_0194454 | Ga0495607_0194454_282_959 | 225 |
| 81 | 3300046810 | Ga0495660_0003768 | Ga0495660_0003768_1811_2488 | 225 |
| 82 | 3300047321 | Ga0495676_0009626 | Ga0495676_0009626_1970_2647 | 225 |
| 83 | iso_pu_bacteria | 2510065053 | 2510284916 | 225 |
| 84 | iso_pu_bacteria | 2510065055 | 2510295225 | 225 |
| 85 | iso_pu_bacteria | 2510065058 | 2510312294 | 225 |
| 86 | iso_pu_bacteria | 2511231004 | 2511257400 | 225 |
| 87 | iso_pu_bacteria | 2511231012 | 2511301352 | 225 |
| 88 | iso_pu_bacteria | 2511231016 | 2511323548 | 225 |
| 89 | iso_pu_bacteria | 2511231021 | 2511355009 | 225 |
| 90 | iso_pu_bacteria | 2511231022 | 2511364016 | 225 |
| 91 | iso_pu_bacteria | 2511231024 | 2511375564 | 225 |
| 92 | iso_pu_bacteria | 2511231156 | 2511826710 | 225 |
| 93 | iso_pu_bacteria | 2554235132 | 2554817006 | 225 |
| 94 | iso_pu_bacteria | 2554235231 | 2555244596 | 225 |
| 95 | iso_pu_bacteria | 2554235341 | 2555668032 | 225 |
| 96 | iso_pu_bacteria | 2597489889 | 2597868046 | 225 |
| 97 | iso_pu_bacteria | 2599185155 | 2599330096 | 225 |
| 98 | iso_pu_bacteria | 2599185167 | 2599397067 | 225 |
| 99 | iso_pu_bacteria | 2599185179 | 2599449060 | 225 |
| 100 | iso_pu_bacteria | 2599185189 | 2599508822 | 225 |
| 101 | iso_pu_bacteria | 2599185190 | 2599511196 | 225 |
| 102 | iso_pu_bacteria | 2599185191 | 2599519313 | 225 |
| 103 | iso_pu_bacteria | 2599185290 | 2599890570 | 225 |
| 104 | iso_pu_bacteria | 2599185307 | 2599974107 | 225 |
| 105 | iso_pu_bacteria | 2599185309 | 2599985821 | 225 |
| 106 | iso_pu_bacteria | 2599185310 | 2599990715 | 225 |
| 107 | iso_pu_bacteria | 2599185356 | 2600214488 | 225 |
| 108 | iso_pu_bacteria | 2600254954 | 2600442962 | 225 |
| 109 | iso_pu_bacteria | 2600255283 | 2601625734 | 225 |
| 110 | iso_pu_bacteria | 2600255296 | 2601690912 | 225 |
| 111 | iso_pu_bacteria | 2600255313 | 2601774807 | 225 |
| 112 | iso_pu_bacteria | 2600255318 | 2601800065 | 225 |
| 113 | iso_pu_bacteria | 2600255389 | 2602009562 | 225 |
| 114 | iso_pu_bacteria | 2603880185 | 2606074671 | 225 |
| 115 | iso_pu_bacteria | 2603880199 | 2606127534 | 225 |
| 116 | iso_pu_bacteria | 2606217733 | 2608379675 | 225 |
| 117 | iso_pu_bacteria | 2643221571 | 2643868902 | 225 |
| 118 | iso_pu_bacteria | 2643221589 | 2643952319 | 225 |
| 119 | iso_pu_bacteria | 2643221602 | 2644023918 | 225 |
| 120 | iso_pu_bacteria | 2643221633 | 2644188324 | 225 |
| 121 | iso_pu_bacteria | 2643221713 | 2644624003 | 225 |
| 122 | iso_pu_bacteria | 2675903420 | 2677898733 | 225 |
| 123 | iso_pu_bacteria | 2687453129 | 2687578972 | 225 |
| 124 | iso_pu_bacteria | 2713897149 | 2715757529 | 225 |
| 125 | iso_pu_bacteria | 2721755607 | 2723247216 | 225 |
| 126 | iso_pu_bacteria | 2738541271 | 2738691552 | 225 |
| 127 | iso_pu_bacteria | 2738543004 | 2739198357 | 225 |
| 128 | iso_pu_bacteria | 2738543016 | 2739267327 | 225 |
| 129 | iso_pu_bacteria | 2738543020 | 2739286204 | 225 |
| 130 | iso_pu_bacteria | 2738543021 | 2739291517 | 225 |
| 131 | iso_pu_bacteria | 2765235841 | 2765585695 | 225 |
| 132 | iso_pu_bacteria | 2773857672 | 2774132316 | 225 |
| 133 | iso_pu_bacteria | 2784132063 | 2784260463 | 225 |
| 134 | iso_pu_bacteria | 2806310737 | 2807406920 | 225 |
| 135 | iso_pu_bacteria | 2806310745 | 2807455252 | 225 |
| 136 | iso_pu_bacteria | 2808606373 | 2808904663 | 225 |
| 137 | iso_pu_bacteria | 2808606379 | 2808941654 | 225 |
| 138 | iso_pu_bacteria | 2808606445 | 2809215750 | 225 |
| 139 | iso_pu_bacteria | 2811994881 | 2812368115 | 225 |
| 140 | iso_pu_bacteria | 2818991456 | 2819658367 | 225 |
| 141 | iso_pu_bacteria | 2818991464 | 2819702716 | 225 |
| 142 | iso_pu_bacteria | 2823421272 | 2823424591 | 225 |
| 143 | iso_pu_bacteria | 2825651385 | 2825656028 | 225 |
| 144 | iso_pu_bacteria | 2826581358 | 2826585735 | 225 |
| 145 | iso_pu_bacteria | 2834028612 | 2834029001 | 225 |
| 146 | iso_pu_bacteria | 2842805378 | 2842805625 | 225 |
| 147 | iso_pu_bacteria | 2842815866 | 2842818605 | 225 |
| 148 | iso_pu_bacteria | 2842826826 | 2842828718 | 225 |
| 149 | iso_pu_bacteria | 2842832357 | 2842835719 | 225 |
| 150 | iso_pu_bacteria | 2842837860 | 2842843218 | 225 |
| 151 | iso_pu_bacteria | 2842843487 | 2842847466 | 225 |
| 152 | iso_pu_bacteria | 2842849001 | 2842853827 | 225 |
| 153 | iso_pu_bacteria | 2842854478 | 2842856432 | 225 |
| 154 | iso_pu_bacteria | 2852612431 | 2852615514 | 225 |
| 155 | iso_pu_bacteria | 2852657418 | 2852662832 | 225 |
| 156 | iso_pu_bacteria | 2852667396 | 2852670482 | 225 |
| 157 | iso_pu_bacteria | 2860339153 | 2860340645 | 225 |
| 158 | iso_pu_bacteria | 2860867994 | 2860869030 | 225 |
| 159 | iso_pu_bacteria | 2878029506 | 2878030776 | 225 |
| 160 | iso_pu_bacteria | 2880230671 | 2880231688 | 225 |
| 161 | iso_pu_bacteria | 2904518522 | 2904520723 | 225 |
| 162 | iso_pu_bacteria | 2904550169 | 2904551108 | 225 |
| 163 | iso_pu_bacteria | 2908446538 | 2908447823 | 225 |
| 164 | iso_pu_bacteria | 2912963787 | 2912967959 | 225 |
| 165 | iso_pu_bacteria | 2913036834 | 2913041684 | 225 |
| 166 | iso_pu_bacteria | 2919063839 | 2919067274 | 225 |
| 167 | iso_pu_bacteria | 2919155634 | 2919159282 | 225 |
| 168 | iso_pu_bacteria | 2919385768 | 2919385827 | 225 |
| 169 | iso_pu_bacteria | 2919456309 | 2919458354 | 225 |
| 170 | iso_pu_bacteria | 2919481497 | 2919484622 | 225 |
| 171 | iso_pu_bacteria | 2919487758 | 2919492795 | 225 |
| 172 | iso_pu_bacteria | 2919501602 | 2919504321 | 225 |
| 173 | iso_pu_bacteria | 2919697872 | 2919699944 | 225 |
| 174 | iso_pu_bacteria | 2923153595 | 2923154666 | 225 |
| 175 | iso_pu_bacteria | 2923519811 | 2923522168 | 225 |
| 176 | iso_pu_bacteria | 2923586266 | 2923590333 | 225 |
| 177 | iso_pu_bacteria | 2926063275 | 2926065106 | 225 |
| 178 | iso_pu_bacteria | 2929144301 | 2929149007 | 225 |
| 179 | iso_pu_bacteria | 2929189879 | 2929191027 | 225 |
| 180 | iso_pu_bacteria | 2931369376 | 2931373572 | 225 |
| 181 | iso_pu_bacteria | 2931390751 | 2931392032 | 225 |
| 182 | iso_pu_bacteria | 2931396565 | 2931399453 | 225 |
| 183 | iso_pu_bacteria | 2935353572 | 2935353967 | 225 |
| 184 | iso_pu_bacteria | 2939636861 | 2939638125 | 225 |
| 185 | iso_pu_bacteria | 2945928738 | 2945929553 | 225 |
| 186 | iso_pu_bacteria | 2945961074 | 2945961257 | 225 |
| 187 | iso_pu_bacteria | 2946006987 | 2946011832 | 225 |
| 188 | iso_pu_bacteria | 2946027586 | 2946029276 | 225 |
| 189 | iso_pu_bacteria | 2952252522 | 2952252652 | 225 |
| 190 | iso_pu_bacteria | 2969304461 | 2969305599 | 225 |
| 191 | iso_pu_bacteria | 2974289157 | 2974292770 | 225 |
| 192 | iso_pu_bacteria | 2974298342 | 2974298758 | 225 |
| 193 | iso_pu_bacteria | 2984286254 | 2984291363 | 225 |
| 194 | iso_pu_bacteria | 2984499530 | 2984501050 | 225 |
| 195 | iso_pu_bacteria | 2984504281 | 2984505503 | 225 |
| 196 | iso_pu_bacteria | 2988728565 | 2988730604 | 225 |
| 197 | iso_pu_bacteria | 2990196909 | 2990198322 | 225 |
| 198 | iso_pu_bacteria | 2998139840 | 2998141041 | 225 |
| 199 | iso_pu_bacteria | 3007252601 | 3007253692 | 225 |
| 200 | iso_pu_bacteria | 3007315729 | 3007317534 | 225 |
| 201 | iso_pu_bacteria | 3007395558 | 3007400196 | 225 |
| 202 | iso_pu_bacteria | 3007419365 | 3007420680 | 225 |
| 203 | iso_pu_bacteria | 3007511990 | 3007516339 | 225 |
| 204 | iso_pu_bacteria | 3007614139 | 3007618773 | 225 |
| 205 | iso_pu_bacteria | 3007619802 | 3007622077 | 225 |
| 206 | iso_pu_bacteria | 3007718800 | 3007719277 | 225 |
| 207 | iso_pu_bacteria | 3007803356 | 3007808413 | 225 |
| 208 | iso_pu_bacteria | 3007855910 | 3007860925 | 225 |
| 209 | iso_pu_bacteria | 3007861166 | 3007863737 | 225 |
| 210 | iso_pu_bacteria | 3007866637 | 3007867648 | 225 |
| 211 | iso_pu_bacteria | 3007872151 | 3007875426 | 225 |
| 212 | iso_pu_bacteria | 8011350971 | 8011353179 | 225 |
| 213 | iso_pu_bacteria | 8015687852 | 8015688902 | 225 |
| 214 | iso_pu_bacteria | 8019769354 | 8019773280 | 225 |
| 215 | iso_pu_bacteria | 8019775933 | 8019776610 | 225 |
| 216 | iso_pu_bacteria | 8029995093 | 8029999721 | 225 |
| 217 | iso_pu_bacteria | 8034962539 | 8034962576 | 225 |
| 218 | iso_pu_bacteria | 8052494512 | 8052495670 | 225 |
| 219 | iso_pu_bacteria | 8054285046 | 8054286227 | 225 |
| 220 | iso_pu_bacteria | 8054347763 | 8054352556 | 225 |
| 221 | iso_pu_bacteria | 8054503363 | 8054504610 | 225 |
| 222 | iso_pu_bacteria | 8054929484 | 8054933236 | 225 |
| 223 | iso_pu_bacteria | 8055770955 | 8055772019 | 225 |
| 224 | iso_pu_bacteria | 8055817908 | 8055819052 | 225 |
| 225 | iso_pu_bacteria | 8055878733 | 8055884063 | 225 |
| 226 | iso_pu_bacteria | 8056115690 | 8056117436 | 225 |
| 227 | iso_pu_bacteria | 8056120720 | 8056124778 | 225 |
| 228 | iso_pu_bacteria | 8056125926 | 8056127085 | 225 |
| 229 | iso_pu_bacteria | 8056131705 | 8056132921 | 225 |
| 230 | iso_pu_bacteria | 8056137416 | 8056138574 | 225 |
| 231 | iso_pu_bacteria | 8056143049 | 8056144387 | 225 |
| 232 | iso_pu_bacteria | 8056148874 | 8056149137 | 225 |
| 233 | iso_pu_bacteria | 8056155041 | 8056155599 | 225 |
| 234 | iso_pu_bacteria | 8056161164 | 8056161204 | 225 |
| 235 | iso_pu_bacteria | 8056166840 | 8056170010 | 225 |
| 236 | iso_pu_bacteria | 8056172158 | 8056176144 | 225 |
| 237 | iso_pu_bacteria | 8056177738 | 8056180573 | 225 |
| 238 | iso_pu_bacteria | 8056569372 | 8056569691 | 225 |
| 239 | iso_pu_bacteria | 8057160832 | 8057161897 | 225 |
| 240 | iso_pu_bacteria | 8057798959 | 8057803308 | 225 |
| 241 | 3300005466 | Ga0070685_10023831 | Ga0070685_100238312 | 226 |
| 242 | 3300006358 | Ga0068871_100097715 | Ga0068871_1000977153 | 226 |
| 243 | 3300013105 | Ga0157369_10234656 | Ga0157369_102346561 | 226 |
| 244 | 3300014969 | Ga0157376_10301049 | Ga0157376_103010492 | 226 |
| 245 | 3300026121 | Ga0207683_10710897 | Ga0207683_107108972 | 226 |
| 246 | 3300031665 | Ga0316575_10039977 | Ga0316575_100399772 | 226 |
| 247 | 3300031728 | Ga0316578_10115257 | Ga0316578_101152573 | 226 |
| 248 | 3300032137 | Ga0316585_10003715 | Ga0316585_100037154 | 226 |
| 249 | 3300032137 | Ga0316585_10029843 | Ga0316585_100298432 | 226 |
| 250 | 3300032168 | Ga0316593_10003019 | Ga0316593_100030195 | 226 |
| 251 | 3300032168 | Ga0316593_10055671 | Ga0316593_100556712 | 226 |
| 252 | 3300035398 | Ga0316574_0224641 | Ga0316574_0224641_15_695 | 226 |
| 253 | 3300036647 | Ga0316582_0215001 | Ga0316582_0215001_422_1102 | 226 |
| 254 | 3300036712 | Ga0316584_0015811 | Ga0316584_0015811_223_903 | 226 |
| 255 | 3300036712 | Ga0316584_0138709 | Ga0316584_0138709_813_1493 | 226 |
| 256 | 3300037588 | Ga0316581_0019261 | Ga0316581_0019261_1039_1719 | 226 |
| 257 | 3300047472 | Ga0495686_0038525 | Ga0495686_0038525_1382_2068 | 226 |
| 258 | 3300048927 | Ga0496124_0170728 | Ga0496124_0170728_647_1327 | 226 |
| 259 | 3300049570 | Ga0501033_0002742 | Ga0501033_0002742_4522_5202 | 226 |
| 260 | 3300049571 | Ga0501034_0010942 | Ga0501034_0010942_1931_2611 | 226 |
| 261 | 3300049571 | Ga0501034_0402076 | Ga0501034_0402076_206_886 | 226 |
| 262 | 3300049572 | Ga0501036_0025136 | Ga0501036_0025136_529_1209 | 226 |
| 263 | 3300049573 | Ga0501037_0006118 | Ga0501037_0006118_3806_4486 | 226 |
| 264 | 3300049574 | Ga0501038_0024540 | Ga0501038_0024540_881_1561 | 226 |
| 265 | 3300049575 | Ga0501039_0328273 | Ga0501039_0328273_304_984 | 226 |
| 266 | 3300049579 | Ga0501043_0007906 | Ga0501043_0007906_3478_4158 | 226 |
| 267 | 3300049580 | Ga0501046_0021216 | Ga0501046_0021216_595_1275 | 226 |
| 268 | 3300049581 | Ga0501047_0022290 | Ga0501047_0022290_3737_4417 | 226 |
| 269 | 3300049589 | Ga0501073_0001320 | Ga0501073_0001320_13309_13989 | 226 |
| 270 | 3300049741 | Ga0501079_0131953 | Ga0501079_0131953_557_1237 | 226 |
| 271 | 3300049742 | Ga0501080_0021156 | Ga0501080_0021156_4722_5402 | 226 |
| 272 | 3300049744 | Ga0501083_0068627 | Ga0501083_0068627_561_1241 | 226 |
| 273 | 3300049822 | Ga0501035_0017408 | Ga0501035_0017408_4323_5003 | 226 |
| 274 | 3300049823 | Ga0501044_0011188 | Ga0501044_0011188_7224_7904 | 226 |
| 275 | 3300053087 | Ga0500643_033704 | Ga0500643_033704_178_864 | 226 |
| 276 | 3300060353 | Ga0501082_0031337 | Ga0501082_0031337_217_897 | 226 |
| 277 | 3300005331 | Ga0070670_100039675 | Ga0070670_1000396754 | 227 |
| 278 | 3300005337 | Ga0070682_100112133 | Ga0070682_1001121333 | 227 |
| 279 | 3300005344 | Ga0070661_100187131 | Ga0070661_1001871313 | 227 |
| 280 | 3300005354 | Ga0070675_100266241 | Ga0070675_1002662412 | 227 |
| 281 | 3300005354 | Ga0070675_100438502 | Ga0070675_1004385022 | 227 |
| 282 | 3300005366 | Ga0070659_100859398 | Ga0070659_1008593981 | 227 |
| 283 | 3300005440 | Ga0070705_100284555 | Ga0070705_1002845552 | 227 |
| 284 | 3300005441 | Ga0070700_100230606 | Ga0070700_1002306062 | 227 |
| 285 | 3300005457 | Ga0070662_100321900 | Ga0070662_1003219002 | 227 |
| 286 | 3300005543 | Ga0070672_100005085 | Ga0070672_1000050858 | 227 |
| 287 | 3300005543 | Ga0070672_100229971 | Ga0070672_1002299713 | 227 |
| 288 | 3300005564 | Ga0070664_100030848 | Ga0070664_1000308482 | 227 |
| 289 | 3300005617 | Ga0068859_100862854 | Ga0068859_1008628542 | 227 |
| 290 | 3300005719 | Ga0068861_100287238 | Ga0068861_1002872382 | 227 |
| 291 | 3300005841 | Ga0068863_100375408 | Ga0068863_1003754082 | 227 |
| 292 | 3300005844 | Ga0068862_100420169 | Ga0068862_1004201693 | 227 |
| 293 | 3300006881 | Ga0068865_100232472 | Ga0068865_1002324722 | 227 |
| 294 | 3300006931 | Ga0097620_100862849 | Ga0097620_1008628492 | 227 |
| 295 | 3300013308 | Ga0157375_10043888 | Ga0157375_100438882 | 227 |
| 296 | 3300014326 | Ga0157380_10004215 | Ga0157380_100042152 | 227 |
| 297 | 3300025926 | Ga0207659_10128848 | Ga0207659_101288482 | 227 |
| 298 | 3300025926 | Ga0207659_10322124 | Ga0207659_103221242 | 227 |
| 299 | 3300025938 | Ga0207704_10142299 | Ga0207704_101422992 | 227 |
| 300 | 3300025940 | Ga0207691_10016948 | Ga0207691_100169487 | 227 |
| 301 | 3300025945 | Ga0207679_10086668 | Ga0207679_100866681 | 227 |
| 302 | 3300026067 | Ga0207678_10131305 | Ga0207678_101313053 | 227 |
| 303 | 3300026075 | Ga0207708_10023462 | Ga0207708_100234624 | 227 |
| 304 | 3300026088 | Ga0207641_10077604 | Ga0207641_100776043 | 227 |
| 305 | 3300026089 | Ga0207648_10606762 | Ga0207648_106067621 | 227 |
| 306 | 3300026118 | Ga0207675_100327998 | Ga0207675_1003279982 | 227 |
| 307 | 3300032126 | Ga0307415_100313280 | Ga0307415_1003132802 | 227 |
| 308 | 3300039062 | Ga0400483_004725 | Ga0400483_004725_89356_90054 | 227 |
| 309 | 3300039062 | Ga0400483_113686 | Ga0400483_113686_67256_67945 | 227 |
| 310 | 3300046501 | Ga0495607_0006701 | Ga0495607_0006701_21_704 | 227 |
| 311 | 3300046519 | Ga0495632_0006071 | Ga0495632_0006071_3202_3885 | 227 |
| 312 | 3300046520 | Ga0495637_0013628 | Ga0495637_0013628_3151_3834 | 227 |
| 313 | 3300046522 | Ga0495643_0024183 | Ga0495643_0024183_2618_3301 | 227 |
| 314 | 3300046524 | Ga0495648_0061188 | Ga0495648_0061188_1301_1984 | 227 |
| 315 | 3300046530 | Ga0495654_0014186 | Ga0495654_0014186_917_1600 | 227 |
| 316 | 3300046616 | Ga0495668_0005973 | Ga0495668_0005973_2914_3597 | 227 |
| 317 | 3300046794 | Ga0495589_0087818 | Ga0495589_0087818_718_1407 | 227 |
| 318 | 3300047469 | Ga0495673_0015361 | Ga0495673_0015361_2741_3424 | 227 |
| 319 | 3300049459 | Ga0495678_000031 | Ga0495678_000031_90528_91211 | 227 |
| 320 | 3300049586 | Ga0501070_0007478 | Ga0501070_0007478_2829_3518 | 227 |
| 321 | 3300049587 | Ga0501071_0027598 | Ga0501071_0027598_3011_3700 | 227 |
| 322 | 3300049589 | Ga0501073_0000314 | Ga0501073_0000314_7461_8150 | 227 |
| 323 | 3300049590 | Ga0501074_0016769 | Ga0501074_0016769_2926_3615 | 227 |
| 324 | 3300049593 | Ga0501077_0000591 | Ga0501077_0000591_3084_3773 | 227 |
| 325 | 3300049741 | Ga0501079_0000274 | Ga0501079_0000274_2559_3248 | 227 |
| 326 | 3300049742 | Ga0501080_0007557 | Ga0501080_0007557_1859_2548 | 227 |
| 327 | 3300049744 | Ga0501083_0045222 | Ga0501083_0045222_35_724 | 227 |
| 328 | 3300060353 | Ga0501082_0056798 | Ga0501082_0056798_2520_3209 | 227 |
| 329 | 3300005333 | Ga0070677_10008755 | Ga0070677_100087553 | 228 |
| 330 | 3300005337 | Ga0070682_100137545 | Ga0070682_1001375452 | 228 |
| 331 | 3300005347 | Ga0070668_100079640 | Ga0070668_1000796403 | 228 |
| 332 | 3300005353 | Ga0070669_100106952 | Ga0070669_1001069522 | 228 |
| 333 | 3300005354 | Ga0070675_100004279 | Ga0070675_10000427912 | 228 |
| 334 | 3300005354 | Ga0070675_100029716 | Ga0070675_1000297164 | 228 |
| 335 | 3300005356 | Ga0070674_100024236 | Ga0070674_1000242363 | 228 |
| 336 | 3300005356 | Ga0070674_100065806 | Ga0070674_1000658062 | 228 |
| 337 | 3300005364 | Ga0070673_100010143 | Ga0070673_1000101432 | 228 |
| 338 | 3300005365 | Ga0070688_100035678 | Ga0070688_1000356781 | 228 |
| 339 | 3300005456 | Ga0070678_100068023 | Ga0070678_1000680233 | 228 |
| 340 | 3300005456 | Ga0070678_100079035 | Ga0070678_1000790352 | 228 |
| 341 | 3300005459 | Ga0068867_100141430 | Ga0068867_1001414302 | 228 |
| 342 | 3300005466 | Ga0070685_10053201 | Ga0070685_100532012 | 228 |
| 343 | 3300005466 | Ga0070685_10183733 | Ga0070685_101837332 | 228 |
| 344 | 3300005543 | Ga0070672_100068414 | Ga0070672_1000684142 | 228 |
| 345 | 3300005543 | Ga0070672_100089962 | Ga0070672_1000899623 | 228 |
| 346 | 3300005548 | Ga0070665_100002619 | Ga0070665_1000026192 | 228 |
| 347 | 3300005617 | Ga0068859_100067363 | Ga0068859_1000673634 | 228 |
| 348 | 3300005617 | Ga0068859_100233488 | Ga0068859_1002334883 | 228 |
| 349 | 3300005618 | Ga0068864_100642716 | Ga0068864_1006427162 | 228 |
| 350 | 3300005840 | Ga0068870_10003293 | Ga0068870_100032935 | 228 |
| 351 | 3300005844 | Ga0068862_100240770 | Ga0068862_1002407703 | 228 |
| 352 | 3300006881 | Ga0068865_100161982 | Ga0068865_1001619822 | 228 |
| 353 | 3300006931 | Ga0097620_100067364 | Ga0097620_1000673644 | 228 |
| 354 | 3300006931 | Ga0097620_100233478 | Ga0097620_1002334783 | 228 |
| 355 | 3300006931 | Ga0097620_100328601 | Ga0097620_1003286013 | 228 |
| 356 | 3300014326 | Ga0157380_10037459 | Ga0157380_100374594 | 228 |
| 357 | 3300014326 | Ga0157380_10145508 | Ga0157380_101455082 | 228 |
| 358 | 3300014326 | Ga0157380_10295877 | Ga0157380_102958772 | 228 |
| 359 | 3300014969 | Ga0157376_10489937 | Ga0157376_104899372 | 228 |
| 360 | 3300025893 | Ga0207682_10000686 | Ga0207682_100006868 | 228 |
| 361 | 3300025893 | Ga0207682_10006464 | Ga0207682_100064646 | 228 |
| 362 | 3300025893 | Ga0207682_10042409 | Ga0207682_100424093 | 228 |
| 363 | 3300025899 | Ga0207642_10282934 | Ga0207642_102829342 | 228 |
| 364 | 3300025908 | Ga0207643_10017116 | Ga0207643_100171164 | 228 |
| 365 | 3300025908 | Ga0207643_10153430 | Ga0207643_101534302 | 228 |
| 366 | 3300025915 | Ga0207693_10339662 | Ga0207693_103396622 | 228 |
| 367 | 3300025916 | Ga0207663_10506160 | Ga0207663_105061602 | 228 |
| 368 | 3300025923 | Ga0207681_10027485 | Ga0207681_100274853 | 228 |
| 369 | 3300025926 | Ga0207659_10008076 | Ga0207659_100080763 | 228 |
| 370 | 3300025926 | Ga0207659_10023389 | Ga0207659_100233893 | 228 |
| 371 | 3300025935 | Ga0207709_10616165 | Ga0207709_106161651 | 228 |
| 372 | 3300025936 | Ga0207670_10085861 | Ga0207670_100858613 | 228 |
| 373 | 3300025937 | Ga0207669_10009009 | Ga0207669_100090092 | 228 |
| 374 | 3300025937 | Ga0207669_10037715 | Ga0207669_100377152 | 228 |
| 375 | 3300025937 | Ga0207669_10048097 | Ga0207669_100480973 | 228 |
| 376 | 3300025938 | Ga0207704_10031354 | Ga0207704_100313543 | 228 |
| 377 | 3300025940 | Ga0207691_10023826 | Ga0207691_100238266 | 228 |
| 378 | 3300025942 | Ga0207689_10109731 | Ga0207689_101097313 | 228 |
| 379 | 3300025960 | Ga0207651_10005709 | Ga0207651_100057096 | 228 |
| 380 | 3300025972 | Ga0207668_10073304 | Ga0207668_100733043 | 228 |
| 381 | 3300025972 | Ga0207668_10273018 | Ga0207668_102730183 | 228 |
| 382 | 3300026075 | Ga0207708_10124399 | Ga0207708_101243992 | 228 |
| 383 | 3300026089 | Ga0207648_10268718 | Ga0207648_102687182 | 228 |
| 384 | 3300026095 | Ga0207676_10601188 | Ga0207676_106011882 | 228 |
| 385 | 3300026118 | Ga0207675_100068850 | Ga0207675_1000688502 | 228 |
| 386 | 3300026121 | Ga0207683_10039155 | Ga0207683_100391554 | 228 |
| 387 | 3300026121 | Ga0207683_10127202 | Ga0207683_101272022 | 228 |
| 388 | 3300028379 | Ga0268266_10041404 | Ga0268266_100414044 | 228 |
| 389 | 3300028380 | Ga0268265_10069157 | Ga0268265_100691572 | 228 |
| 390 | 3300031456 | Ga0307513_10007954 | Ga0307513_1000795410 | 228 |
| 391 | 3300031507 | Ga0307509_10008745 | Ga0307509_100087455 | 228 |
| 392 | 3300031901 | Ga0307406_10012977 | Ga0307406_100129774 | 228 |
| 393 | 3300031903 | Ga0307407_10283524 | Ga0307407_102835242 | 228 |
| 394 | 3300031995 | Ga0307409_100008553 | Ga0307409_1000085537 | 228 |
| 395 | 3300031995 | Ga0307409_100069783 | Ga0307409_1000697833 | 228 |
| 396 | 3300032002 | Ga0307416_100006820 | Ga0307416_1000068202 | 228 |
| 397 | 3300032004 | Ga0307414_10409439 | Ga0307414_104094392 | 228 |
| 398 | 3300032005 | Ga0307411_10067409 | Ga0307411_100674093 | 228 |
| 399 | 3300032168 | Ga0316593_10128852 | Ga0316593_101288521 | 228 |
| 400 | 3300035086 | Ga0373934_0074571 | Ga0373934_0074571_556_1248 | 228 |
| 401 | 3300035172 | Ga0373955_0054195 | Ga0373955_0054195_825_1517 | 228 |
| 402 | 3300035724 | Ga0373933_0038554 | Ga0373933_0038554_1339_2031 | 228 |
| 403 | 3300036401 | Ga0373937_0002058 | Ga0373937_0002058_3901_4593 | 228 |
| 404 | 3300041453 | Ga0451797_0851571 | Ga0451797_0851571_1287_1979 | 228 |
| 405 | 3300041486 | Ga0451807_0342670 | Ga0451807_0342670_664_1356 | 228 |
| 406 | 3300041486 | Ga0451807_0343574 | Ga0451807_0343574_981_1673 | 228 |
| 407 | 3300041486 | Ga0451807_1464927 | Ga0451807_1464927_4210_4902 | 228 |
| 408 | 3300041512 | Ga0451853_1748554 | Ga0451853_1748554_40_732 | 228 |
| 409 | 3300046460 | Ga0495638_0004299 | Ga0495638_0004299_3066_3758 | 228 |
| 410 | 3300046513 | Ga0495616_0003504 | Ga0495616_0003504_8360_9052 | 228 |
| 411 | 3300046515 | Ga0495620_0057198 | Ga0495620_0057198_59_751 | 228 |
| 412 | 3300046529 | Ga0495652_0326822 | Ga0495652_0326822_313_1005 | 228 |
| 413 | 3300046543 | Ga0495645_0286967 | Ga0495645_0286967_295_987 | 228 |
| 414 | 3300046660 | Ga0495625_0425260 | Ga0495625_0425260_51_743 | 228 |
| 415 | 3300046679 | Ga0495623_0218928 | Ga0495623_0218928_346_1038 | 228 |
| 416 | 3300046691 | Ga0495670_0252846 | Ga0495670_0252846_118_810 | 228 |
| 417 | 3300048088 | Ga0495602_0084979 | Ga0495602_0084979_1215_1907 | 228 |
| 418 | 3300049578 | Ga0501042_0055528 | Ga0501042_0055528_286_978 | 228 |
| 419 | 3300049578 | Ga0501042_0114273 | Ga0501042_0114273_208_900 | 228 |
| 420 | 2162886007 | SwRhRL2b_contig_836207 | SwRhRL2b_0141.00008220 | 229 |
| 421 | 3300003752 | Ga0055539_1000039 | Ga0055539_100003976 | 229 |
| 422 | 3300003756 | Ga0055533_1000049 | Ga0055533_100004992 | 229 |
| 423 | 3300003758 | Ga0055532_1000049 | Ga0055532_100004977 | 229 |
| 424 | 3300003759 | Ga0055525_1000077 | Ga0055525_100007777 | 229 |
| 425 | 3300003781 | Ga0055536_1005866 | Ga0055536_10058665 | 229 |
| 426 | 3300003781 | Ga0055536_1016124 | Ga0055536_10161242 | 229 |
| 427 | 3300003791 | Ga0055530_10003906 | Ga0055530_100039065 | 229 |
| 428 | 3300003792 | Ga0055540_1001086 | Ga0055540_100108611 | 229 |
| 429 | 3300003792 | Ga0055540_1002667 | Ga0055540_10026672 | 229 |
| 430 | 3300003841 | Ga0055541_1000026 | Ga0055541_100002692 | 229 |
| 431 | 3300003856 | Ga0058692_1014272 | Ga0058692_10142722 | 229 |
| 432 | 3300005288 | Ga0065714_10004098 | Ga0065714_100040989 | 229 |
| 433 | 3300005288 | Ga0065714_10007073 | Ga0065714_100070732 | 229 |
| 434 | 3300005289 | Ga0065704_10083049 | Ga0065704_100830494 | 229 |
| 435 | 3300005289 | Ga0065704_10110576 | Ga0065704_101105763 | 229 |
| 436 | 3300005290 | Ga0065712_10067895 | Ga0065712_100678954 | 229 |
| 437 | 3300005331 | Ga0070670_100061804 | Ga0070670_1000618041 | 229 |
| 438 | 3300005353 | Ga0070669_100000292 | Ga0070669_10000029238 | 229 |
| 439 | 3300005353 | Ga0070669_100002278 | Ga0070669_1000022787 | 229 |
| 440 | 3300005455 | Ga0070663_100540934 | Ga0070663_1005409341 | 229 |
| 441 | 3300005457 | Ga0070662_100000560 | Ga0070662_10000056014 | 229 |
| 442 | 3300005539 | Ga0068853_100006406 | Ga0068853_1000064064 | 229 |
| 443 | 3300005564 | Ga0070664_100641769 | Ga0070664_1006417691 | 229 |
| 444 | 3300005578 | Ga0068854_100004163 | Ga0068854_1000041634 | 229 |
| 445 | 3300005834 | Ga0068851_10000006 | Ga0068851_1000000697 | 229 |
| 446 | 3300006051 | Ga0075364_10121181 | Ga0075364_101211812 | 229 |
| 447 | 3300006058 | Ga0075432_10049305 | Ga0075432_100493052 | 229 |
| 448 | 3300006944 | Ga0099823_1000054 | Ga0099823_10000543 | 229 |
| 449 | 3300006946 | Ga0079104_1000917 | Ga0079104_10009173 | 229 |
| 450 | 3300009011 | Ga0105251_10000004 | Ga0105251_10000004112 | 229 |
| 451 | 3300009011 | Ga0105251_10000149 | Ga0105251_1000014952 | 229 |
| 452 | 3300009011 | Ga0105251_10000935 | Ga0105251_1000093521 | 229 |
| 453 | 3300009011 | Ga0105251_10006259 | Ga0105251_100062597 | 229 |
| 454 | 3300009011 | Ga0105251_10008504 | Ga0105251_100085046 | 229 |
| 455 | 3300009011 | Ga0105251_10072706 | Ga0105251_100727062 | 229 |
| 456 | 3300009011 | Ga0105251_10092040 | Ga0105251_100920401 | 229 |
| 457 | 3300009011 | Ga0105251_10163534 | Ga0105251_101635341 | 229 |
| 458 | 3300009011 | Ga0105251_10271248 | Ga0105251_102712481 | 229 |
| 459 | 3300009036 | Ga0105244_10000922 | Ga0105244_1000092212 | 229 |
| 460 | 3300009036 | Ga0105244_10004903 | Ga0105244_100049033 | 229 |
| 461 | 3300009036 | Ga0105244_10006728 | Ga0105244_100067286 | 229 |
| 462 | 3300009036 | Ga0105244_10010706 | Ga0105244_100107063 | 229 |
| 463 | 3300009036 | Ga0105244_10015168 | Ga0105244_100151683 | 229 |
| 464 | 3300009036 | Ga0105244_10016206 | Ga0105244_100162063 | 229 |
| 465 | 3300009036 | Ga0105244_10025677 | Ga0105244_100256774 | 229 |
| 466 | 3300009036 | Ga0105244_10030254 | Ga0105244_100302543 | 229 |
| 467 | 3300009036 | Ga0105244_10047337 | Ga0105244_100473373 | 229 |
| 468 | 3300009036 | Ga0105244_10054694 | Ga0105244_100546943 | 229 |
| 469 | 3300009036 | Ga0105244_10063867 | Ga0105244_100638672 | 229 |
| 470 | 3300009036 | Ga0105244_10279559 | Ga0105244_102795591 | 229 |
| 471 | 3300009036 | Ga0105244_10303763 | Ga0105244_103037631 | 229 |
| 472 | 3300009092 | Ga0105250_10000235 | Ga0105250_1000023536 | 229 |
| 473 | 3300009092 | Ga0105250_10003383 | Ga0105250_100033835 | 229 |
| 474 | 3300009092 | Ga0105250_10024448 | Ga0105250_100244482 | 229 |
| 475 | 3300009092 | Ga0105250_10042350 | Ga0105250_100423502 | 229 |
| 476 | 3300009092 | Ga0105250_10077221 | Ga0105250_100772213 | 229 |
| 477 | 3300009092 | Ga0105250_10079672 | Ga0105250_100796722 | 229 |
| 478 | 3300009148 | Ga0105243_10001292 | Ga0105243_1000129213 | 229 |
| 479 | 3300009148 | Ga0105243_10039035 | Ga0105243_100390354 | 229 |
| 480 | 3300009148 | Ga0105243_10064661 | Ga0105243_100646612 | 229 |
| 481 | 3300009148 | Ga0105243_10206080 | Ga0105243_102060802 | 229 |
| 482 | 3300009148 | Ga0105243_10542411 | Ga0105243_105424112 | 229 |
| 483 | 3300009176 | Ga0105242_10000233 | Ga0105242_1000023316 | 229 |
| 484 | 3300009545 | Ga0105237_10000160 | Ga0105237_1000016071 | 229 |
| 485 | 3300009553 | Ga0105249_10475853 | Ga0105249_104758532 | 229 |
| 486 | 3300011119 | Ga0105246_10000822 | Ga0105246_1000082211 | 229 |
| 487 | 3300011119 | Ga0105246_10125641 | Ga0105246_101256413 | 229 |
| 488 | 3300011119 | Ga0105246_10288591 | Ga0105246_102885913 | 229 |
| 489 | 3300012498 | Ga0157345_1000347 | Ga0157345_10003472 | 229 |
| 490 | 3300013100 | Ga0157373_10001605 | Ga0157373_100016052 | 229 |
| 491 | 3300013100 | Ga0157373_10060224 | Ga0157373_100602241 | 229 |
| 492 | 3300013100 | Ga0157373_10222780 | Ga0157373_102227801 | 229 |
| 493 | 3300013100 | Ga0157373_10261841 | Ga0157373_102618412 | 229 |
| 494 | 3300013100 | Ga0157373_10345603 | Ga0157373_103456031 | 229 |
| 495 | 3300013102 | Ga0157371_10000460 | Ga0157371_1000046018 | 229 |
| 496 | 3300013102 | Ga0157371_10007535 | Ga0157371_100075356 | 229 |
| 497 | 3300013102 | Ga0157371_10024923 | Ga0157371_100249234 | 229 |
| 498 | 3300013102 | Ga0157371_10030541 | Ga0157371_100305414 | 229 |
| 499 | 3300013102 | Ga0157371_10108493 | Ga0157371_101084932 | 229 |
| 500 | 3300013102 | Ga0157371_10143168 | Ga0157371_101431681 | 229 |
| 501 | 3300013104 | Ga0157370_10165536 | Ga0157370_101655363 | 229 |
| 502 | 3300013104 | Ga0157370_10398975 | Ga0157370_103989753 | 229 |
| 503 | 3300013105 | Ga0157369_10035640 | Ga0157369_100356404 | 229 |
| 504 | 3300013105 | Ga0157369_10073948 | Ga0157369_100739484 | 229 |
| 505 | 3300013105 | Ga0157369_10144236 | Ga0157369_101442363 | 229 |
| 506 | 3300013105 | Ga0157369_10174391 | Ga0157369_101743911 | 229 |
| 507 | 3300013105 | Ga0157369_10467425 | Ga0157369_104674252 | 229 |
| 508 | 3300013306 | Ga0163162_10004406 | Ga0163162_100044065 | 229 |
| 509 | 3300013307 | Ga0157372_10000815 | Ga0157372_1000081518 | 229 |
| 510 | 3300013307 | Ga0157372_10059115 | Ga0157372_100591153 | 229 |
| 511 | 3300013307 | Ga0157372_10165575 | Ga0157372_101655752 | 229 |
| 512 | 3300013307 | Ga0157372_10627579 | Ga0157372_106275792 | 229 |
| 513 | 3300013308 | Ga0157375_10270891 | Ga0157375_102708912 | 229 |
| 514 | 3300014497 | Ga0182008_10009461 | Ga0182008_100094615 | 229 |
| 515 | 3300014497 | Ga0182008_10031014 | Ga0182008_100310143 | 229 |
| 516 | 3300015261 | Ga0182006_1062988 | Ga0182006_10629882 | 229 |
| 517 | 3300015261 | Ga0182006_1108278 | Ga0182006_11082781 | 229 |
| 518 | 3300015261 | Ga0182006_1115165 | Ga0182006_11151651 | 229 |
| 519 | 3300015262 | Ga0182007_10006004 | Ga0182007_100060045 | 229 |
| 520 | 3300015265 | Ga0182005_1017434 | Ga0182005_10174342 | 229 |
| 521 | 3300017792 | Ga0163161_10605337 | Ga0163161_106053372 | 229 |
| 522 | 3300025206 | Ga0209435_100669 | Ga0209435_1006693 | 229 |
| 523 | 3300025224 | Ga0209784_100045 | Ga0209784_10004592 | 229 |
| 524 | 3300025225 | Ga0209566_100057 | Ga0209566_10005792 | 229 |
| 525 | 3300025226 | Ga0209674_100080 | Ga0209674_10008092 | 229 |
| 526 | 3300025229 | Ga0209147_100079 | Ga0209147_10007992 | 229 |
| 527 | 3300025230 | Ga0209563_100078 | Ga0209563_10007892 | 229 |
| 528 | 3300025242 | Ga0209258_100178 | Ga0209258_10017851 | 229 |
| 529 | 3300025246 | Ga0209646_1000311 | Ga0209646_100031123 | 229 |
| 530 | 3300025253 | Ga0209677_100045 | Ga0209677_10004592 | 229 |
| 531 | 3300025256 | Ga0209759_1003165 | Ga0209759_10031653 | 229 |
| 532 | 3300025256 | Ga0209759_1006779 | Ga0209759_10067793 | 229 |
| 533 | 3300025292 | Ga0209676_1000056 | Ga0209676_1000056105 | 229 |
| 534 | 3300025292 | Ga0209676_1000721 | Ga0209676_100072136 | 229 |
| 535 | 3300025292 | Ga0209676_1004156 | Ga0209676_10041565 | 229 |
| 536 | 3300025298 | Ga0209050_1000027 | Ga0209050_1000027210 | 229 |
| 537 | 3300025298 | Ga0209050_1000181 | Ga0209050_10001816 | 229 |
| 538 | 3300025298 | Ga0209050_1002328 | Ga0209050_10023281 | 229 |
| 539 | 3300025303 | Ga0209051_1000061 | Ga0209051_1000061105 | 229 |
| 540 | 3300025303 | Ga0209051_1000065 | Ga0209051_1000065122 | 229 |
| 541 | 3300025303 | Ga0209051_1023515 | Ga0209051_10235151 | 229 |
| 542 | 3300025321 | Ga0207656_10000017 | Ga0207656_1000001736 | 229 |
| 543 | 3300025711 | Ga0207696_1000022 | Ga0207696_100002290 | 229 |
| 544 | 3300025711 | Ga0207696_1000044 | Ga0207696_1000044105 | 229 |
| 545 | 3300025711 | Ga0207696_1003748 | Ga0207696_10037484 | 229 |
| 546 | 3300025711 | Ga0207696_1003920 | Ga0207696_10039206 | 229 |
| 547 | 3300025711 | Ga0207696_1037561 | Ga0207696_10375612 | 229 |
| 548 | 3300025728 | Ga0207655_1000005 | Ga0207655_1000005259 | 229 |
| 549 | 3300025728 | Ga0207655_1000015 | Ga0207655_1000015348 | 229 |
| 550 | 3300025728 | Ga0207655_1000240 | Ga0207655_100024034 | 229 |
| 551 | 3300025728 | Ga0207655_1000462 | Ga0207655_10004623 | 229 |
| 552 | 3300025728 | Ga0207655_1001511 | Ga0207655_100151112 | 229 |
| 553 | 3300025728 | Ga0207655_1002564 | Ga0207655_10025644 | 229 |
| 554 | 3300025728 | Ga0207655_1003475 | Ga0207655_10034752 | 229 |
| 555 | 3300025728 | Ga0207655_1010955 | Ga0207655_10109555 | 229 |
| 556 | 3300025728 | Ga0207655_1012202 | Ga0207655_10122025 | 229 |
| 557 | 3300025728 | Ga0207655_1015532 | Ga0207655_10155323 | 229 |
| 558 | 3300025728 | Ga0207655_1036554 | Ga0207655_10365542 | 229 |
| 559 | 3300025728 | Ga0207655_1050350 | Ga0207655_10503503 | 229 |
| 560 | 3300025735 | Ga0207713_1000013 | Ga0207713_1000013157 | 229 |
| 561 | 3300025735 | Ga0207713_1000104 | Ga0207713_100010413 | 229 |
| 562 | 3300025735 | Ga0207713_1000454 | Ga0207713_100045437 | 229 |
| 563 | 3300025735 | Ga0207713_1005892 | Ga0207713_10058925 | 229 |
| 564 | 3300025735 | Ga0207713_1011540 | Ga0207713_10115405 | 229 |
| 565 | 3300025735 | Ga0207713_1024556 | Ga0207713_10245564 | 229 |
| 566 | 3300025735 | Ga0207713_1031185 | Ga0207713_10311853 | 229 |
| 567 | 3300025735 | Ga0207713_1039599 | Ga0207713_10395992 | 229 |
| 568 | 3300025923 | Ga0207681_10000679 | Ga0207681_100006793 | 229 |
| 569 | 3300025925 | Ga0207650_10000668 | Ga0207650_1000066815 | 229 |
| 570 | 3300025925 | Ga0207650_10001102 | Ga0207650_100011025 | 229 |
| 571 | 3300025933 | Ga0207706_10001474 | Ga0207706_100014749 | 229 |
| 572 | 3300025935 | Ga0207709_10028404 | Ga0207709_100284042 | 229 |
| 573 | 3300025935 | Ga0207709_10077797 | Ga0207709_100777972 | 229 |
| 574 | 3300025981 | Ga0207640_10031633 | Ga0207640_100316333 | 229 |
| 575 | 3300026041 | Ga0207639_10003002 | Ga0207639_100030029 | 229 |
| 576 | 3300026067 | Ga0207678_10624398 | Ga0207678_106243982 | 229 |
| 577 | 3300027111 | Ga0209281_1000013 | Ga0209281_1000013223 | 229 |
| 578 | 3300027296 | Ga0209389_1000002 | Ga0209389_1000002264 | 229 |
| 579 | 3300027312 | Ga0209371_1000239 | Ga0209371_100023940 | 229 |
| 580 | 3300027312 | Ga0209371_1000253 | Ga0209371_10002534 | 229 |
| 581 | 3300027312 | Ga0209371_1005194 | Ga0209371_10051944 | 229 |
| 582 | 3300027471 | Ga0209995_1000414 | Ga0209995_10004145 | 229 |
| 583 | 3300027526 | Ga0209968_1003561 | Ga0209968_10035612 | 229 |
| 584 | 3300027543 | Ga0209999_1003846 | Ga0209999_10038463 | 229 |
| 585 | 3300027617 | Ga0210002_1009337 | Ga0210002_10093372 | 229 |
| 586 | 3300027665 | Ga0209983_1000325 | Ga0209983_10003254 | 229 |
| 587 | 3300027682 | Ga0209971_1001262 | Ga0209971_10012627 | 229 |
| 588 | 3300027876 | Ga0209974_10007126 | Ga0209974_100071264 | 229 |
| 589 | 3300027907 | Ga0207428_10249763 | Ga0207428_102497632 | 229 |
| 590 | 3300030500 | Ga0268256_1000199 | Ga0268256_100019928 | 229 |
| 591 | 3300030500 | Ga0268256_1000367 | Ga0268256_100036733 | 229 |
| 592 | 3300030500 | Ga0268256_1004916 | Ga0268256_10049164 | 229 |
| 593 | 3300030733 | Ga0314311_1224394 | Ga0314311_12243942 | 229 |
| 594 | 3300031548 | Ga0307408_100000081 | Ga0307408_1000000814 | 229 |
| 595 | 3300031548 | Ga0307408_100191555 | Ga0307408_1001915552 | 229 |
| 596 | 3300032004 | Ga0307414_10048055 | Ga0307414_100480553 | 229 |
| 597 | 3300038705 | Ga0237819_03246 | Ga0237819_03246_1801_2490 | 229 |
| 598 | 3300041404 | Ga0439436_0000833 | Ga0439436_0000833_4729_5418 | 229 |
| 599 | 3300041405 | Ga0439438_001224 | Ga0439438_001224_8018_8707 | 229 |
| 600 | 3300041405 | Ga0439438_001549 | Ga0439438_001549_3068_3757 | 229 |
| 601 | 3300041405 | Ga0439438_004008 | Ga0439438_004008_572_1261 | 229 |
| 602 | 3300041405 | Ga0439438_005594 | Ga0439438_005594_1066_1755 | 229 |
| 603 | 3300041405 | Ga0439438_010939 | Ga0439438_010939_1826_2515 | 229 |
| 604 | 3300041405 | Ga0439438_021145 | Ga0439438_021145_219_908 | 229 |
| 605 | 3300041405 | Ga0439438_024202 | Ga0439438_024202_712_1401 | 229 |
| 606 | 3300041405 | Ga0439438_024411 | Ga0439438_024411_336_1025 | 229 |
| 607 | 3300041407 | Ga0439447_021944 | Ga0439447_021944_234_923 | 229 |
| 608 | 3300041411 | Ga0439466_0000342 | Ga0439466_0000342_9046_9735 | 229 |
| 609 | 3300041411 | Ga0439466_0008671 | Ga0439466_0008671_502_1191 | 229 |
| 610 | 3300041411 | Ga0439466_0017990 | Ga0439466_0017990_1608_2297 | 229 |
| 611 | 3300041411 | Ga0439466_0018321 | Ga0439466_0018321_824_1513 | 229 |
| 612 | 3300041411 | Ga0439466_0032593 | Ga0439466_0032593_865_1554 | 229 |
| 613 | 3300041997 | Ga0439431_0030722 | Ga0439431_0030722_77_766 | 229 |
| 614 | 3300042000 | Ga0439437_001017 | Ga0439437_001017_2095_2784 | 229 |
| 615 | 3300042006 | Ga0439432_002272 | Ga0439432_002272_963_1652 | 229 |
| 616 | 3300042006 | Ga0439432_012067 | Ga0439432_012067_417_1106 | 229 |
| 617 | 3300042006 | Ga0439432_041463 | Ga0439432_041463_532_1221 | 229 |
| 618 | 3300042006 | Ga0439432_077801 | Ga0439432_077801_133_822 | 229 |
| 619 | 3300042009 | Ga0439451_007452 | Ga0439451_007452_260_949 | 229 |
| 620 | 3300042010 | Ga0439452_003201 | Ga0439452_003201_652_1341 | 229 |
| 621 | 3300042010 | Ga0439452_003645 | Ga0439452_003645_1866_2555 | 229 |
| 622 | 3300042010 | Ga0439452_040989 | Ga0439452_040989_29_718 | 229 |
| 623 | 3300042013 | Ga0439456_013404 | Ga0439456_013404_926_1615 | 229 |
| 624 | 3300042016 | Ga0439463_000853 | Ga0439463_000853_5291_5980 | 229 |
| 625 | 3300042016 | Ga0439463_002002 | Ga0439463_002002_3792_4481 | 229 |
| 626 | 3300042016 | Ga0439463_005102 | Ga0439463_005102_91_780 | 229 |
| 627 | 3300042115 | Ga0450911_000037 | Ga0450911_000037_45136_45825 | 229 |
| 628 | 3300042115 | Ga0450911_001642 | Ga0450911_001642_3636_4325 | 229 |
| 629 | 3300042115 | Ga0450911_013889 | Ga0450911_013889_45_734 | 229 |
| 630 | 3300042121 | Ga0450919_013351 | Ga0450919_013351_14_703 | 229 |
| 631 | 3300042125 | Ga0450923_006052 | Ga0450923_006052_556_1245 | 229 |
| 632 | 3300042127 | Ga0450890_004602 | Ga0450890_004602_426_1115 | 229 |
| 633 | 3300042136 | Ga0450900_014018 | Ga0450900_014018_218_907 | 229 |
| 634 | 3300042137 | Ga0450902_006795 | Ga0450902_006795_374_1063 | 229 |
| 635 | 3300042138 | Ga0450903_015907 | Ga0450903_015907_111_800 | 229 |
| 636 | 3300042139 | Ga0450904_000010 | Ga0450904_000010_2038_2727 | 229 |
| 637 | 3300042142 | Ga0450905_004233 | Ga0450905_004233_820_1509 | 229 |
| 638 | 3300042142 | Ga0450905_038071 | Ga0450905_038071_50_739 | 229 |
| 639 | 3300042146 | Ga0450907_002271 | Ga0450907_002271_2780_3469 | 229 |
| 640 | 3300042146 | Ga0450907_002488 | Ga0450907_002488_2787_3476 | 229 |
| 641 | 3300042147 | Ga0450910_000828 | Ga0450910_000828_2400_3089 | 229 |
| 642 | 3300042156 | Ga0439446_0007265 | Ga0439446_0007265_1647_2336 | 229 |
| 643 | 3300042156 | Ga0439446_0085730 | Ga0439446_0085730_179_868 | 229 |
| 644 | 3300042185 | Ga0450909_005848 | Ga0450909_005848_362_1051 | 229 |
| 645 | 3300042435 | Ga0439434_0005198 | Ga0439434_0005198_2296_2985 | 229 |
| 646 | 3300042439 | Ga0439464_0008158 | Ga0439464_0008158_1790_2479 | 229 |
| 647 | 3300042439 | Ga0439464_0099538 | Ga0439464_0099538_159_848 | 229 |
| 648 | 3300042461 | Ga0439460_0002311 | Ga0439460_0002311_2831_3520 | 229 |
| 649 | 3300042532 | Ga0450893_0007907 | Ga0450893_0007907_447_1136 | 229 |
| 650 | 3300042533 | Ga0450901_001715 | Ga0450901_001715_340_1029 | 229 |
| 651 | 3300042993 | Ga0439440_0035470 | Ga0439440_0035470_238_927 | 229 |
| 652 | 3300046452 | Ga0495617_006990 | Ga0495617_006990_2984_3673 | 229 |
| 653 | 3300046452 | Ga0495617_020318 | Ga0495617_020318_493_1182 | 229 |
| 654 | 3300046452 | Ga0495617_039050 | Ga0495617_039050_705_1394 | 229 |
| 655 | 3300046452 | Ga0495617_060399 | Ga0495617_060399_519_1208 | 229 |
| 656 | 3300046453 | Ga0495627_000021 | Ga0495627_000021_160658_161347 | 229 |
| 657 | 3300046453 | Ga0495627_000279 | Ga0495627_000279_35910_36599 | 229 |
| 658 | 3300046453 | Ga0495627_002877 | Ga0495627_002877_4481_5170 | 229 |
| 659 | 3300046453 | Ga0495627_017992 | Ga0495627_017992_1529_2218 | 229 |
| 660 | 3300046453 | Ga0495627_032243 | Ga0495627_032243_250_939 | 229 |
| 661 | 3300046457 | Ga0495590_0005949 | Ga0495590_0005949_562_1251 | 229 |
| 662 | 3300046457 | Ga0495590_0068414 | Ga0495590_0068414_526_1215 | 229 |
| 663 | 3300046458 | Ga0495591_000015 | Ga0495591_000015_239006_239695 | 229 |
| 664 | 3300046458 | Ga0495591_001669 | Ga0495591_001669_4426_5115 | 229 |
| 665 | 3300046458 | Ga0495591_002885 | Ga0495591_002885_6967_7656 | 229 |
| 666 | 3300046458 | Ga0495591_004439 | Ga0495591_004439_205_894 | 229 |
| 667 | 3300046458 | Ga0495591_008158 | Ga0495591_008158_2339_3028 | 229 |
| 668 | 3300046458 | Ga0495591_008588 | Ga0495591_008588_212_901 | 229 |
| 669 | 3300046458 | Ga0495591_013373 | Ga0495591_013373_183_872 | 229 |
| 670 | 3300046458 | Ga0495591_021189 | Ga0495591_021189_1226_1915 | 229 |
| 671 | 3300046458 | Ga0495591_053892 | Ga0495591_053892_270_959 | 229 |
| 672 | 3300046459 | Ga0495629_0303336 | Ga0495629_0303336_262_951 | 229 |
| 673 | 3300046460 | Ga0495638_0007372 | Ga0495638_0007372_2901_3590 | 229 |
| 674 | 3300046460 | Ga0495638_0056195 | Ga0495638_0056195_1201_1890 | 229 |
| 675 | 3300046460 | Ga0495638_0067200 | Ga0495638_0067200_290_979 | 229 |
| 676 | 3300046460 | Ga0495638_0205775 | Ga0495638_0205775_134_823 | 229 |
| 677 | 3300046463 | Ga0495653_0043552 | Ga0495653_0043552_2385_3074 | 229 |
| 678 | 3300046463 | Ga0495653_0064101 | Ga0495653_0064101_1496_2185 | 229 |
| 679 | 3300046463 | Ga0495653_0071493 | Ga0495653_0071493_289_978 | 229 |
| 680 | 3300046471 | Ga0495650_0000672 | Ga0495650_0000672_22078_22767 | 229 |
| 681 | 3300046471 | Ga0495650_0008514 | Ga0495650_0008514_2553_3242 | 229 |
| 682 | 3300046471 | Ga0495650_0010244 | Ga0495650_0010244_4431_5120 | 229 |
| 683 | 3300046471 | Ga0495650_0014847 | Ga0495650_0014847_3297_3986 | 229 |
| 684 | 3300046471 | Ga0495650_0025885 | Ga0495650_0025885_665_1354 | 229 |
| 685 | 3300046471 | Ga0495650_0040686 | Ga0495650_0040686_692_1381 | 229 |
| 686 | 3300046473 | Ga0495582_0140242 | Ga0495582_0140242_505_1194 | 229 |
| 687 | 3300046474 | Ga0495605_0000016 | Ga0495605_0000016_207253_207942 | 229 |
| 688 | 3300046474 | Ga0495605_0000031 | Ga0495605_0000031_160180_160869 | 229 |
| 689 | 3300046474 | Ga0495605_0009557 | Ga0495605_0009557_2674_3363 | 229 |
| 690 | 3300046474 | Ga0495605_0012810 | Ga0495605_0012810_256_945 | 229 |
| 691 | 3300046474 | Ga0495605_0028704 | Ga0495605_0028704_1063_1752 | 229 |
| 692 | 3300046474 | Ga0495605_0052335 | Ga0495605_0052335_1063_1752 | 229 |
| 693 | 3300046475 | Ga0495639_0002355 | Ga0495639_0002355_2796_3485 | 229 |
| 694 | 3300046491 | Ga0495584_0012531 | Ga0495584_0012531_456_1145 | 229 |
| 695 | 3300046491 | Ga0495584_0070675 | Ga0495584_0070675_823_1512 | 229 |
| 696 | 3300046491 | Ga0495584_0246861 | Ga0495584_0246861_57_746 | 229 |
| 697 | 3300046492 | Ga0495585_0021995 | Ga0495585_0021995_1907_2596 | 229 |
| 698 | 3300046492 | Ga0495585_0036292 | Ga0495585_0036292_286_975 | 229 |
| 699 | 3300046499 | Ga0495594_0040103 | Ga0495594_0040103_620_1309 | 229 |
| 700 | 3300046500 | Ga0495596_0005366 | Ga0495596_0005366_4429_5118 | 229 |
| 701 | 3300046500 | Ga0495596_0114782 | Ga0495596_0114782_251_940 | 229 |
| 702 | 3300046501 | Ga0495607_0000248 | Ga0495607_0000248_55237_55926 | 229 |
| 703 | 3300046501 | Ga0495607_0000780 | Ga0495607_0000780_29735_30424 | 229 |
| 704 | 3300046501 | Ga0495607_0002842 | Ga0495607_0002842_1852_2541 | 229 |
| 705 | 3300046501 | Ga0495607_0009954 | Ga0495607_0009954_937_1626 | 229 |
| 706 | 3300046501 | Ga0495607_0035190 | Ga0495607_0035190_284_973 | 229 |
| 707 | 3300046501 | Ga0495607_0049776 | Ga0495607_0049776_306_995 | 229 |
| 708 | 3300046501 | Ga0495607_0107693 | Ga0495607_0107693_382_1071 | 229 |
| 709 | 3300046501 | Ga0495607_0137813 | Ga0495607_0137813_16_705 | 229 |
| 710 | 3300046501 | Ga0495607_0209265 | Ga0495607_0209265_103_792 | 229 |
| 711 | 3300046501 | Ga0495607_0216479 | Ga0495607_0216479_124_813 | 229 |
| 712 | 3300046506 | Ga0495583_0000041 | Ga0495583_0000041_44709_45398 | 229 |
| 713 | 3300046506 | Ga0495583_0000698 | Ga0495583_0000698_6959_7648 | 229 |
| 714 | 3300046506 | Ga0495583_0003486 | Ga0495583_0003486_8159_8848 | 229 |
| 715 | 3300046506 | Ga0495583_0007614 | Ga0495583_0007614_87_776 | 229 |
| 716 | 3300046506 | Ga0495583_0023108 | Ga0495583_0023108_844_1533 | 229 |
| 717 | 3300046506 | Ga0495583_0072323 | Ga0495583_0072323_524_1213 | 229 |
| 718 | 3300046506 | Ga0495583_0095210 | Ga0495583_0095210_87_776 | 229 |
| 719 | 3300046507 | Ga0495606_0000055 | Ga0495606_0000055_195753_196442 | 229 |
| 720 | 3300046507 | Ga0495606_0002535 | Ga0495606_0002535_14235_14924 | 229 |
| 721 | 3300046507 | Ga0495606_0021122 | Ga0495606_0021122_1411_2100 | 229 |
| 722 | 3300046507 | Ga0495606_0025179 | Ga0495606_0025179_1184_1873 | 229 |
| 723 | 3300046507 | Ga0495606_0047702 | Ga0495606_0047702_317_1006 | 229 |
| 724 | 3300046507 | Ga0495606_0048476 | Ga0495606_0048476_1816_2505 | 229 |
| 725 | 3300046512 | Ga0495610_0011574 | Ga0495610_0011574_4154_4843 | 229 |
| 726 | 3300046512 | Ga0495610_0037130 | Ga0495610_0037130_19_708 | 229 |
| 727 | 3300046512 | Ga0495610_0070752 | Ga0495610_0070752_272_961 | 229 |
| 728 | 3300046513 | Ga0495616_0018287 | Ga0495616_0018287_3069_3758 | 229 |
| 729 | 3300046513 | Ga0495616_0062591 | Ga0495616_0062591_241_930 | 229 |
| 730 | 3300046513 | Ga0495616_0064862 | Ga0495616_0064862_745_1434 | 229 |
| 731 | 3300046513 | Ga0495616_0097381 | Ga0495616_0097381_237_932 | 229 |
| 732 | 3300046513 | Ga0495616_0188867 | Ga0495616_0188867_18_707 | 229 |
| 733 | 3300046515 | Ga0495620_0000013 | Ga0495620_0000013_100760_101449 | 229 |
| 734 | 3300046515 | Ga0495620_0000015 | Ga0495620_0000015_44678_45367 | 229 |
| 735 | 3300046515 | Ga0495620_0005216 | Ga0495620_0005216_4702_5391 | 229 |
| 736 | 3300046515 | Ga0495620_0007041 | Ga0495620_0007041_1050_1739 | 229 |
| 737 | 3300046515 | Ga0495620_0031553 | Ga0495620_0031553_1635_2324 | 229 |
| 738 | 3300046515 | Ga0495620_0062734 | Ga0495620_0062734_665_1354 | 229 |
| 739 | 3300046515 | Ga0495620_0090181 | Ga0495620_0090181_249_938 | 229 |
| 740 | 3300046517 | Ga0495630_0114013 | Ga0495630_0114013_142_831 | 229 |
| 741 | 3300046517 | Ga0495630_0177603 | Ga0495630_0177603_584_1273 | 229 |
| 742 | 3300046518 | Ga0495631_0005402 | Ga0495631_0005402_3210_3899 | 229 |
| 743 | 3300046518 | Ga0495631_0012690 | Ga0495631_0012690_1648_2337 | 229 |
| 744 | 3300046519 | Ga0495632_0000912 | Ga0495632_0000912_1556_2245 | 229 |
| 745 | 3300046519 | Ga0495632_0000914 | Ga0495632_0000914_553_1242 | 229 |
| 746 | 3300046519 | Ga0495632_0004792 | Ga0495632_0004792_6160_6849 | 229 |
| 747 | 3300046519 | Ga0495632_0054101 | Ga0495632_0054101_873_1562 | 229 |
| 748 | 3300046519 | Ga0495632_0093183 | Ga0495632_0093183_18_707 | 229 |
| 749 | 3300046519 | Ga0495632_0094242 | Ga0495632_0094242_239_928 | 229 |
| 750 | 3300046520 | Ga0495637_0002612 | Ga0495637_0002612_6049_6738 | 229 |
| 751 | 3300046520 | Ga0495637_0004529 | Ga0495637_0004529_1438_2127 | 229 |
| 752 | 3300046520 | Ga0495637_0005694 | Ga0495637_0005694_4413_5102 | 229 |
| 753 | 3300046520 | Ga0495637_0034150 | Ga0495637_0034150_947_1636 | 229 |
| 754 | 3300046520 | Ga0495637_0061030 | Ga0495637_0061030_837_1526 | 229 |
| 755 | 3300046520 | Ga0495637_0093297 | Ga0495637_0093297_227_916 | 229 |
| 756 | 3300046520 | Ga0495637_0133004 | Ga0495637_0133004_218_907 | 229 |
| 757 | 3300046522 | Ga0495643_0000223 | Ga0495643_0000223_29796_30485 | 229 |
| 758 | 3300046522 | Ga0495643_0000903 | Ga0495643_0000903_2866_3555 | 229 |
| 759 | 3300046522 | Ga0495643_0019550 | Ga0495643_0019550_362_1051 | 229 |
| 760 | 3300046523 | Ga0495644_0002168 | Ga0495644_0002168_1376_2065 | 229 |
| 761 | 3300046523 | Ga0495644_0045454 | Ga0495644_0045454_579_1409 | 229 |
| 762 | 3300046523 | Ga0495644_0062484 | Ga0495644_0062484_314_1003 | 229 |
| 763 | 3300046524 | Ga0495648_0001423 | Ga0495648_0001423_558_1247 | 229 |
| 764 | 3300046524 | Ga0495648_0049543 | Ga0495648_0049543_393_1082 | 229 |
| 765 | 3300046524 | Ga0495648_0096057 | Ga0495648_0096057_718_1407 | 229 |
| 766 | 3300046524 | Ga0495648_0200171 | Ga0495648_0200171_284_973 | 229 |
| 767 | 3300046526 | Ga0495666_0022867 | Ga0495666_0022867_1764_2453 | 229 |
| 768 | 3300046526 | Ga0495666_0064542 | Ga0495666_0064542_792_1481 | 229 |
| 769 | 3300046528 | Ga0495642_0002131 | Ga0495642_0002131_6485_7174 | 229 |
| 770 | 3300046528 | Ga0495642_0035623 | Ga0495642_0035623_1095_1784 | 229 |
| 771 | 3300046530 | Ga0495654_0003357 | Ga0495654_0003357_9086_9775 | 229 |
| 772 | 3300046530 | Ga0495654_0003364 | Ga0495654_0003364_6313_7002 | 229 |
| 773 | 3300046530 | Ga0495654_0017170 | Ga0495654_0017170_308_997 | 229 |
| 774 | 3300046530 | Ga0495654_0037853 | Ga0495654_0037853_605_1294 | 229 |
| 775 | 3300046530 | Ga0495654_0048994 | Ga0495654_0048994_1279_1968 | 229 |
| 776 | 3300046530 | Ga0495654_0086018 | Ga0495654_0086018_680_1369 | 229 |
| 777 | 3300046530 | Ga0495654_0138884 | Ga0495654_0138884_99_788 | 229 |
| 778 | 3300046530 | Ga0495654_0165479 | Ga0495654_0165479_150_839 | 229 |
| 779 | 3300046535 | Ga0495586_0079406 | Ga0495586_0079406_581_1270 | 229 |
| 780 | 3300046536 | Ga0495587_0021981 | Ga0495587_0021981_2790_3479 | 229 |
| 781 | 3300046538 | Ga0495609_0000015 | Ga0495609_0000015_276974_277663 | 229 |
| 782 | 3300046538 | Ga0495609_0000070 | Ga0495609_0000070_98647_99336 | 229 |
| 783 | 3300046538 | Ga0495609_0003891 | Ga0495609_0003891_6038_6727 | 229 |
| 784 | 3300046538 | Ga0495609_0022602 | Ga0495609_0022602_2028_2717 | 229 |
| 785 | 3300046538 | Ga0495609_0091328 | Ga0495609_0091328_614_1303 | 229 |
| 786 | 3300046542 | Ga0495597_0000005 | Ga0495597_0000005_179185_179874 | 229 |
| 787 | 3300046542 | Ga0495597_0011863 | Ga0495597_0011863_746_1435 | 229 |
| 788 | 3300046542 | Ga0495597_0074803 | Ga0495597_0074803_163_852 | 229 |
| 789 | 3300046542 | Ga0495597_0155327 | Ga0495597_0155327_14_703 | 229 |
| 790 | 3300046557 | Ga0495622_0003963 | Ga0495622_0003963_3454_4143 | 229 |
| 791 | 3300046557 | Ga0495622_0006164 | Ga0495622_0006164_367_1056 | 229 |
| 792 | 3300046557 | Ga0495622_0014077 | Ga0495622_0014077_1570_2259 | 229 |
| 793 | 3300046557 | Ga0495622_0131555 | Ga0495622_0131555_394_1083 | 229 |
| 794 | 3300046558 | Ga0495633_0000060 | Ga0495633_0000060_113465_114154 | 229 |
| 795 | 3300046616 | Ga0495668_0014935 | Ga0495668_0014935_280_969 | 229 |
| 796 | 3300046616 | Ga0495668_0122682 | Ga0495668_0122682_355_1044 | 229 |
| 797 | 3300046616 | Ga0495668_0144806 | Ga0495668_0144806_596_1285 | 229 |
| 798 | 3300046642 | Ga0495634_0140357 | Ga0495634_0140357_485_1174 | 229 |
| 799 | 3300046648 | Ga0495611_0000817 | Ga0495611_0000817_6727_7416 | 229 |
| 800 | 3300046648 | Ga0495611_0003416 | Ga0495611_0003416_2147_2836 | 229 |
| 801 | 3300046648 | Ga0495611_0191946 | Ga0495611_0191946_106_795 | 229 |
| 802 | 3300046660 | Ga0495625_0001491 | Ga0495625_0001491_6136_6825 | 229 |
| 803 | 3300046660 | Ga0495625_0019930 | Ga0495625_0019930_1736_2425 | 229 |
| 804 | 3300046660 | Ga0495625_0126498 | Ga0495625_0126498_287_976 | 229 |
| 805 | 3300046660 | Ga0495625_0252467 | Ga0495625_0252467_410_1099 | 229 |
| 806 | 3300046663 | Ga0495635_0024927 | Ga0495635_0024927_459_1148 | 229 |
| 807 | 3300046664 | Ga0495659_0003433 | Ga0495659_0003433_350_1039 | 229 |
| 808 | 3300046664 | Ga0495659_0011603 | Ga0495659_0011603_300_989 | 229 |
| 809 | 3300046665 | Ga0495661_0000110 | Ga0495661_0000110_38159_38848 | 229 |
| 810 | 3300046665 | Ga0495661_0000139 | Ga0495661_0000139_78337_79026 | 229 |
| 811 | 3300046665 | Ga0495661_0000194 | Ga0495661_0000194_45848_46537 | 229 |
| 812 | 3300046665 | Ga0495661_0000304 | Ga0495661_0000304_39849_40538 | 229 |
| 813 | 3300046665 | Ga0495661_0044658 | Ga0495661_0044658_462_1151 | 229 |
| 814 | 3300046665 | Ga0495661_0195824 | Ga0495661_0195824_68_757 | 229 |
| 815 | 3300046665 | Ga0495661_0204943 | Ga0495661_0204943_41_730 | 229 |
| 816 | 3300046674 | Ga0495588_0148363 | Ga0495588_0148363_313_1002 | 229 |
| 817 | 3300046679 | Ga0495623_0028796 | Ga0495623_0028796_2621_3310 | 229 |
| 818 | 3300046684 | Ga0495669_0004936 | Ga0495669_0004936_2402_3091 | 229 |
| 819 | 3300046689 | Ga0495613_0327929 | Ga0495613_0327929_332_1021 | 229 |
| 820 | 3300046690 | Ga0495624_0063633 | Ga0495624_0063633_1461_2150 | 229 |
| 821 | 3300046691 | Ga0495670_0002014 | Ga0495670_0002014_3578_4267 | 229 |
| 822 | 3300046691 | Ga0495670_0077080 | Ga0495670_0077080_770_1459 | 229 |
| 823 | 3300046691 | Ga0495670_0154114 | Ga0495670_0154114_489_1178 | 229 |
| 824 | 3300046692 | Ga0495671_0009834 | Ga0495671_0009834_1355_2044 | 229 |
| 825 | 3300046692 | Ga0495671_0012159 | Ga0495671_0012159_3990_4679 | 229 |
| 826 | 3300046692 | Ga0495671_0014145 | Ga0495671_0014145_2237_2926 | 229 |
| 827 | 3300046692 | Ga0495671_0040795 | Ga0495671_0040795_1198_1887 | 229 |
| 828 | 3300046692 | Ga0495671_0064974 | Ga0495671_0064974_789_1478 | 229 |
| 829 | 3300046692 | Ga0495671_0146599 | Ga0495671_0146599_240_929 | 229 |
| 830 | 3300046692 | Ga0495671_0175419 | Ga0495671_0175419_338_1027 | 229 |
| 831 | 3300046694 | Ga0495649_0005972 | Ga0495649_0005972_2915_3604 | 229 |
| 832 | 3300046694 | Ga0495649_0038788 | Ga0495649_0038788_1373_2062 | 229 |
| 833 | 3300046694 | Ga0495649_0039240 | Ga0495649_0039240_514_1203 | 229 |
| 834 | 3300046694 | Ga0495649_0058119 | Ga0495649_0058119_1219_1908 | 229 |
| 835 | 3300046694 | Ga0495649_0278180 | Ga0495649_0278180_142_831 | 229 |
| 836 | 3300046794 | Ga0495589_0000855 | Ga0495589_0000855_1063_1752 | 229 |
| 837 | 3300046794 | Ga0495589_0007319 | Ga0495589_0007319_619_1308 | 229 |
| 838 | 3300046794 | Ga0495589_0017167 | Ga0495589_0017167_1218_1907 | 229 |
| 839 | 3300046809 | Ga0495600_0005020 | Ga0495600_0005020_2787_3476 | 229 |
| 840 | 3300046810 | Ga0495660_0001756 | Ga0495660_0001756_1033_1722 | 229 |
| 841 | 3300046810 | Ga0495660_0019277 | Ga0495660_0019277_2258_2947 | 229 |
| 842 | 3300046810 | Ga0495660_0023430 | Ga0495660_0023430_2794_3483 | 229 |
| 843 | 3300046810 | Ga0495660_0056189 | Ga0495660_0056189_158_847 | 229 |
| 844 | 3300046810 | Ga0495660_0157692 | Ga0495660_0157692_15_704 | 229 |
| 845 | 3300047317 | Ga0495604_0216665 | Ga0495604_0216665_335_1024 | 229 |
| 846 | 3300047318 | Ga0495636_0014835 | Ga0495636_0014835_2232_2921 | 229 |
| 847 | 3300047318 | Ga0495636_0080700 | Ga0495636_0080700_260_949 | 229 |
| 848 | 3300047320 | Ga0495672_0020211 | Ga0495672_0020211_1678_2367 | 229 |
| 849 | 3300047320 | Ga0495672_0028649 | Ga0495672_0028649_1857_2546 | 229 |
| 850 | 3300047320 | Ga0495672_0034225 | Ga0495672_0034225_232_921 | 229 |
| 851 | 3300047320 | Ga0495672_0061584 | Ga0495672_0061584_1143_1832 | 229 |
| 852 | 3300047320 | Ga0495672_0076723 | Ga0495672_0076723_85_774 | 229 |
| 853 | 3300047320 | Ga0495672_0079440 | Ga0495672_0079440_1076_1765 | 229 |
| 854 | 3300047320 | Ga0495672_0143183 | Ga0495672_0143183_354_1043 | 229 |
| 855 | 3300047321 | Ga0495676_0000013 | Ga0495676_0000013_206231_206920 | 229 |
| 856 | 3300047323 | Ga0495683_0000027 | Ga0495683_0000027_107964_108653 | 229 |
| 857 | 3300047323 | Ga0495683_0000261 | Ga0495683_0000261_6154_6843 | 229 |
| 858 | 3300047323 | Ga0495683_0008434 | Ga0495683_0008434_3991_4680 | 229 |
| 859 | 3300047323 | Ga0495683_0015414 | Ga0495683_0015414_698_1387 | 229 |
| 860 | 3300047323 | Ga0495683_0037791 | Ga0495683_0037791_1219_1908 | 229 |
| 861 | 3300047323 | Ga0495683_0069159 | Ga0495683_0069159_309_998 | 229 |
| 862 | 3300047443 | Ga0495687_010031 | Ga0495687_010031_4016_4705 | 229 |
| 863 | 3300047443 | Ga0495687_012754 | Ga0495687_012754_350_1039 | 229 |
| 864 | 3300047446 | Ga0495679_000206 | Ga0495679_000206_44846_45535 | 229 |
| 865 | 3300047446 | Ga0495679_001765 | Ga0495679_001765_8310_8999 | 229 |
| 866 | 3300047469 | Ga0495673_0003090 | Ga0495673_0003090_8021_8710 | 229 |
| 867 | 3300047469 | Ga0495673_0010910 | Ga0495673_0010910_3315_4004 | 229 |
| 868 | 3300047469 | Ga0495673_0011603 | Ga0495673_0011603_3773_4462 | 229 |
| 869 | 3300047469 | Ga0495673_0011642 | Ga0495673_0011642_505_1194 | 229 |
| 870 | 3300047469 | Ga0495673_0013537 | Ga0495673_0013537_277_966 | 229 |
| 871 | 3300047469 | Ga0495673_0017519 | Ga0495673_0017519_141_830 | 229 |
| 872 | 3300047469 | Ga0495673_0055784 | Ga0495673_0055784_454_1143 | 229 |
| 873 | 3300047470 | Ga0495681_0003664 | Ga0495681_0003664_3959_4648 | 229 |
| 874 | 3300047470 | Ga0495681_0005466 | Ga0495681_0005466_6126_6815 | 229 |
| 875 | 3300047470 | Ga0495681_0010709 | Ga0495681_0010709_3362_4051 | 229 |
| 876 | 3300047470 | Ga0495681_0011975 | Ga0495681_0011975_21_710 | 229 |
| 877 | 3300047470 | Ga0495681_0020315 | Ga0495681_0020315_2793_3482 | 229 |
| 878 | 3300047470 | Ga0495681_0028153 | Ga0495681_0028153_2119_2808 | 229 |
| 879 | 3300047470 | Ga0495681_0033280 | Ga0495681_0033280_351_1040 | 229 |
| 880 | 3300047470 | Ga0495681_0050445 | Ga0495681_0050445_911_1600 | 229 |
| 881 | 3300047470 | Ga0495681_0122153 | Ga0495681_0122153_287_976 | 229 |
| 882 | 3300047470 | Ga0495681_0135867 | Ga0495681_0135867_140_829 | 229 |
| 883 | 3300047472 | Ga0495686_0031369 | Ga0495686_0031369_1591_2280 | 229 |
| 884 | 3300047472 | Ga0495686_0143798 | Ga0495686_0143798_497_1186 | 229 |
| 885 | 3300047673 | Ga0495593_0030808 | Ga0495593_0030808_1602_2291 | 229 |
| 886 | 3300048091 | Ga0495626_0000056 | Ga0495626_0000056_143839_144528 | 229 |
| 887 | 3300048091 | Ga0495626_0004948 | Ga0495626_0004948_2891_3580 | 229 |
| 888 | 3300048091 | Ga0495626_0011052 | Ga0495626_0011052_4062_4751 | 229 |
| 889 | 3300048091 | Ga0495626_0013013 | Ga0495626_0013013_398_1087 | 229 |
| 890 | 3300048091 | Ga0495626_0017070 | Ga0495626_0017070_1841_2530 | 229 |
| 891 | 3300048905 | Ga0496102_0191890 | Ga0496102_0191890_1131_1820 | 229 |
| 892 | 3300048905 | Ga0496102_0265742 | Ga0496102_0265742_581_1270 | 229 |
| 893 | 3300048913 | Ga0496110_0192502 | Ga0496110_0192502_488_1177 | 229 |
| 894 | 3300048914 | Ga0496111_0237833 | Ga0496111_0237833_266_955 | 229 |
| 895 | 3300048915 | Ga0496112_0564801 | Ga0496112_0564801_170_859 | 229 |
| 896 | 3300048917 | Ga0496114_0147898 | Ga0496114_0147898_579_1268 | 229 |
| 897 | 3300048919 | Ga0496116_0000999 | Ga0496116_0000999_25703_26392 | 229 |
| 898 | 3300048919 | Ga0496116_0018019 | Ga0496116_0018019_4423_5112 | 229 |
| 899 | 3300048919 | Ga0496116_0117967 | Ga0496116_0117967_270_959 | 229 |
| 900 | 3300048920 | Ga0496117_0006411 | Ga0496117_0006411_743_1432 | 229 |
| 901 | 3300048920 | Ga0496117_0030232 | Ga0496117_0030232_1978_2667 | 229 |
| 902 | 3300048920 | Ga0496117_0081587 | Ga0496117_0081587_85_774 | 229 |
| 903 | 3300048920 | Ga0496117_0084328 | Ga0496117_0084328_1138_1827 | 229 |
| 904 | 3300048920 | Ga0496117_0152088 | Ga0496117_0152088_421_1110 | 229 |
| 905 | 3300048920 | Ga0496117_0182483 | Ga0496117_0182483_235_924 | 229 |
| 906 | 3300048921 | Ga0496118_0001807 | Ga0496118_0001807_12418_13107 | 229 |
| 907 | 3300048921 | Ga0496118_0095878 | Ga0496118_0095878_352_1041 | 229 |
| 908 | 3300048921 | Ga0496118_0226515 | Ga0496118_0226515_64_756 | 229 |
| 909 | 3300048921 | Ga0496118_0233500 | Ga0496118_0233500_19_708 | 229 |
| 910 | 3300048921 | Ga0496118_0262216 | Ga0496118_0262216_54_743 | 229 |
| 911 | 3300048922 | Ga0496119_0000112 | Ga0496119_0000112_104398_105087 | 229 |
| 912 | 3300048922 | Ga0496119_0230022 | Ga0496119_0230022_176_865 | 229 |
| 913 | 3300048923 | Ga0496120_0004409 | Ga0496120_0004409_10530_11219 | 229 |
| 914 | 3300048924 | Ga0496121_0002354 | Ga0496121_0002354_2768_3457 | 229 |
| 915 | 3300048924 | Ga0496121_0003009 | Ga0496121_0003009_6064_6753 | 229 |
| 916 | 3300048924 | Ga0496121_0066285 | Ga0496121_0066285_117_806 | 229 |
| 917 | 3300048924 | Ga0496121_0137771 | Ga0496121_0137771_811_1500 | 229 |
| 918 | 3300048924 | Ga0496121_0171305 | Ga0496121_0171305_416_1105 | 229 |
| 919 | 3300048925 | Ga0496122_0000122 | Ga0496122_0000122_175792_176481 | 229 |
| 920 | 3300048925 | Ga0496122_0009298 | Ga0496122_0009298_6888_7577 | 229 |
| 921 | 3300048925 | Ga0496122_0033077 | Ga0496122_0033077_333_1022 | 229 |
| 922 | 3300048925 | Ga0496122_0093864 | Ga0496122_0093864_324_1013 | 229 |
| 923 | 3300048925 | Ga0496122_0266663 | Ga0496122_0266663_179_868 | 229 |
| 924 | 3300048926 | Ga0496123_0000391 | Ga0496123_0000391_18123_18812 | 229 |
| 925 | 3300048926 | Ga0496123_0001340 | Ga0496123_0001340_17452_18141 | 229 |
| 926 | 3300048926 | Ga0496123_0012443 | Ga0496123_0012443_2208_2897 | 229 |
| 927 | 3300048926 | Ga0496123_0139280 | Ga0496123_0139280_94_783 | 229 |
| 928 | 3300048927 | Ga0496124_0000222 | Ga0496124_0000222_44365_45054 | 229 |
| 929 | 3300048927 | Ga0496124_0034795 | Ga0496124_0034795_3064_3753 | 229 |
| 930 | 3300048927 | Ga0496124_0053019 | Ga0496124_0053019_92_781 | 229 |
| 931 | 3300048927 | Ga0496124_0081731 | Ga0496124_0081731_831_1520 | 229 |
| 932 | 3300048927 | Ga0496124_0084069 | Ga0496124_0084069_956_1645 | 229 |
| 933 | 3300048927 | Ga0496124_0127532 | Ga0496124_0127532_103_792 | 229 |
| 934 | 3300048927 | Ga0496124_0135034 | Ga0496124_0135034_1050_1739 | 229 |
| 935 | 3300048927 | Ga0496124_0139891 | Ga0496124_0139891_38_727 | 229 |
| 936 | 3300048927 | Ga0496124_0248867 | Ga0496124_0248867_331_1020 | 229 |
| 937 | 3300048927 | Ga0496124_0296867 | Ga0496124_0296867_197_886 | 229 |
| 938 | 3300048927 | Ga0496124_0334600 | Ga0496124_0334600_279_971 | 229 |
| 939 | 3300048928 | Ga0496125_0000908 | Ga0496125_0000908_43291_43980 | 229 |
| 940 | 3300048928 | Ga0496125_0044153 | Ga0496125_0044153_2027_2716 | 229 |
| 941 | 3300048928 | Ga0496125_0084520 | Ga0496125_0084520_1146_1835 | 229 |
| 942 | 3300048928 | Ga0496125_0123920 | Ga0496125_0123920_846_1535 | 229 |
| 943 | 3300048929 | Ga0496126_0134998 | Ga0496126_0134998_1010_1699 | 229 |
| 944 | 3300049459 | Ga0495678_000039 | Ga0495678_000039_146101_146790 | 229 |
| 945 | 3300049459 | Ga0495678_004626 | Ga0495678_004626_2774_3463 | 229 |
| 946 | 3300049459 | Ga0495678_008903 | Ga0495678_008903_424_1113 | 229 |
| 947 | 3300049459 | Ga0495678_050737 | Ga0495678_050737_454_1143 | 229 |
| 948 | 3300049459 | Ga0495678_085666 | Ga0495678_085666_28_717 | 229 |
| 949 | 3300049460 | Ga0495682_0000577 | Ga0495682_0000577_1595_2284 | 229 |
| 950 | 3300049460 | Ga0495682_0001344 | Ga0495682_0001344_12645_13334 | 229 |
| 951 | 3300049460 | Ga0495682_0027923 | Ga0495682_0027923_896_1585 | 229 |
| 952 | 3300049460 | Ga0495682_0070558 | Ga0495682_0070558_309_998 | 229 |
| 953 | 3300049530 | Ga0501314_000184 | Ga0501314_000184_1947_2636 | 229 |
| 954 | 3300049569 | Ga0501032_0017099 | Ga0501032_0017099_2806_3495 | 229 |
| 955 | 3300049569 | Ga0501032_0143071 | Ga0501032_0143071_144_833 | 229 |
| 956 | 3300049571 | Ga0501034_0000137 | Ga0501034_0000137_103606_104295 | 229 |
| 957 | 3300049571 | Ga0501034_0535707 | Ga0501034_0535707_310_999 | 229 |
| 958 | 3300049573 | Ga0501037_0019740 | Ga0501037_0019740_991_1686 | 229 |
| 959 | 3300049573 | Ga0501037_0098256 | Ga0501037_0098256_806_1495 | 229 |
| 960 | 3300049573 | Ga0501037_0187385 | Ga0501037_0187385_486_1175 | 229 |
| 961 | 3300049574 | Ga0501038_0145172 | Ga0501038_0145172_663_1352 | 229 |
| 962 | 3300049575 | Ga0501039_0098402 | Ga0501039_0098402_62_757 | 229 |
| 963 | 3300049575 | Ga0501039_0319704 | Ga0501039_0319704_344_1033 | 229 |
| 964 | 3300049580 | Ga0501046_0001861 | Ga0501046_0001861_12766_13461 | 229 |
| 965 | 3300049583 | Ga0501067_0319823 | Ga0501067_0319823_140_835 | 229 |
| 966 | 3300049585 | Ga0501069_0045541 | Ga0501069_0045541_1651_2346 | 229 |
| 967 | 3300049586 | Ga0501070_0010248 | Ga0501070_0010248_6034_6729 | 229 |
| 968 | 3300049590 | Ga0501074_0426670 | Ga0501074_0426670_91_786 | 229 |
| 969 | 3300049853 | Ga0501226_000017 | Ga0501226_000017_39498_40187 | 229 |
| 970 | 3300050489 | nmdc:mga03683_87068_c1 | nmdc:mga03683_87068_c1_263_952 | 229 |
| 971 | 3300050514 | nmdc:mga08x19_193284_c1 | nmdc:mga08x19_193284_c1_307_996 | 229 |
| 972 | 3300053125 | Ga0500618_009345 | Ga0500618_009345_1719_2408 | 229 |
| 973 | 3300053135 | Ga0500659_0046867 | Ga0500659_0046867_557_1246 | 229 |
| 974 | 3300053140 | Ga0500573_0056391 | Ga0500573_0056391_1069_1758 | 229 |
| 975 | 3300053727 | Ga0500611_046406 | Ga0500611_046406_88_783 | 229 |
| 976 | 3300005530 | Ga0070679_100081979 | Ga0070679_1000819794 | 230 |
| 977 | 3300009093 | Ga0105240_10019805 | Ga0105240_100198054 | 230 |
| 978 | 3300025912 | Ga0207707_10052767 | Ga0207707_100527672 | 230 |
| 979 | 3300025913 | Ga0207695_10040478 | Ga0207695_100404782 | 230 |
| 980 | 3300025921 | Ga0207652_10034747 | Ga0207652_100347473 | 230 |
| 981 | iso_pu_bacteria | 2773857670 | 2774122156 | 276 |
| 982 | iso_pu_bacteria | 2784132072 | 2784314401 | 276 |
| 983 | 2124908027 | MRS2a_Contig_171 | MRS2a_00070420 | 280 |
| 984 | 3300005288 | Ga0065714_10000901 | Ga0065714_100009012 | 280 |
| 985 | 3300005290 | Ga0065712_10000436 | Ga0065712_1000043610 | 280 |
| 986 | 3300009036 | Ga0105244_10087762 | Ga0105244_100877622 | 280 |
| 987 | 3300025711 | Ga0207696_1015171 | Ga0207696_10151713 | 280 |
| 988 | 3300025728 | Ga0207655_1004133 | Ga0207655_10041339 | 280 |
| 989 | 3300025735 | Ga0207713_1003950 | Ga0207713_10039502 | 280 |
| 990 | 3300046557 | Ga0495622_0006468 | Ga0495622_0006468_2363_3205 | 280 |
| 991 | 3300046674 | Ga0495588_0096414 | Ga0495588_0096414_405_1247 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a11-assembly1.cif.gz_A-2 | crystal structure of nuclease domain of ribonuclase iii from mycobacterium tuberculosis | 0.9772 | 58 | 195 |
| 3o2r-assembly2.cif.gz_D | structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni | 0.9716 | 56 | 195 |
| 1di2-assembly1.cif.gz_A | crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions | 0.9607 | 206 | 274 |
| 3adl-assembly1.cif.gz_A | structure of trbp2 and its molecule implications for mirna processing | 0.947 | 204 | 274 |
| 3n3w-assembly1.cif.gz_B | 2.2 angstrom resolution crystal structure of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni | 0.9457 | 56 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A7Y0_154_224_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 1.002 | 204 | 273 | 3.30.160.20 |
| af_P0A7Y0_4_147_1.10.1520.10 | Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain | 0.9952 | 56 | 197 | 1.10.1520.10 |
| 2a11A00 | Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain | 0.9772 | 58 | 195 | 1.10.1520.10 |
| af_P0A7Y0_4_147_1.10.1520.10 | Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain | 0.9746 | 56 | 197 | 1.10.1520.10 |
| af_P0A7Y0_154_224_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9738 | 204 | 273 | 3.30.160.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356E6B3-F1-model_v4 | Ribonuclease III | 0.9934 | 54 | 173 |
GO:0004525
GO:0006396 |
| AF-A0A6L6EC33-F1-model_v4 | deleted | 0.9885 | 73 | 184 |
|
| AF-A0A497HAB7-F1-model_v4 | RNase III domain-containing protein | 0.9843 | 54 | 189 |
GO:0004525
GO:0006396 |
| AF-A0A4Q6EIP2-F1-model_v4 | Ribonuclease III | 0.9805 | 57 | 192 |
GO:0003725
GO:0004525 GO:0006396 GO:0010468 |
| AF-A0A0K8Q528-F1-model_v4 | Ribonuclease 3 | 0.9803 | 55 | 190 |
GO:0003723
GO:0004525 GO:0005737 GO:0030422 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar