F487627

General Info

Members Datasets Scaffolds Average Seq Length
991 496 831 229

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10000901|Ga0065714_100009012
Length 280
Sequence MHFWSRHNRRQTHENNDIQDVIFEHSVNCPKPAPHHGDGGGIQPRTQRGYTVSVSLSRLERQLGYTFKDQELMVLALTHRSFAGRNNERLEFLGDAILNFVAGEALFDRFPLAREGXLSRLRARLVKGETLAVLARGFDLGEYLRLGSGELKSGGFRRESILADALEALIGAIYLDAGMDMARERVLAWLAGEFEGLTLVDTNKDPKTRLQEFLQSRGCELPRYEVVDIQGEPHCRTFFVECEITLLNEKSRGQGVSRRIAEQVAAAAALIALGVENGHD

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231016 Pseudomonas sp. GM50 Isolate Nodule
9 2511231021 Pseudomonas sp. GM78 Isolate Nodule
10 2511231022 Pseudomonas sp. GM79 Isolate Nodule
11 2511231024 Pseudomonas sp. GM84 Isolate Nodule
12 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
13 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
14 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
15 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
16 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
17 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
18 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
19 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
20 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
21 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
22 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
23 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
24 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
25 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
26 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
27 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
28 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
29 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
30 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
31 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
32 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
33 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
34 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
35 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
36 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
37 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
38 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
39 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
40 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
41 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
42 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
43 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
44 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
45 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
46 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
47 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
48 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
49 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
50 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
51 2765235841 Pseudomonas putida AA7 Isolate Unclassified
52 2773857670 Pseudomonas sp. 478 Isolate Unclassified
53 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
54 2784132063 Pseudomonas sp. 424 Isolate Unclassified
55 2784132072 Pseudomonas sp. 460 Isolate Unclassified
56 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
57 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
58 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
59 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
60 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
61 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
62 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
63 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
64 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
65 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
66 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
67 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
68 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
69 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
70 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
71 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
72 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
73 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
74 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
75 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
76 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
77 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
78 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
79 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
80 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
81 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
82 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
83 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
84 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
85 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
86 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
87 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
88 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
89 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
90 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
91 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
92 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
93 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
94 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
95 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
96 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
97 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
98 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
99 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
100 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
101 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
102 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
103 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
104 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
105 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
106 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
107 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
108 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
109 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
110 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
111 2952252522 Salinicola sp. DM10 Isolate Unclassified
112 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
113 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
114 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
115 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
116 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
117 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
118 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
119 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
120 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
121 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
122 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
123 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
124 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
125 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
126 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
127 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
128 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
129 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
130 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
131 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
132 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
133 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
134 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
135 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
136 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
137 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
138 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
139 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
140 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
141 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
142 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
143 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
144 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
145 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
146 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
147 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
148 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
149 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
150 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
151 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
152 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
153 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
154 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
155 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
156 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
157 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
158 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
159 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
160 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
161 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
162 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
163 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
164 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
165 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
166 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
167 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
168 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
169 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
170 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
171 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
172 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
173 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
174 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
175 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
176 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
177 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
178 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
179 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
180 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
181 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
182 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
183 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
184 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
185 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
186 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
187 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
188 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
189 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
190 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
191 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
192 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
193 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
194 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
195 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
200 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
201 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
202 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
203 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
204 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
205 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
206 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
207 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
208 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
209 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
210 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
211 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
212 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
213 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
214 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
215 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
216 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
222 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
223 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
225 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
227 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
228 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
267 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
268 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
277 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
280 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
281 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
282 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
283 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
284 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
285 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
286 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
287 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
288 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
289 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
290 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
291 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
292 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
293 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
294 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
295 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
296 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
297 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
298 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
300 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
301 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
302 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
305 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
306 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
307 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
308 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
309 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
310 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
311 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
312 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
313 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
314 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
315 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
316 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
317 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
318 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
319 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
320 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
321 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
322 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
323 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
324 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
325 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
326 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
327 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
328 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
329 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
330 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
331 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
332 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
333 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
334 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
335 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
336 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
337 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
338 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
339 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
340 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
341 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
342 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
343 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
344 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
345 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
348 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
349 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
350 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
351 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
352 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
353 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
354 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
355 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
356 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
357 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
358 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
359 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
360 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
361 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
362 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
363 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
364 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
365 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
366 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
367 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
368 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
369 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
370 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
371 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
372 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
373 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
374 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
375 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
376 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
377 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
378 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
379 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
380 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
381 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
382 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
383 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
384 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
385 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
386 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
389 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
390 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
391 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
392 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
393 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
394 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
395 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
396 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
397 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
398 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
399 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
400 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
401 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
402 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
403 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
404 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
405 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
406 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
407 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
408 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
409 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
410 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
411 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
412 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
413 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
414 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
415 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
416 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
417 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
418 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
419 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
420 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
421 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
422 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
423 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
424 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
425 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
426 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
427 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
428 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
429 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
430 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
431 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
432 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
433 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
434 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
447 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
448 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
449 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
453 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
454 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
455 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
456 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
459 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
460 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
461 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
462 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
463 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
464 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
465 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
466 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
467 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
468 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
469 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
470 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
471 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
472 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
473 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
474 8052494512 Pseudomonas putida LD6 Isolate Unclassified
475 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
476 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
477 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
478 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
479 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
480 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
481 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
482 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
483 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
484 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
485 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
486 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
487 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
488 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
489 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
490 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
491 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
492 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
493 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
494 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
495 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
496 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.35
Metatranscriptomes 0.5
Isolates 16.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 4.04
Nodule 1.11
Rhizoplane 3.23
Rhizosphere 77.9
Stem 0
Stem Tuber 0
Unclassified 13.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_171 2124908027 Bacteria 22045
2 SwRhRL2b_contig_836207 2162886007 Bacteria 1203
3 JGI25162J39368_1000126 3300002737 Bacteria 84404
4 JGI25164J39214_1000100 3300002772 Bacteria 84404
5 JGI25165J46597_1000207 3300003214 Bacteria 84404
6 Ga0055539_1000039 3300003752 Bacteria 203858
7 Ga0055533_1000049 3300003756 Bacteria 203858
8 Ga0055532_1000049 3300003758 Bacteria 174079
9 Ga0055525_1000077 3300003759 Bacteria 166608
10 Ga0055536_1005866 3300003781 Bacteria 5893
11 Ga0055536_1016124 3300003781 Bacteria 2516
12 Ga0055530_10003906 3300003791 Bacteria 8114
13 Ga0055540_1001086 3300003792 Bacteria 17251
14 Ga0055540_1002667 3300003792 Bacteria 9212
15 Ga0055541_1000026 3300003841 Bacteria 203858
16 Ga0058692_1014272 3300003856 Bacteria 1825
17 Ga0065714_10000901 3300005288 Bacteria 2139
18 Ga0065714_10004098 3300005288 Bacteria 9895
19 Ga0065714_10007073 3300005288 Bacteria 3007
20 Ga0065704_10082904 3300005289 Bacteria 3536
21 Ga0065704_10083049 3300005289 Bacteria 3515
22 Ga0065704_10110576 3300005289 Bacteria 1970
23 Ga0065712_10000436 3300005290 Bacteria 11353
24 Ga0065712_10067895 3300005290 Bacteria 22221
25 Ga0070670_100039675 3300005331 Bacteria 4048
26 Ga0070670_100061804 3300005331 Bacteria 3215
27 Ga0070677_10008755 3300005333 Bacteria 3415
28 Ga0070682_100112133 3300005337 Bacteria 1819
29 Ga0070682_100137545 3300005337 Bacteria 1661
30 Ga0070661_100187131 3300005344 Bacteria 1578
31 Ga0070668_100079640 3300005347 Bacteria 2565
32 Ga0070669_100000292 3300005353 Bacteria 39324
33 Ga0070669_100002278 3300005353 Bacteria 13917
34 Ga0070669_100106952 3300005353 Bacteria 2118
35 Ga0070675_100004279 3300005354 Bacteria 10872
36 Ga0070675_100029716 3300005354 Bacteria 4409
37 Ga0070675_100266241 3300005354 Bacteria 1503
38 Ga0070675_100438502 3300005354 Bacteria 1170
39 Ga0070674_100024236 3300005356 Bacteria 3936
40 Ga0070674_100065806 3300005356 Bacteria 2545
41 Ga0070673_100010143 3300005364 Bacteria 6361
42 Ga0070688_100035678 3300005365 Bacteria 3021
43 Ga0070659_100859398 3300005366 Bacteria 791
44 Ga0070705_100284555 3300005440 Bacteria 1177
45 Ga0070700_100230606 3300005441 Bacteria 1317
46 Ga0070663_100540934 3300005455 Bacteria 972
47 Ga0070678_100068023 3300005456 Bacteria 2654
48 Ga0070678_100079035 3300005456 Bacteria 2486
49 Ga0070662_100000560 3300005457 Bacteria 22585
50 Ga0070662_100321900 3300005457 Bacteria 1261
51 Ga0070681_10301329 3300005458 Bacteria 1512
52 Ga0068867_100141430 3300005459 Bacteria 1881
53 Ga0070685_10023831 3300005466 Bacteria 3355
54 Ga0070685_10053201 3300005466 Bacteria 2345
55 Ga0070685_10183733 3300005466 Bacteria 1348
56 Ga0070679_100081979 3300005530 Bacteria 3216
57 Ga0068853_100006406 3300005539 Bacteria 9353
58 Ga0070672_100005085 3300005543 Bacteria 8679
59 Ga0070672_100068414 3300005543 Bacteria 2816
60 Ga0070672_100089962 3300005543 Bacteria 2474
61 Ga0070672_100229971 3300005543 Bacteria 1557
62 Ga0070665_100002619 3300005548 Bacteria 19629
63 Ga0070664_100030848 3300005564 Bacteria 4474
64 Ga0070664_100641769 3300005564 Bacteria 986
65 Ga0068854_100004163 3300005578 Bacteria 9096
66 Ga0068859_100067363 3300005617 Bacteria 3615
67 Ga0068859_100233488 3300005617 Bacteria 1928
68 Ga0068859_100862854 3300005617 Bacteria 991
69 Ga0068864_100642716 3300005618 Bacteria 1032
70 Ga0068861_100287238 3300005719 Bacteria 1419
71 Ga0068851_10000006 3300005834 Bacteria 258116
72 Ga0068870_10003293 3300005840 Bacteria 6825
73 Ga0068863_100375408 3300005841 Bacteria 1388
74 Ga0068862_100240770 3300005844 Bacteria 1645
75 Ga0068862_100420169 3300005844 Bacteria 1254
76 Ga0075364_10121181 3300006051 Bacteria 1751
77 Ga0075432_10049305 3300006058 Bacteria 1483
78 Ga0097621_100551519 3300006237 Bacteria 1049
79 Ga0068871_100097715 3300006358 Bacteria 2455
80 Ga0068865_100161982 3300006881 Bacteria 1707
81 Ga0068865_100232472 3300006881 Bacteria 1447
82 Ga0097620_100067364 3300006931 Bacteria 3615
83 Ga0097620_100233478 3300006931 Bacteria 1928
84 Ga0097620_100328601 3300006931 Bacteria 1623
85 Ga0097620_100862849 3300006931 Bacteria 991
86 Ga0099823_1000054 3300006944 Bacteria 55085
87 Ga0079104_1000917 3300006946 Bacteria 23727
88 Ga0105251_10000004 3300009011 Bacteria 285212
89 Ga0105251_10000149 3300009011 Bacteria 71244
90 Ga0105251_10000935 3300009011 Bacteria 26139
91 Ga0105251_10006259 3300009011 Bacteria 7629
92 Ga0105251_10008504 3300009011 Bacteria 6165
93 Ga0105251_10013238 3300009011 Bacteria 4624
94 Ga0105251_10072706 3300009011 Bacteria 1598
95 Ga0105251_10092040 3300009011 Bacteria 1392
96 Ga0105251_10163534 3300009011 Bacteria 1003
97 Ga0105251_10271248 3300009011 Bacteria 766
98 Ga0105244_10000031 3300009036 Bacteria 177606
99 Ga0105244_10000922 3300009036 Bacteria 24861
100 Ga0105244_10004903 3300009036 Bacteria 9067
101 Ga0105244_10006728 3300009036 Bacteria 7395
102 Ga0105244_10010706 3300009036 Bacteria 5544
103 Ga0105244_10015168 3300009036 Bacteria 4426
104 Ga0105244_10016206 3300009036 Bacteria 4252
105 Ga0105244_10025677 3300009036 Bacteria 3198
106 Ga0105244_10030254 3300009036 Bacteria 2882
107 Ga0105244_10047337 3300009036 Bacteria 2206
108 Ga0105244_10054694 3300009036 Bacteria 2024
109 Ga0105244_10063867 3300009036 Bacteria 1848
110 Ga0105244_10087762 3300009036 Bacteria 1532
111 Ga0105244_10279559 3300009036 Bacteria 774
112 Ga0105244_10303763 3300009036 Bacteria 738
113 Ga0105250_10000235 3300009092 Bacteria 46317
114 Ga0105250_10003383 3300009092 Bacteria 7565
115 Ga0105250_10004328 3300009092 Bacteria 6551
116 Ga0105250_10024448 3300009092 Bacteria 2434
117 Ga0105250_10042350 3300009092 Bacteria 1825
118 Ga0105250_10077221 3300009092 Bacteria 1348
119 Ga0105250_10079672 3300009092 Bacteria 1327
120 Ga0105240_10019805 3300009093 Bacteria 8987
121 Ga0105247_10000048 3300009101 Bacteria 150745
122 Ga0105243_10001292 3300009148 Bacteria 22446
123 Ga0105243_10001767 3300009148 Bacteria 18576
124 Ga0105243_10039035 3300009148 Bacteria 3700
125 Ga0105243_10064661 3300009148 Bacteria 2936
126 Ga0105243_10206080 3300009148 Bacteria 1728
127 Ga0105243_10542411 3300009148 Bacteria 1110
128 Ga0105242_10000233 3300009176 Bacteria 43902
129 Ga0105237_10000160 3300009545 Bacteria 95183
130 Ga0105238_11323403 3300009551 Bacteria 747
131 Ga0105249_10475853 3300009553 Bacteria 1291
132 Ga0105246_10000822 3300011119 Bacteria 17660
133 Ga0105246_10125641 3300011119 Bacteria 1908
134 Ga0105246_10288591 3300011119 Bacteria 1319
135 Ga0157345_1000347 3300012498 Bacteria 5414
136 Ga0157373_10000473 3300013100 Bacteria 31857
137 Ga0157373_10001605 3300013100 Bacteria 17261
138 Ga0157373_10004828 3300013100 Bacteria 10143
139 Ga0157373_10060224 3300013100 Bacteria 2690
140 Ga0157373_10222780 3300013100 Bacteria 1331
141 Ga0157373_10261841 3300013100 Bacteria 1224
142 Ga0157373_10345603 3300013100 Bacteria 1061
143 Ga0157371_10000460 3300013102 Bacteria 49750
144 Ga0157371_10001529 3300013102 Bacteria 23814
145 Ga0157371_10003068 3300013102 Bacteria 15502
146 Ga0157371_10007535 3300013102 Bacteria 8798
147 Ga0157371_10024923 3300013102 Bacteria 4365
148 Ga0157371_10030541 3300013102 Bacteria 3887
149 Ga0157371_10108493 3300013102 Bacteria 1970
150 Ga0157371_10143168 3300013102 Bacteria 1703
151 Ga0157370_10000572 3300013104 Bacteria 45922
152 Ga0157370_10165536 3300013104 Bacteria 2056
153 Ga0157370_10398975 3300013104 Bacteria 1266
154 Ga0157369_10035640 3300013105 Bacteria 5453
155 Ga0157369_10073948 3300013105 Bacteria 3655
156 Ga0157369_10144236 3300013105 Bacteria 2518
157 Ga0157369_10174391 3300013105 Bacteria 2264
158 Ga0157369_10234656 3300013105 Bacteria 1917
159 Ga0157369_10467425 3300013105 Bacteria 1306
160 Ga0163162_10004406 3300013306 Bacteria 13546
161 Ga0157372_10000815 3300013307 Bacteria 33774
162 Ga0157372_10059115 3300013307 Bacteria 4287
163 Ga0157372_10165575 3300013307 Bacteria 2556
164 Ga0157372_10627579 3300013307 Bacteria 1252
165 Ga0157375_10043888 3300013308 Bacteria 4338
166 Ga0157375_10270891 3300013308 Bacteria 1860
167 Ga0157380_10004215 3300014326 Bacteria 9944
168 Ga0157380_10037459 3300014326 Bacteria 3758
169 Ga0157380_10145508 3300014326 Bacteria 2042
170 Ga0157380_10295877 3300014326 Bacteria 1488
171 Ga0182008_10000570 3300014497 Bacteria 27277
172 Ga0182008_10009461 3300014497 Bacteria 5257
173 Ga0182008_10031014 3300014497 Bacteria 2693
174 Ga0157376_10301049 3300014969 Bacteria 1518
175 Ga0157376_10489937 3300014969 Bacteria 1206
176 Ga0182006_1062988 3300015261 Bacteria 1394
177 Ga0182006_1108278 3300015261 Bacteria 978
178 Ga0182006_1115165 3300015261 Bacteria 940
179 Ga0182007_10006004 3300015262 Bacteria 5264
180 Ga0182005_1017434 3300015265 Bacteria 1988
181 Ga0163161_10000005 3300017792 Bacteria 327860
182 Ga0163161_10605337 3300017792 Bacteria 904
183 Ga0209435_100669 3300025206 Bacteria 6033
184 Ga0209784_100045 3300025224 Bacteria 203911
185 Ga0209566_100057 3300025225 Bacteria 203960
186 Ga0209674_100080 3300025226 Bacteria 203960
187 Ga0209147_100079 3300025229 Bacteria 203960
188 Ga0209563_100078 3300025230 Bacteria 203960
189 Ga0207427_100001 3300025231 Bacteria 1410763
190 Ga0209437_100003 3300025233 Bacteria 1517827
191 Ga0209258_100178 3300025242 Bacteria 138843
192 Ga0209646_1000311 3300025246 Bacteria 38501
193 Ga0209677_100045 3300025253 Bacteria 203960
194 Ga0209759_1003165 3300025256 Bacteria 6711
195 Ga0209759_1006779 3300025256 Bacteria 3796
196 Ga0209233_1000007 3300025261 Bacteria 1411234
197 Ga0209676_1000056 3300025292 Bacteria 361329
198 Ga0209676_1000721 3300025292 Bacteria 45474
199 Ga0209676_1004156 3300025292 Bacteria 8235
200 Ga0209050_1000027 3300025298 Bacteria 483261
201 Ga0209050_1000181 3300025298 Bacteria 142533
202 Ga0209050_1002328 3300025298 Bacteria 16701
203 Ga0209051_1000061 3300025303 Bacteria 253485
204 Ga0209051_1000065 3300025303 Bacteria 231445
205 Ga0209051_1023515 3300025303 Bacteria 2558
206 Ga0207656_10000017 3300025321 Bacteria 117646
207 Ga0207696_1000022 3300025711 Bacteria 427529
208 Ga0207696_1000035 3300025711 Bacteria 339626
209 Ga0207696_1000039 3300025711 Bacteria 324954
210 Ga0207696_1000044 3300025711 Bacteria 300953
211 Ga0207696_1003748 3300025711 Bacteria 6792
212 Ga0207696_1003920 3300025711 Bacteria 6561
213 Ga0207696_1015171 3300025711 Bacteria 2618
214 Ga0207696_1037561 3300025711 Bacteria 1433
215 Ga0207655_1000005 3300025728 Bacteria 917277
216 Ga0207655_1000015 3300025728 Bacteria 600662
217 Ga0207655_1000240 3300025728 Bacteria 90267
218 Ga0207655_1000462 3300025728 Bacteria 53331
219 Ga0207655_1001511 3300025728 Bacteria 21214
220 Ga0207655_1002564 3300025728 Bacteria 14532
221 Ga0207655_1003475 3300025728 Bacteria 11712
222 Ga0207655_1004133 3300025728 Bacteria 10427
223 Ga0207655_1010955 3300025728 Bacteria 5447
224 Ga0207655_1012202 3300025728 Bacteria 5045
225 Ga0207655_1015532 3300025728 Bacteria 4224
226 Ga0207655_1022327 3300025728 Bacteria 3178
227 Ga0207655_1036554 3300025728 Bacteria 2175
228 Ga0207655_1050350 3300025728 Bacteria 1694
229 Ga0207713_1000013 3300025735 Bacteria 475751
230 Ga0207713_1000086 3300025735 Bacteria 157106
231 Ga0207713_1000104 3300025735 Bacteria 138310
232 Ga0207713_1000454 3300025735 Bacteria 42911
233 Ga0207713_1003950 3300025735 Bacteria 9850
234 Ga0207713_1005892 3300025735 Bacteria 7568
235 Ga0207713_1011540 3300025735 Bacteria 4792
236 Ga0207713_1024556 3300025735 Bacteria 2807
237 Ga0207713_1031185 3300025735 Bacteria 2360
238 Ga0207713_1039599 3300025735 Bacteria 1986
239 Ga0207713_1072527 3300025735 Bacteria 1267
240 Ga0207682_10000686 3300025893 Bacteria 15721
241 Ga0207682_10006464 3300025893 Bacteria 4718
242 Ga0207682_10042409 3300025893 Bacteria 1859
243 Ga0207642_10282934 3300025899 Bacteria 955
244 Ga0207710_10000026 3300025900 Bacteria 307644
245 Ga0207643_10017116 3300025908 Bacteria 3958
246 Ga0207643_10153430 3300025908 Bacteria 1382
247 Ga0207707_10052767 3300025912 Bacteria 3538
248 Ga0207707_10293602 3300025912 Bacteria 1406
249 Ga0207695_10040478 3300025913 Bacteria 4995
250 Ga0207693_10339662 3300025915 Bacteria 1175
251 Ga0207663_10506160 3300025916 Bacteria 939
252 Ga0207652_10034747 3300025921 Bacteria 4251
253 Ga0207681_10000679 3300025923 Bacteria 22341
254 Ga0207681_10027485 3300025923 Bacteria 3679
255 Ga0207650_10000668 3300025925 Bacteria 26952
256 Ga0207650_10001102 3300025925 Bacteria 19910
257 Ga0207659_10008076 3300025926 Bacteria 6515
258 Ga0207659_10023389 3300025926 Bacteria 4123
259 Ga0207659_10128848 3300025926 Bacteria 1950
260 Ga0207659_10322124 3300025926 Bacteria 1275
261 Ga0207706_10001474 3300025933 Bacteria 23502
262 Ga0207709_10028404 3300025935 Bacteria 3233
263 Ga0207709_10034539 3300025935 Bacteria 2981
264 Ga0207709_10077797 3300025935 Bacteria 2128
265 Ga0207709_10616165 3300025935 Bacteria 861
266 Ga0207670_10085861 3300025936 Bacteria 2213
267 Ga0207669_10009009 3300025937 Bacteria 4723
268 Ga0207669_10037715 3300025937 Bacteria 2775
269 Ga0207669_10048097 3300025937 Bacteria 2531
270 Ga0207704_10031354 3300025938 Bacteria 2993
271 Ga0207704_10142299 3300025938 Bacteria 1680
272 Ga0207691_10016948 3300025940 Bacteria 6913
273 Ga0207691_10023826 3300025940 Bacteria 5761
274 Ga0207689_10109731 3300025942 Bacteria 2267
275 Ga0207679_10086668 3300025945 Bacteria 2409
276 Ga0207651_10005709 3300025960 Bacteria 6424
277 Ga0207668_10073304 3300025972 Bacteria 2453
278 Ga0207668_10273018 3300025972 Bacteria 1383
279 Ga0207640_10031633 3300025981 Bacteria 3272
280 Ga0207639_10003002 3300026041 Bacteria 11354
281 Ga0207678_10131305 3300026067 Bacteria 2137
282 Ga0207678_10624398 3300026067 Bacteria 946
283 Ga0207708_10023462 3300026075 Bacteria 4663
284 Ga0207708_10124399 3300026075 Bacteria 2012
285 Ga0207641_10077604 3300026088 Bacteria 2875
286 Ga0207648_10268718 3300026089 Bacteria 1523
287 Ga0207648_10606762 3300026089 Bacteria 1009
288 Ga0207676_10601188 3300026095 Bacteria 1056
289 Ga0207675_100068850 3300026118 Bacteria 3307
290 Ga0207675_100327998 3300026118 Bacteria 1495
291 Ga0207683_10039155 3300026121 Bacteria 4135
292 Ga0207683_10127202 3300026121 Bacteria 2290
293 Ga0207683_10710897 3300026121 Bacteria 932
294 Ga0209281_1000013 3300027111 Bacteria 653449
295 Ga0209389_1000002 3300027296 Bacteria 333932
296 Ga0209371_1000239 3300027312 Bacteria 68842
297 Ga0209371_1000253 3300027312 Bacteria 65388
298 Ga0209371_1003222 3300027312 Bacteria 8190
299 Ga0209371_1005194 3300027312 Bacteria 5287
300 Ga0209995_1000414 3300027471 Bacteria 6643
301 Ga0209968_1003561 3300027526 Bacteria 2335
302 Ga0209999_1003846 3300027543 Bacteria 2699
303 Ga0210002_1009337 3300027617 Bacteria 1497
304 Ga0209983_1000325 3300027665 Bacteria 9954
305 Ga0209971_1001262 3300027682 Bacteria 6315
306 Ga0209974_10007126 3300027876 Bacteria 3864
307 Ga0207428_10249763 3300027907 Bacteria 1323
308 Ga0268266_10041404 3300028379 Bacteria 3930
309 Ga0268265_10069157 3300028380 Bacteria 2741
310 Ga0268256_1000199 3300030500 Bacteria 68849
311 Ga0268256_1000367 3300030500 Bacteria 42860
312 Ga0268256_1004916 3300030500 Bacteria 5392
313 Ga0314311_1224394 3300030733 Bacteria 3180
314 Ga0265339_10226017 3300031249 Bacteria 913
315 Ga0265331_10156701 3300031250 Bacteria 1033
316 Ga0307513_10007954 3300031456 Bacteria 13642
317 Ga0307509_10008745 3300031507 Bacteria 12810
318 Ga0307408_100000081 3300031548 Bacteria 106920
319 Ga0307408_100191555 3300031548 Bacteria 1648
320 Ga0316575_10039977 3300031665 Bacteria 1852
321 Ga0316579_10000057 3300031691 Bacteria 26877
322 Ga0316578_10115257 3300031728 Bacteria 1614
323 Ga0316577_10007619 3300031733 Bacteria 5776
324 Ga0307406_10012977 3300031901 Bacteria 4762
325 Ga0307407_10283524 3300031903 Bacteria 1148
326 Ga0307409_100008553 3300031995 Bacteria 6221
327 Ga0307409_100069783 3300031995 Bacteria 2786
328 Ga0307409_100070786 3300031995 Bacteria 2770
329 Ga0307416_100006820 3300032002 Bacteria 7186
330 Ga0307414_10048055 3300032004 Bacteria 2941
331 Ga0307414_10409439 3300032004 Bacteria 1180
332 Ga0307411_10067409 3300032005 Bacteria 2408
333 Ga0307415_100313280 3300032126 Bacteria 1305
334 Ga0316585_10003715 3300032137 Bacteria 4211
335 Ga0316585_10006649 3300032137 Bacteria 3309
336 Ga0316585_10029843 3300032137 Bacteria 1709
337 Ga0316593_10001028 3300032168 Bacteria 5788
338 Ga0316593_10003019 3300032168 Bacteria 4102
339 Ga0316593_10055671 3300032168 Bacteria 1345
340 Ga0316593_10128852 3300032168 Bacteria 912
341 Ga0373934_0074571 3300035086 Bacteria 1359
342 Ga0373955_0054195 3300035172 Bacteria 2192
343 Ga0316574_0224641 3300035398 Bacteria 1202
344 Ga0373933_0038554 3300035724 Bacteria 2808
345 Ga0373937_0002058 3300036401 Bacteria 16806
346 Ga0316582_0001289 3300036647 Bacteria 10845
347 Ga0316582_0147306 3300036647 Bacteria 1590
348 Ga0316582_0215001 3300036647 Bacteria 1314
349 Ga0316584_0001968 3300036712 Bacteria 12826
350 Ga0316584_0015811 3300036712 Bacteria 5403
351 Ga0316584_0138709 3300036712 Bacteria 1814
352 Ga0316584_0542910 3300036712 Bacteria 812
353 Ga0316581_0019261 3300037588 Bacteria 1988
354 Ga0316581_0060986 3300037588 Bacteria 1157
355 Ga0237819_03246 3300038705 Bacteria 2946
356 Ga0400483_004725 3300039062 Bacteria 184421
357 Ga0400483_067590 3300039062 Bacteria 70090
358 Ga0400483_113686 3300039062 Bacteria 71883
359 Ga0400489_01548 3300039093 Bacteria 3187
360 Ga0400487_32164 3300039110 Bacteria 36666
361 Ga0439436_0000833 3300041404 Bacteria 8396
362 Ga0439438_000002 3300041405 Bacteria 618223
363 Ga0439438_001224 3300041405 Bacteria 11394
364 Ga0439438_001311 3300041405 Bacteria 11020
365 Ga0439438_001549 3300041405 Bacteria 10138
366 Ga0439438_004008 3300041405 Bacteria 5784
367 Ga0439438_005594 3300041405 Bacteria 4588
368 Ga0439438_010939 3300041405 Bacteria 2847
369 Ga0439438_021145 3300041405 Bacteria 1818
370 Ga0439438_024202 3300041405 Bacteria 1664
371 Ga0439438_024411 3300041405 Bacteria 1655
372 Ga0439447_002008 3300041407 Bacteria 7477
373 Ga0439447_017403 3300041407 Bacteria 1957
374 Ga0439447_021944 3300041407 Bacteria 1676
375 Ga0439466_0000342 3300041411 Bacteria 17912
376 Ga0439466_0003474 3300041411 Bacteria 6107
377 Ga0439466_0008671 3300041411 Bacteria 3830
378 Ga0439466_0017990 3300041411 Bacteria 2539
379 Ga0439466_0018321 3300041411 Bacteria 2512
380 Ga0439466_0032593 3300041411 Bacteria 1775
381 Ga0439466_0054106 3300041411 Bacteria 1308
382 Ga0451797_0851571 3300041453 Bacteria 2218
383 Ga0451807_0342670 3300041486 Bacteria 1908
384 Ga0451807_0343574 3300041486 Bacteria 1796
385 Ga0451807_1464927 3300041486 Bacteria 6723
386 Ga0451853_1748554 3300041512 Bacteria 1434
387 Ga0439431_0030722 3300041997 Bacteria 1332
388 Ga0439437_001017 3300042000 Bacteria 2932
389 Ga0439432_001917 3300042006 Bacteria 7854
390 Ga0439432_002272 3300042006 Bacteria 7244
391 Ga0439432_012067 3300042006 Bacteria 2965
392 Ga0439432_041463 3300042006 Bacteria 1457
393 Ga0439432_077801 3300042006 Bacteria 1006
394 Ga0439451_007452 3300042009 Bacteria 2229
395 Ga0439452_003201 3300042010 Bacteria 5790
396 Ga0439452_003645 3300042010 Bacteria 5346
397 Ga0439452_040989 3300042010 Bacteria 1090
398 Ga0439456_013404 3300042013 Bacteria 1705
399 Ga0439463_000853 3300042016 Bacteria 8362
400 Ga0439463_002002 3300042016 Bacteria 5301
401 Ga0439463_005102 3300042016 Bacteria 3267
402 Ga0450911_000037 3300042115 Bacteria 60341
403 Ga0450911_001642 3300042115 Bacteria 4967
404 Ga0450911_013889 3300042115 Bacteria 1074
405 Ga0450919_013351 3300042121 Bacteria 929
406 Ga0450923_006052 3300042125 Bacteria 1984
407 Ga0450890_004602 3300042127 Bacteria 1799
408 Ga0450900_014018 3300042136 Bacteria 1066
409 Ga0450902_006795 3300042137 Bacteria 1757
410 Ga0450903_015907 3300042138 Bacteria 1182
411 Ga0450904_000010 3300042139 Bacteria 43301
412 Ga0450905_004233 3300042142 Bacteria 1895
413 Ga0450905_038071 3300042142 Bacteria 758
414 Ga0450907_002271 3300042146 Bacteria 3729
415 Ga0450907_002488 3300042146 Bacteria 3503
416 Ga0450910_000828 3300042147 Bacteria 3745
417 Ga0439446_0007265 3300042156 Bacteria 2909
418 Ga0439446_0085730 3300042156 Bacteria 980
419 Ga0450909_005848 3300042185 Bacteria 1772
420 Ga0439434_0005198 3300042435 Bacteria 3806
421 Ga0439464_0004718 3300042439 Bacteria 3492
422 Ga0439464_0008158 3300042439 Bacteria 2745
423 Ga0439464_0099538 3300042439 Bacteria 882
424 Ga0439460_0002311 3300042461 Bacteria 4585
425 Ga0450893_0007907 3300042532 Bacteria 1728
426 Ga0450901_001715 3300042533 Bacteria 2470
427 Ga0439440_0035470 3300042993 Bacteria 1196
428 Ga0495617_006990 3300046452 Bacteria 3934
429 Ga0495617_020318 3300046452 Bacteria 2244
430 Ga0495617_039050 3300046452 Bacteria 1587
431 Ga0495617_060399 3300046452 Bacteria 1254
432 Ga0495627_000021 3300046453 Bacteria 282454
433 Ga0495627_000128 3300046453 Bacteria 92036
434 Ga0495627_000279 3300046453 Bacteria 51531
435 Ga0495627_002877 3300046453 Bacteria 7932
436 Ga0495627_017992 3300046453 Bacteria 2392
437 Ga0495627_032243 3300046453 Bacteria 1649
438 Ga0495603_0126094 3300046455 Bacteria 1492
439 Ga0495590_0005949 3300046457 Bacteria 4783
440 Ga0495590_0068414 3300046457 Bacteria 1244
441 Ga0495591_000015 3300046458 Bacteria 252107
442 Ga0495591_001669 3300046458 Bacteria 13384
443 Ga0495591_002885 3300046458 Bacteria 9218
444 Ga0495591_004439 3300046458 Bacteria 6880
445 Ga0495591_008158 3300046458 Bacteria 4322
446 Ga0495591_008588 3300046458 Bacteria 4167
447 Ga0495591_013373 3300046458 Bacteria 3007
448 Ga0495591_021189 3300046458 Bacteria 2127
449 Ga0495591_053892 3300046458 Bacteria 1089
450 Ga0495629_0303336 3300046459 Bacteria 1093
451 Ga0495638_0004299 3300046460 Bacteria 10811
452 Ga0495638_0007372 3300046460 Bacteria 7894
453 Ga0495638_0056195 3300046460 Bacteria 2442
454 Ga0495638_0067200 3300046460 Bacteria 2201
455 Ga0495638_0205775 3300046460 Bacteria 1108
456 Ga0495653_0043552 3300046463 Bacteria 3489
457 Ga0495653_0064101 3300046463 Bacteria 2769
458 Ga0495653_0071493 3300046463 Bacteria 2593
459 Ga0495650_0000672 3300046471 Bacteria 44486
460 Ga0495650_0008514 3300046471 Bacteria 5968
461 Ga0495650_0010244 3300046471 Bacteria 5243
462 Ga0495650_0014847 3300046471 Bacteria 4023
463 Ga0495650_0025885 3300046471 Bacteria 2739
464 Ga0495650_0040686 3300046471 Bacteria 1993
465 Ga0495582_0140242 3300046473 Bacteria 1369
466 Ga0495605_0000016 3300046474 Bacteria 289508
467 Ga0495605_0000031 3300046474 Bacteria 213242
468 Ga0495605_0009557 3300046474 Bacteria 5443
469 Ga0495605_0012810 3300046474 Bacteria 4640
470 Ga0495605_0020101 3300046474 Bacteria 3552
471 Ga0495605_0028704 3300046474 Bacteria 2870
472 Ga0495605_0052335 3300046474 Bacteria 1984
473 Ga0495639_0002355 3300046475 Bacteria 8263
474 Ga0495584_0012531 3300046491 Bacteria 4328
475 Ga0495584_0070675 3300046491 Bacteria 1754
476 Ga0495584_0246861 3300046491 Bacteria 907
477 Ga0495585_0021995 3300046492 Bacteria 3660
478 Ga0495585_0036292 3300046492 Bacteria 2781
479 Ga0495594_0040103 3300046499 Bacteria 2561
480 Ga0495596_0005366 3300046500 Bacteria 6065
481 Ga0495596_0016371 3300046500 Bacteria 3082
482 Ga0495596_0114782 3300046500 Bacteria 1046
483 Ga0495607_0000213 3300046501 Bacteria 61906
484 Ga0495607_0000248 3300046501 Bacteria 57955
485 Ga0495607_0000780 3300046501 Bacteria 30486
486 Ga0495607_0002842 3300046501 Bacteria 13733
487 Ga0495607_0006701 3300046501 Bacteria 8065
488 Ga0495607_0009954 3300046501 Bacteria 6402
489 Ga0495607_0035190 3300046501 Bacteria 3031
490 Ga0495607_0049776 3300046501 Bacteria 2441
491 Ga0495607_0107693 3300046501 Bacteria 1482
492 Ga0495607_0137813 3300046501 Bacteria 1262
493 Ga0495607_0194454 3300046501 Bacteria 1008
494 Ga0495607_0209265 3300046501 Bacteria 960
495 Ga0495607_0216479 3300046501 Bacteria 939
496 Ga0495583_0000041 3300046506 Bacteria 234707
497 Ga0495583_0000698 3300046506 Bacteria 43244
498 Ga0495583_0003486 3300046506 Bacteria 11919
499 Ga0495583_0007614 3300046506 Bacteria 6759
500 Ga0495583_0023108 3300046506 Bacteria 3152
501 Ga0495583_0072323 3300046506 Bacteria 1513
502 Ga0495583_0095210 3300046506 Bacteria 1277
503 Ga0495606_0000055 3300046507 Bacteria 199348
504 Ga0495606_0002535 3300046507 Bacteria 21017
505 Ga0495606_0021122 3300046507 Bacteria 4774
506 Ga0495606_0025179 3300046507 Bacteria 4268
507 Ga0495606_0047702 3300046507 Bacteria 2822
508 Ga0495606_0048476 3300046507 Bacteria 2794
509 Ga0495610_0011574 3300046512 Bacteria 5380
510 Ga0495610_0037130 3300046512 Bacteria 2482
511 Ga0495610_0070752 3300046512 Bacteria 1628
512 Ga0495616_0003504 3300046513 Bacteria 10039
513 Ga0495616_0018287 3300046513 Bacteria 3850
514 Ga0495616_0062591 3300046513 Bacteria 1821
515 Ga0495616_0064862 3300046513 Bacteria 1781
516 Ga0495616_0097381 3300046513 Bacteria 1384
517 Ga0495616_0188867 3300046513 Bacteria 911
518 Ga0495620_0000013 3300046515 Bacteria 160349
519 Ga0495620_0000015 3300046515 Bacteria 154625
520 Ga0495620_0005216 3300046515 Bacteria 7273
521 Ga0495620_0007041 3300046515 Bacteria 6134
522 Ga0495620_0031553 3300046515 Bacteria 2426
523 Ga0495620_0057198 3300046515 Bacteria 1638
524 Ga0495620_0062734 3300046515 Bacteria 1542
525 Ga0495620_0090181 3300046515 Bacteria 1231
526 Ga0495630_0114013 3300046517 Bacteria 2048
527 Ga0495630_0177603 3300046517 Bacteria 1623
528 Ga0495631_0005402 3300046518 Bacteria 6686
529 Ga0495631_0012690 3300046518 Bacteria 4108
530 Ga0495632_0000912 3300046519 Bacteria 25920
531 Ga0495632_0000914 3300046519 Bacteria 25916
532 Ga0495632_0004792 3300046519 Bacteria 9107
533 Ga0495632_0006071 3300046519 Bacteria 7836
534 Ga0495632_0054101 3300046519 Bacteria 1968
535 Ga0495632_0081951 3300046519 Bacteria 1538
536 Ga0495632_0093183 3300046519 Bacteria 1425
537 Ga0495632_0094242 3300046519 Bacteria 1416
538 Ga0495637_0002612 3300046520 Bacteria 9881
539 Ga0495637_0004529 3300046520 Bacteria 7191
540 Ga0495637_0005694 3300046520 Bacteria 6319
541 Ga0495637_0013628 3300046520 Bacteria 3854
542 Ga0495637_0034150 3300046520 Bacteria 2229
543 Ga0495637_0061030 3300046520 Bacteria 1546
544 Ga0495637_0093297 3300046520 Bacteria 1184
545 Ga0495637_0133004 3300046520 Bacteria 948
546 Ga0495643_0000223 3300046522 Bacteria 86920
547 Ga0495643_0000903 3300046522 Bacteria 31380
548 Ga0495643_0019550 3300046522 Bacteria 3916
549 Ga0495643_0024183 3300046522 Bacteria 3448
550 Ga0495644_0002168 3300046523 Bacteria 7885
551 Ga0495644_0045454 3300046523 Bacteria 1651
552 Ga0495644_0062484 3300046523 Bacteria 1399
553 Ga0495648_0001423 3300046524 Bacteria 23410
554 Ga0495648_0049543 3300046524 Bacteria 2573
555 Ga0495648_0061188 3300046524 Bacteria 2237
556 Ga0495648_0096057 3300046524 Bacteria 1647
557 Ga0495648_0200171 3300046524 Bacteria 1000
558 Ga0495666_0022867 3300046526 Bacteria 3094
559 Ga0495666_0064542 3300046526 Bacteria 1747
560 Ga0495642_0002131 3300046528 Bacteria 8166
561 Ga0495642_0035623 3300046528 Bacteria 2008
562 Ga0495652_0326822 3300046529 Bacteria 1106
563 Ga0495654_0000033 3300046530 Bacteria 201799
564 Ga0495654_0003357 3300046530 Bacteria 9863
565 Ga0495654_0003364 3300046530 Bacteria 9852
566 Ga0495654_0014186 3300046530 Bacteria 4246
567 Ga0495654_0017170 3300046530 Bacteria 3809
568 Ga0495654_0037853 3300046530 Bacteria 2415
569 Ga0495654_0048994 3300046530 Bacteria 2070
570 Ga0495654_0086018 3300046530 Bacteria 1465
571 Ga0495654_0138884 3300046530 Bacteria 1084
572 Ga0495654_0165479 3300046530 Bacteria 968
573 Ga0495586_0079406 3300046535 Bacteria 1801
574 Ga0495587_0021981 3300046536 Bacteria 3931
575 Ga0495609_0000015 3300046538 Bacteria 322474
576 Ga0495609_0000070 3300046538 Bacteria 128181
577 Ga0495609_0003891 3300046538 Bacteria 8374
578 Ga0495609_0022602 3300046538 Bacteria 2896
579 Ga0495609_0091328 3300046538 Bacteria 1324
580 Ga0495597_0000005 3300046542 Bacteria 286580
581 Ga0495597_0011863 3300046542 Bacteria 4218
582 Ga0495597_0074803 3300046542 Bacteria 1454
583 Ga0495597_0155327 3300046542 Bacteria 936
584 Ga0495645_0286967 3300046543 Bacteria 1080
585 Ga0495622_0003963 3300046557 Bacteria 6912
586 Ga0495622_0006164 3300046557 Bacteria 5570
587 Ga0495622_0006468 3300046557 Bacteria 5435
588 Ga0495622_0014077 3300046557 Bacteria 3712
589 Ga0495622_0131555 3300046557 Bacteria 1139
590 Ga0495633_0000060 3300046558 Bacteria 144561
591 Ga0495668_0005973 3300046616 Bacteria 8089
592 Ga0495668_0014935 3300046616 Bacteria 4543
593 Ga0495668_0122682 3300046616 Bacteria 1421
594 Ga0495668_0144806 3300046616 Bacteria 1300
595 Ga0495634_0140357 3300046642 Bacteria 1534
596 Ga0495611_0000817 3300046648 Bacteria 17225
597 Ga0495611_0003416 3300046648 Bacteria 7005
598 Ga0495611_0191946 3300046648 Bacteria 953
599 Ga0495625_0001491 3300046660 Bacteria 28149
600 Ga0495625_0019930 3300046660 Bacteria 5188
601 Ga0495625_0126498 3300046660 Bacteria 1734
602 Ga0495625_0252467 3300046660 Bacteria 1144
603 Ga0495625_0425260 3300046660 Bacteria 825
604 Ga0495635_0024927 3300046663 Bacteria 4167
605 Ga0495659_0003433 3300046664 Bacteria 5057
606 Ga0495659_0011603 3300046664 Bacteria 2838
607 Ga0495661_0000110 3300046665 Bacteria 97854
608 Ga0495661_0000139 3300046665 Bacteria 85160
609 Ga0495661_0000194 3300046665 Bacteria 70173
610 Ga0495661_0000304 3300046665 Bacteria 56019
611 Ga0495661_0044658 3300046665 Bacteria 2714
612 Ga0495661_0195824 3300046665 Bacteria 1061
613 Ga0495661_0204943 3300046665 Bacteria 1030
614 Ga0495588_0096414 3300046674 Bacteria 1551
615 Ga0495588_0148363 3300046674 Bacteria 1239
616 Ga0495623_0028796 3300046679 Bacteria 3574
617 Ga0495623_0218928 3300046679 Bacteria 1086
618 Ga0495669_0004936 3300046684 Bacteria 5538
619 Ga0495613_0327929 3300046689 Bacteria 1055
620 Ga0495624_0063633 3300046690 Bacteria 2306
621 Ga0495670_0002014 3300046691 Bacteria 10003
622 Ga0495670_0077080 3300046691 Bacteria 1694
623 Ga0495670_0154114 3300046691 Bacteria 1205
624 Ga0495670_0252846 3300046691 Bacteria 940
625 Ga0495671_0009834 3300046692 Bacteria 5324
626 Ga0495671_0012159 3300046692 Bacteria 4705
627 Ga0495671_0014145 3300046692 Bacteria 4299
628 Ga0495671_0040795 3300046692 Bacteria 2339
629 Ga0495671_0064974 3300046692 Bacteria 1796
630 Ga0495671_0146599 3300046692 Bacteria 1149
631 Ga0495671_0175419 3300046692 Bacteria 1041
632 Ga0495649_0005972 3300046694 Bacteria 7633
633 Ga0495649_0038788 3300046694 Bacteria 2612
634 Ga0495649_0039240 3300046694 Bacteria 2596
635 Ga0495649_0058119 3300046694 Bacteria 2084
636 Ga0495649_0278180 3300046694 Bacteria 855
637 Ga0495589_0000855 3300046794 Bacteria 19099
638 Ga0495589_0007319 3300046794 Bacteria 5784
639 Ga0495589_0017167 3300046794 Bacteria 3716
640 Ga0495589_0087818 3300046794 Bacteria 1510
641 Ga0495600_0005020 3300046809 Bacteria 7955
642 Ga0495660_0001756 3300046810 Bacteria 14444
643 Ga0495660_0003768 3300046810 Bacteria 9298
644 Ga0495660_0019277 3300046810 Bacteria 3916
645 Ga0495660_0023430 3300046810 Bacteria 3520
646 Ga0495660_0056189 3300046810 Bacteria 2128
647 Ga0495660_0157692 3300046810 Bacteria 1115
648 Ga0495604_0216665 3300047317 Bacteria 1320
649 Ga0495636_0014835 3300047318 Bacteria 3100
650 Ga0495636_0080700 3300047318 Bacteria 1400
651 Ga0495672_0020211 3300047320 Bacteria 4371
652 Ga0495672_0028649 3300047320 Bacteria 3519
653 Ga0495672_0034225 3300047320 Bacteria 3141
654 Ga0495672_0061584 3300047320 Bacteria 2162
655 Ga0495672_0076723 3300047320 Bacteria 1875
656 Ga0495672_0079440 3300047320 Bacteria 1832
657 Ga0495672_0143183 3300047320 Bacteria 1246
658 Ga0495676_0000013 3300047321 Bacteria 213031
659 Ga0495676_0009626 3300047321 Bacteria 8793
660 Ga0495683_0000027 3300047323 Bacteria 153730
661 Ga0495683_0000261 3300047323 Bacteria 47209
662 Ga0495683_0008434 3300047323 Bacteria 5512
663 Ga0495683_0015414 3300047323 Bacteria 3978
664 Ga0495683_0037791 3300047323 Bacteria 2445
665 Ga0495683_0069159 3300047323 Bacteria 1735
666 Ga0495687_010031 3300047443 Bacteria 5232
667 Ga0495687_012754 3300047443 Bacteria 4426
668 Ga0495679_000206 3300047446 Bacteria 51518
669 Ga0495679_001765 3300047446 Bacteria 11865
670 Ga0495673_0003090 3300047469 Bacteria 11196
671 Ga0495673_0010910 3300047469 Bacteria 4916
672 Ga0495673_0011603 3300047469 Bacteria 4727
673 Ga0495673_0011642 3300047469 Bacteria 4718
674 Ga0495673_0013537 3300047469 Bacteria 4279
675 Ga0495673_0015361 3300047469 Bacteria 3947
676 Ga0495673_0017519 3300047469 Bacteria 3632
677 Ga0495673_0055784 3300047469 Bacteria 1712
678 Ga0495681_0003664 3300047470 Bacteria 10667
679 Ga0495681_0005466 3300047470 Bacteria 8496
680 Ga0495681_0010709 3300047470 Bacteria 5528
681 Ga0495681_0011975 3300047470 Bacteria 5122
682 Ga0495681_0020315 3300047470 Bacteria 3606
683 Ga0495681_0028153 3300047470 Bacteria 2895
684 Ga0495681_0033280 3300047470 Bacteria 2584
685 Ga0495681_0049006 3300047470 Bacteria 1999
686 Ga0495681_0050445 3300047470 Bacteria 1961
687 Ga0495681_0122153 3300047470 Bacteria 1116
688 Ga0495681_0135867 3300047470 Bacteria 1043
689 Ga0495686_0031369 3300047472 Bacteria 3446
690 Ga0495686_0038525 3300047472 Bacteria 3057
691 Ga0495686_0143798 3300047472 Bacteria 1405
692 Ga0495593_0030808 3300047673 Bacteria 2932
693 Ga0495602_0084979 3300048088 Bacteria 2646
694 Ga0495626_0000056 3300048091 Bacteria 150654
695 Ga0495626_0004948 3300048091 Bacteria 7991
696 Ga0495626_0011052 3300048091 Bacteria 4788
697 Ga0495626_0013013 3300048091 Bacteria 4337
698 Ga0495626_0017070 3300048091 Bacteria 3671
699 Ga0496101_0000120 3300048904 Bacteria 76357
700 Ga0496102_0191890 3300048905 Bacteria 1925
701 Ga0496102_0265742 3300048905 Bacteria 1617
702 Ga0496110_0192502 3300048913 Bacteria 1852
703 Ga0496111_0237833 3300048914 Bacteria 1353
704 Ga0496112_0564801 3300048915 Bacteria 1071
705 Ga0496114_0147898 3300048917 Bacteria 2037
706 Ga0496116_0000007 3300048919 Bacteria 795464
707 Ga0496116_0000283 3300048919 Bacteria 86431
708 Ga0496116_0000999 3300048919 Bacteria 34585
709 Ga0496116_0018019 3300048919 Bacteria 5457
710 Ga0496116_0028363 3300048919 Bacteria 4057
711 Ga0496116_0117967 3300048919 Bacteria 1543
712 Ga0496117_0006411 3300048920 Bacteria 11929
713 Ga0496117_0019055 3300048920 Bacteria 5653
714 Ga0496117_0030232 3300048920 Bacteria 4159
715 Ga0496117_0081587 3300048920 Bacteria 2121
716 Ga0496117_0084328 3300048920 Bacteria 2073
717 Ga0496117_0152088 3300048920 Bacteria 1368
718 Ga0496117_0182483 3300048920 Bacteria 1204
719 Ga0496118_0001807 3300048921 Bacteria 30813
720 Ga0496118_0044060 3300048921 Bacteria 3497
721 Ga0496118_0095878 3300048921 Bacteria 2023
722 Ga0496118_0226515 3300048921 Bacteria 1083
723 Ga0496118_0233500 3300048921 Bacteria 1059
724 Ga0496118_0262216 3300048921 Bacteria 974
725 Ga0496119_0000112 3300048922 Bacteria 114767
726 Ga0496119_0000214 3300048922 Bacteria 82258
727 Ga0496119_0005412 3300048922 Bacteria 12255
728 Ga0496119_0060680 3300048922 Bacteria 2262
729 Ga0496119_0230022 3300048922 Bacteria 944
730 Ga0496120_0000035 3300048923 Bacteria 213992
731 Ga0496120_0000064 3300048923 Bacteria 169462
732 Ga0496120_0000826 3300048923 Bacteria 44233
733 Ga0496120_0004409 3300048923 Bacteria 11819
734 Ga0496121_0002354 3300048924 Bacteria 29143
735 Ga0496121_0003009 3300048924 Bacteria 24478
736 Ga0496121_0066285 3300048924 Bacteria 2933
737 Ga0496121_0137771 3300048924 Bacteria 1816
738 Ga0496121_0171305 3300048924 Bacteria 1576
739 Ga0496122_0000122 3300048925 Bacteria 181491
740 Ga0496122_0009298 3300048925 Bacteria 10388
741 Ga0496122_0010760 3300048925 Bacteria 9384
742 Ga0496122_0033077 3300048925 Bacteria 4260
743 Ga0496122_0093864 3300048925 Bacteria 2034
744 Ga0496122_0266663 3300048925 Bacteria 946
745 Ga0496123_0000391 3300048926 Bacteria 82015
746 Ga0496123_0001340 3300048926 Bacteria 34830
747 Ga0496123_0008677 3300048926 Bacteria 9286
748 Ga0496123_0012443 3300048926 Bacteria 7253
749 Ga0496123_0139280 3300048926 Bacteria 1329
750 Ga0496124_0000222 3300048927 Bacteria 110854
751 Ga0496124_0034795 3300048927 Bacteria 4414
752 Ga0496124_0051094 3300048927 Bacteria 3518
753 Ga0496124_0053019 3300048927 Bacteria 3441
754 Ga0496124_0081731 3300048927 Bacteria 2654
755 Ga0496124_0084069 3300048927 Bacteria 2610
756 Ga0496124_0093443 3300048927 Bacteria 2448
757 Ga0496124_0127532 3300048927 Bacteria 2025
758 Ga0496124_0135034 3300048927 Bacteria 1954
759 Ga0496124_0139891 3300048927 Bacteria 1911
760 Ga0496124_0170728 3300048927 Bacteria 1684
761 Ga0496124_0248867 3300048927 Bacteria 1316
762 Ga0496124_0296867 3300048927 Bacteria 1169
763 Ga0496124_0334600 3300048927 Bacteria 1078
764 Ga0496125_0000908 3300048928 Bacteria 46824
765 Ga0496125_0044153 3300048928 Bacteria 3773
766 Ga0496125_0084520 3300048928 Bacteria 2409
767 Ga0496125_0123920 3300048928 Bacteria 1836
768 Ga0496126_0134998 3300048929 Bacteria 2129
769 Ga0495678_000031 3300049459 Bacteria 215528
770 Ga0495678_000039 3300049459 Bacteria 191665
771 Ga0495678_004626 3300049459 Bacteria 7900
772 Ga0495678_008903 3300049459 Bacteria 5018
773 Ga0495678_050737 3300049459 Bacteria 1606
774 Ga0495678_085666 3300049459 Bacteria 1121
775 Ga0495682_0000577 3300049460 Bacteria 24873
776 Ga0495682_0001344 3300049460 Bacteria 13589
777 Ga0495682_0027923 3300049460 Bacteria 2092
778 Ga0495682_0070558 3300049460 Bacteria 1257
779 Ga0501314_000184 3300049530 Bacteria 3372
780 Ga0501032_0017099 3300049569 Bacteria 5096
781 Ga0501032_0143071 3300049569 Bacteria 1575
782 Ga0501033_0002742 3300049570 Bacteria 14770
783 Ga0501034_0000137 3300049571 Bacteria 136592
784 Ga0501034_0010942 3300049571 Bacteria 9427
785 Ga0501034_0402076 3300049571 Bacteria 1292
786 Ga0501034_0535707 3300049571 Bacteria 1081
787 Ga0501036_0025136 3300049572 Bacteria 5023
788 Ga0501037_0006118 3300049573 Bacteria 8793
789 Ga0501037_0019740 3300049573 Bacteria 4973
790 Ga0501037_0098256 3300049573 Bacteria 2115
791 Ga0501037_0187385 3300049573 Bacteria 1466
792 Ga0501038_0024540 3300049574 Bacteria 5379
793 Ga0501038_0145172 3300049574 Bacteria 1938
794 Ga0501039_0098402 3300049575 Bacteria 2282
795 Ga0501039_0319704 3300049575 Bacteria 1220
796 Ga0501039_0328273 3300049575 Bacteria 1202
797 Ga0501042_0055528 3300049578 Bacteria 2827
798 Ga0501042_0114273 3300049578 Bacteria 1944
799 Ga0501043_0007906 3300049579 Bacteria 8405
800 Ga0501046_0001861 3300049580 Bacteria 20092
801 Ga0501046_0021216 3300049580 Bacteria 5363
802 Ga0501047_0022290 3300049581 Bacteria 6084
803 Ga0501067_0319823 3300049583 Bacteria 864
804 Ga0501069_0045541 3300049585 Bacteria 2431
805 Ga0501070_0007478 3300049586 Bacteria 9280
806 Ga0501070_0010248 3300049586 Bacteria 7930
807 Ga0501071_0027598 3300049587 Bacteria 3995
808 Ga0501073_0000314 3300049589 Bacteria 32139
809 Ga0501073_0001320 3300049589 Bacteria 18260
810 Ga0501074_0016769 3300049590 Bacteria 5315
811 Ga0501074_0426670 3300049590 Bacteria 940
812 Ga0501077_0000591 3300049593 Bacteria 21943
813 Ga0501079_0000274 3300049741 Bacteria 31680
814 Ga0501079_0131953 3300049741 Bacteria 1944
815 Ga0501080_0007557 3300049742 Bacteria 9823
816 Ga0501080_0021156 3300049742 Bacteria 6020
817 Ga0501083_0045222 3300049744 Bacteria 2979
818 Ga0501083_0068627 3300049744 Bacteria 2359
819 Ga0501035_0017408 3300049822 Bacteria 6628
820 Ga0501044_0011188 3300049823 Bacteria 9731
821 Ga0501226_000017 3300049853 Bacteria 150879
822 nmdc:mga03683_87068_c1 3300050489 Bacteria 1357
823 nmdc:mga00v17_7724_c1 3300050491 Bacteria 5759
824 nmdc:mga08x19_193284_c1 3300050514 Bacteria 1393
825 Ga0500643_033704 3300053087 Bacteria 1547
826 Ga0500618_009345 3300053125 Bacteria 2681
827 Ga0500659_0046867 3300053135 Bacteria 2338
828 Ga0500573_0056391 3300053140 Bacteria 2255
829 Ga0500611_046406 3300053727 Bacteria 977
830 Ga0501082_0031337 3300060353 Bacteria 4584
831 Ga0501082_0056798 3300060353 Bacteria 3372

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100070786 Ga0307409_1000707863 214
2 3300031250 Ga0265331_10156701 Ga0265331_101567012 223
3 3300009011 Ga0105251_10013238 Ga0105251_100132385 224
4 3300009036 Ga0105244_10000031 Ga0105244_1000003190 224
5 3300009092 Ga0105250_10004328 Ga0105250_100043288 224
6 3300009101 Ga0105247_10000048 Ga0105247_1000004867 224
7 3300013100 Ga0157373_10000473 Ga0157373_1000047314 224
8 3300013100 Ga0157373_10004828 Ga0157373_1000482811 224
9 3300013102 Ga0157371_10001529 Ga0157371_100015292 224
10 3300013102 Ga0157371_10003068 Ga0157371_1000306810 224
11 3300013104 Ga0157370_10000572 Ga0157370_100005729 224
12 3300017792 Ga0163161_10000005 Ga0163161_10000005201 224
13 3300025711 Ga0207696_1000035 Ga0207696_1000035156 224
14 3300025711 Ga0207696_1000039 Ga0207696_100003993 224
15 3300025728 Ga0207655_1022327 Ga0207655_10223273 224
16 3300025735 Ga0207713_1000086 Ga0207713_100008677 224
17 3300025735 Ga0207713_1072527 Ga0207713_10725272 224
18 3300025900 Ga0207710_10000026 Ga0207710_1000002677 224
19 3300027312 Ga0209371_1003222 Ga0209371_10032227 224
20 3300041405 Ga0439438_000002 Ga0439438_000002_562159_562839 224
21 3300041405 Ga0439438_001311 Ga0439438_001311_1542_2222 224
22 3300041407 Ga0439447_002008 Ga0439447_002008_6117_6797 224
23 3300041407 Ga0439447_017403 Ga0439447_017403_1091_1771 224
24 3300042006 Ga0439432_001917 Ga0439432_001917_2886_3566 224
25 3300046453 Ga0495627_000128 Ga0495627_000128_11698_12378 224
26 3300046500 Ga0495596_0016371 Ga0495596_0016371_546_1226 224
27 3300046519 Ga0495632_0081951 Ga0495632_0081951_51_731 224
28 3300046530 Ga0495654_0000033 Ga0495654_0000033_144577_145257 224
29 3300047470 Ga0495681_0049006 Ga0495681_0049006_1170_1850 224
30 3300048904 Ga0496101_0000120 Ga0496101_0000120_57612_58292 224
31 3300048919 Ga0496116_0000007 Ga0496116_0000007_721520_722200 224
32 3300048919 Ga0496116_0000283 Ga0496116_0000283_64624_65304 224
33 3300048919 Ga0496116_0028363 Ga0496116_0028363_1287_1967 224
34 3300048920 Ga0496117_0019055 Ga0496117_0019055_1975_2655 224
35 3300048921 Ga0496118_0044060 Ga0496118_0044060_1162_1842 224
36 3300048922 Ga0496119_0000214 Ga0496119_0000214_20314_20994 224
37 3300048922 Ga0496119_0005412 Ga0496119_0005412_1164_1844 224
38 3300048922 Ga0496119_0060680 Ga0496119_0060680_904_1584 224
39 3300048923 Ga0496120_0000035 Ga0496120_0000035_62539_63219 224
40 3300048923 Ga0496120_0000064 Ga0496120_0000064_74022_74702 224
41 3300048923 Ga0496120_0000826 Ga0496120_0000826_12133_12813 224
42 3300048925 Ga0496122_0010760 Ga0496122_0010760_7977_8657 224
43 3300048926 Ga0496123_0008677 Ga0496123_0008677_1746_2426 224
44 3300048927 Ga0496124_0051094 Ga0496124_0051094_198_878 224
45 3300048927 Ga0496124_0093443 Ga0496124_0093443_1030_1710 224
46 3300050491 nmdc:mga00v17_7724_c1 nmdc:mga00v17_7724_c1_4923_5603 224
47 3300002737 JGI25162J39368_1000126 JGI25162J39368_10001263 225
48 3300002772 JGI25164J39214_1000100 JGI25164J39214_10001003 225
49 3300003214 JGI25165J46597_1000207 JGI25165J46597_10002073 225
50 3300005289 Ga0065704_10082904 Ga0065704_100829041 225
51 3300005458 Ga0070681_10301329 Ga0070681_103013292 225
52 3300006237 Ga0097621_100551519 Ga0097621_1005515191 225
53 3300009148 Ga0105243_10001767 Ga0105243_1000176712 225
54 3300009551 Ga0105238_11323403 Ga0105238_113234031 225
55 3300014497 Ga0182008_10000570 Ga0182008_100005703 225
56 3300025231 Ga0207427_100001 Ga0207427_100001224 225
57 3300025233 Ga0209437_100003 Ga0209437_1000031148 225
58 3300025261 Ga0209233_1000007 Ga0209233_1000007224 225
59 3300025912 Ga0207707_10293602 Ga0207707_102936022 225
60 3300025935 Ga0207709_10034539 Ga0207709_100345393 225
61 3300031249 Ga0265339_10226017 Ga0265339_102260171 225
62 3300031691 Ga0316579_10000057 Ga0316579_100000573 225
63 3300031733 Ga0316577_10007619 Ga0316577_100076192 225
64 3300032137 Ga0316585_10006649 Ga0316585_100066494 225
65 3300032168 Ga0316593_10001028 Ga0316593_100010282 225
66 3300036647 Ga0316582_0001289 Ga0316582_0001289_3352_4029 225
67 3300036647 Ga0316582_0147306 Ga0316582_0147306_630_1307 225
68 3300036712 Ga0316584_0001968 Ga0316584_0001968_1574_2251 225
69 3300036712 Ga0316584_0542910 Ga0316584_0542910_47_724 225
70 3300037588 Ga0316581_0060986 Ga0316581_0060986_34_711 225
71 3300039062 Ga0400483_067590 Ga0400483_067590_31360_32037 225
72 3300039093 Ga0400489_01548 Ga0400489_01548_36_713 225
73 3300039110 Ga0400487_32164 Ga0400487_32164_29979_30659 225
74 3300041411 Ga0439466_0003474 Ga0439466_0003474_4448_5125 225
75 3300041411 Ga0439466_0054106 Ga0439466_0054106_359_1036 225
76 3300042439 Ga0439464_0004718 Ga0439464_0004718_1968_2645 225
77 3300046455 Ga0495603_0126094 Ga0495603_0126094_421_1098 225
78 3300046474 Ga0495605_0020101 Ga0495605_0020101_2537_3214 225
79 3300046501 Ga0495607_0000213 Ga0495607_0000213_2919_3596 225
80 3300046501 Ga0495607_0194454 Ga0495607_0194454_282_959 225
81 3300046810 Ga0495660_0003768 Ga0495660_0003768_1811_2488 225
82 3300047321 Ga0495676_0009626 Ga0495676_0009626_1970_2647 225
83 iso_pu_bacteria 2510065053 2510284916 225
84 iso_pu_bacteria 2510065055 2510295225 225
85 iso_pu_bacteria 2510065058 2510312294 225
86 iso_pu_bacteria 2511231004 2511257400 225
87 iso_pu_bacteria 2511231012 2511301352 225
88 iso_pu_bacteria 2511231016 2511323548 225
89 iso_pu_bacteria 2511231021 2511355009 225
90 iso_pu_bacteria 2511231022 2511364016 225
91 iso_pu_bacteria 2511231024 2511375564 225
92 iso_pu_bacteria 2511231156 2511826710 225
93 iso_pu_bacteria 2554235132 2554817006 225
94 iso_pu_bacteria 2554235231 2555244596 225
95 iso_pu_bacteria 2554235341 2555668032 225
96 iso_pu_bacteria 2597489889 2597868046 225
97 iso_pu_bacteria 2599185155 2599330096 225
98 iso_pu_bacteria 2599185167 2599397067 225
99 iso_pu_bacteria 2599185179 2599449060 225
100 iso_pu_bacteria 2599185189 2599508822 225
101 iso_pu_bacteria 2599185190 2599511196 225
102 iso_pu_bacteria 2599185191 2599519313 225
103 iso_pu_bacteria 2599185290 2599890570 225
104 iso_pu_bacteria 2599185307 2599974107 225
105 iso_pu_bacteria 2599185309 2599985821 225
106 iso_pu_bacteria 2599185310 2599990715 225
107 iso_pu_bacteria 2599185356 2600214488 225
108 iso_pu_bacteria 2600254954 2600442962 225
109 iso_pu_bacteria 2600255283 2601625734 225
110 iso_pu_bacteria 2600255296 2601690912 225
111 iso_pu_bacteria 2600255313 2601774807 225
112 iso_pu_bacteria 2600255318 2601800065 225
113 iso_pu_bacteria 2600255389 2602009562 225
114 iso_pu_bacteria 2603880185 2606074671 225
115 iso_pu_bacteria 2603880199 2606127534 225
116 iso_pu_bacteria 2606217733 2608379675 225
117 iso_pu_bacteria 2643221571 2643868902 225
118 iso_pu_bacteria 2643221589 2643952319 225
119 iso_pu_bacteria 2643221602 2644023918 225
120 iso_pu_bacteria 2643221633 2644188324 225
121 iso_pu_bacteria 2643221713 2644624003 225
122 iso_pu_bacteria 2675903420 2677898733 225
123 iso_pu_bacteria 2687453129 2687578972 225
124 iso_pu_bacteria 2713897149 2715757529 225
125 iso_pu_bacteria 2721755607 2723247216 225
126 iso_pu_bacteria 2738541271 2738691552 225
127 iso_pu_bacteria 2738543004 2739198357 225
128 iso_pu_bacteria 2738543016 2739267327 225
129 iso_pu_bacteria 2738543020 2739286204 225
130 iso_pu_bacteria 2738543021 2739291517 225
131 iso_pu_bacteria 2765235841 2765585695 225
132 iso_pu_bacteria 2773857672 2774132316 225
133 iso_pu_bacteria 2784132063 2784260463 225
134 iso_pu_bacteria 2806310737 2807406920 225
135 iso_pu_bacteria 2806310745 2807455252 225
136 iso_pu_bacteria 2808606373 2808904663 225
137 iso_pu_bacteria 2808606379 2808941654 225
138 iso_pu_bacteria 2808606445 2809215750 225
139 iso_pu_bacteria 2811994881 2812368115 225
140 iso_pu_bacteria 2818991456 2819658367 225
141 iso_pu_bacteria 2818991464 2819702716 225
142 iso_pu_bacteria 2823421272 2823424591 225
143 iso_pu_bacteria 2825651385 2825656028 225
144 iso_pu_bacteria 2826581358 2826585735 225
145 iso_pu_bacteria 2834028612 2834029001 225
146 iso_pu_bacteria 2842805378 2842805625 225
147 iso_pu_bacteria 2842815866 2842818605 225
148 iso_pu_bacteria 2842826826 2842828718 225
149 iso_pu_bacteria 2842832357 2842835719 225
150 iso_pu_bacteria 2842837860 2842843218 225
151 iso_pu_bacteria 2842843487 2842847466 225
152 iso_pu_bacteria 2842849001 2842853827 225
153 iso_pu_bacteria 2842854478 2842856432 225
154 iso_pu_bacteria 2852612431 2852615514 225
155 iso_pu_bacteria 2852657418 2852662832 225
156 iso_pu_bacteria 2852667396 2852670482 225
157 iso_pu_bacteria 2860339153 2860340645 225
158 iso_pu_bacteria 2860867994 2860869030 225
159 iso_pu_bacteria 2878029506 2878030776 225
160 iso_pu_bacteria 2880230671 2880231688 225
161 iso_pu_bacteria 2904518522 2904520723 225
162 iso_pu_bacteria 2904550169 2904551108 225
163 iso_pu_bacteria 2908446538 2908447823 225
164 iso_pu_bacteria 2912963787 2912967959 225
165 iso_pu_bacteria 2913036834 2913041684 225
166 iso_pu_bacteria 2919063839 2919067274 225
167 iso_pu_bacteria 2919155634 2919159282 225
168 iso_pu_bacteria 2919385768 2919385827 225
169 iso_pu_bacteria 2919456309 2919458354 225
170 iso_pu_bacteria 2919481497 2919484622 225
171 iso_pu_bacteria 2919487758 2919492795 225
172 iso_pu_bacteria 2919501602 2919504321 225
173 iso_pu_bacteria 2919697872 2919699944 225
174 iso_pu_bacteria 2923153595 2923154666 225
175 iso_pu_bacteria 2923519811 2923522168 225
176 iso_pu_bacteria 2923586266 2923590333 225
177 iso_pu_bacteria 2926063275 2926065106 225
178 iso_pu_bacteria 2929144301 2929149007 225
179 iso_pu_bacteria 2929189879 2929191027 225
180 iso_pu_bacteria 2931369376 2931373572 225
181 iso_pu_bacteria 2931390751 2931392032 225
182 iso_pu_bacteria 2931396565 2931399453 225
183 iso_pu_bacteria 2935353572 2935353967 225
184 iso_pu_bacteria 2939636861 2939638125 225
185 iso_pu_bacteria 2945928738 2945929553 225
186 iso_pu_bacteria 2945961074 2945961257 225
187 iso_pu_bacteria 2946006987 2946011832 225
188 iso_pu_bacteria 2946027586 2946029276 225
189 iso_pu_bacteria 2952252522 2952252652 225
190 iso_pu_bacteria 2969304461 2969305599 225
191 iso_pu_bacteria 2974289157 2974292770 225
192 iso_pu_bacteria 2974298342 2974298758 225
193 iso_pu_bacteria 2984286254 2984291363 225
194 iso_pu_bacteria 2984499530 2984501050 225
195 iso_pu_bacteria 2984504281 2984505503 225
196 iso_pu_bacteria 2988728565 2988730604 225
197 iso_pu_bacteria 2990196909 2990198322 225
198 iso_pu_bacteria 2998139840 2998141041 225
199 iso_pu_bacteria 3007252601 3007253692 225
200 iso_pu_bacteria 3007315729 3007317534 225
201 iso_pu_bacteria 3007395558 3007400196 225
202 iso_pu_bacteria 3007419365 3007420680 225
203 iso_pu_bacteria 3007511990 3007516339 225
204 iso_pu_bacteria 3007614139 3007618773 225
205 iso_pu_bacteria 3007619802 3007622077 225
206 iso_pu_bacteria 3007718800 3007719277 225
207 iso_pu_bacteria 3007803356 3007808413 225
208 iso_pu_bacteria 3007855910 3007860925 225
209 iso_pu_bacteria 3007861166 3007863737 225
210 iso_pu_bacteria 3007866637 3007867648 225
211 iso_pu_bacteria 3007872151 3007875426 225
212 iso_pu_bacteria 8011350971 8011353179 225
213 iso_pu_bacteria 8015687852 8015688902 225
214 iso_pu_bacteria 8019769354 8019773280 225
215 iso_pu_bacteria 8019775933 8019776610 225
216 iso_pu_bacteria 8029995093 8029999721 225
217 iso_pu_bacteria 8034962539 8034962576 225
218 iso_pu_bacteria 8052494512 8052495670 225
219 iso_pu_bacteria 8054285046 8054286227 225
220 iso_pu_bacteria 8054347763 8054352556 225
221 iso_pu_bacteria 8054503363 8054504610 225
222 iso_pu_bacteria 8054929484 8054933236 225
223 iso_pu_bacteria 8055770955 8055772019 225
224 iso_pu_bacteria 8055817908 8055819052 225
225 iso_pu_bacteria 8055878733 8055884063 225
226 iso_pu_bacteria 8056115690 8056117436 225
227 iso_pu_bacteria 8056120720 8056124778 225
228 iso_pu_bacteria 8056125926 8056127085 225
229 iso_pu_bacteria 8056131705 8056132921 225
230 iso_pu_bacteria 8056137416 8056138574 225
231 iso_pu_bacteria 8056143049 8056144387 225
232 iso_pu_bacteria 8056148874 8056149137 225
233 iso_pu_bacteria 8056155041 8056155599 225
234 iso_pu_bacteria 8056161164 8056161204 225
235 iso_pu_bacteria 8056166840 8056170010 225
236 iso_pu_bacteria 8056172158 8056176144 225
237 iso_pu_bacteria 8056177738 8056180573 225
238 iso_pu_bacteria 8056569372 8056569691 225
239 iso_pu_bacteria 8057160832 8057161897 225
240 iso_pu_bacteria 8057798959 8057803308 225
241 3300005466 Ga0070685_10023831 Ga0070685_100238312 226
242 3300006358 Ga0068871_100097715 Ga0068871_1000977153 226
243 3300013105 Ga0157369_10234656 Ga0157369_102346561 226
244 3300014969 Ga0157376_10301049 Ga0157376_103010492 226
245 3300026121 Ga0207683_10710897 Ga0207683_107108972 226
246 3300031665 Ga0316575_10039977 Ga0316575_100399772 226
247 3300031728 Ga0316578_10115257 Ga0316578_101152573 226
248 3300032137 Ga0316585_10003715 Ga0316585_100037154 226
249 3300032137 Ga0316585_10029843 Ga0316585_100298432 226
250 3300032168 Ga0316593_10003019 Ga0316593_100030195 226
251 3300032168 Ga0316593_10055671 Ga0316593_100556712 226
252 3300035398 Ga0316574_0224641 Ga0316574_0224641_15_695 226
253 3300036647 Ga0316582_0215001 Ga0316582_0215001_422_1102 226
254 3300036712 Ga0316584_0015811 Ga0316584_0015811_223_903 226
255 3300036712 Ga0316584_0138709 Ga0316584_0138709_813_1493 226
256 3300037588 Ga0316581_0019261 Ga0316581_0019261_1039_1719 226
257 3300047472 Ga0495686_0038525 Ga0495686_0038525_1382_2068 226
258 3300048927 Ga0496124_0170728 Ga0496124_0170728_647_1327 226
259 3300049570 Ga0501033_0002742 Ga0501033_0002742_4522_5202 226
260 3300049571 Ga0501034_0010942 Ga0501034_0010942_1931_2611 226
261 3300049571 Ga0501034_0402076 Ga0501034_0402076_206_886 226
262 3300049572 Ga0501036_0025136 Ga0501036_0025136_529_1209 226
263 3300049573 Ga0501037_0006118 Ga0501037_0006118_3806_4486 226
264 3300049574 Ga0501038_0024540 Ga0501038_0024540_881_1561 226
265 3300049575 Ga0501039_0328273 Ga0501039_0328273_304_984 226
266 3300049579 Ga0501043_0007906 Ga0501043_0007906_3478_4158 226
267 3300049580 Ga0501046_0021216 Ga0501046_0021216_595_1275 226
268 3300049581 Ga0501047_0022290 Ga0501047_0022290_3737_4417 226
269 3300049589 Ga0501073_0001320 Ga0501073_0001320_13309_13989 226
270 3300049741 Ga0501079_0131953 Ga0501079_0131953_557_1237 226
271 3300049742 Ga0501080_0021156 Ga0501080_0021156_4722_5402 226
272 3300049744 Ga0501083_0068627 Ga0501083_0068627_561_1241 226
273 3300049822 Ga0501035_0017408 Ga0501035_0017408_4323_5003 226
274 3300049823 Ga0501044_0011188 Ga0501044_0011188_7224_7904 226
275 3300053087 Ga0500643_033704 Ga0500643_033704_178_864 226
276 3300060353 Ga0501082_0031337 Ga0501082_0031337_217_897 226
277 3300005331 Ga0070670_100039675 Ga0070670_1000396754 227
278 3300005337 Ga0070682_100112133 Ga0070682_1001121333 227
279 3300005344 Ga0070661_100187131 Ga0070661_1001871313 227
280 3300005354 Ga0070675_100266241 Ga0070675_1002662412 227
281 3300005354 Ga0070675_100438502 Ga0070675_1004385022 227
282 3300005366 Ga0070659_100859398 Ga0070659_1008593981 227
283 3300005440 Ga0070705_100284555 Ga0070705_1002845552 227
284 3300005441 Ga0070700_100230606 Ga0070700_1002306062 227
285 3300005457 Ga0070662_100321900 Ga0070662_1003219002 227
286 3300005543 Ga0070672_100005085 Ga0070672_1000050858 227
287 3300005543 Ga0070672_100229971 Ga0070672_1002299713 227
288 3300005564 Ga0070664_100030848 Ga0070664_1000308482 227
289 3300005617 Ga0068859_100862854 Ga0068859_1008628542 227
290 3300005719 Ga0068861_100287238 Ga0068861_1002872382 227
291 3300005841 Ga0068863_100375408 Ga0068863_1003754082 227
292 3300005844 Ga0068862_100420169 Ga0068862_1004201693 227
293 3300006881 Ga0068865_100232472 Ga0068865_1002324722 227
294 3300006931 Ga0097620_100862849 Ga0097620_1008628492 227
295 3300013308 Ga0157375_10043888 Ga0157375_100438882 227
296 3300014326 Ga0157380_10004215 Ga0157380_100042152 227
297 3300025926 Ga0207659_10128848 Ga0207659_101288482 227
298 3300025926 Ga0207659_10322124 Ga0207659_103221242 227
299 3300025938 Ga0207704_10142299 Ga0207704_101422992 227
300 3300025940 Ga0207691_10016948 Ga0207691_100169487 227
301 3300025945 Ga0207679_10086668 Ga0207679_100866681 227
302 3300026067 Ga0207678_10131305 Ga0207678_101313053 227
303 3300026075 Ga0207708_10023462 Ga0207708_100234624 227
304 3300026088 Ga0207641_10077604 Ga0207641_100776043 227
305 3300026089 Ga0207648_10606762 Ga0207648_106067621 227
306 3300026118 Ga0207675_100327998 Ga0207675_1003279982 227
307 3300032126 Ga0307415_100313280 Ga0307415_1003132802 227
308 3300039062 Ga0400483_004725 Ga0400483_004725_89356_90054 227
309 3300039062 Ga0400483_113686 Ga0400483_113686_67256_67945 227
310 3300046501 Ga0495607_0006701 Ga0495607_0006701_21_704 227
311 3300046519 Ga0495632_0006071 Ga0495632_0006071_3202_3885 227
312 3300046520 Ga0495637_0013628 Ga0495637_0013628_3151_3834 227
313 3300046522 Ga0495643_0024183 Ga0495643_0024183_2618_3301 227
314 3300046524 Ga0495648_0061188 Ga0495648_0061188_1301_1984 227
315 3300046530 Ga0495654_0014186 Ga0495654_0014186_917_1600 227
316 3300046616 Ga0495668_0005973 Ga0495668_0005973_2914_3597 227
317 3300046794 Ga0495589_0087818 Ga0495589_0087818_718_1407 227
318 3300047469 Ga0495673_0015361 Ga0495673_0015361_2741_3424 227
319 3300049459 Ga0495678_000031 Ga0495678_000031_90528_91211 227
320 3300049586 Ga0501070_0007478 Ga0501070_0007478_2829_3518 227
321 3300049587 Ga0501071_0027598 Ga0501071_0027598_3011_3700 227
322 3300049589 Ga0501073_0000314 Ga0501073_0000314_7461_8150 227
323 3300049590 Ga0501074_0016769 Ga0501074_0016769_2926_3615 227
324 3300049593 Ga0501077_0000591 Ga0501077_0000591_3084_3773 227
325 3300049741 Ga0501079_0000274 Ga0501079_0000274_2559_3248 227
326 3300049742 Ga0501080_0007557 Ga0501080_0007557_1859_2548 227
327 3300049744 Ga0501083_0045222 Ga0501083_0045222_35_724 227
328 3300060353 Ga0501082_0056798 Ga0501082_0056798_2520_3209 227
329 3300005333 Ga0070677_10008755 Ga0070677_100087553 228
330 3300005337 Ga0070682_100137545 Ga0070682_1001375452 228
331 3300005347 Ga0070668_100079640 Ga0070668_1000796403 228
332 3300005353 Ga0070669_100106952 Ga0070669_1001069522 228
333 3300005354 Ga0070675_100004279 Ga0070675_10000427912 228
334 3300005354 Ga0070675_100029716 Ga0070675_1000297164 228
335 3300005356 Ga0070674_100024236 Ga0070674_1000242363 228
336 3300005356 Ga0070674_100065806 Ga0070674_1000658062 228
337 3300005364 Ga0070673_100010143 Ga0070673_1000101432 228
338 3300005365 Ga0070688_100035678 Ga0070688_1000356781 228
339 3300005456 Ga0070678_100068023 Ga0070678_1000680233 228
340 3300005456 Ga0070678_100079035 Ga0070678_1000790352 228
341 3300005459 Ga0068867_100141430 Ga0068867_1001414302 228
342 3300005466 Ga0070685_10053201 Ga0070685_100532012 228
343 3300005466 Ga0070685_10183733 Ga0070685_101837332 228
344 3300005543 Ga0070672_100068414 Ga0070672_1000684142 228
345 3300005543 Ga0070672_100089962 Ga0070672_1000899623 228
346 3300005548 Ga0070665_100002619 Ga0070665_1000026192 228
347 3300005617 Ga0068859_100067363 Ga0068859_1000673634 228
348 3300005617 Ga0068859_100233488 Ga0068859_1002334883 228
349 3300005618 Ga0068864_100642716 Ga0068864_1006427162 228
350 3300005840 Ga0068870_10003293 Ga0068870_100032935 228
351 3300005844 Ga0068862_100240770 Ga0068862_1002407703 228
352 3300006881 Ga0068865_100161982 Ga0068865_1001619822 228
353 3300006931 Ga0097620_100067364 Ga0097620_1000673644 228
354 3300006931 Ga0097620_100233478 Ga0097620_1002334783 228
355 3300006931 Ga0097620_100328601 Ga0097620_1003286013 228
356 3300014326 Ga0157380_10037459 Ga0157380_100374594 228
357 3300014326 Ga0157380_10145508 Ga0157380_101455082 228
358 3300014326 Ga0157380_10295877 Ga0157380_102958772 228
359 3300014969 Ga0157376_10489937 Ga0157376_104899372 228
360 3300025893 Ga0207682_10000686 Ga0207682_100006868 228
361 3300025893 Ga0207682_10006464 Ga0207682_100064646 228
362 3300025893 Ga0207682_10042409 Ga0207682_100424093 228
363 3300025899 Ga0207642_10282934 Ga0207642_102829342 228
364 3300025908 Ga0207643_10017116 Ga0207643_100171164 228
365 3300025908 Ga0207643_10153430 Ga0207643_101534302 228
366 3300025915 Ga0207693_10339662 Ga0207693_103396622 228
367 3300025916 Ga0207663_10506160 Ga0207663_105061602 228
368 3300025923 Ga0207681_10027485 Ga0207681_100274853 228
369 3300025926 Ga0207659_10008076 Ga0207659_100080763 228
370 3300025926 Ga0207659_10023389 Ga0207659_100233893 228
371 3300025935 Ga0207709_10616165 Ga0207709_106161651 228
372 3300025936 Ga0207670_10085861 Ga0207670_100858613 228
373 3300025937 Ga0207669_10009009 Ga0207669_100090092 228
374 3300025937 Ga0207669_10037715 Ga0207669_100377152 228
375 3300025937 Ga0207669_10048097 Ga0207669_100480973 228
376 3300025938 Ga0207704_10031354 Ga0207704_100313543 228
377 3300025940 Ga0207691_10023826 Ga0207691_100238266 228
378 3300025942 Ga0207689_10109731 Ga0207689_101097313 228
379 3300025960 Ga0207651_10005709 Ga0207651_100057096 228
380 3300025972 Ga0207668_10073304 Ga0207668_100733043 228
381 3300025972 Ga0207668_10273018 Ga0207668_102730183 228
382 3300026075 Ga0207708_10124399 Ga0207708_101243992 228
383 3300026089 Ga0207648_10268718 Ga0207648_102687182 228
384 3300026095 Ga0207676_10601188 Ga0207676_106011882 228
385 3300026118 Ga0207675_100068850 Ga0207675_1000688502 228
386 3300026121 Ga0207683_10039155 Ga0207683_100391554 228
387 3300026121 Ga0207683_10127202 Ga0207683_101272022 228
388 3300028379 Ga0268266_10041404 Ga0268266_100414044 228
389 3300028380 Ga0268265_10069157 Ga0268265_100691572 228
390 3300031456 Ga0307513_10007954 Ga0307513_1000795410 228
391 3300031507 Ga0307509_10008745 Ga0307509_100087455 228
392 3300031901 Ga0307406_10012977 Ga0307406_100129774 228
393 3300031903 Ga0307407_10283524 Ga0307407_102835242 228
394 3300031995 Ga0307409_100008553 Ga0307409_1000085537 228
395 3300031995 Ga0307409_100069783 Ga0307409_1000697833 228
396 3300032002 Ga0307416_100006820 Ga0307416_1000068202 228
397 3300032004 Ga0307414_10409439 Ga0307414_104094392 228
398 3300032005 Ga0307411_10067409 Ga0307411_100674093 228
399 3300032168 Ga0316593_10128852 Ga0316593_101288521 228
400 3300035086 Ga0373934_0074571 Ga0373934_0074571_556_1248 228
401 3300035172 Ga0373955_0054195 Ga0373955_0054195_825_1517 228
402 3300035724 Ga0373933_0038554 Ga0373933_0038554_1339_2031 228
403 3300036401 Ga0373937_0002058 Ga0373937_0002058_3901_4593 228
404 3300041453 Ga0451797_0851571 Ga0451797_0851571_1287_1979 228
405 3300041486 Ga0451807_0342670 Ga0451807_0342670_664_1356 228
406 3300041486 Ga0451807_0343574 Ga0451807_0343574_981_1673 228
407 3300041486 Ga0451807_1464927 Ga0451807_1464927_4210_4902 228
408 3300041512 Ga0451853_1748554 Ga0451853_1748554_40_732 228
409 3300046460 Ga0495638_0004299 Ga0495638_0004299_3066_3758 228
410 3300046513 Ga0495616_0003504 Ga0495616_0003504_8360_9052 228
411 3300046515 Ga0495620_0057198 Ga0495620_0057198_59_751 228
412 3300046529 Ga0495652_0326822 Ga0495652_0326822_313_1005 228
413 3300046543 Ga0495645_0286967 Ga0495645_0286967_295_987 228
414 3300046660 Ga0495625_0425260 Ga0495625_0425260_51_743 228
415 3300046679 Ga0495623_0218928 Ga0495623_0218928_346_1038 228
416 3300046691 Ga0495670_0252846 Ga0495670_0252846_118_810 228
417 3300048088 Ga0495602_0084979 Ga0495602_0084979_1215_1907 228
418 3300049578 Ga0501042_0055528 Ga0501042_0055528_286_978 228
419 3300049578 Ga0501042_0114273 Ga0501042_0114273_208_900 228
420 2162886007 SwRhRL2b_contig_836207 SwRhRL2b_0141.00008220 229
421 3300003752 Ga0055539_1000039 Ga0055539_100003976 229
422 3300003756 Ga0055533_1000049 Ga0055533_100004992 229
423 3300003758 Ga0055532_1000049 Ga0055532_100004977 229
424 3300003759 Ga0055525_1000077 Ga0055525_100007777 229
425 3300003781 Ga0055536_1005866 Ga0055536_10058665 229
426 3300003781 Ga0055536_1016124 Ga0055536_10161242 229
427 3300003791 Ga0055530_10003906 Ga0055530_100039065 229
428 3300003792 Ga0055540_1001086 Ga0055540_100108611 229
429 3300003792 Ga0055540_1002667 Ga0055540_10026672 229
430 3300003841 Ga0055541_1000026 Ga0055541_100002692 229
431 3300003856 Ga0058692_1014272 Ga0058692_10142722 229
432 3300005288 Ga0065714_10004098 Ga0065714_100040989 229
433 3300005288 Ga0065714_10007073 Ga0065714_100070732 229
434 3300005289 Ga0065704_10083049 Ga0065704_100830494 229
435 3300005289 Ga0065704_10110576 Ga0065704_101105763 229
436 3300005290 Ga0065712_10067895 Ga0065712_100678954 229
437 3300005331 Ga0070670_100061804 Ga0070670_1000618041 229
438 3300005353 Ga0070669_100000292 Ga0070669_10000029238 229
439 3300005353 Ga0070669_100002278 Ga0070669_1000022787 229
440 3300005455 Ga0070663_100540934 Ga0070663_1005409341 229
441 3300005457 Ga0070662_100000560 Ga0070662_10000056014 229
442 3300005539 Ga0068853_100006406 Ga0068853_1000064064 229
443 3300005564 Ga0070664_100641769 Ga0070664_1006417691 229
444 3300005578 Ga0068854_100004163 Ga0068854_1000041634 229
445 3300005834 Ga0068851_10000006 Ga0068851_1000000697 229
446 3300006051 Ga0075364_10121181 Ga0075364_101211812 229
447 3300006058 Ga0075432_10049305 Ga0075432_100493052 229
448 3300006944 Ga0099823_1000054 Ga0099823_10000543 229
449 3300006946 Ga0079104_1000917 Ga0079104_10009173 229
450 3300009011 Ga0105251_10000004 Ga0105251_10000004112 229
451 3300009011 Ga0105251_10000149 Ga0105251_1000014952 229
452 3300009011 Ga0105251_10000935 Ga0105251_1000093521 229
453 3300009011 Ga0105251_10006259 Ga0105251_100062597 229
454 3300009011 Ga0105251_10008504 Ga0105251_100085046 229
455 3300009011 Ga0105251_10072706 Ga0105251_100727062 229
456 3300009011 Ga0105251_10092040 Ga0105251_100920401 229
457 3300009011 Ga0105251_10163534 Ga0105251_101635341 229
458 3300009011 Ga0105251_10271248 Ga0105251_102712481 229
459 3300009036 Ga0105244_10000922 Ga0105244_1000092212 229
460 3300009036 Ga0105244_10004903 Ga0105244_100049033 229
461 3300009036 Ga0105244_10006728 Ga0105244_100067286 229
462 3300009036 Ga0105244_10010706 Ga0105244_100107063 229
463 3300009036 Ga0105244_10015168 Ga0105244_100151683 229
464 3300009036 Ga0105244_10016206 Ga0105244_100162063 229
465 3300009036 Ga0105244_10025677 Ga0105244_100256774 229
466 3300009036 Ga0105244_10030254 Ga0105244_100302543 229
467 3300009036 Ga0105244_10047337 Ga0105244_100473373 229
468 3300009036 Ga0105244_10054694 Ga0105244_100546943 229
469 3300009036 Ga0105244_10063867 Ga0105244_100638672 229
470 3300009036 Ga0105244_10279559 Ga0105244_102795591 229
471 3300009036 Ga0105244_10303763 Ga0105244_103037631 229
472 3300009092 Ga0105250_10000235 Ga0105250_1000023536 229
473 3300009092 Ga0105250_10003383 Ga0105250_100033835 229
474 3300009092 Ga0105250_10024448 Ga0105250_100244482 229
475 3300009092 Ga0105250_10042350 Ga0105250_100423502 229
476 3300009092 Ga0105250_10077221 Ga0105250_100772213 229
477 3300009092 Ga0105250_10079672 Ga0105250_100796722 229
478 3300009148 Ga0105243_10001292 Ga0105243_1000129213 229
479 3300009148 Ga0105243_10039035 Ga0105243_100390354 229
480 3300009148 Ga0105243_10064661 Ga0105243_100646612 229
481 3300009148 Ga0105243_10206080 Ga0105243_102060802 229
482 3300009148 Ga0105243_10542411 Ga0105243_105424112 229
483 3300009176 Ga0105242_10000233 Ga0105242_1000023316 229
484 3300009545 Ga0105237_10000160 Ga0105237_1000016071 229
485 3300009553 Ga0105249_10475853 Ga0105249_104758532 229
486 3300011119 Ga0105246_10000822 Ga0105246_1000082211 229
487 3300011119 Ga0105246_10125641 Ga0105246_101256413 229
488 3300011119 Ga0105246_10288591 Ga0105246_102885913 229
489 3300012498 Ga0157345_1000347 Ga0157345_10003472 229
490 3300013100 Ga0157373_10001605 Ga0157373_100016052 229
491 3300013100 Ga0157373_10060224 Ga0157373_100602241 229
492 3300013100 Ga0157373_10222780 Ga0157373_102227801 229
493 3300013100 Ga0157373_10261841 Ga0157373_102618412 229
494 3300013100 Ga0157373_10345603 Ga0157373_103456031 229
495 3300013102 Ga0157371_10000460 Ga0157371_1000046018 229
496 3300013102 Ga0157371_10007535 Ga0157371_100075356 229
497 3300013102 Ga0157371_10024923 Ga0157371_100249234 229
498 3300013102 Ga0157371_10030541 Ga0157371_100305414 229
499 3300013102 Ga0157371_10108493 Ga0157371_101084932 229
500 3300013102 Ga0157371_10143168 Ga0157371_101431681 229
501 3300013104 Ga0157370_10165536 Ga0157370_101655363 229
502 3300013104 Ga0157370_10398975 Ga0157370_103989753 229
503 3300013105 Ga0157369_10035640 Ga0157369_100356404 229
504 3300013105 Ga0157369_10073948 Ga0157369_100739484 229
505 3300013105 Ga0157369_10144236 Ga0157369_101442363 229
506 3300013105 Ga0157369_10174391 Ga0157369_101743911 229
507 3300013105 Ga0157369_10467425 Ga0157369_104674252 229
508 3300013306 Ga0163162_10004406 Ga0163162_100044065 229
509 3300013307 Ga0157372_10000815 Ga0157372_1000081518 229
510 3300013307 Ga0157372_10059115 Ga0157372_100591153 229
511 3300013307 Ga0157372_10165575 Ga0157372_101655752 229
512 3300013307 Ga0157372_10627579 Ga0157372_106275792 229
513 3300013308 Ga0157375_10270891 Ga0157375_102708912 229
514 3300014497 Ga0182008_10009461 Ga0182008_100094615 229
515 3300014497 Ga0182008_10031014 Ga0182008_100310143 229
516 3300015261 Ga0182006_1062988 Ga0182006_10629882 229
517 3300015261 Ga0182006_1108278 Ga0182006_11082781 229
518 3300015261 Ga0182006_1115165 Ga0182006_11151651 229
519 3300015262 Ga0182007_10006004 Ga0182007_100060045 229
520 3300015265 Ga0182005_1017434 Ga0182005_10174342 229
521 3300017792 Ga0163161_10605337 Ga0163161_106053372 229
522 3300025206 Ga0209435_100669 Ga0209435_1006693 229
523 3300025224 Ga0209784_100045 Ga0209784_10004592 229
524 3300025225 Ga0209566_100057 Ga0209566_10005792 229
525 3300025226 Ga0209674_100080 Ga0209674_10008092 229
526 3300025229 Ga0209147_100079 Ga0209147_10007992 229
527 3300025230 Ga0209563_100078 Ga0209563_10007892 229
528 3300025242 Ga0209258_100178 Ga0209258_10017851 229
529 3300025246 Ga0209646_1000311 Ga0209646_100031123 229
530 3300025253 Ga0209677_100045 Ga0209677_10004592 229
531 3300025256 Ga0209759_1003165 Ga0209759_10031653 229
532 3300025256 Ga0209759_1006779 Ga0209759_10067793 229
533 3300025292 Ga0209676_1000056 Ga0209676_1000056105 229
534 3300025292 Ga0209676_1000721 Ga0209676_100072136 229
535 3300025292 Ga0209676_1004156 Ga0209676_10041565 229
536 3300025298 Ga0209050_1000027 Ga0209050_1000027210 229
537 3300025298 Ga0209050_1000181 Ga0209050_10001816 229
538 3300025298 Ga0209050_1002328 Ga0209050_10023281 229
539 3300025303 Ga0209051_1000061 Ga0209051_1000061105 229
540 3300025303 Ga0209051_1000065 Ga0209051_1000065122 229
541 3300025303 Ga0209051_1023515 Ga0209051_10235151 229
542 3300025321 Ga0207656_10000017 Ga0207656_1000001736 229
543 3300025711 Ga0207696_1000022 Ga0207696_100002290 229
544 3300025711 Ga0207696_1000044 Ga0207696_1000044105 229
545 3300025711 Ga0207696_1003748 Ga0207696_10037484 229
546 3300025711 Ga0207696_1003920 Ga0207696_10039206 229
547 3300025711 Ga0207696_1037561 Ga0207696_10375612 229
548 3300025728 Ga0207655_1000005 Ga0207655_1000005259 229
549 3300025728 Ga0207655_1000015 Ga0207655_1000015348 229
550 3300025728 Ga0207655_1000240 Ga0207655_100024034 229
551 3300025728 Ga0207655_1000462 Ga0207655_10004623 229
552 3300025728 Ga0207655_1001511 Ga0207655_100151112 229
553 3300025728 Ga0207655_1002564 Ga0207655_10025644 229
554 3300025728 Ga0207655_1003475 Ga0207655_10034752 229
555 3300025728 Ga0207655_1010955 Ga0207655_10109555 229
556 3300025728 Ga0207655_1012202 Ga0207655_10122025 229
557 3300025728 Ga0207655_1015532 Ga0207655_10155323 229
558 3300025728 Ga0207655_1036554 Ga0207655_10365542 229
559 3300025728 Ga0207655_1050350 Ga0207655_10503503 229
560 3300025735 Ga0207713_1000013 Ga0207713_1000013157 229
561 3300025735 Ga0207713_1000104 Ga0207713_100010413 229
562 3300025735 Ga0207713_1000454 Ga0207713_100045437 229
563 3300025735 Ga0207713_1005892 Ga0207713_10058925 229
564 3300025735 Ga0207713_1011540 Ga0207713_10115405 229
565 3300025735 Ga0207713_1024556 Ga0207713_10245564 229
566 3300025735 Ga0207713_1031185 Ga0207713_10311853 229
567 3300025735 Ga0207713_1039599 Ga0207713_10395992 229
568 3300025923 Ga0207681_10000679 Ga0207681_100006793 229
569 3300025925 Ga0207650_10000668 Ga0207650_1000066815 229
570 3300025925 Ga0207650_10001102 Ga0207650_100011025 229
571 3300025933 Ga0207706_10001474 Ga0207706_100014749 229
572 3300025935 Ga0207709_10028404 Ga0207709_100284042 229
573 3300025935 Ga0207709_10077797 Ga0207709_100777972 229
574 3300025981 Ga0207640_10031633 Ga0207640_100316333 229
575 3300026041 Ga0207639_10003002 Ga0207639_100030029 229
576 3300026067 Ga0207678_10624398 Ga0207678_106243982 229
577 3300027111 Ga0209281_1000013 Ga0209281_1000013223 229
578 3300027296 Ga0209389_1000002 Ga0209389_1000002264 229
579 3300027312 Ga0209371_1000239 Ga0209371_100023940 229
580 3300027312 Ga0209371_1000253 Ga0209371_10002534 229
581 3300027312 Ga0209371_1005194 Ga0209371_10051944 229
582 3300027471 Ga0209995_1000414 Ga0209995_10004145 229
583 3300027526 Ga0209968_1003561 Ga0209968_10035612 229
584 3300027543 Ga0209999_1003846 Ga0209999_10038463 229
585 3300027617 Ga0210002_1009337 Ga0210002_10093372 229
586 3300027665 Ga0209983_1000325 Ga0209983_10003254 229
587 3300027682 Ga0209971_1001262 Ga0209971_10012627 229
588 3300027876 Ga0209974_10007126 Ga0209974_100071264 229
589 3300027907 Ga0207428_10249763 Ga0207428_102497632 229
590 3300030500 Ga0268256_1000199 Ga0268256_100019928 229
591 3300030500 Ga0268256_1000367 Ga0268256_100036733 229
592 3300030500 Ga0268256_1004916 Ga0268256_10049164 229
593 3300030733 Ga0314311_1224394 Ga0314311_12243942 229
594 3300031548 Ga0307408_100000081 Ga0307408_1000000814 229
595 3300031548 Ga0307408_100191555 Ga0307408_1001915552 229
596 3300032004 Ga0307414_10048055 Ga0307414_100480553 229
597 3300038705 Ga0237819_03246 Ga0237819_03246_1801_2490 229
598 3300041404 Ga0439436_0000833 Ga0439436_0000833_4729_5418 229
599 3300041405 Ga0439438_001224 Ga0439438_001224_8018_8707 229
600 3300041405 Ga0439438_001549 Ga0439438_001549_3068_3757 229
601 3300041405 Ga0439438_004008 Ga0439438_004008_572_1261 229
602 3300041405 Ga0439438_005594 Ga0439438_005594_1066_1755 229
603 3300041405 Ga0439438_010939 Ga0439438_010939_1826_2515 229
604 3300041405 Ga0439438_021145 Ga0439438_021145_219_908 229
605 3300041405 Ga0439438_024202 Ga0439438_024202_712_1401 229
606 3300041405 Ga0439438_024411 Ga0439438_024411_336_1025 229
607 3300041407 Ga0439447_021944 Ga0439447_021944_234_923 229
608 3300041411 Ga0439466_0000342 Ga0439466_0000342_9046_9735 229
609 3300041411 Ga0439466_0008671 Ga0439466_0008671_502_1191 229
610 3300041411 Ga0439466_0017990 Ga0439466_0017990_1608_2297 229
611 3300041411 Ga0439466_0018321 Ga0439466_0018321_824_1513 229
612 3300041411 Ga0439466_0032593 Ga0439466_0032593_865_1554 229
613 3300041997 Ga0439431_0030722 Ga0439431_0030722_77_766 229
614 3300042000 Ga0439437_001017 Ga0439437_001017_2095_2784 229
615 3300042006 Ga0439432_002272 Ga0439432_002272_963_1652 229
616 3300042006 Ga0439432_012067 Ga0439432_012067_417_1106 229
617 3300042006 Ga0439432_041463 Ga0439432_041463_532_1221 229
618 3300042006 Ga0439432_077801 Ga0439432_077801_133_822 229
619 3300042009 Ga0439451_007452 Ga0439451_007452_260_949 229
620 3300042010 Ga0439452_003201 Ga0439452_003201_652_1341 229
621 3300042010 Ga0439452_003645 Ga0439452_003645_1866_2555 229
622 3300042010 Ga0439452_040989 Ga0439452_040989_29_718 229
623 3300042013 Ga0439456_013404 Ga0439456_013404_926_1615 229
624 3300042016 Ga0439463_000853 Ga0439463_000853_5291_5980 229
625 3300042016 Ga0439463_002002 Ga0439463_002002_3792_4481 229
626 3300042016 Ga0439463_005102 Ga0439463_005102_91_780 229
627 3300042115 Ga0450911_000037 Ga0450911_000037_45136_45825 229
628 3300042115 Ga0450911_001642 Ga0450911_001642_3636_4325 229
629 3300042115 Ga0450911_013889 Ga0450911_013889_45_734 229
630 3300042121 Ga0450919_013351 Ga0450919_013351_14_703 229
631 3300042125 Ga0450923_006052 Ga0450923_006052_556_1245 229
632 3300042127 Ga0450890_004602 Ga0450890_004602_426_1115 229
633 3300042136 Ga0450900_014018 Ga0450900_014018_218_907 229
634 3300042137 Ga0450902_006795 Ga0450902_006795_374_1063 229
635 3300042138 Ga0450903_015907 Ga0450903_015907_111_800 229
636 3300042139 Ga0450904_000010 Ga0450904_000010_2038_2727 229
637 3300042142 Ga0450905_004233 Ga0450905_004233_820_1509 229
638 3300042142 Ga0450905_038071 Ga0450905_038071_50_739 229
639 3300042146 Ga0450907_002271 Ga0450907_002271_2780_3469 229
640 3300042146 Ga0450907_002488 Ga0450907_002488_2787_3476 229
641 3300042147 Ga0450910_000828 Ga0450910_000828_2400_3089 229
642 3300042156 Ga0439446_0007265 Ga0439446_0007265_1647_2336 229
643 3300042156 Ga0439446_0085730 Ga0439446_0085730_179_868 229
644 3300042185 Ga0450909_005848 Ga0450909_005848_362_1051 229
645 3300042435 Ga0439434_0005198 Ga0439434_0005198_2296_2985 229
646 3300042439 Ga0439464_0008158 Ga0439464_0008158_1790_2479 229
647 3300042439 Ga0439464_0099538 Ga0439464_0099538_159_848 229
648 3300042461 Ga0439460_0002311 Ga0439460_0002311_2831_3520 229
649 3300042532 Ga0450893_0007907 Ga0450893_0007907_447_1136 229
650 3300042533 Ga0450901_001715 Ga0450901_001715_340_1029 229
651 3300042993 Ga0439440_0035470 Ga0439440_0035470_238_927 229
652 3300046452 Ga0495617_006990 Ga0495617_006990_2984_3673 229
653 3300046452 Ga0495617_020318 Ga0495617_020318_493_1182 229
654 3300046452 Ga0495617_039050 Ga0495617_039050_705_1394 229
655 3300046452 Ga0495617_060399 Ga0495617_060399_519_1208 229
656 3300046453 Ga0495627_000021 Ga0495627_000021_160658_161347 229
657 3300046453 Ga0495627_000279 Ga0495627_000279_35910_36599 229
658 3300046453 Ga0495627_002877 Ga0495627_002877_4481_5170 229
659 3300046453 Ga0495627_017992 Ga0495627_017992_1529_2218 229
660 3300046453 Ga0495627_032243 Ga0495627_032243_250_939 229
661 3300046457 Ga0495590_0005949 Ga0495590_0005949_562_1251 229
662 3300046457 Ga0495590_0068414 Ga0495590_0068414_526_1215 229
663 3300046458 Ga0495591_000015 Ga0495591_000015_239006_239695 229
664 3300046458 Ga0495591_001669 Ga0495591_001669_4426_5115 229
665 3300046458 Ga0495591_002885 Ga0495591_002885_6967_7656 229
666 3300046458 Ga0495591_004439 Ga0495591_004439_205_894 229
667 3300046458 Ga0495591_008158 Ga0495591_008158_2339_3028 229
668 3300046458 Ga0495591_008588 Ga0495591_008588_212_901 229
669 3300046458 Ga0495591_013373 Ga0495591_013373_183_872 229
670 3300046458 Ga0495591_021189 Ga0495591_021189_1226_1915 229
671 3300046458 Ga0495591_053892 Ga0495591_053892_270_959 229
672 3300046459 Ga0495629_0303336 Ga0495629_0303336_262_951 229
673 3300046460 Ga0495638_0007372 Ga0495638_0007372_2901_3590 229
674 3300046460 Ga0495638_0056195 Ga0495638_0056195_1201_1890 229
675 3300046460 Ga0495638_0067200 Ga0495638_0067200_290_979 229
676 3300046460 Ga0495638_0205775 Ga0495638_0205775_134_823 229
677 3300046463 Ga0495653_0043552 Ga0495653_0043552_2385_3074 229
678 3300046463 Ga0495653_0064101 Ga0495653_0064101_1496_2185 229
679 3300046463 Ga0495653_0071493 Ga0495653_0071493_289_978 229
680 3300046471 Ga0495650_0000672 Ga0495650_0000672_22078_22767 229
681 3300046471 Ga0495650_0008514 Ga0495650_0008514_2553_3242 229
682 3300046471 Ga0495650_0010244 Ga0495650_0010244_4431_5120 229
683 3300046471 Ga0495650_0014847 Ga0495650_0014847_3297_3986 229
684 3300046471 Ga0495650_0025885 Ga0495650_0025885_665_1354 229
685 3300046471 Ga0495650_0040686 Ga0495650_0040686_692_1381 229
686 3300046473 Ga0495582_0140242 Ga0495582_0140242_505_1194 229
687 3300046474 Ga0495605_0000016 Ga0495605_0000016_207253_207942 229
688 3300046474 Ga0495605_0000031 Ga0495605_0000031_160180_160869 229
689 3300046474 Ga0495605_0009557 Ga0495605_0009557_2674_3363 229
690 3300046474 Ga0495605_0012810 Ga0495605_0012810_256_945 229
691 3300046474 Ga0495605_0028704 Ga0495605_0028704_1063_1752 229
692 3300046474 Ga0495605_0052335 Ga0495605_0052335_1063_1752 229
693 3300046475 Ga0495639_0002355 Ga0495639_0002355_2796_3485 229
694 3300046491 Ga0495584_0012531 Ga0495584_0012531_456_1145 229
695 3300046491 Ga0495584_0070675 Ga0495584_0070675_823_1512 229
696 3300046491 Ga0495584_0246861 Ga0495584_0246861_57_746 229
697 3300046492 Ga0495585_0021995 Ga0495585_0021995_1907_2596 229
698 3300046492 Ga0495585_0036292 Ga0495585_0036292_286_975 229
699 3300046499 Ga0495594_0040103 Ga0495594_0040103_620_1309 229
700 3300046500 Ga0495596_0005366 Ga0495596_0005366_4429_5118 229
701 3300046500 Ga0495596_0114782 Ga0495596_0114782_251_940 229
702 3300046501 Ga0495607_0000248 Ga0495607_0000248_55237_55926 229
703 3300046501 Ga0495607_0000780 Ga0495607_0000780_29735_30424 229
704 3300046501 Ga0495607_0002842 Ga0495607_0002842_1852_2541 229
705 3300046501 Ga0495607_0009954 Ga0495607_0009954_937_1626 229
706 3300046501 Ga0495607_0035190 Ga0495607_0035190_284_973 229
707 3300046501 Ga0495607_0049776 Ga0495607_0049776_306_995 229
708 3300046501 Ga0495607_0107693 Ga0495607_0107693_382_1071 229
709 3300046501 Ga0495607_0137813 Ga0495607_0137813_16_705 229
710 3300046501 Ga0495607_0209265 Ga0495607_0209265_103_792 229
711 3300046501 Ga0495607_0216479 Ga0495607_0216479_124_813 229
712 3300046506 Ga0495583_0000041 Ga0495583_0000041_44709_45398 229
713 3300046506 Ga0495583_0000698 Ga0495583_0000698_6959_7648 229
714 3300046506 Ga0495583_0003486 Ga0495583_0003486_8159_8848 229
715 3300046506 Ga0495583_0007614 Ga0495583_0007614_87_776 229
716 3300046506 Ga0495583_0023108 Ga0495583_0023108_844_1533 229
717 3300046506 Ga0495583_0072323 Ga0495583_0072323_524_1213 229
718 3300046506 Ga0495583_0095210 Ga0495583_0095210_87_776 229
719 3300046507 Ga0495606_0000055 Ga0495606_0000055_195753_196442 229
720 3300046507 Ga0495606_0002535 Ga0495606_0002535_14235_14924 229
721 3300046507 Ga0495606_0021122 Ga0495606_0021122_1411_2100 229
722 3300046507 Ga0495606_0025179 Ga0495606_0025179_1184_1873 229
723 3300046507 Ga0495606_0047702 Ga0495606_0047702_317_1006 229
724 3300046507 Ga0495606_0048476 Ga0495606_0048476_1816_2505 229
725 3300046512 Ga0495610_0011574 Ga0495610_0011574_4154_4843 229
726 3300046512 Ga0495610_0037130 Ga0495610_0037130_19_708 229
727 3300046512 Ga0495610_0070752 Ga0495610_0070752_272_961 229
728 3300046513 Ga0495616_0018287 Ga0495616_0018287_3069_3758 229
729 3300046513 Ga0495616_0062591 Ga0495616_0062591_241_930 229
730 3300046513 Ga0495616_0064862 Ga0495616_0064862_745_1434 229
731 3300046513 Ga0495616_0097381 Ga0495616_0097381_237_932 229
732 3300046513 Ga0495616_0188867 Ga0495616_0188867_18_707 229
733 3300046515 Ga0495620_0000013 Ga0495620_0000013_100760_101449 229
734 3300046515 Ga0495620_0000015 Ga0495620_0000015_44678_45367 229
735 3300046515 Ga0495620_0005216 Ga0495620_0005216_4702_5391 229
736 3300046515 Ga0495620_0007041 Ga0495620_0007041_1050_1739 229
737 3300046515 Ga0495620_0031553 Ga0495620_0031553_1635_2324 229
738 3300046515 Ga0495620_0062734 Ga0495620_0062734_665_1354 229
739 3300046515 Ga0495620_0090181 Ga0495620_0090181_249_938 229
740 3300046517 Ga0495630_0114013 Ga0495630_0114013_142_831 229
741 3300046517 Ga0495630_0177603 Ga0495630_0177603_584_1273 229
742 3300046518 Ga0495631_0005402 Ga0495631_0005402_3210_3899 229
743 3300046518 Ga0495631_0012690 Ga0495631_0012690_1648_2337 229
744 3300046519 Ga0495632_0000912 Ga0495632_0000912_1556_2245 229
745 3300046519 Ga0495632_0000914 Ga0495632_0000914_553_1242 229
746 3300046519 Ga0495632_0004792 Ga0495632_0004792_6160_6849 229
747 3300046519 Ga0495632_0054101 Ga0495632_0054101_873_1562 229
748 3300046519 Ga0495632_0093183 Ga0495632_0093183_18_707 229
749 3300046519 Ga0495632_0094242 Ga0495632_0094242_239_928 229
750 3300046520 Ga0495637_0002612 Ga0495637_0002612_6049_6738 229
751 3300046520 Ga0495637_0004529 Ga0495637_0004529_1438_2127 229
752 3300046520 Ga0495637_0005694 Ga0495637_0005694_4413_5102 229
753 3300046520 Ga0495637_0034150 Ga0495637_0034150_947_1636 229
754 3300046520 Ga0495637_0061030 Ga0495637_0061030_837_1526 229
755 3300046520 Ga0495637_0093297 Ga0495637_0093297_227_916 229
756 3300046520 Ga0495637_0133004 Ga0495637_0133004_218_907 229
757 3300046522 Ga0495643_0000223 Ga0495643_0000223_29796_30485 229
758 3300046522 Ga0495643_0000903 Ga0495643_0000903_2866_3555 229
759 3300046522 Ga0495643_0019550 Ga0495643_0019550_362_1051 229
760 3300046523 Ga0495644_0002168 Ga0495644_0002168_1376_2065 229
761 3300046523 Ga0495644_0045454 Ga0495644_0045454_579_1409 229
762 3300046523 Ga0495644_0062484 Ga0495644_0062484_314_1003 229
763 3300046524 Ga0495648_0001423 Ga0495648_0001423_558_1247 229
764 3300046524 Ga0495648_0049543 Ga0495648_0049543_393_1082 229
765 3300046524 Ga0495648_0096057 Ga0495648_0096057_718_1407 229
766 3300046524 Ga0495648_0200171 Ga0495648_0200171_284_973 229
767 3300046526 Ga0495666_0022867 Ga0495666_0022867_1764_2453 229
768 3300046526 Ga0495666_0064542 Ga0495666_0064542_792_1481 229
769 3300046528 Ga0495642_0002131 Ga0495642_0002131_6485_7174 229
770 3300046528 Ga0495642_0035623 Ga0495642_0035623_1095_1784 229
771 3300046530 Ga0495654_0003357 Ga0495654_0003357_9086_9775 229
772 3300046530 Ga0495654_0003364 Ga0495654_0003364_6313_7002 229
773 3300046530 Ga0495654_0017170 Ga0495654_0017170_308_997 229
774 3300046530 Ga0495654_0037853 Ga0495654_0037853_605_1294 229
775 3300046530 Ga0495654_0048994 Ga0495654_0048994_1279_1968 229
776 3300046530 Ga0495654_0086018 Ga0495654_0086018_680_1369 229
777 3300046530 Ga0495654_0138884 Ga0495654_0138884_99_788 229
778 3300046530 Ga0495654_0165479 Ga0495654_0165479_150_839 229
779 3300046535 Ga0495586_0079406 Ga0495586_0079406_581_1270 229
780 3300046536 Ga0495587_0021981 Ga0495587_0021981_2790_3479 229
781 3300046538 Ga0495609_0000015 Ga0495609_0000015_276974_277663 229
782 3300046538 Ga0495609_0000070 Ga0495609_0000070_98647_99336 229
783 3300046538 Ga0495609_0003891 Ga0495609_0003891_6038_6727 229
784 3300046538 Ga0495609_0022602 Ga0495609_0022602_2028_2717 229
785 3300046538 Ga0495609_0091328 Ga0495609_0091328_614_1303 229
786 3300046542 Ga0495597_0000005 Ga0495597_0000005_179185_179874 229
787 3300046542 Ga0495597_0011863 Ga0495597_0011863_746_1435 229
788 3300046542 Ga0495597_0074803 Ga0495597_0074803_163_852 229
789 3300046542 Ga0495597_0155327 Ga0495597_0155327_14_703 229
790 3300046557 Ga0495622_0003963 Ga0495622_0003963_3454_4143 229
791 3300046557 Ga0495622_0006164 Ga0495622_0006164_367_1056 229
792 3300046557 Ga0495622_0014077 Ga0495622_0014077_1570_2259 229
793 3300046557 Ga0495622_0131555 Ga0495622_0131555_394_1083 229
794 3300046558 Ga0495633_0000060 Ga0495633_0000060_113465_114154 229
795 3300046616 Ga0495668_0014935 Ga0495668_0014935_280_969 229
796 3300046616 Ga0495668_0122682 Ga0495668_0122682_355_1044 229
797 3300046616 Ga0495668_0144806 Ga0495668_0144806_596_1285 229
798 3300046642 Ga0495634_0140357 Ga0495634_0140357_485_1174 229
799 3300046648 Ga0495611_0000817 Ga0495611_0000817_6727_7416 229
800 3300046648 Ga0495611_0003416 Ga0495611_0003416_2147_2836 229
801 3300046648 Ga0495611_0191946 Ga0495611_0191946_106_795 229
802 3300046660 Ga0495625_0001491 Ga0495625_0001491_6136_6825 229
803 3300046660 Ga0495625_0019930 Ga0495625_0019930_1736_2425 229
804 3300046660 Ga0495625_0126498 Ga0495625_0126498_287_976 229
805 3300046660 Ga0495625_0252467 Ga0495625_0252467_410_1099 229
806 3300046663 Ga0495635_0024927 Ga0495635_0024927_459_1148 229
807 3300046664 Ga0495659_0003433 Ga0495659_0003433_350_1039 229
808 3300046664 Ga0495659_0011603 Ga0495659_0011603_300_989 229
809 3300046665 Ga0495661_0000110 Ga0495661_0000110_38159_38848 229
810 3300046665 Ga0495661_0000139 Ga0495661_0000139_78337_79026 229
811 3300046665 Ga0495661_0000194 Ga0495661_0000194_45848_46537 229
812 3300046665 Ga0495661_0000304 Ga0495661_0000304_39849_40538 229
813 3300046665 Ga0495661_0044658 Ga0495661_0044658_462_1151 229
814 3300046665 Ga0495661_0195824 Ga0495661_0195824_68_757 229
815 3300046665 Ga0495661_0204943 Ga0495661_0204943_41_730 229
816 3300046674 Ga0495588_0148363 Ga0495588_0148363_313_1002 229
817 3300046679 Ga0495623_0028796 Ga0495623_0028796_2621_3310 229
818 3300046684 Ga0495669_0004936 Ga0495669_0004936_2402_3091 229
819 3300046689 Ga0495613_0327929 Ga0495613_0327929_332_1021 229
820 3300046690 Ga0495624_0063633 Ga0495624_0063633_1461_2150 229
821 3300046691 Ga0495670_0002014 Ga0495670_0002014_3578_4267 229
822 3300046691 Ga0495670_0077080 Ga0495670_0077080_770_1459 229
823 3300046691 Ga0495670_0154114 Ga0495670_0154114_489_1178 229
824 3300046692 Ga0495671_0009834 Ga0495671_0009834_1355_2044 229
825 3300046692 Ga0495671_0012159 Ga0495671_0012159_3990_4679 229
826 3300046692 Ga0495671_0014145 Ga0495671_0014145_2237_2926 229
827 3300046692 Ga0495671_0040795 Ga0495671_0040795_1198_1887 229
828 3300046692 Ga0495671_0064974 Ga0495671_0064974_789_1478 229
829 3300046692 Ga0495671_0146599 Ga0495671_0146599_240_929 229
830 3300046692 Ga0495671_0175419 Ga0495671_0175419_338_1027 229
831 3300046694 Ga0495649_0005972 Ga0495649_0005972_2915_3604 229
832 3300046694 Ga0495649_0038788 Ga0495649_0038788_1373_2062 229
833 3300046694 Ga0495649_0039240 Ga0495649_0039240_514_1203 229
834 3300046694 Ga0495649_0058119 Ga0495649_0058119_1219_1908 229
835 3300046694 Ga0495649_0278180 Ga0495649_0278180_142_831 229
836 3300046794 Ga0495589_0000855 Ga0495589_0000855_1063_1752 229
837 3300046794 Ga0495589_0007319 Ga0495589_0007319_619_1308 229
838 3300046794 Ga0495589_0017167 Ga0495589_0017167_1218_1907 229
839 3300046809 Ga0495600_0005020 Ga0495600_0005020_2787_3476 229
840 3300046810 Ga0495660_0001756 Ga0495660_0001756_1033_1722 229
841 3300046810 Ga0495660_0019277 Ga0495660_0019277_2258_2947 229
842 3300046810 Ga0495660_0023430 Ga0495660_0023430_2794_3483 229
843 3300046810 Ga0495660_0056189 Ga0495660_0056189_158_847 229
844 3300046810 Ga0495660_0157692 Ga0495660_0157692_15_704 229
845 3300047317 Ga0495604_0216665 Ga0495604_0216665_335_1024 229
846 3300047318 Ga0495636_0014835 Ga0495636_0014835_2232_2921 229
847 3300047318 Ga0495636_0080700 Ga0495636_0080700_260_949 229
848 3300047320 Ga0495672_0020211 Ga0495672_0020211_1678_2367 229
849 3300047320 Ga0495672_0028649 Ga0495672_0028649_1857_2546 229
850 3300047320 Ga0495672_0034225 Ga0495672_0034225_232_921 229
851 3300047320 Ga0495672_0061584 Ga0495672_0061584_1143_1832 229
852 3300047320 Ga0495672_0076723 Ga0495672_0076723_85_774 229
853 3300047320 Ga0495672_0079440 Ga0495672_0079440_1076_1765 229
854 3300047320 Ga0495672_0143183 Ga0495672_0143183_354_1043 229
855 3300047321 Ga0495676_0000013 Ga0495676_0000013_206231_206920 229
856 3300047323 Ga0495683_0000027 Ga0495683_0000027_107964_108653 229
857 3300047323 Ga0495683_0000261 Ga0495683_0000261_6154_6843 229
858 3300047323 Ga0495683_0008434 Ga0495683_0008434_3991_4680 229
859 3300047323 Ga0495683_0015414 Ga0495683_0015414_698_1387 229
860 3300047323 Ga0495683_0037791 Ga0495683_0037791_1219_1908 229
861 3300047323 Ga0495683_0069159 Ga0495683_0069159_309_998 229
862 3300047443 Ga0495687_010031 Ga0495687_010031_4016_4705 229
863 3300047443 Ga0495687_012754 Ga0495687_012754_350_1039 229
864 3300047446 Ga0495679_000206 Ga0495679_000206_44846_45535 229
865 3300047446 Ga0495679_001765 Ga0495679_001765_8310_8999 229
866 3300047469 Ga0495673_0003090 Ga0495673_0003090_8021_8710 229
867 3300047469 Ga0495673_0010910 Ga0495673_0010910_3315_4004 229
868 3300047469 Ga0495673_0011603 Ga0495673_0011603_3773_4462 229
869 3300047469 Ga0495673_0011642 Ga0495673_0011642_505_1194 229
870 3300047469 Ga0495673_0013537 Ga0495673_0013537_277_966 229
871 3300047469 Ga0495673_0017519 Ga0495673_0017519_141_830 229
872 3300047469 Ga0495673_0055784 Ga0495673_0055784_454_1143 229
873 3300047470 Ga0495681_0003664 Ga0495681_0003664_3959_4648 229
874 3300047470 Ga0495681_0005466 Ga0495681_0005466_6126_6815 229
875 3300047470 Ga0495681_0010709 Ga0495681_0010709_3362_4051 229
876 3300047470 Ga0495681_0011975 Ga0495681_0011975_21_710 229
877 3300047470 Ga0495681_0020315 Ga0495681_0020315_2793_3482 229
878 3300047470 Ga0495681_0028153 Ga0495681_0028153_2119_2808 229
879 3300047470 Ga0495681_0033280 Ga0495681_0033280_351_1040 229
880 3300047470 Ga0495681_0050445 Ga0495681_0050445_911_1600 229
881 3300047470 Ga0495681_0122153 Ga0495681_0122153_287_976 229
882 3300047470 Ga0495681_0135867 Ga0495681_0135867_140_829 229
883 3300047472 Ga0495686_0031369 Ga0495686_0031369_1591_2280 229
884 3300047472 Ga0495686_0143798 Ga0495686_0143798_497_1186 229
885 3300047673 Ga0495593_0030808 Ga0495593_0030808_1602_2291 229
886 3300048091 Ga0495626_0000056 Ga0495626_0000056_143839_144528 229
887 3300048091 Ga0495626_0004948 Ga0495626_0004948_2891_3580 229
888 3300048091 Ga0495626_0011052 Ga0495626_0011052_4062_4751 229
889 3300048091 Ga0495626_0013013 Ga0495626_0013013_398_1087 229
890 3300048091 Ga0495626_0017070 Ga0495626_0017070_1841_2530 229
891 3300048905 Ga0496102_0191890 Ga0496102_0191890_1131_1820 229
892 3300048905 Ga0496102_0265742 Ga0496102_0265742_581_1270 229
893 3300048913 Ga0496110_0192502 Ga0496110_0192502_488_1177 229
894 3300048914 Ga0496111_0237833 Ga0496111_0237833_266_955 229
895 3300048915 Ga0496112_0564801 Ga0496112_0564801_170_859 229
896 3300048917 Ga0496114_0147898 Ga0496114_0147898_579_1268 229
897 3300048919 Ga0496116_0000999 Ga0496116_0000999_25703_26392 229
898 3300048919 Ga0496116_0018019 Ga0496116_0018019_4423_5112 229
899 3300048919 Ga0496116_0117967 Ga0496116_0117967_270_959 229
900 3300048920 Ga0496117_0006411 Ga0496117_0006411_743_1432 229
901 3300048920 Ga0496117_0030232 Ga0496117_0030232_1978_2667 229
902 3300048920 Ga0496117_0081587 Ga0496117_0081587_85_774 229
903 3300048920 Ga0496117_0084328 Ga0496117_0084328_1138_1827 229
904 3300048920 Ga0496117_0152088 Ga0496117_0152088_421_1110 229
905 3300048920 Ga0496117_0182483 Ga0496117_0182483_235_924 229
906 3300048921 Ga0496118_0001807 Ga0496118_0001807_12418_13107 229
907 3300048921 Ga0496118_0095878 Ga0496118_0095878_352_1041 229
908 3300048921 Ga0496118_0226515 Ga0496118_0226515_64_756 229
909 3300048921 Ga0496118_0233500 Ga0496118_0233500_19_708 229
910 3300048921 Ga0496118_0262216 Ga0496118_0262216_54_743 229
911 3300048922 Ga0496119_0000112 Ga0496119_0000112_104398_105087 229
912 3300048922 Ga0496119_0230022 Ga0496119_0230022_176_865 229
913 3300048923 Ga0496120_0004409 Ga0496120_0004409_10530_11219 229
914 3300048924 Ga0496121_0002354 Ga0496121_0002354_2768_3457 229
915 3300048924 Ga0496121_0003009 Ga0496121_0003009_6064_6753 229
916 3300048924 Ga0496121_0066285 Ga0496121_0066285_117_806 229
917 3300048924 Ga0496121_0137771 Ga0496121_0137771_811_1500 229
918 3300048924 Ga0496121_0171305 Ga0496121_0171305_416_1105 229
919 3300048925 Ga0496122_0000122 Ga0496122_0000122_175792_176481 229
920 3300048925 Ga0496122_0009298 Ga0496122_0009298_6888_7577 229
921 3300048925 Ga0496122_0033077 Ga0496122_0033077_333_1022 229
922 3300048925 Ga0496122_0093864 Ga0496122_0093864_324_1013 229
923 3300048925 Ga0496122_0266663 Ga0496122_0266663_179_868 229
924 3300048926 Ga0496123_0000391 Ga0496123_0000391_18123_18812 229
925 3300048926 Ga0496123_0001340 Ga0496123_0001340_17452_18141 229
926 3300048926 Ga0496123_0012443 Ga0496123_0012443_2208_2897 229
927 3300048926 Ga0496123_0139280 Ga0496123_0139280_94_783 229
928 3300048927 Ga0496124_0000222 Ga0496124_0000222_44365_45054 229
929 3300048927 Ga0496124_0034795 Ga0496124_0034795_3064_3753 229
930 3300048927 Ga0496124_0053019 Ga0496124_0053019_92_781 229
931 3300048927 Ga0496124_0081731 Ga0496124_0081731_831_1520 229
932 3300048927 Ga0496124_0084069 Ga0496124_0084069_956_1645 229
933 3300048927 Ga0496124_0127532 Ga0496124_0127532_103_792 229
934 3300048927 Ga0496124_0135034 Ga0496124_0135034_1050_1739 229
935 3300048927 Ga0496124_0139891 Ga0496124_0139891_38_727 229
936 3300048927 Ga0496124_0248867 Ga0496124_0248867_331_1020 229
937 3300048927 Ga0496124_0296867 Ga0496124_0296867_197_886 229
938 3300048927 Ga0496124_0334600 Ga0496124_0334600_279_971 229
939 3300048928 Ga0496125_0000908 Ga0496125_0000908_43291_43980 229
940 3300048928 Ga0496125_0044153 Ga0496125_0044153_2027_2716 229
941 3300048928 Ga0496125_0084520 Ga0496125_0084520_1146_1835 229
942 3300048928 Ga0496125_0123920 Ga0496125_0123920_846_1535 229
943 3300048929 Ga0496126_0134998 Ga0496126_0134998_1010_1699 229
944 3300049459 Ga0495678_000039 Ga0495678_000039_146101_146790 229
945 3300049459 Ga0495678_004626 Ga0495678_004626_2774_3463 229
946 3300049459 Ga0495678_008903 Ga0495678_008903_424_1113 229
947 3300049459 Ga0495678_050737 Ga0495678_050737_454_1143 229
948 3300049459 Ga0495678_085666 Ga0495678_085666_28_717 229
949 3300049460 Ga0495682_0000577 Ga0495682_0000577_1595_2284 229
950 3300049460 Ga0495682_0001344 Ga0495682_0001344_12645_13334 229
951 3300049460 Ga0495682_0027923 Ga0495682_0027923_896_1585 229
952 3300049460 Ga0495682_0070558 Ga0495682_0070558_309_998 229
953 3300049530 Ga0501314_000184 Ga0501314_000184_1947_2636 229
954 3300049569 Ga0501032_0017099 Ga0501032_0017099_2806_3495 229
955 3300049569 Ga0501032_0143071 Ga0501032_0143071_144_833 229
956 3300049571 Ga0501034_0000137 Ga0501034_0000137_103606_104295 229
957 3300049571 Ga0501034_0535707 Ga0501034_0535707_310_999 229
958 3300049573 Ga0501037_0019740 Ga0501037_0019740_991_1686 229
959 3300049573 Ga0501037_0098256 Ga0501037_0098256_806_1495 229
960 3300049573 Ga0501037_0187385 Ga0501037_0187385_486_1175 229
961 3300049574 Ga0501038_0145172 Ga0501038_0145172_663_1352 229
962 3300049575 Ga0501039_0098402 Ga0501039_0098402_62_757 229
963 3300049575 Ga0501039_0319704 Ga0501039_0319704_344_1033 229
964 3300049580 Ga0501046_0001861 Ga0501046_0001861_12766_13461 229
965 3300049583 Ga0501067_0319823 Ga0501067_0319823_140_835 229
966 3300049585 Ga0501069_0045541 Ga0501069_0045541_1651_2346 229
967 3300049586 Ga0501070_0010248 Ga0501070_0010248_6034_6729 229
968 3300049590 Ga0501074_0426670 Ga0501074_0426670_91_786 229
969 3300049853 Ga0501226_000017 Ga0501226_000017_39498_40187 229
970 3300050489 nmdc:mga03683_87068_c1 nmdc:mga03683_87068_c1_263_952 229
971 3300050514 nmdc:mga08x19_193284_c1 nmdc:mga08x19_193284_c1_307_996 229
972 3300053125 Ga0500618_009345 Ga0500618_009345_1719_2408 229
973 3300053135 Ga0500659_0046867 Ga0500659_0046867_557_1246 229
974 3300053140 Ga0500573_0056391 Ga0500573_0056391_1069_1758 229
975 3300053727 Ga0500611_046406 Ga0500611_046406_88_783 229
976 3300005530 Ga0070679_100081979 Ga0070679_1000819794 230
977 3300009093 Ga0105240_10019805 Ga0105240_100198054 230
978 3300025912 Ga0207707_10052767 Ga0207707_100527672 230
979 3300025913 Ga0207695_10040478 Ga0207695_100404782 230
980 3300025921 Ga0207652_10034747 Ga0207652_100347473 230
981 iso_pu_bacteria 2773857670 2774122156 276
982 iso_pu_bacteria 2784132072 2784314401 276
983 2124908027 MRS2a_Contig_171 MRS2a_00070420 280
984 3300005288 Ga0065714_10000901 Ga0065714_100009012 280
985 3300005290 Ga0065712_10000436 Ga0065712_1000043610 280
986 3300009036 Ga0105244_10087762 Ga0105244_100877622 280
987 3300025711 Ga0207696_1015171 Ga0207696_10151713 280
988 3300025728 Ga0207655_1004133 Ga0207655_10041339 280
989 3300025735 Ga0207713_1003950 Ga0207713_10039502 280
990 3300046557 Ga0495622_0006468 Ga0495622_0006468_2363_3205 280
991 3300046674 Ga0495588_0096414 Ga0495588_0096414_405_1247 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00636

Ribonuclease_3

Ribonuclease III domain

88

178

0.98

PF14622

Ribonucleas_3_3

Ribonuclease-III-like

69

194

0.96

PF00035

dsrm

Double-stranded RNA binding motif

206

273

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a11-assembly1.cif.gz_A-2 crystal structure of nuclease domain of ribonuclase iii from mycobacterium tuberculosis 0.9772 58 195
3o2r-assembly2.cif.gz_D structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.9716 56 195
1di2-assembly1.cif.gz_A crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions 0.9607 206 274
3adl-assembly1.cif.gz_A structure of trbp2 and its molecule implications for mirna processing 0.947 204 274
3n3w-assembly1.cif.gz_B 2.2 angstrom resolution crystal structure of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.9457 56 198
ID Description Score Start End Superfamily
af_P0A7Y0_154_224_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 1.002 204 273 3.30.160.20
af_P0A7Y0_4_147_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9952 56 197 1.10.1520.10
2a11A00 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9772 58 195 1.10.1520.10
af_P0A7Y0_4_147_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9746 56 197 1.10.1520.10
af_P0A7Y0_154_224_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9738 204 273 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A356E6B3-F1-model_v4 Ribonuclease III 0.9934 54 173 GO:0004525
GO:0006396
AF-A0A6L6EC33-F1-model_v4 deleted 0.9885 73 184
AF-A0A497HAB7-F1-model_v4 RNase III domain-containing protein 0.9843 54 189 GO:0004525
GO:0006396
AF-A0A4Q6EIP2-F1-model_v4 Ribonuclease III 0.9805 57 192 GO:0003725
GO:0004525
GO:0006396
GO:0010468
AF-A0A0K8Q528-F1-model_v4 Ribonuclease 3 0.9803 55 190 GO:0003723
GO:0004525
GO:0005737
GO:0030422

Feature Viewer

pLDDT pTM Quality
82.26 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map