F487629
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 991 | 377 | 1982 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100122005|Ga0070660_1001220053 |
| Length | 236 |
| Sequence | MQAGRTDSTASAWRGIVFMRKEYTARSSSFSSTFVPSPEKEKAMAAKKILFLTGDFAEDYETMVPFQALQAVGHTVDAVCPGKRAGQKIKTAIHDFEGDQTYTEKPGHQFALNATFDEVDASSYDALAIAGGRAPEYLRLDPKVIELVRHFAQSKKPIAAICHAAQLLAAADVIRGKRISAYPACAPEVRMAGGEYADIPVDAAVTDAPFVTAPAWPAHPEWLSQFLVLLGTRIEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 66 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 83 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 173 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 174 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 175 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 176 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 197 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 204 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 205 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 206 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 207 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 332 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 333 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 336 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 344 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 347 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 357 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 358 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 359 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 360 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 361 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 362 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 364 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 366 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 367 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 368 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 369 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 370 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 371 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 373 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 374 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 375 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 376 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 377 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.39 |
| Metatranscriptomes | 1.11 |
| Isolates | 0.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.15 |
| Nodule | 0.4 |
| Rhizoplane | 3.33 |
| Rhizosphere | 73.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070660_100122005 | 3300005339 | Bacteria | 2080 |
| 2 | JGI24739J22299_10002605 | 3300001989 | Bacteria | 6945 |
| 3 | JGI24737J22298_10065992 | 3300001990 | Bacteria | 1084 |
| 4 | JGI24735J21928_10000339 | 3300002067 | Bacteria | 16297 |
| 5 | JGI25158J39367_1000436 | 3300002739 | Bacteria | 8648 |
| 6 | JGI25152J39213_1000115 | 3300002773 | Bacteria | 55874 |
| 7 | JGI25150J39212_1000197 | 3300002774 | Bacteria | 33435 |
| 8 | JGI25150J39212_1000927 | 3300002774 | Bacteria | 9514 |
| 9 | JGI25159J45721_1002012 | 3300002987 | Bacteria | 8066 |
| 10 | JGI25165J46597_1000844 | 3300003214 | Bacteria | 22467 |
| 11 | JGI25153J46596_10001988 | 3300003215 | Bacteria | 12086 |
| 12 | rootH2_10008947 | 3300003320 | Bacteria | 16700 |
| 13 | rootL2_10011897 | 3300003322 | Bacteria | 10664 |
| 14 | rootL2_10011911 | 3300003322 | Bacteria | 5093 |
| 15 | rootH1_10055638 | 3300003323 | Bacteria | 4609 |
| 16 | JGI25161J50226_1000895 | 3300003374 | Bacteria | 10795 |
| 17 | Ga0006556J51387_1036097 | 3300003479 | Bacteria | 981 |
| 18 | Ga0006554J51385_1033659 | 3300003567 | Bacteria | 740 |
| 19 | Ga0055533_1000026 | 3300003756 | Bacteria | 323407 |
| 20 | Ga0055533_1000095 | 3300003756 | Bacteria | 114060 |
| 21 | Ga0055532_1000010 | 3300003758 | Bacteria | 392055 |
| 22 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 23 | Ga0055525_1001465 | 3300003759 | Bacteria | 4189 |
| 24 | Ga0055525_1007078 | 3300003759 | Bacteria | 949 |
| 25 | Ga0055527_1000008 | 3300003760 | Bacteria | 392055 |
| 26 | Ga0055535_1000007 | 3300003761 | Bacteria | 392055 |
| 27 | Ga0055542_1000011 | 3300003762 | Bacteria | 392055 |
| 28 | Ga0055529_1000009 | 3300003763 | Bacteria | 392055 |
| 29 | Ga0055526_1000807 | 3300003771 | Bacteria | 23354 |
| 30 | Ga0055526_1002869 | 3300003771 | Bacteria | 11361 |
| 31 | Ga0055537_1001395 | 3300003773 | Bacteria | 9576 |
| 32 | Ga0055537_1002259 | 3300003773 | Bacteria | 6632 |
| 33 | Ga0055537_1011766 | 3300003773 | Bacteria | 1751 |
| 34 | Ga0055524_1000242 | 3300003775 | Bacteria | 57160 |
| 35 | Ga0055524_1001375 | 3300003775 | Bacteria | 14119 |
| 36 | Ga0055524_1003370 | 3300003775 | Bacteria | 7784 |
| 37 | Ga0055524_1003664 | 3300003775 | Bacteria | 7366 |
| 38 | Ga0055524_1006151 | 3300003775 | Bacteria | 5244 |
| 39 | Ga0055524_1033266 | 3300003775 | Bacteria | 1445 |
| 40 | Ga0055534_1000279 | 3300003784 | Bacteria | 34956 |
| 41 | Ga0055528_1000089 | 3300003790 | Bacteria | 72690 |
| 42 | Ga0055528_1007432 | 3300003790 | Bacteria | 4845 |
| 43 | Ga0055530_10002301 | 3300003791 | Bacteria | 12487 |
| 44 | Ga0055530_10002731 | 3300003791 | Bacteria | 10938 |
| 45 | Ga0055530_10003871 | 3300003791 | Bacteria | 8197 |
| 46 | Ga0055531_10005443 | 3300003794 | Bacteria | 7453 |
| 47 | Ga0055531_10006833 | 3300003794 | Bacteria | 6366 |
| 48 | Ga0055531_10006897 | 3300003794 | Bacteria | 6330 |
| 49 | Ga0055531_10014393 | 3300003794 | Bacteria | 3562 |
| 50 | Ga0055543_1001210 | 3300004625 | Bacteria | 10837 |
| 51 | Ga0055543_1014883 | 3300004625 | Bacteria | 1507 |
| 52 | Ga0065165_1000304 | 3300005262 | Bacteria | 81791 |
| 53 | Ga0065165_1000507 | 3300005262 | Bacteria | 59988 |
| 54 | Ga0065165_1001445 | 3300005262 | Bacteria | 25750 |
| 55 | Ga0065165_1002631 | 3300005262 | Bacteria | 14600 |
| 56 | Ga0065165_1005827 | 3300005262 | Bacteria | 6718 |
| 57 | Ga0065712_10131452 | 3300005290 | Bacteria | 1545 |
| 58 | Ga0070658_10064683 | 3300005327 | Bacteria | 2983 |
| 59 | Ga0070658_10106526 | 3300005327 | Bacteria | 2319 |
| 60 | Ga0070658_10194074 | 3300005327 | Bacteria | 1712 |
| 61 | Ga0070658_10343259 | 3300005327 | Bacteria | 1277 |
| 62 | Ga0070658_10439620 | 3300005327 | Bacteria | 1123 |
| 63 | Ga0070658_10562363 | 3300005327 | Bacteria | 987 |
| 64 | Ga0070658_10614211 | 3300005327 | Bacteria | 943 |
| 65 | Ga0070676_10342994 | 3300005328 | Bacteria | 1025 |
| 66 | Ga0068869_100242320 | 3300005334 | Bacteria | 1437 |
| 67 | Ga0070660_100000021 | 3300005339 | Bacteria | 97654 |
| 68 | Ga0070660_100005471 | 3300005339 | Bacteria | 8794 |
| 69 | Ga0070660_100170974 | 3300005339 | Bacteria | 1755 |
| 70 | Ga0070660_100221108 | 3300005339 | Bacteria | 1539 |
| 71 | Ga0070687_100334262 | 3300005343 | Bacteria | 972 |
| 72 | Ga0070661_100032836 | 3300005344 | Bacteria | 3758 |
| 73 | Ga0070661_100152719 | 3300005344 | Bacteria | 1746 |
| 74 | Ga0070661_100308725 | 3300005344 | Bacteria | 1233 |
| 75 | Ga0070675_101049077 | 3300005354 | Bacteria | 749 |
| 76 | Ga0070659_100000061 | 3300005366 | Bacteria | 85192 |
| 77 | Ga0070659_100009077 | 3300005366 | Bacteria | 7296 |
| 78 | Ga0070659_100038300 | 3300005366 | Bacteria | 3739 |
| 79 | Ga0070667_100317080 | 3300005367 | Bacteria | 1406 |
| 80 | Ga0070667_100780917 | 3300005367 | Bacteria | 886 |
| 81 | Ga0070705_100473304 | 3300005440 | Bacteria | 945 |
| 82 | Ga0070663_100000250 | 3300005455 | Bacteria | 27134 |
| 83 | Ga0070663_100993626 | 3300005455 | Bacteria | 729 |
| 84 | Ga0070662_100312849 | 3300005457 | Bacteria | 1279 |
| 85 | Ga0070662_100527988 | 3300005457 | Bacteria | 987 |
| 86 | Ga0070681_10100520 | 3300005458 | Bacteria | 2838 |
| 87 | Ga0068867_100000006 | 3300005459 | Bacteria | 152530 |
| 88 | Ga0070706_100255135 | 3300005467 | Bacteria | 1637 |
| 89 | Ga0070665_100031969 | 3300005548 | Bacteria | 5298 |
| 90 | Ga0068855_100001767 | 3300005563 | Bacteria | 26998 |
| 91 | Ga0068855_100010462 | 3300005563 | Bacteria | 11194 |
| 92 | Ga0068855_100078301 | 3300005563 | Bacteria | 3835 |
| 93 | Ga0068855_100080939 | 3300005563 | Bacteria | 3765 |
| 94 | Ga0068855_100478176 | 3300005563 | Bacteria | 1356 |
| 95 | Ga0068855_100510417 | 3300005563 | Bacteria | 1305 |
| 96 | Ga0068855_101387746 | 3300005563 | Bacteria | 724 |
| 97 | Ga0070664_100027116 | 3300005564 | Bacteria | 4759 |
| 98 | Ga0070664_100029426 | 3300005564 | Bacteria | 4579 |
| 99 | Ga0070664_100084209 | 3300005564 | Bacteria | 2744 |
| 100 | Ga0070664_100620632 | 3300005564 | Bacteria | 1003 |
| 101 | Ga0068857_101054903 | 3300005577 | Bacteria | 784 |
| 102 | Ga0068854_100493485 | 3300005578 | Bacteria | 1030 |
| 103 | Ga0068856_100056998 | 3300005614 | Bacteria | 3857 |
| 104 | Ga0068856_100080213 | 3300005614 | Bacteria | 3237 |
| 105 | Ga0068856_100127063 | 3300005614 | Bacteria | 2553 |
| 106 | Ga0068852_100147354 | 3300005616 | Bacteria | 2185 |
| 107 | Ga0068852_100161242 | 3300005616 | Bacteria | 2094 |
| 108 | Ga0068852_100194557 | 3300005616 | Bacteria | 1915 |
| 109 | Ga0068852_100771924 | 3300005616 | Bacteria | 974 |
| 110 | Ga0068858_100312322 | 3300005842 | Bacteria | 1501 |
| 111 | Ga0068860_100494046 | 3300005843 | Bacteria | 1221 |
| 112 | Ga0075369_10042589 | 3300006186 | Bacteria | 1947 |
| 113 | Ga0075366_10022492 | 3300006195 | Bacteria | 3668 |
| 114 | Ga0075366_10049119 | 3300006195 | Bacteria | 2503 |
| 115 | Ga0097621_100035470 | 3300006237 | Bacteria | 3986 |
| 116 | Ga0075370_10001645 | 3300006353 | Bacteria | 9866 |
| 117 | Ga0075370_10004814 | 3300006353 | Bacteria | 6609 |
| 118 | Ga0075370_10016442 | 3300006353 | Bacteria | 3981 |
| 119 | Ga0068871_100406625 | 3300006358 | Bacteria | 1213 |
| 120 | Ga0075428_100193190 | 3300006844 | Bacteria | 2201 |
| 121 | Ga0075433_10192832 | 3300006852 | Bacteria | 1812 |
| 122 | Ga0068865_100099237 | 3300006881 | Bacteria | 2129 |
| 123 | Ga0099823_1000015 | 3300006944 | Bacteria | 88096 |
| 124 | Ga0079104_1000219 | 3300006946 | Bacteria | 79928 |
| 125 | Ga0105251_10000339 | 3300009011 | Bacteria | 46681 |
| 126 | Ga0105244_10017542 | 3300009036 | Bacteria | 4042 |
| 127 | Ga0105240_10011738 | 3300009093 | Bacteria | 12170 |
| 128 | Ga0105240_10060155 | 3300009093 | Bacteria | 4736 |
| 129 | Ga0105240_10082826 | 3300009093 | Bacteria | 3939 |
| 130 | Ga0105240_10119970 | 3300009093 | Bacteria | 3167 |
| 131 | Ga0105240_10173883 | 3300009093 | Bacteria | 2548 |
| 132 | Ga0105240_10182748 | 3300009093 | Bacteria | 2473 |
| 133 | Ga0105240_10428075 | 3300009093 | Bacteria | 1485 |
| 134 | Ga0111539_10298125 | 3300009094 | Bacteria | 1876 |
| 135 | Ga0105247_10051506 | 3300009101 | Bacteria | 2535 |
| 136 | Ga0114129_11308822 | 3300009147 | Bacteria | 898 |
| 137 | Ga0105243_10010521 | 3300009148 | Bacteria | 7024 |
| 138 | Ga0105243_10021153 | 3300009148 | Bacteria | 4937 |
| 139 | Ga0105243_10417078 | 3300009148 | Bacteria | 1251 |
| 140 | Ga0105241_10007081 | 3300009174 | Bacteria | 8257 |
| 141 | Ga0105241_10113010 | 3300009174 | Bacteria | 2176 |
| 142 | Ga0105242_10101147 | 3300009176 | Bacteria | 2442 |
| 143 | Ga0105242_10759942 | 3300009176 | Bacteria | 955 |
| 144 | Ga0105248_10078860 | 3300009177 | Bacteria | 3701 |
| 145 | Ga0105237_10019777 | 3300009545 | Bacteria | 6952 |
| 146 | Ga0105237_10028567 | 3300009545 | Bacteria | 5679 |
| 147 | Ga0105237_10086978 | 3300009545 | Bacteria | 3115 |
| 148 | Ga0105237_10169169 | 3300009545 | Bacteria | 2185 |
| 149 | Ga0105237_10307716 | 3300009545 | Bacteria | 1587 |
| 150 | Ga0105238_10005127 | 3300009551 | Bacteria | 12948 |
| 151 | Ga0105238_10071253 | 3300009551 | Bacteria | 3473 |
| 152 | Ga0105238_10166431 | 3300009551 | Bacteria | 2180 |
| 153 | Ga0105249_10090252 | 3300009553 | Bacteria | 2865 |
| 154 | Ga0105239_10028815 | 3300010375 | Bacteria | 6105 |
| 155 | Ga0105239_11423913 | 3300010375 | Bacteria | 800 |
| 156 | Ga0105246_10059543 | 3300011119 | Bacteria | 2650 |
| 157 | Ga0157317_1000267 | 3300012475 | Bacteria | 1968 |
| 158 | Ga0157319_1000052 | 3300012497 | Bacteria | 13081 |
| 159 | Ga0157373_10144252 | 3300013100 | Bacteria | 1674 |
| 160 | Ga0157373_10207412 | 3300013100 | Bacteria | 1382 |
| 161 | Ga0157370_10057901 | 3300013104 | Bacteria | 3683 |
| 162 | Ga0157370_10191350 | 3300013104 | Bacteria | 1899 |
| 163 | Ga0157370_10614920 | 3300013104 | Bacteria | 994 |
| 164 | Ga0157370_11100946 | 3300013104 | Bacteria | 718 |
| 165 | Ga0157369_10001141 | 3300013105 | Bacteria | 33176 |
| 166 | Ga0157369_10002876 | 3300013105 | Bacteria | 20563 |
| 167 | Ga0157369_10012544 | 3300013105 | Bacteria | 9615 |
| 168 | Ga0157374_10000065 | 3300013296 | Bacteria | 108630 |
| 169 | Ga0163162_10023284 | 3300013306 | Bacteria | 6111 |
| 170 | Ga0157372_10067178 | 3300013307 | Bacteria | 4029 |
| 171 | Ga0157372_10279224 | 3300013307 | Bacteria | 1942 |
| 172 | Ga0157372_10347106 | 3300013307 | Bacteria | 1729 |
| 173 | Ga0157372_10565912 | 3300013307 | Bacteria | 1325 |
| 174 | Ga0157377_10000013 | 3300014745 | Bacteria | 267125 |
| 175 | Ga0157379_10021990 | 3300014968 | Bacteria | 5651 |
| 176 | Ga0157376_10283990 | 3300014969 | Bacteria | 1560 |
| 177 | Ga0182006_1000004 | 3300015261 | Bacteria | 622190 |
| 178 | Ga0182006_1067610 | 3300015261 | Bacteria | 1333 |
| 179 | Ga0182007_10000018 | 3300015262 | Bacteria | 198916 |
| 180 | Ga0182007_10017713 | 3300015262 | Bacteria | 2594 |
| 181 | Ga0182005_1000011 | 3300015265 | Bacteria | 420605 |
| 182 | Ga0183361_10011 | 3300016635 | Bacteria | 203855 |
| 183 | Ga0206356_10023468 | 3300020070 | Bacteria | 869 |
| 184 | Ga0206350_10862829 | 3300020080 | Bacteria | 1431 |
| 185 | Ga0206350_11560598 | 3300020080 | Bacteria | 739 |
| 186 | Ga0206354_10894230 | 3300020081 | Bacteria | 2118 |
| 187 | Ga0206354_11516447 | 3300020081 | Bacteria | 2877 |
| 188 | Ga0206353_10753358 | 3300020082 | Bacteria | 2553 |
| 189 | Ga0213872_10054713 | 3300021361 | Bacteria | 1809 |
| 190 | Ga0224712_10000214 | 3300022467 | Bacteria | 10415 |
| 191 | Ga0209436_100900 | 3300025208 | Bacteria | 11803 |
| 192 | Ga0209436_102124 | 3300025208 | Bacteria | 6208 |
| 193 | Ga0209566_100398 | 3300025225 | Bacteria | 34826 |
| 194 | Ga0209566_106506 | 3300025225 | Bacteria | 1376 |
| 195 | Ga0209674_100022 | 3300025226 | Bacteria | 563656 |
| 196 | Ga0209674_100024 | 3300025226 | Bacteria | 535481 |
| 197 | Ga0209674_103180 | 3300025226 | Bacteria | 3114 |
| 198 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 199 | Ga0209672_100046 | 3300025228 | Bacteria | 264244 |
| 200 | Ga0209672_100047 | 3300025228 | Bacteria | 250925 |
| 201 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 202 | Ga0209147_100043 | 3300025229 | Bacteria | 300460 |
| 203 | Ga0209147_100059 | 3300025229 | Bacteria | 250891 |
| 204 | Ga0209147_100232 | 3300025229 | Bacteria | 55193 |
| 205 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 206 | Ga0209563_100069 | 3300025230 | Bacteria | 253154 |
| 207 | Ga0209563_101770 | 3300025230 | Bacteria | 5428 |
| 208 | Ga0207427_100301 | 3300025231 | Bacteria | 34522 |
| 209 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 210 | Ga0209258_100023 | 3300025242 | Bacteria | 547286 |
| 211 | Ga0209258_100172 | 3300025242 | Bacteria | 144895 |
| 212 | Ga0207425_1000006 | 3300025245 | Bacteria | 808854 |
| 213 | Ga0207425_1000650 | 3300025245 | Bacteria | 19214 |
| 214 | Ga0207425_1013432 | 3300025245 | Bacteria | 1892 |
| 215 | Ga0209677_100048 | 3300025253 | Bacteria | 183563 |
| 216 | Ga0209677_111551 | 3300025253 | Bacteria | 1370 |
| 217 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 218 | Ga0209148_1000029 | 3300025254 | Bacteria | 579199 |
| 219 | Ga0209148_1001548 | 3300025254 | Bacteria | 11145 |
| 220 | Ga0209148_1002649 | 3300025254 | Bacteria | 5796 |
| 221 | Ga0209759_1000319 | 3300025256 | Bacteria | 63833 |
| 222 | Ga0209759_1000413 | 3300025256 | Bacteria | 52782 |
| 223 | Ga0209759_1000530 | 3300025256 | Bacteria | 40498 |
| 224 | Ga0209759_1015128 | 3300025256 | Bacteria | 2004 |
| 225 | Ga0209129_1000090 | 3300025258 | Bacteria | 175755 |
| 226 | Ga0209233_1000061 | 3300025261 | Bacteria | 406211 |
| 227 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 228 | Ga0209565_1001548 | 3300025263 | Bacteria | 9864 |
| 229 | Ga0209565_1001935 | 3300025263 | Bacteria | 8135 |
| 230 | Ga0209565_1003489 | 3300025263 | Bacteria | 5061 |
| 231 | Ga0209565_1003552 | 3300025263 | Bacteria | 4994 |
| 232 | Ga0209565_1015077 | 3300025263 | Bacteria | 1752 |
| 233 | Ga0209565_1024467 | 3300025263 | Bacteria | 1229 |
| 234 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 235 | Ga0209455_1000064 | 3300025272 | Bacteria | 332404 |
| 236 | Ga0209455_1002194 | 3300025272 | Bacteria | 7728 |
| 237 | Ga0209673_1000019 | 3300025273 | Bacteria | 449094 |
| 238 | Ga0209673_1000115 | 3300025273 | Bacteria | 176939 |
| 239 | Ga0209673_1013401 | 3300025273 | Bacteria | 3237 |
| 240 | Ga0209673_1016521 | 3300025273 | Bacteria | 2754 |
| 241 | Ga0209673_1079363 | 3300025273 | Bacteria | 756 |
| 242 | Ga0209130_1000298 | 3300025284 | Bacteria | 60508 |
| 243 | Ga0209130_1000545 | 3300025284 | Bacteria | 37692 |
| 244 | Ga0209130_1006951 | 3300025284 | Bacteria | 3578 |
| 245 | Ga0209675_1000028 | 3300025291 | Bacteria | 281253 |
| 246 | Ga0209675_1002663 | 3300025291 | Bacteria | 9014 |
| 247 | Ga0209675_1004422 | 3300025291 | Bacteria | 6253 |
| 248 | Ga0209675_1009018 | 3300025291 | Bacteria | 3578 |
| 249 | Ga0209675_1011928 | 3300025291 | Bacteria | 2840 |
| 250 | Ga0209564_1000058 | 3300025295 | Bacteria | 332955 |
| 251 | Ga0209564_1000513 | 3300025295 | Bacteria | 63602 |
| 252 | Ga0209564_1003940 | 3300025295 | Bacteria | 9474 |
| 253 | Ga0209564_1012805 | 3300025295 | Bacteria | 3621 |
| 254 | Ga0209564_1013486 | 3300025295 | Bacteria | 3466 |
| 255 | Ga0209564_1022819 | 3300025295 | Bacteria | 2195 |
| 256 | Ga0209758_1000047 | 3300025297 | Bacteria | 360971 |
| 257 | Ga0209758_1072935 | 3300025297 | Bacteria | 1072 |
| 258 | Ga0209050_1000085 | 3300025298 | Bacteria | 263219 |
| 259 | Ga0209050_1000984 | 3300025298 | Bacteria | 36274 |
| 260 | Ga0209050_1001090 | 3300025298 | Bacteria | 32998 |
| 261 | Ga0209050_1002313 | 3300025298 | Bacteria | 16765 |
| 262 | Ga0209050_1003717 | 3300025298 | Bacteria | 10980 |
| 263 | Ga0209050_1004254 | 3300025298 | Bacteria | 9835 |
| 264 | Ga0209256_1000052 | 3300025299 | Bacteria | 299374 |
| 265 | Ga0209256_1000080 | 3300025299 | Bacteria | 224592 |
| 266 | Ga0209256_1000092 | 3300025299 | Bacteria | 210547 |
| 267 | Ga0209256_1001916 | 3300025299 | Bacteria | 19043 |
| 268 | Ga0209256_1004507 | 3300025299 | Bacteria | 8699 |
| 269 | Ga0209256_1004520 | 3300025299 | Bacteria | 8681 |
| 270 | Ga0209256_1005321 | 3300025299 | Bacteria | 7485 |
| 271 | Ga0207426_1000050 | 3300025302 | Bacteria | 393022 |
| 272 | Ga0207426_1002637 | 3300025302 | Bacteria | 11088 |
| 273 | Ga0209051_1002466 | 3300025303 | Bacteria | 13235 |
| 274 | Ga0209051_1002996 | 3300025303 | Bacteria | 11480 |
| 275 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 276 | Ga0209257_1002829 | 3300025304 | Bacteria | 16295 |
| 277 | Ga0209257_1005729 | 3300025304 | Bacteria | 8511 |
| 278 | Ga0209257_1006946 | 3300025304 | Bacteria | 7058 |
| 279 | Ga0209257_1019815 | 3300025304 | Bacteria | 2515 |
| 280 | Ga0207696_1015504 | 3300025711 | Bacteria | 2582 |
| 281 | Ga0207647_10001156 | 3300025904 | Bacteria | 20341 |
| 282 | Ga0207647_10018927 | 3300025904 | Bacteria | 4641 |
| 283 | Ga0207647_10039748 | 3300025904 | Bacteria | 2966 |
| 284 | Ga0207647_10095531 | 3300025904 | Bacteria | 1770 |
| 285 | Ga0207705_10001644 | 3300025909 | Bacteria | 17733 |
| 286 | Ga0207705_10009754 | 3300025909 | Bacteria | 6986 |
| 287 | Ga0207705_10409054 | 3300025909 | Bacteria | 1050 |
| 288 | Ga0207705_10488605 | 3300025909 | Bacteria | 956 |
| 289 | Ga0207684_10737214 | 3300025910 | Bacteria | 836 |
| 290 | Ga0207654_10047541 | 3300025911 | Bacteria | 2452 |
| 291 | Ga0207707_10220709 | 3300025912 | Bacteria | 1650 |
| 292 | Ga0207695_10004189 | 3300025913 | Bacteria | 19817 |
| 293 | Ga0207695_10004468 | 3300025913 | Bacteria | 19049 |
| 294 | Ga0207695_10019442 | 3300025913 | Bacteria | 7823 |
| 295 | Ga0207695_10030609 | 3300025913 | Bacteria | 5922 |
| 296 | Ga0207695_10288429 | 3300025913 | Bacteria | 1534 |
| 297 | Ga0207671_10007405 | 3300025914 | Bacteria | 9524 |
| 298 | Ga0207671_10016770 | 3300025914 | Bacteria | 5679 |
| 299 | Ga0207671_10099981 | 3300025914 | Bacteria | 2195 |
| 300 | Ga0207671_10160811 | 3300025914 | Bacteria | 1739 |
| 301 | Ga0207671_10266705 | 3300025914 | Bacteria | 1348 |
| 302 | Ga0207671_10288343 | 3300025914 | Bacteria | 1296 |
| 303 | Ga0207660_10155061 | 3300025917 | Bacteria | 1763 |
| 304 | Ga0207657_10000008 | 3300025919 | Bacteria | 189885 |
| 305 | Ga0207657_10000192 | 3300025919 | Bacteria | 63445 |
| 306 | Ga0207657_10021104 | 3300025919 | Bacteria | 6137 |
| 307 | Ga0207657_10144447 | 3300025919 | Bacteria | 1942 |
| 308 | Ga0207694_10012623 | 3300025924 | Bacteria | 6365 |
| 309 | Ga0207694_10113317 | 3300025924 | Bacteria | 2159 |
| 310 | Ga0207694_10185503 | 3300025924 | Bacteria | 1688 |
| 311 | Ga0207694_10244111 | 3300025924 | Bacteria | 1468 |
| 312 | Ga0207687_10373091 | 3300025927 | Bacteria | 1167 |
| 313 | Ga0207664_11127008 | 3300025929 | Bacteria | 701 |
| 314 | Ga0207690_10000013 | 3300025932 | Bacteria | 266156 |
| 315 | Ga0207690_10025017 | 3300025932 | Bacteria | 3745 |
| 316 | Ga0207690_10189329 | 3300025932 | Bacteria | 1555 |
| 317 | Ga0207706_10044176 | 3300025933 | Bacteria | 3950 |
| 318 | Ga0207706_10050822 | 3300025933 | Bacteria | 3662 |
| 319 | Ga0207706_10172071 | 3300025933 | Bacteria | 1903 |
| 320 | Ga0207706_10495620 | 3300025933 | Bacteria | 1055 |
| 321 | Ga0207706_10561211 | 3300025933 | Bacteria | 982 |
| 322 | Ga0207686_10017470 | 3300025934 | Bacteria | 4043 |
| 323 | Ga0207709_10008532 | 3300025935 | Bacteria | 5665 |
| 324 | Ga0207709_10010427 | 3300025935 | Bacteria | 5115 |
| 325 | Ga0207709_10436978 | 3300025935 | Bacteria | 1008 |
| 326 | Ga0207670_10060892 | 3300025936 | Bacteria | 2573 |
| 327 | Ga0207704_10063809 | 3300025938 | Bacteria | 2298 |
| 328 | Ga0207711_10216108 | 3300025941 | Bacteria | 1752 |
| 329 | Ga0207711_11185249 | 3300025941 | Bacteria | 705 |
| 330 | Ga0207689_10528010 | 3300025942 | Bacteria | 990 |
| 331 | Ga0207679_10000154 | 3300025945 | Bacteria | 56628 |
| 332 | Ga0207679_10064425 | 3300025945 | Bacteria | 2739 |
| 333 | Ga0207667_10000273 | 3300025949 | Bacteria | 71462 |
| 334 | Ga0207667_10003101 | 3300025949 | Bacteria | 20573 |
| 335 | Ga0207667_10009746 | 3300025949 | Bacteria | 11296 |
| 336 | Ga0207667_10015652 | 3300025949 | Bacteria | 8604 |
| 337 | Ga0207667_10039180 | 3300025949 | Bacteria | 5052 |
| 338 | Ga0207667_10064971 | 3300025949 | Bacteria | 3807 |
| 339 | Ga0207640_10973570 | 3300025981 | Bacteria | 745 |
| 340 | Ga0207658_10437472 | 3300025986 | Bacteria | 1156 |
| 341 | Ga0207703_10277059 | 3300026035 | Bacteria | 1522 |
| 342 | Ga0207639_10463346 | 3300026041 | Bacteria | 1153 |
| 343 | Ga0207639_10697764 | 3300026041 | Bacteria | 941 |
| 344 | Ga0207639_11206266 | 3300026041 | Bacteria | 710 |
| 345 | Ga0207678_10001041 | 3300026067 | Bacteria | 25323 |
| 346 | Ga0207678_10346232 | 3300026067 | Bacteria | 1281 |
| 347 | Ga0207678_10907369 | 3300026067 | Bacteria | 779 |
| 348 | Ga0207708_10123694 | 3300026075 | Bacteria | 2017 |
| 349 | Ga0207702_10184381 | 3300026078 | Bacteria | 1924 |
| 350 | Ga0207648_10000006 | 3300026089 | Bacteria | 223855 |
| 351 | Ga0207648_10107853 | 3300026089 | Bacteria | 2444 |
| 352 | Ga0207674_10188279 | 3300026116 | Bacteria | 2014 |
| 353 | Ga0207674_10322231 | 3300026116 | Bacteria | 1495 |
| 354 | Ga0207683_10168058 | 3300026121 | Bacteria | 1985 |
| 355 | Ga0207698_10011839 | 3300026142 | Bacteria | 5678 |
| 356 | Ga0207698_10043411 | 3300026142 | Bacteria | 3368 |
| 357 | Ga0207698_10142926 | 3300026142 | Bacteria | 2065 |
| 358 | Ga0207698_10167412 | 3300026142 | Bacteria | 1931 |
| 359 | Ga0207698_10660144 | 3300026142 | Bacteria | 1037 |
| 360 | Ga0209281_1000074 | 3300027111 | Bacteria | 267848 |
| 361 | Ga0209389_1000831 | 3300027296 | Bacteria | 19759 |
| 362 | Ga0209371_1000065 | 3300027312 | Bacteria | 214464 |
| 363 | Ga0209371_1015544 | 3300027312 | Bacteria | 2040 |
| 364 | Ga0209974_10005833 | 3300027876 | Bacteria | 4318 |
| 365 | Ga0268266_10017033 | 3300028379 | Bacteria | 6205 |
| 366 | Ga0268266_10034628 | 3300028379 | Bacteria | 4295 |
| 367 | Ga0268265_10929145 | 3300028380 | Bacteria | 856 |
| 368 | Ga0268264_10390059 | 3300028381 | Bacteria | 1336 |
| 369 | Ga0265338_10000022 | 3300028800 | Bacteria | 308414 |
| 370 | Ga0265338_10098424 | 3300028800 | Bacteria | 2393 |
| 371 | Ga0268256_1000118 | 3300030500 | Bacteria | 115175 |
| 372 | Ga0268256_1017243 | 3300030500 | Bacteria | 2040 |
| 373 | Ga0307511_10261041 | 3300030521 | Bacteria | 821 |
| 374 | Ga0316177_1005603 | 3300030731 | Bacteria | 5065 |
| 375 | Ga0316180_1057521 | 3300030736 | Bacteria | 2839 |
| 376 | Ga0316183_1006639 | 3300030742 | Bacteria | 769 |
| 377 | Ga0265340_10138979 | 3300031247 | Bacteria | 1111 |
| 378 | Ga0307509_10206247 | 3300031507 | Bacteria | 1796 |
| 379 | Ga0307408_100000191 | 3300031548 | Bacteria | 66129 |
| 380 | Ga0307408_100001241 | 3300031548 | Bacteria | 19160 |
| 381 | Ga0307408_100004007 | 3300031548 | Bacteria | 10040 |
| 382 | Ga0307408_100013788 | 3300031548 | Bacteria | 5366 |
| 383 | Ga0307408_100017461 | 3300031548 | Bacteria | 4802 |
| 384 | Ga0307408_100017765 | 3300031548 | Bacteria | 4766 |
| 385 | Ga0307516_10228823 | 3300031730 | Bacteria | 1564 |
| 386 | Ga0307405_10384582 | 3300031731 | Bacteria | 1093 |
| 387 | Ga0307412_10000003 | 3300031911 | Bacteria | 659081 |
| 388 | Ga0307409_100551558 | 3300031995 | Bacteria | 1131 |
| 389 | Ga0307411_10213387 | 3300032005 | Bacteria | 1492 |
| 390 | Ga0373959_0007713 | 3300034820 | Bacteria | 1814 |
| 391 | Ga0373934_0003204 | 3300035086 | Bacteria | 5982 |
| 392 | Ga0373949_0090496 | 3300035090 | Bacteria | 827 |
| 393 | Ga0373923_0289357 | 3300035111 | Bacteria | 773 |
| 394 | Ga0373932_0165776 | 3300035112 | Bacteria | 767 |
| 395 | Ga0373931_0000156 | 3300035691 | Bacteria | 29608 |
| 396 | Ga0373927_0699894 | 3300035695 | Bacteria | 669 |
| 397 | Ga0395899_0000041 | 3300037312 | Bacteria | 255615 |
| 398 | Ga0395899_0000141 | 3300037312 | Bacteria | 109773 |
| 399 | Ga0395899_0009226 | 3300037312 | Bacteria | 7576 |
| 400 | Ga0395899_0059143 | 3300037312 | Bacteria | 2825 |
| 401 | Ga0395899_0090836 | 3300037312 | Bacteria | 2213 |
| 402 | Ga0395900_0000077 | 3300037418 | Bacteria | 179525 |
| 403 | Ga0395900_0000097 | 3300037418 | Bacteria | 161598 |
| 404 | Ga0395900_0000550 | 3300037418 | Bacteria | 52140 |
| 405 | Ga0395900_0002226 | 3300037418 | Bacteria | 21642 |
| 406 | Ga0395900_0003642 | 3300037418 | Bacteria | 16564 |
| 407 | Ga0395900_0025526 | 3300037418 | Bacteria | 6049 |
| 408 | Ga0395900_0052880 | 3300037418 | Bacteria | 4181 |
| 409 | Ga0395900_0067410 | 3300037418 | Bacteria | 3677 |
| 410 | Ga0395900_0116663 | 3300037418 | Bacteria | 2739 |
| 411 | Ga0395900_0216592 | 3300037418 | Bacteria | 1932 |
| 412 | Ga0395898_0000322 | 3300037466 | Bacteria | 109324 |
| 413 | Ga0395898_0000936 | 3300037466 | Bacteria | 46540 |
| 414 | Ga0395898_0022797 | 3300037466 | Bacteria | 6335 |
| 415 | Ga0395898_0114762 | 3300037466 | Bacteria | 2580 |
| 416 | Ga0395905_0000041 | 3300037471 | Bacteria | 250958 |
| 417 | Ga0395905_0024802 | 3300037471 | Bacteria | 5659 |
| 418 | Ga0395905_0056095 | 3300037471 | Bacteria | 3687 |
| 419 | Ga0395905_0168542 | 3300037471 | Bacteria | 2057 |
| 420 | Ga0395905_0213943 | 3300037471 | Bacteria | 1805 |
| 421 | Ga0395905_0336528 | 3300037471 | Bacteria | 1400 |
| 422 | Ga0395905_0386112 | 3300037471 | Bacteria | 1294 |
| 423 | Ga0395901_0000011 | 3300038443 | Bacteria | 400724 |
| 424 | Ga0395901_0000073 | 3300038443 | Bacteria | 139769 |
| 425 | Ga0395901_0000085 | 3300038443 | Bacteria | 126093 |
| 426 | Ga0395901_0001346 | 3300038443 | Bacteria | 25770 |
| 427 | Ga0395901_0003050 | 3300038443 | Bacteria | 16874 |
| 428 | Ga0395901_0036048 | 3300038443 | Bacteria | 5111 |
| 429 | Ga0395901_0037810 | 3300038443 | Bacteria | 4991 |
| 430 | Ga0395901_0061473 | 3300038443 | Bacteria | 3908 |
| 431 | Ga0395901_0068282 | 3300038443 | Bacteria | 3703 |
| 432 | Ga0395901_0167462 | 3300038443 | Bacteria | 2306 |
| 433 | Ga0395901_0564311 | 3300038443 | Bacteria | 1152 |
| 434 | Ga0395901_1335662 | 3300038443 | Bacteria | 677 |
| 435 | Ga0436361_0126092 | 3300039447 | Bacteria | 1423 |
| 436 | Ga0436361_1083859 | 3300039447 | Bacteria | 2364 |
| 437 | Ga0451793_0939722 | 3300041452 | Bacteria | 1604 |
| 438 | Ga0451795_0434151 | 3300041456 | Bacteria | 735 |
| 439 | Ga0451795_0666079 | 3300041456 | Bacteria | 1176 |
| 440 | Ga0451839_0947087 | 3300041496 | Bacteria | 2146 |
| 441 | Ga0451853_0369105 | 3300041512 | Bacteria | 1662 |
| 442 | Ga0439448_0000195 | 3300042005 | Bacteria | 12572 |
| 443 | Ga0439448_0000244 | 3300042005 | Bacteria | 11662 |
| 444 | Ga0439448_0004918 | 3300042005 | Bacteria | 3793 |
| 445 | Ga0439449_0005188 | 3300042007 | Bacteria | 4999 |
| 446 | Ga0439454_039038 | 3300042011 | Bacteria | 771 |
| 447 | Ga0450890_000911 | 3300042127 | Bacteria | 4272 |
| 448 | Ga0466969_0000012 | 3300044656 | Bacteria | 112852 |
| 449 | Ga0466969_0002391 | 3300044656 | Bacteria | 10029 |
| 450 | Ga0466969_0017878 | 3300044656 | Bacteria | 3699 |
| 451 | Ga0466969_0020358 | 3300044656 | Bacteria | 3437 |
| 452 | Ga0466969_0269671 | 3300044656 | Bacteria | 771 |
| 453 | Ga0466972_0000760 | 3300044658 | Bacteria | 15365 |
| 454 | Ga0466972_0006233 | 3300044658 | Bacteria | 5992 |
| 455 | Ga0466972_0009161 | 3300044658 | Bacteria | 4972 |
| 456 | Ga0466972_0076166 | 3300044658 | Bacteria | 1598 |
| 457 | Ga0466972_0250372 | 3300044658 | Bacteria | 828 |
| 458 | Ga0453683_0017910 | 3300044673 | Bacteria | 4552 |
| 459 | Ga0466965_0008497 | 3300044683 | Bacteria | 4751 |
| 460 | Ga0466965_0008969 | 3300044683 | Bacteria | 4637 |
| 461 | Ga0466965_0055699 | 3300044683 | Bacteria | 1968 |
| 462 | Ga0466965_0218820 | 3300044683 | Bacteria | 1014 |
| 463 | Ga0466965_0314093 | 3300044683 | Bacteria | 852 |
| 464 | Ga0466966_0000002 | 3300044684 | Bacteria | 370962 |
| 465 | Ga0466966_0002140 | 3300044684 | Bacteria | 12803 |
| 466 | Ga0466966_0023672 | 3300044684 | Bacteria | 4019 |
| 467 | Ga0466966_0040218 | 3300044684 | Bacteria | 3009 |
| 468 | Ga0466966_0049870 | 3300044684 | Bacteria | 2664 |
| 469 | Ga0466966_0093158 | 3300044684 | Bacteria | 1868 |
| 470 | Ga0466966_0101132 | 3300044684 | Bacteria | 1783 |
| 471 | Ga0466961_0000216 | 3300044693 | Bacteria | 38914 |
| 472 | Ga0466961_0038598 | 3300044693 | Bacteria | 3063 |
| 473 | Ga0466961_0061806 | 3300044693 | Bacteria | 2380 |
| 474 | Ga0466961_0068379 | 3300044693 | Bacteria | 2255 |
| 475 | Ga0466961_0092592 | 3300044693 | Bacteria | 1907 |
| 476 | Ga0466963_0005544 | 3300044694 | Bacteria | 7393 |
| 477 | Ga0466963_0008787 | 3300044694 | Bacteria | 6068 |
| 478 | Ga0466963_0016633 | 3300044694 | Bacteria | 4576 |
| 479 | Ga0466963_0024293 | 3300044694 | Bacteria | 3858 |
| 480 | Ga0466964_0002313 | 3300044706 | Bacteria | 6758 |
| 481 | Ga0466964_0014215 | 3300044706 | Bacteria | 3025 |
| 482 | Ga0466964_0025490 | 3300044706 | Bacteria | 2309 |
| 483 | Ga0466964_0036416 | 3300044706 | Bacteria | 1973 |
| 484 | Ga0466964_0309049 | 3300044706 | Bacteria | 799 |
| 485 | Ga0453684_0122487 | 3300044712 | Bacteria | 3137 |
| 486 | Ga0453684_0292543 | 3300044712 | Bacteria | 1854 |
| 487 | Ga0453684_0446303 | 3300044712 | Bacteria | 1441 |
| 488 | Ga0466971_0000120 | 3300044719 | Bacteria | 28491 |
| 489 | Ga0466971_0039849 | 3300044719 | Bacteria | 2109 |
| 490 | Ga0466971_0047894 | 3300044719 | Bacteria | 1921 |
| 491 | Ga0466971_0048658 | 3300044719 | Bacteria | 1906 |
| 492 | Ga0466971_0095050 | 3300044719 | Bacteria | 1366 |
| 493 | Ga0466971_0117173 | 3300044719 | Bacteria | 1231 |
| 494 | Ga0466968_0018603 | 3300044735 | Bacteria | 2788 |
| 495 | Ga0466968_0142204 | 3300044735 | Bacteria | 1098 |
| 496 | Ga0466970_0004957 | 3300044765 | Bacteria | 6576 |
| 497 | Ga0466970_0010359 | 3300044765 | Bacteria | 4732 |
| 498 | Ga0466957_0001745 | 3300044842 | Bacteria | 11435 |
| 499 | Ga0466957_0004724 | 3300044842 | Bacteria | 7627 |
| 500 | Ga0466957_0017328 | 3300044842 | Bacteria | 4217 |
| 501 | Ga0466957_0032879 | 3300044842 | Bacteria | 3108 |
| 502 | Ga0466957_0037922 | 3300044842 | Bacteria | 2902 |
| 503 | Ga0466957_0042723 | 3300044842 | Bacteria | 2743 |
| 504 | Ga0466957_0043930 | 3300044842 | Bacteria | 2707 |
| 505 | Ga0466957_0074413 | 3300044842 | Bacteria | 2106 |
| 506 | Ga0466957_0233434 | 3300044842 | Bacteria | 1218 |
| 507 | Ga0466960_0114817 | 3300044901 | Bacteria | 1403 |
| 508 | Ga0466959_0010555 | 3300045049 | Bacteria | 6610 |
| 509 | Ga0466959_0010571 | 3300045049 | Bacteria | 6606 |
| 510 | Ga0466959_0039405 | 3300045049 | Bacteria | 3491 |
| 511 | Ga0466959_0044170 | 3300045049 | Bacteria | 3283 |
| 512 | Ga0466959_0151332 | 3300045049 | Bacteria | 1635 |
| 513 | Ga0466959_0191674 | 3300045049 | Bacteria | 1426 |
| 514 | Ga0466959_0584934 | 3300045049 | Bacteria | 751 |
| 515 | Ga0451576_0006412 | 3300045051 | Bacteria | 14432 |
| 516 | Ga0451576_0716641 | 3300045051 | Bacteria | 1051 |
| 517 | Ga0466958_0003491 | 3300045836 | Bacteria | 8163 |
| 518 | Ga0466958_0016956 | 3300045836 | Bacteria | 4201 |
| 519 | Ga0466958_0020856 | 3300045836 | Bacteria | 3824 |
| 520 | Ga0466958_0045715 | 3300045836 | Bacteria | 2642 |
| 521 | Ga0466958_0087507 | 3300045836 | Bacteria | 1923 |
| 522 | Ga0466958_0293869 | 3300045836 | Bacteria | 1042 |
| 523 | Ga0466958_0381281 | 3300045836 | Bacteria | 909 |
| 524 | Ga0466967_0011397 | 3300045976 | Bacteria | 6732 |
| 525 | Ga0466967_0115857 | 3300045976 | Bacteria | 2468 |
| 526 | Ga0466967_0298917 | 3300045976 | Bacteria | 1548 |
| 527 | Ga0466967_1313534 | 3300045976 | Bacteria | 720 |
| 528 | Ga0495617_003209 | 3300046452 | Bacteria | 6212 |
| 529 | Ga0495627_023015 | 3300046453 | Bacteria | 2045 |
| 530 | Ga0495592_0062776 | 3300046454 | Bacteria | 2726 |
| 531 | Ga0495592_0123363 | 3300046454 | Bacteria | 1820 |
| 532 | Ga0495603_0012122 | 3300046455 | Bacteria | 5221 |
| 533 | Ga0495603_0142185 | 3300046455 | Bacteria | 1395 |
| 534 | Ga0495590_0011958 | 3300046457 | Bacteria | 3231 |
| 535 | Ga0495590_0025976 | 3300046457 | Bacteria | 2057 |
| 536 | Ga0495590_0028459 | 3300046457 | Bacteria | 1960 |
| 537 | Ga0495590_0198633 | 3300046457 | Bacteria | 736 |
| 538 | Ga0495591_000678 | 3300046458 | Bacteria | 24894 |
| 539 | Ga0495629_0000289 | 3300046459 | Bacteria | 43521 |
| 540 | Ga0495629_0001153 | 3300046459 | Bacteria | 20873 |
| 541 | Ga0495629_0012599 | 3300046459 | Bacteria | 6123 |
| 542 | Ga0495629_0017439 | 3300046459 | Bacteria | 5145 |
| 543 | Ga0495638_0018569 | 3300046460 | Bacteria | 4615 |
| 544 | Ga0495638_0112548 | 3300046460 | Bacteria | 1615 |
| 545 | Ga0495638_0159117 | 3300046460 | Bacteria | 1304 |
| 546 | Ga0495641_0025926 | 3300046461 | Bacteria | 2870 |
| 547 | Ga0495641_0069470 | 3300046461 | Bacteria | 1583 |
| 548 | Ga0495651_0003781 | 3300046462 | Bacteria | 11579 |
| 549 | Ga0495651_0200354 | 3300046462 | Bacteria | 1397 |
| 550 | Ga0495653_0002090 | 3300046463 | Bacteria | 15731 |
| 551 | Ga0495653_0024301 | 3300046463 | Bacteria | 4885 |
| 552 | Ga0495653_0062635 | 3300046463 | Bacteria | 2809 |
| 553 | Ga0495653_0083700 | 3300046463 | Bacteria | 2351 |
| 554 | Ga0495650_0005534 | 3300046471 | Bacteria | 8163 |
| 555 | Ga0495650_0028202 | 3300046471 | Bacteria | 2582 |
| 556 | Ga0495650_0187643 | 3300046471 | Bacteria | 724 |
| 557 | Ga0495650_0215024 | 3300046471 | Bacteria | 664 |
| 558 | Ga0495580_0000785 | 3300046472 | Bacteria | 27394 |
| 559 | Ga0495580_0000899 | 3300046472 | Bacteria | 25893 |
| 560 | Ga0495580_0003519 | 3300046472 | Bacteria | 13308 |
| 561 | Ga0495580_0010528 | 3300046472 | Bacteria | 7199 |
| 562 | Ga0495580_0038890 | 3300046472 | Bacteria | 3404 |
| 563 | Ga0495580_0053930 | 3300046472 | Bacteria | 2836 |
| 564 | Ga0495580_0057248 | 3300046472 | Bacteria | 2744 |
| 565 | Ga0495582_0003362 | 3300046473 | Bacteria | 8998 |
| 566 | Ga0495582_0011259 | 3300046473 | Bacteria | 4928 |
| 567 | Ga0495582_0079755 | 3300046473 | Bacteria | 1817 |
| 568 | Ga0495605_0001707 | 3300046474 | Bacteria | 14089 |
| 569 | Ga0495605_0004905 | 3300046474 | Bacteria | 7819 |
| 570 | Ga0495605_0011963 | 3300046474 | Bacteria | 4824 |
| 571 | Ga0495605_0012750 | 3300046474 | Bacteria | 4654 |
| 572 | Ga0495605_0013772 | 3300046474 | Bacteria | 4445 |
| 573 | Ga0495605_0095567 | 3300046474 | Bacteria | 1371 |
| 574 | Ga0495605_0163543 | 3300046474 | Bacteria | 987 |
| 575 | Ga0495662_0004969 | 3300046476 | Bacteria | 6657 |
| 576 | Ga0495662_0115312 | 3300046476 | Bacteria | 1317 |
| 577 | Ga0495664_0004903 | 3300046477 | Bacteria | 7319 |
| 578 | Ga0495664_0007151 | 3300046477 | Bacteria | 6186 |
| 579 | Ga0495664_0007967 | 3300046477 | Bacteria | 5899 |
| 580 | Ga0495664_0111909 | 3300046477 | Bacteria | 1648 |
| 581 | Ga0495664_0250483 | 3300046477 | Bacteria | 1071 |
| 582 | Ga0495584_0000010 | 3300046491 | Bacteria | 225095 |
| 583 | Ga0495584_0000095 | 3300046491 | Bacteria | 60048 |
| 584 | Ga0495584_0006618 | 3300046491 | Bacteria | 6056 |
| 585 | Ga0495584_0007580 | 3300046491 | Bacteria | 5658 |
| 586 | Ga0495584_0037281 | 3300046491 | Bacteria | 2456 |
| 587 | Ga0495584_0155223 | 3300046491 | Bacteria | 1163 |
| 588 | Ga0495585_0000004 | 3300046492 | Bacteria | 348260 |
| 589 | Ga0495585_0000172 | 3300046492 | Bacteria | 69900 |
| 590 | Ga0495585_0000428 | 3300046492 | Bacteria | 40340 |
| 591 | Ga0495585_0006668 | 3300046492 | Bacteria | 7132 |
| 592 | Ga0495585_0013177 | 3300046492 | Bacteria | 4844 |
| 593 | Ga0495585_0022088 | 3300046492 | Bacteria | 3652 |
| 594 | Ga0495585_0039342 | 3300046492 | Bacteria | 2659 |
| 595 | Ga0495585_0046432 | 3300046492 | Bacteria | 2422 |
| 596 | Ga0495594_0187781 | 3300046499 | Bacteria | 1177 |
| 597 | Ga0495596_0008490 | 3300046500 | Bacteria | 4570 |
| 598 | Ga0495596_0011774 | 3300046500 | Bacteria | 3757 |
| 599 | Ga0495596_0012381 | 3300046500 | Bacteria | 3653 |
| 600 | Ga0495596_0071153 | 3300046500 | Bacteria | 1351 |
| 601 | Ga0495607_0000653 | 3300046501 | Bacteria | 33707 |
| 602 | Ga0495607_0001362 | 3300046501 | Bacteria | 21779 |
| 603 | Ga0495607_0022033 | 3300046501 | Bacteria | 4005 |
| 604 | Ga0495607_0025850 | 3300046501 | Bacteria | 3647 |
| 605 | Ga0495607_0054685 | 3300046501 | Bacteria | 2299 |
| 606 | Ga0495607_0212174 | 3300046501 | Bacteria | 952 |
| 607 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 608 | Ga0495583_0000022 | 3300046506 | Bacteria | 282544 |
| 609 | Ga0495583_0000067 | 3300046506 | Bacteria | 189381 |
| 610 | Ga0495583_0000536 | 3300046506 | Bacteria | 53700 |
| 611 | Ga0495583_0008806 | 3300046506 | Bacteria | 6116 |
| 612 | Ga0495583_0010345 | 3300046506 | Bacteria | 5447 |
| 613 | Ga0495583_0057132 | 3300046506 | Bacteria | 1756 |
| 614 | Ga0495606_0002047 | 3300046507 | Bacteria | 24702 |
| 615 | Ga0495606_0010757 | 3300046507 | Bacteria | 7543 |
| 616 | Ga0495606_0011903 | 3300046507 | Bacteria | 7037 |
| 617 | Ga0495606_0031765 | 3300046507 | Bacteria | 3666 |
| 618 | Ga0495606_0033519 | 3300046507 | Bacteria | 3541 |
| 619 | Ga0495606_0054139 | 3300046507 | Bacteria | 2599 |
| 620 | Ga0495606_0193753 | 3300046507 | Bacteria | 1163 |
| 621 | Ga0495608_0023931 | 3300046511 | Bacteria | 4178 |
| 622 | Ga0495608_0031178 | 3300046511 | Bacteria | 3605 |
| 623 | Ga0495610_0000621 | 3300046512 | Bacteria | 35096 |
| 624 | Ga0495616_0000214 | 3300046513 | Bacteria | 48126 |
| 625 | Ga0495616_0001258 | 3300046513 | Bacteria | 17834 |
| 626 | Ga0495616_0006240 | 3300046513 | Bacteria | 7244 |
| 627 | Ga0495616_0057539 | 3300046513 | Bacteria | 1917 |
| 628 | Ga0495618_0003432 | 3300046514 | Bacteria | 9853 |
| 629 | Ga0495618_0037718 | 3300046514 | Bacteria | 3036 |
| 630 | Ga0495620_0014167 | 3300046515 | Bacteria | 4061 |
| 631 | Ga0495620_0054381 | 3300046515 | Bacteria | 1691 |
| 632 | Ga0495628_0006759 | 3300046516 | Bacteria | 9986 |
| 633 | Ga0495628_0007278 | 3300046516 | Bacteria | 9590 |
| 634 | Ga0495628_0039972 | 3300046516 | Bacteria | 3750 |
| 635 | Ga0495628_0084151 | 3300046516 | Bacteria | 2468 |
| 636 | Ga0495628_0190042 | 3300046516 | Bacteria | 1550 |
| 637 | Ga0495628_0224279 | 3300046516 | Bacteria | 1410 |
| 638 | Ga0495630_0008019 | 3300046517 | Bacteria | 7587 |
| 639 | Ga0495630_0022291 | 3300046517 | Bacteria | 4678 |
| 640 | Ga0495630_0024879 | 3300046517 | Bacteria | 4426 |
| 641 | Ga0495630_0038505 | 3300046517 | Bacteria | 3576 |
| 642 | Ga0495631_0010394 | 3300046518 | Bacteria | 4606 |
| 643 | Ga0495631_0243709 | 3300046518 | Bacteria | 766 |
| 644 | Ga0495632_0003651 | 3300046519 | Bacteria | 10799 |
| 645 | Ga0495643_0050494 | 3300046522 | Bacteria | 2240 |
| 646 | Ga0495643_0059604 | 3300046522 | Bacteria | 2028 |
| 647 | Ga0495643_0088701 | 3300046522 | Bacteria | 1598 |
| 648 | Ga0495644_0009116 | 3300046523 | Bacteria | 3822 |
| 649 | Ga0495644_0011074 | 3300046523 | Bacteria | 3476 |
| 650 | Ga0495648_0000044 | 3300046524 | Bacteria | 175587 |
| 651 | Ga0495648_0001359 | 3300046524 | Bacteria | 24164 |
| 652 | Ga0495648_0007602 | 3300046524 | Bacteria | 8654 |
| 653 | Ga0495648_0014426 | 3300046524 | Bacteria | 5786 |
| 654 | Ga0495648_0031864 | 3300046524 | Bacteria | 3467 |
| 655 | Ga0495663_0004270 | 3300046525 | Bacteria | 4027 |
| 656 | Ga0495663_0004892 | 3300046525 | Bacteria | 3744 |
| 657 | Ga0495666_0005409 | 3300046526 | Bacteria | 6433 |
| 658 | Ga0495666_0022038 | 3300046526 | Bacteria | 3154 |
| 659 | Ga0495666_0050857 | 3300046526 | Bacteria | 1991 |
| 660 | Ga0495666_0118938 | 3300046526 | Bacteria | 1238 |
| 661 | Ga0495642_0002219 | 3300046528 | Bacteria | 7954 |
| 662 | Ga0495642_0003835 | 3300046528 | Bacteria | 5894 |
| 663 | Ga0495652_0048168 | 3300046529 | Bacteria | 3653 |
| 664 | Ga0495652_0215171 | 3300046529 | Bacteria | 1447 |
| 665 | Ga0495652_0227953 | 3300046529 | Bacteria | 1395 |
| 666 | Ga0495654_0041308 | 3300046530 | Bacteria | 2294 |
| 667 | Ga0495654_0115427 | 3300046530 | Bacteria | 1221 |
| 668 | Ga0495665_0004142 | 3300046531 | Bacteria | 7820 |
| 669 | Ga0495665_0034113 | 3300046531 | Bacteria | 2721 |
| 670 | Ga0495665_0048002 | 3300046531 | Bacteria | 2264 |
| 671 | Ga0495665_0067759 | 3300046531 | Bacteria | 1882 |
| 672 | Ga0495640_0030009 | 3300046533 | Bacteria | 3897 |
| 673 | Ga0495640_0031099 | 3300046533 | Bacteria | 3813 |
| 674 | Ga0495640_0052392 | 3300046533 | Bacteria | 2802 |
| 675 | Ga0495586_0008431 | 3300046535 | Bacteria | 5486 |
| 676 | Ga0495586_0013861 | 3300046535 | Bacteria | 4277 |
| 677 | Ga0495587_0000965 | 3300046536 | Bacteria | 18815 |
| 678 | Ga0495587_0004819 | 3300046536 | Bacteria | 8861 |
| 679 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 680 | Ga0495609_0001124 | 3300046538 | Bacteria | 18539 |
| 681 | Ga0495609_0008848 | 3300046538 | Bacteria | 4901 |
| 682 | Ga0495609_0020599 | 3300046538 | Bacteria | 3046 |
| 683 | Ga0495609_0021029 | 3300046538 | Bacteria | 3011 |
| 684 | Ga0495609_0021833 | 3300046538 | Bacteria | 2952 |
| 685 | Ga0495597_0002364 | 3300046542 | Bacteria | 12110 |
| 686 | Ga0495597_0015402 | 3300046542 | Bacteria | 3621 |
| 687 | Ga0495645_0022630 | 3300046543 | Bacteria | 4548 |
| 688 | Ga0495645_0028042 | 3300046543 | Bacteria | 4091 |
| 689 | Ga0495645_0058386 | 3300046543 | Bacteria | 2799 |
| 690 | Ga0495622_0000241 | 3300046557 | Bacteria | 42689 |
| 691 | Ga0495622_0022112 | 3300046557 | Bacteria | 2963 |
| 692 | Ga0495633_0000204 | 3300046558 | Bacteria | 75182 |
| 693 | Ga0495633_0001422 | 3300046558 | Bacteria | 18622 |
| 694 | Ga0495633_0002751 | 3300046558 | Bacteria | 12161 |
| 695 | Ga0495633_0005172 | 3300046558 | Bacteria | 8069 |
| 696 | Ga0495633_0005664 | 3300046558 | Bacteria | 7562 |
| 697 | Ga0495633_0031836 | 3300046558 | Bacteria | 2552 |
| 698 | Ga0495633_0146743 | 3300046558 | Bacteria | 1090 |
| 699 | Ga0495656_0007691 | 3300046615 | Bacteria | 3821 |
| 700 | Ga0495656_0007894 | 3300046615 | Bacteria | 3782 |
| 701 | Ga0495656_0013063 | 3300046615 | Bacteria | 3079 |
| 702 | Ga0495656_0029284 | 3300046615 | Bacteria | 2216 |
| 703 | Ga0495656_0449767 | 3300046615 | Bacteria | 678 |
| 704 | Ga0495668_0002694 | 3300046616 | Bacteria | 14248 |
| 705 | Ga0495668_0029337 | 3300046616 | Bacteria | 3108 |
| 706 | Ga0495634_0009942 | 3300046642 | Bacteria | 6991 |
| 707 | Ga0495634_0027206 | 3300046642 | Bacteria | 3979 |
| 708 | Ga0495634_0111377 | 3300046642 | Bacteria | 1760 |
| 709 | Ga0495611_0001009 | 3300046648 | Bacteria | 14914 |
| 710 | Ga0495611_0005235 | 3300046648 | Bacteria | 5555 |
| 711 | Ga0495611_0024774 | 3300046648 | Bacteria | 2611 |
| 712 | Ga0495625_0005030 | 3300046660 | Bacteria | 12268 |
| 713 | Ga0495625_0014975 | 3300046660 | Bacteria | 6162 |
| 714 | Ga0495625_0017139 | 3300046660 | Bacteria | 5675 |
| 715 | Ga0495625_0104994 | 3300046660 | Bacteria | 1936 |
| 716 | Ga0495635_0008829 | 3300046663 | Bacteria | 7039 |
| 717 | Ga0495635_0028617 | 3300046663 | Bacteria | 3873 |
| 718 | Ga0495635_0030983 | 3300046663 | Bacteria | 3715 |
| 719 | Ga0495659_0000052 | 3300046664 | Bacteria | 52258 |
| 720 | Ga0495659_0133641 | 3300046664 | Bacteria | 985 |
| 721 | Ga0495661_0000251 | 3300046665 | Bacteria | 61803 |
| 722 | Ga0495661_0006759 | 3300046665 | Bacteria | 8042 |
| 723 | Ga0495661_0009400 | 3300046665 | Bacteria | 6710 |
| 724 | Ga0495661_0030658 | 3300046665 | Bacteria | 3421 |
| 725 | Ga0495661_0123379 | 3300046665 | Bacteria | 1428 |
| 726 | Ga0495661_0164970 | 3300046665 | Bacteria | 1186 |
| 727 | Ga0495661_0231762 | 3300046665 | Bacteria | 952 |
| 728 | Ga0495588_0000226 | 3300046674 | Bacteria | 51538 |
| 729 | Ga0495588_0235313 | 3300046674 | Bacteria | 966 |
| 730 | Ga0495657_0007993 | 3300046675 | Bacteria | 8110 |
| 731 | Ga0495657_0375442 | 3300046675 | Bacteria | 839 |
| 732 | Ga0495599_0002021 | 3300046678 | Bacteria | 11735 |
| 733 | Ga0495599_0008761 | 3300046678 | Bacteria | 6159 |
| 734 | Ga0495599_0034002 | 3300046678 | Bacteria | 3204 |
| 735 | Ga0495599_0040553 | 3300046678 | Bacteria | 2923 |
| 736 | Ga0495623_0014419 | 3300046679 | Bacteria | 5115 |
| 737 | Ga0495623_0117422 | 3300046679 | Bacteria | 1606 |
| 738 | Ga0495623_0139371 | 3300046679 | Bacteria | 1444 |
| 739 | Ga0495646_0012249 | 3300046680 | Bacteria | 5452 |
| 740 | Ga0495646_0026741 | 3300046680 | Bacteria | 3621 |
| 741 | Ga0495646_0026937 | 3300046680 | Bacteria | 3608 |
| 742 | Ga0495646_0038883 | 3300046680 | Bacteria | 2935 |
| 743 | Ga0495646_0135293 | 3300046680 | Bacteria | 1383 |
| 744 | Ga0495669_0030303 | 3300046684 | Bacteria | 2375 |
| 745 | Ga0495613_0004889 | 3300046689 | Bacteria | 10065 |
| 746 | Ga0495613_0007176 | 3300046689 | Bacteria | 8299 |
| 747 | Ga0495613_0114124 | 3300046689 | Bacteria | 1945 |
| 748 | Ga0495624_0024355 | 3300046690 | Bacteria | 3983 |
| 749 | Ga0495624_0040141 | 3300046690 | Bacteria | 2998 |
| 750 | Ga0495624_0122973 | 3300046690 | Bacteria | 1593 |
| 751 | Ga0495670_0005679 | 3300046691 | Bacteria | 6116 |
| 752 | Ga0495670_0014121 | 3300046691 | Bacteria | 3930 |
| 753 | Ga0495671_0000128 | 3300046692 | Bacteria | 68354 |
| 754 | Ga0495671_0006426 | 3300046692 | Bacteria | 6786 |
| 755 | Ga0495671_0419351 | 3300046692 | Bacteria | 640 |
| 756 | Ga0495649_0001087 | 3300046694 | Bacteria | 21193 |
| 757 | Ga0495649_0006900 | 3300046694 | Bacteria | 7027 |
| 758 | Ga0495649_0007468 | 3300046694 | Bacteria | 6659 |
| 759 | Ga0495649_0108334 | 3300046694 | Bacteria | 1474 |
| 760 | Ga0495649_0135350 | 3300046694 | Bacteria | 1299 |
| 761 | Ga0495649_0304924 | 3300046694 | Bacteria | 810 |
| 762 | Ga0495589_0000030 | 3300046794 | Bacteria | 170254 |
| 763 | Ga0495589_0001930 | 3300046794 | Bacteria | 11741 |
| 764 | Ga0495589_0004662 | 3300046794 | Bacteria | 7282 |
| 765 | Ga0495589_0007857 | 3300046794 | Bacteria | 5583 |
| 766 | Ga0495589_0074780 | 3300046794 | Bacteria | 1652 |
| 767 | Ga0495600_0002396 | 3300046809 | Bacteria | 10740 |
| 768 | Ga0495600_0086790 | 3300046809 | Bacteria | 2041 |
| 769 | Ga0495600_0270310 | 3300046809 | Bacteria | 1078 |
| 770 | Ga0495660_0001867 | 3300046810 | Bacteria | 13830 |
| 771 | Ga0495660_0002717 | 3300046810 | Bacteria | 11176 |
| 772 | Ga0495660_0003009 | 3300046810 | Bacteria | 10514 |
| 773 | Ga0495660_0225007 | 3300046810 | Bacteria | 882 |
| 774 | Ga0495581_0003096 | 3300047315 | Bacteria | 9518 |
| 775 | Ga0495581_0003171 | 3300047315 | Bacteria | 9413 |
| 776 | Ga0495581_0039551 | 3300047315 | Bacteria | 2730 |
| 777 | Ga0495604_0003807 | 3300047317 | Bacteria | 12012 |
| 778 | Ga0495604_0117842 | 3300047317 | Bacteria | 1925 |
| 779 | Ga0495604_0177227 | 3300047317 | Bacteria | 1493 |
| 780 | Ga0495604_0323313 | 3300047317 | Bacteria | 1030 |
| 781 | Ga0495636_0000126 | 3300047318 | Bacteria | 31355 |
| 782 | Ga0495636_0021985 | 3300047318 | Bacteria | 2577 |
| 783 | Ga0495674_0083335 | 3300047319 | Bacteria | 2741 |
| 784 | Ga0495674_0084835 | 3300047319 | Bacteria | 2713 |
| 785 | Ga0495674_0104554 | 3300047319 | Bacteria | 2407 |
| 786 | Ga0495674_0109533 | 3300047319 | Bacteria | 2342 |
| 787 | Ga0495674_0116104 | 3300047319 | Bacteria | 2264 |
| 788 | Ga0495674_0217724 | 3300047319 | Bacteria | 1579 |
| 789 | Ga0495672_0000005 | 3300047320 | Bacteria | 593294 |
| 790 | Ga0495672_0000066 | 3300047320 | Bacteria | 193318 |
| 791 | Ga0495672_0003903 | 3300047320 | Bacteria | 12514 |
| 792 | Ga0495672_0013035 | 3300047320 | Bacteria | 5754 |
| 793 | Ga0495672_0021078 | 3300047320 | Bacteria | 4255 |
| 794 | Ga0495672_0024467 | 3300047320 | Bacteria | 3888 |
| 795 | Ga0495672_0067195 | 3300047320 | Bacteria | 2042 |
| 796 | Ga0495672_0108195 | 3300047320 | Bacteria | 1496 |
| 797 | Ga0495672_0140951 | 3300047320 | Bacteria | 1259 |
| 798 | Ga0495676_0026137 | 3300047321 | Bacteria | 5029 |
| 799 | Ga0495676_0140261 | 3300047321 | Bacteria | 1733 |
| 800 | Ga0495676_0144711 | 3300047321 | Bacteria | 1699 |
| 801 | Ga0495676_0198191 | 3300047321 | Bacteria | 1396 |
| 802 | Ga0495680_0002192 | 3300047322 | Bacteria | 20217 |
| 803 | Ga0495680_0027643 | 3300047322 | Bacteria | 4657 |
| 804 | Ga0495680_0196824 | 3300047322 | Bacteria | 1447 |
| 805 | Ga0495680_0294986 | 3300047322 | Bacteria | 1139 |
| 806 | Ga0495683_0000157 | 3300047323 | Bacteria | 66884 |
| 807 | Ga0495683_0001712 | 3300047323 | Bacteria | 13911 |
| 808 | Ga0495683_0002800 | 3300047323 | Bacteria | 10350 |
| 809 | Ga0495683_0006507 | 3300047323 | Bacteria | 6381 |
| 810 | Ga0495683_0006618 | 3300047323 | Bacteria | 6319 |
| 811 | Ga0495683_0014609 | 3300047323 | Bacteria | 4091 |
| 812 | Ga0495683_0016862 | 3300047323 | Bacteria | 3791 |
| 813 | Ga0495683_0031089 | 3300047323 | Bacteria | 2721 |
| 814 | Ga0495687_000047 | 3300047443 | Bacteria | 206452 |
| 815 | Ga0495687_000095 | 3300047443 | Bacteria | 134456 |
| 816 | Ga0495687_000112 | 3300047443 | Bacteria | 124725 |
| 817 | Ga0495687_001241 | 3300047443 | Bacteria | 24342 |
| 818 | Ga0495687_018969 | 3300047443 | Bacteria | 3386 |
| 819 | Ga0495687_038722 | 3300047443 | Bacteria | 2114 |
| 820 | Ga0495687_149089 | 3300047443 | Bacteria | 802 |
| 821 | Ga0495675_0007329 | 3300047444 | Bacteria | 6797 |
| 822 | Ga0495675_0009649 | 3300047444 | Bacteria | 6012 |
| 823 | Ga0495675_0020246 | 3300047444 | Bacteria | 4229 |
| 824 | Ga0495677_0000052 | 3300047445 | Bacteria | 66870 |
| 825 | Ga0495677_0004589 | 3300047445 | Bacteria | 5276 |
| 826 | Ga0495677_0009036 | 3300047445 | Bacteria | 3686 |
| 827 | Ga0495677_0009136 | 3300047445 | Bacteria | 3662 |
| 828 | Ga0495677_0156873 | 3300047445 | Bacteria | 877 |
| 829 | Ga0495679_000054 | 3300047446 | Bacteria | 114312 |
| 830 | Ga0495679_001272 | 3300047446 | Bacteria | 14815 |
| 831 | Ga0495679_009408 | 3300047446 | Bacteria | 3911 |
| 832 | Ga0495685_000011 | 3300047447 | Bacteria | 83484 |
| 833 | Ga0495673_0011344 | 3300047469 | Bacteria | 4798 |
| 834 | Ga0495673_0014493 | 3300047469 | Bacteria | 4096 |
| 835 | Ga0495673_0018286 | 3300047469 | Bacteria | 3538 |
| 836 | Ga0495681_0016210 | 3300047470 | Bacteria | 4190 |
| 837 | Ga0495681_0047211 | 3300047470 | Bacteria | 2050 |
| 838 | Ga0495681_0075188 | 3300047470 | Bacteria | 1521 |
| 839 | Ga0495684_0069604 | 3300047471 | Bacteria | 2675 |
| 840 | Ga0495684_0212090 | 3300047471 | Bacteria | 1423 |
| 841 | Ga0495686_0000012 | 3300047472 | Bacteria | 508428 |
| 842 | Ga0495686_0000658 | 3300047472 | Bacteria | 46922 |
| 843 | Ga0495686_0014289 | 3300047472 | Bacteria | 5470 |
| 844 | Ga0495686_0052100 | 3300047472 | Bacteria | 2566 |
| 845 | Ga0495686_0123933 | 3300047472 | Bacteria | 1538 |
| 846 | Ga0495686_0161251 | 3300047472 | Bacteria | 1310 |
| 847 | Ga0495593_0001554 | 3300047673 | Bacteria | 13534 |
| 848 | Ga0495593_0004656 | 3300047673 | Bacteria | 8156 |
| 849 | Ga0495593_0005157 | 3300047673 | Bacteria | 7721 |
| 850 | Ga0495593_0013844 | 3300047673 | Bacteria | 4595 |
| 851 | Ga0495602_0012381 | 3300048088 | Bacteria | 8772 |
| 852 | Ga0495602_0063111 | 3300048088 | Bacteria | 3211 |
| 853 | Ga0495602_0073096 | 3300048088 | Bacteria | 2920 |
| 854 | Ga0495602_0083255 | 3300048088 | Bacteria | 2681 |
| 855 | Ga0495602_0135436 | 3300048088 | Bacteria | 1957 |
| 856 | Ga0495602_0288852 | 3300048088 | Bacteria | 1205 |
| 857 | Ga0495614_0002943 | 3300048089 | Bacteria | 7586 |
| 858 | Ga0495615_0000858 | 3300048090 | Bacteria | 4293 |
| 859 | Ga0495615_0104295 | 3300048090 | Bacteria | 804 |
| 860 | Ga0495626_0000551 | 3300048091 | Bacteria | 37220 |
| 861 | Ga0495626_0000677 | 3300048091 | Bacteria | 32591 |
| 862 | Ga0495626_0028912 | 3300048091 | Bacteria | 2684 |
| 863 | Ga0495626_0053523 | 3300048091 | Bacteria | 1857 |
| 864 | Ga0496100_0001586 | 3300048903 | Bacteria | 11204 |
| 865 | Ga0496100_0074843 | 3300048903 | Bacteria | 2270 |
| 866 | Ga0496100_0122931 | 3300048903 | Bacteria | 1818 |
| 867 | Ga0496100_0455098 | 3300048903 | Bacteria | 982 |
| 868 | Ga0496101_0000487 | 3300048904 | Bacteria | 24987 |
| 869 | Ga0496101_1012119 | 3300048904 | Bacteria | 653 |
| 870 | Ga0496102_0000974 | 3300048905 | Bacteria | 26937 |
| 871 | Ga0496102_0028008 | 3300048905 | Bacteria | 5034 |
| 872 | Ga0496102_0101931 | 3300048905 | Bacteria | 2668 |
| 873 | Ga0496102_0230069 | 3300048905 | Bacteria | 1748 |
| 874 | Ga0496103_0007325 | 3300048906 | Bacteria | 6577 |
| 875 | Ga0496103_0035945 | 3300048906 | Bacteria | 3033 |
| 876 | Ga0496103_0081617 | 3300048906 | Bacteria | 2034 |
| 877 | Ga0496104_0498687 | 3300048907 | Bacteria | 1129 |
| 878 | Ga0496105_0054193 | 3300048908 | Bacteria | 3312 |
| 879 | Ga0496105_0294415 | 3300048908 | Bacteria | 1306 |
| 880 | Ga0496106_0000039 | 3300048909 | Bacteria | 109456 |
| 881 | Ga0496106_0036853 | 3300048909 | Bacteria | 3658 |
| 882 | Ga0496106_0162374 | 3300048909 | Bacteria | 1767 |
| 883 | Ga0496110_0208878 | 3300048913 | Bacteria | 1775 |
| 884 | Ga0496111_0009864 | 3300048914 | Bacteria | 6383 |
| 885 | Ga0496111_0372959 | 3300048914 | Bacteria | 1056 |
| 886 | Ga0496112_0026855 | 3300048915 | Bacteria | 5548 |
| 887 | Ga0496112_0156966 | 3300048915 | Bacteria | 2242 |
| 888 | Ga0496112_0441729 | 3300048915 | Bacteria | 1239 |
| 889 | Ga0496113_0004903 | 3300048916 | Bacteria | 8288 |
| 890 | Ga0496113_0005681 | 3300048916 | Bacteria | 7813 |
| 891 | Ga0496113_0311588 | 3300048916 | Bacteria | 1261 |
| 892 | Ga0496114_0000481 | 3300048917 | Bacteria | 29272 |
| 893 | Ga0496115_0473872 | 3300048918 | Bacteria | 1009 |
| 894 | Ga0496116_0012990 | 3300048919 | Bacteria | 6754 |
| 895 | Ga0496116_0028145 | 3300048919 | Bacteria | 4077 |
| 896 | Ga0496116_0035581 | 3300048919 | Bacteria | 3496 |
| 897 | Ga0496117_0000011 | 3300048920 | Bacteria | 610930 |
| 898 | Ga0496117_0000703 | 3300048920 | Bacteria | 53036 |
| 899 | Ga0496117_0007839 | 3300048920 | Bacteria | 10273 |
| 900 | Ga0496117_0007889 | 3300048920 | Bacteria | 10234 |
| 901 | Ga0496117_0024772 | 3300048920 | Bacteria | 4733 |
| 902 | Ga0496117_0033645 | 3300048920 | Bacteria | 3873 |
| 903 | Ga0496117_0062092 | 3300048920 | Bacteria | 2563 |
| 904 | Ga0496117_0154619 | 3300048920 | Bacteria | 1352 |
| 905 | Ga0496118_0000010 | 3300048921 | Bacteria | 610930 |
| 906 | Ga0496118_0000834 | 3300048921 | Bacteria | 49005 |
| 907 | Ga0496118_0000867 | 3300048921 | Bacteria | 47938 |
| 908 | Ga0496118_0002842 | 3300048921 | Bacteria | 22604 |
| 909 | Ga0496118_0011261 | 3300048921 | Bacteria | 8752 |
| 910 | Ga0496118_0023374 | 3300048921 | Bacteria | 5370 |
| 911 | Ga0496118_0035982 | 3300048921 | Bacteria | 4011 |
| 912 | Ga0496118_0090752 | 3300048921 | Bacteria | 2104 |
| 913 | Ga0496119_0209159 | 3300048922 | Bacteria | 1005 |
| 914 | Ga0496121_0001406 | 3300048924 | Bacteria | 40761 |
| 915 | Ga0496121_0004768 | 3300048924 | Bacteria | 17890 |
| 916 | Ga0496121_0005730 | 3300048924 | Bacteria | 15773 |
| 917 | Ga0496121_0007306 | 3300048924 | Bacteria | 13364 |
| 918 | Ga0496121_0008867 | 3300048924 | Bacteria | 11702 |
| 919 | Ga0496121_0010834 | 3300048924 | Bacteria | 10200 |
| 920 | Ga0496121_0068128 | 3300048924 | Bacteria | 2880 |
| 921 | Ga0496121_0084743 | 3300048924 | Bacteria | 2497 |
| 922 | Ga0496121_0122474 | 3300048924 | Bacteria | 1961 |
| 923 | Ga0496122_0000375 | 3300048925 | Bacteria | 95681 |
| 924 | Ga0496122_0003247 | 3300048925 | Bacteria | 21569 |
| 925 | Ga0496122_0010071 | 3300048925 | Bacteria | 9816 |
| 926 | Ga0496123_0000267 | 3300048926 | Bacteria | 104282 |
| 927 | Ga0496123_0002270 | 3300048926 | Bacteria | 24213 |
| 928 | Ga0496123_0007240 | 3300048926 | Bacteria | 10533 |
| 929 | Ga0496123_0062621 | 3300048926 | Bacteria | 2382 |
| 930 | Ga0496124_0009287 | 3300048927 | Bacteria | 10138 |
| 931 | Ga0496124_0023269 | 3300048927 | Bacteria | 5659 |
| 932 | Ga0496125_0085404 | 3300048928 | Bacteria | 2391 |
| 933 | Ga0496125_0116362 | 3300048928 | Bacteria | 1920 |
| 934 | Ga0496126_0000083 | 3300048929 | Bacteria | 217567 |
| 935 | Ga0496126_0000977 | 3300048929 | Bacteria | 49035 |
| 936 | Ga0496126_0001235 | 3300048929 | Bacteria | 41469 |
| 937 | Ga0496126_0010736 | 3300048929 | Bacteria | 9563 |
| 938 | Ga0496126_0493808 | 3300048929 | Bacteria | 979 |
| 939 | Ga0496126_0614469 | 3300048929 | Bacteria | 855 |
| 940 | Ga0501308_028939 | 3300049128 | Bacteria | 734 |
| 941 | Ga0495678_001683 | 3300049459 | Bacteria | 16763 |
| 942 | Ga0495678_014476 | 3300049459 | Bacteria | 3667 |
| 943 | Ga0495678_104850 | 3300049459 | Bacteria | 974 |
| 944 | Ga0495682_0000592 | 3300049460 | Bacteria | 24625 |
| 945 | Ga0495682_0005199 | 3300049460 | Bacteria | 5436 |
| 946 | Ga0495682_0005886 | 3300049460 | Bacteria | 5032 |
| 947 | Ga0495682_0036361 | 3300049460 | Bacteria | 1813 |
| 948 | Ga0495682_0039974 | 3300049460 | Bacteria | 1721 |
| 949 | Ga0501222_002985 | 3300049662 | Bacteria | 2330 |
| 950 | Ga0501227_010138 | 3300049665 | Bacteria | 2039 |
| 951 | Ga0501079_0175321 | 3300049741 | Bacteria | 1672 |
| 952 | Ga0501279_000604 | 3300049775 | Bacteria | 4726 |
| 953 | Ga0501279_007476 | 3300049775 | Bacteria | 1450 |
| 954 | Ga0501035_0002298 | 3300049822 | Bacteria | 18870 |
| 955 | Ga0501044_0084631 | 3300049823 | Bacteria | 3205 |
| 956 | nmdc:mga03683_81946_c1 | 3300050489 | Bacteria | 1394 |
| 957 | nmdc:mga0k408_27923_c1 | 3300050493 | Bacteria | 3207 |
| 958 | nmdc:mga0k408_89023_c1 | 3300050493 | Bacteria | 1813 |
| 959 | nmdc:mga07m45_114_c1 | 3300050496 | Bacteria | 32256 |
| 960 | nmdc:mga07m45_122567_c1 | 3300050496 | Bacteria | 1502 |
| 961 | nmdc:mga07m45_27493_c1 | 3300050496 | Bacteria | 3134 |
| 962 | nmdc:mga08y16_222388_c1 | 3300050511 | Bacteria | 1954 |
| 963 | nmdc:mga0a205_908027_c1 | 3300050515 | Bacteria | 728 |
| 964 | nmdc:mga0sz30_51147_c1 | 3300050516 | Bacteria | 1752 |
| 965 | Ga0500644_0038062 | 3300053088 | Bacteria | 1576 |
| 966 | Ga0500646_0004926 | 3300053090 | Bacteria | 3385 |
| 967 | Ga0500583_0057596 | 3300053092 | Bacteria | 1825 |
| 968 | Ga0500651_0001617 | 3300053093 | Bacteria | 11450 |
| 969 | Ga0500569_005574 | 3300053109 | Bacteria | 2711 |
| 970 | Ga0500617_065104 | 3300053124 | Bacteria | 1607 |
| 971 | Ga0500628_001756 | 3300053129 | Bacteria | 3658 |
| 972 | Ga0500642_0066937 | 3300053130 | Bacteria | 1626 |
| 973 | Ga0500652_001967 | 3300053131 | Bacteria | 6185 |
| 974 | Ga0500568_0023578 | 3300053139 | Bacteria | 2616 |
| 975 | Ga0500577_0017145 | 3300053142 | Bacteria | 2300 |
| 976 | Ga0500579_112193 | 3300053143 | Bacteria | 1366 |
| 977 | Ga0500588_0004849 | 3300053146 | Bacteria | 2942 |
| 978 | Ga0500604_0102309 | 3300053151 | Bacteria | 945 |
| 979 | Ga0500622_0000142 | 3300053156 | Bacteria | 76275 |
| 980 | Ga0500622_0007351 | 3300053156 | Bacteria | 6265 |
| 981 | Ga0590075_021093 | 3300059424 | Bacteria | 1624 |
| 982 | Ga0587106_025958 | 3300059605 | Bacteria | 907 |
| 983 | Ga0466962_0001945 | 3300061719 | Bacteria | 9740 |
| 984 | Ga0466962_0005671 | 3300061719 | Bacteria | 5998 |
| 985 | Ga0466962_0020531 | 3300061719 | Bacteria | 3173 |
| 986 | Ga0466962_0041639 | 3300061719 | Bacteria | 2197 |
| 987 | 2738740082 | 2738541280 | Bacteria | 6630198 |
| 988 | 2738844158 | 2738541300 | Bacteria | 6675882 |
| 989 | 2739274282 | 2738543018 | Bacteria | 6718814 |
| 990 | 2739343326 | 2738543030 | Bacteria | 6719714 |
| 991 | 8040169719 | 8040167225 | Bacteria | 6542727 |
| 992 | Ga0070660_100122005 | |||
| 993 | JGI24739J22299_10002605 | |||
| 994 | JGI24737J22298_10065992 | |||
| 995 | JGI24735J21928_10000339 | |||
| 996 | JGI25158J39367_1000436 | |||
| 997 | JGI25152J39213_1000115 | |||
| 998 | JGI25150J39212_1000197 | |||
| 999 | JGI25150J39212_1000927 | |||
| 1000 | JGI25159J45721_1002012 | |||
| 1001 | JGI25165J46597_1000844 | |||
| 1002 | JGI25153J46596_10001988 | |||
| 1003 | rootH2_10008947 | |||
| 1004 | rootL2_10011897 | |||
| 1005 | rootL2_10011911 | |||
| 1006 | rootH1_10055638 | |||
| 1007 | JGI25161J50226_1000895 | |||
| 1008 | Ga0006556J51387_1036097 | |||
| 1009 | Ga0006554J51385_1033659 | |||
| 1010 | Ga0055533_1000026 | |||
| 1011 | Ga0055533_1000095 | |||
| 1012 | Ga0055532_1000010 | |||
| 1013 | Ga0055525_1000009 | |||
| 1014 | Ga0055525_1001465 | |||
| 1015 | Ga0055525_1007078 | |||
| 1016 | Ga0055527_1000008 | |||
| 1017 | Ga0055535_1000007 | |||
| 1018 | Ga0055542_1000011 | |||
| 1019 | Ga0055529_1000009 | |||
| 1020 | Ga0055526_1000807 | |||
| 1021 | Ga0055526_1002869 | |||
| 1022 | Ga0055537_1001395 | |||
| 1023 | Ga0055537_1002259 | |||
| 1024 | Ga0055537_1011766 | |||
| 1025 | Ga0055524_1000242 | |||
| 1026 | Ga0055524_1001375 | |||
| 1027 | Ga0055524_1003370 | |||
| 1028 | Ga0055524_1003664 | |||
| 1029 | Ga0055524_1006151 | |||
| 1030 | Ga0055524_1033266 | |||
| 1031 | Ga0055534_1000279 | |||
| 1032 | Ga0055528_1000089 | |||
| 1033 | Ga0055528_1007432 | |||
| 1034 | Ga0055530_10002301 | |||
| 1035 | Ga0055530_10002731 | |||
| 1036 | Ga0055530_10003871 | |||
| 1037 | Ga0055531_10005443 | |||
| 1038 | Ga0055531_10006833 | |||
| 1039 | Ga0055531_10006897 | |||
| 1040 | Ga0055531_10014393 | |||
| 1041 | Ga0055543_1001210 | |||
| 1042 | Ga0055543_1014883 | |||
| 1043 | Ga0065165_1000304 | |||
| 1044 | Ga0065165_1000507 | |||
| 1045 | Ga0065165_1001445 | |||
| 1046 | Ga0065165_1002631 | |||
| 1047 | Ga0065165_1005827 | |||
| 1048 | Ga0065712_10131452 | |||
| 1049 | Ga0070658_10064683 | |||
| 1050 | Ga0070658_10106526 | |||
| 1051 | Ga0070658_10194074 | |||
| 1052 | Ga0070658_10343259 | |||
| 1053 | Ga0070658_10439620 | |||
| 1054 | Ga0070658_10562363 | |||
| 1055 | Ga0070658_10614211 | |||
| 1056 | Ga0070676_10342994 | |||
| 1057 | Ga0068869_100242320 | |||
| 1058 | Ga0070660_100000021 | |||
| 1059 | Ga0070660_100005471 | |||
| 1060 | Ga0070660_100170974 | |||
| 1061 | Ga0070660_100221108 | |||
| 1062 | Ga0070687_100334262 | |||
| 1063 | Ga0070661_100032836 | |||
| 1064 | Ga0070661_100152719 | |||
| 1065 | Ga0070661_100308725 | |||
| 1066 | Ga0070675_101049077 | |||
| 1067 | Ga0070659_100000061 | |||
| 1068 | Ga0070659_100009077 | |||
| 1069 | Ga0070659_100038300 | |||
| 1070 | Ga0070667_100317080 | |||
| 1071 | Ga0070667_100780917 | |||
| 1072 | Ga0070705_100473304 | |||
| 1073 | Ga0070663_100000250 | |||
| 1074 | Ga0070663_100993626 | |||
| 1075 | Ga0070662_100312849 | |||
| 1076 | Ga0070662_100527988 | |||
| 1077 | Ga0070681_10100520 | |||
| 1078 | Ga0068867_100000006 | |||
| 1079 | Ga0070706_100255135 | |||
| 1080 | Ga0070665_100031969 | |||
| 1081 | Ga0068855_100001767 | |||
| 1082 | Ga0068855_100010462 | |||
| 1083 | Ga0068855_100078301 | |||
| 1084 | Ga0068855_100080939 | |||
| 1085 | Ga0068855_100478176 | |||
| 1086 | Ga0068855_100510417 | |||
| 1087 | Ga0068855_101387746 | |||
| 1088 | Ga0070664_100027116 | |||
| 1089 | Ga0070664_100029426 | |||
| 1090 | Ga0070664_100084209 | |||
| 1091 | Ga0070664_100620632 | |||
| 1092 | Ga0068857_101054903 | |||
| 1093 | Ga0068854_100493485 | |||
| 1094 | Ga0068856_100056998 | |||
| 1095 | Ga0068856_100080213 | |||
| 1096 | Ga0068856_100127063 | |||
| 1097 | Ga0068852_100147354 | |||
| 1098 | Ga0068852_100161242 | |||
| 1099 | Ga0068852_100194557 | |||
| 1100 | Ga0068852_100771924 | |||
| 1101 | Ga0068858_100312322 | |||
| 1102 | Ga0068860_100494046 | |||
| 1103 | Ga0075369_10042589 | |||
| 1104 | Ga0075366_10022492 | |||
| 1105 | Ga0075366_10049119 | |||
| 1106 | Ga0097621_100035470 | |||
| 1107 | Ga0075370_10001645 | |||
| 1108 | Ga0075370_10004814 | |||
| 1109 | Ga0075370_10016442 | |||
| 1110 | Ga0068871_100406625 | |||
| 1111 | Ga0075428_100193190 | |||
| 1112 | Ga0075433_10192832 | |||
| 1113 | Ga0068865_100099237 | |||
| 1114 | Ga0099823_1000015 | |||
| 1115 | Ga0079104_1000219 | |||
| 1116 | Ga0105251_10000339 | |||
| 1117 | Ga0105244_10017542 | |||
| 1118 | Ga0105240_10011738 | |||
| 1119 | Ga0105240_10060155 | |||
| 1120 | Ga0105240_10082826 | |||
| 1121 | Ga0105240_10119970 | |||
| 1122 | Ga0105240_10173883 | |||
| 1123 | Ga0105240_10182748 | |||
| 1124 | Ga0105240_10428075 | |||
| 1125 | Ga0111539_10298125 | |||
| 1126 | Ga0105247_10051506 | |||
| 1127 | Ga0114129_11308822 | |||
| 1128 | Ga0105243_10010521 | |||
| 1129 | Ga0105243_10021153 | |||
| 1130 | Ga0105243_10417078 | |||
| 1131 | Ga0105241_10007081 | |||
| 1132 | Ga0105241_10113010 | |||
| 1133 | Ga0105242_10101147 | |||
| 1134 | Ga0105242_10759942 | |||
| 1135 | Ga0105248_10078860 | |||
| 1136 | Ga0105237_10019777 | |||
| 1137 | Ga0105237_10028567 | |||
| 1138 | Ga0105237_10086978 | |||
| 1139 | Ga0105237_10169169 | |||
| 1140 | Ga0105237_10307716 | |||
| 1141 | Ga0105238_10005127 | |||
| 1142 | Ga0105238_10071253 | |||
| 1143 | Ga0105238_10166431 | |||
| 1144 | Ga0105249_10090252 | |||
| 1145 | Ga0105239_10028815 | |||
| 1146 | Ga0105239_11423913 | |||
| 1147 | Ga0105246_10059543 | |||
| 1148 | Ga0157317_1000267 | |||
| 1149 | Ga0157319_1000052 | |||
| 1150 | Ga0157373_10144252 | |||
| 1151 | Ga0157373_10207412 | |||
| 1152 | Ga0157370_10057901 | |||
| 1153 | Ga0157370_10191350 | |||
| 1154 | Ga0157370_10614920 | |||
| 1155 | Ga0157370_11100946 | |||
| 1156 | Ga0157369_10001141 | |||
| 1157 | Ga0157369_10002876 | |||
| 1158 | Ga0157369_10012544 | |||
| 1159 | Ga0157374_10000065 | |||
| 1160 | Ga0163162_10023284 | |||
| 1161 | Ga0157372_10067178 | |||
| 1162 | Ga0157372_10279224 | |||
| 1163 | Ga0157372_10347106 | |||
| 1164 | Ga0157372_10565912 | |||
| 1165 | Ga0157377_10000013 | |||
| 1166 | Ga0157379_10021990 | |||
| 1167 | Ga0157376_10283990 | |||
| 1168 | Ga0182006_1000004 | |||
| 1169 | Ga0182006_1067610 | |||
| 1170 | Ga0182007_10000018 | |||
| 1171 | Ga0182007_10017713 | |||
| 1172 | Ga0182005_1000011 | |||
| 1173 | Ga0183361_10011 | |||
| 1174 | Ga0206356_10023468 | |||
| 1175 | Ga0206350_10862829 | |||
| 1176 | Ga0206350_11560598 | |||
| 1177 | Ga0206354_10894230 | |||
| 1178 | Ga0206354_11516447 | |||
| 1179 | Ga0206353_10753358 | |||
| 1180 | Ga0213872_10054713 | |||
| 1181 | Ga0224712_10000214 | |||
| 1182 | Ga0209436_100900 | |||
| 1183 | Ga0209436_102124 | |||
| 1184 | Ga0209566_100398 | |||
| 1185 | Ga0209566_106506 | |||
| 1186 | Ga0209674_100022 | |||
| 1187 | Ga0209674_100024 | |||
| 1188 | Ga0209674_103180 | |||
| 1189 | Ga0209672_100001 | |||
| 1190 | Ga0209672_100046 | |||
| 1191 | Ga0209672_100047 | |||
| 1192 | Ga0209147_100001 | |||
| 1193 | Ga0209147_100043 | |||
| 1194 | Ga0209147_100059 | |||
| 1195 | Ga0209147_100232 | |||
| 1196 | Ga0209563_100015 | |||
| 1197 | Ga0209563_100069 | |||
| 1198 | Ga0209563_101770 | |||
| 1199 | Ga0207427_100301 | |||
| 1200 | Ga0209258_100001 | |||
| 1201 | Ga0209258_100023 | |||
| 1202 | Ga0209258_100172 | |||
| 1203 | Ga0207425_1000006 | |||
| 1204 | Ga0207425_1000650 | |||
| 1205 | Ga0207425_1013432 | |||
| 1206 | Ga0209677_100048 | |||
| 1207 | Ga0209677_111551 | |||
| 1208 | Ga0209148_1000003 | |||
| 1209 | Ga0209148_1000029 | |||
| 1210 | Ga0209148_1001548 | |||
| 1211 | Ga0209148_1002649 | |||
| 1212 | Ga0209759_1000319 | |||
| 1213 | Ga0209759_1000413 | |||
| 1214 | Ga0209759_1000530 | |||
| 1215 | Ga0209759_1015128 | |||
| 1216 | Ga0209129_1000090 | |||
| 1217 | Ga0209233_1000061 | |||
| 1218 | Ga0209565_1000009 | |||
| 1219 | Ga0209565_1001548 | |||
| 1220 | Ga0209565_1001935 | |||
| 1221 | Ga0209565_1003489 | |||
| 1222 | Ga0209565_1003552 | |||
| 1223 | Ga0209565_1015077 | |||
| 1224 | Ga0209565_1024467 | |||
| 1225 | Ga0209455_1000001 | |||
| 1226 | Ga0209455_1000064 | |||
| 1227 | Ga0209455_1002194 | |||
| 1228 | Ga0209673_1000019 | |||
| 1229 | Ga0209673_1000115 | |||
| 1230 | Ga0209673_1013401 | |||
| 1231 | Ga0209673_1016521 | |||
| 1232 | Ga0209673_1079363 | |||
| 1233 | Ga0209130_1000298 | |||
| 1234 | Ga0209130_1000545 | |||
| 1235 | Ga0209130_1006951 | |||
| 1236 | Ga0209675_1000028 | |||
| 1237 | Ga0209675_1002663 | |||
| 1238 | Ga0209675_1004422 | |||
| 1239 | Ga0209675_1009018 | |||
| 1240 | Ga0209675_1011928 | |||
| 1241 | Ga0209564_1000058 | |||
| 1242 | Ga0209564_1000513 | |||
| 1243 | Ga0209564_1003940 | |||
| 1244 | Ga0209564_1012805 | |||
| 1245 | Ga0209564_1013486 | |||
| 1246 | Ga0209564_1022819 | |||
| 1247 | Ga0209758_1000047 | |||
| 1248 | Ga0209758_1072935 | |||
| 1249 | Ga0209050_1000085 | |||
| 1250 | Ga0209050_1000984 | |||
| 1251 | Ga0209050_1001090 | |||
| 1252 | Ga0209050_1002313 | |||
| 1253 | Ga0209050_1003717 | |||
| 1254 | Ga0209050_1004254 | |||
| 1255 | Ga0209256_1000052 | |||
| 1256 | Ga0209256_1000080 | |||
| 1257 | Ga0209256_1000092 | |||
| 1258 | Ga0209256_1001916 | |||
| 1259 | Ga0209256_1004507 | |||
| 1260 | Ga0209256_1004520 | |||
| 1261 | Ga0209256_1005321 | |||
| 1262 | Ga0207426_1000050 | |||
| 1263 | Ga0207426_1002637 | |||
| 1264 | Ga0209051_1002466 | |||
| 1265 | Ga0209051_1002996 | |||
| 1266 | Ga0209257_1000010 | |||
| 1267 | Ga0209257_1002829 | |||
| 1268 | Ga0209257_1005729 | |||
| 1269 | Ga0209257_1006946 | |||
| 1270 | Ga0209257_1019815 | |||
| 1271 | Ga0207696_1015504 | |||
| 1272 | Ga0207647_10001156 | |||
| 1273 | Ga0207647_10018927 | |||
| 1274 | Ga0207647_10039748 | |||
| 1275 | Ga0207647_10095531 | |||
| 1276 | Ga0207705_10001644 | |||
| 1277 | Ga0207705_10009754 | |||
| 1278 | Ga0207705_10409054 | |||
| 1279 | Ga0207705_10488605 | |||
| 1280 | Ga0207684_10737214 | |||
| 1281 | Ga0207654_10047541 | |||
| 1282 | Ga0207707_10220709 | |||
| 1283 | Ga0207695_10004189 | |||
| 1284 | Ga0207695_10004468 | |||
| 1285 | Ga0207695_10019442 | |||
| 1286 | Ga0207695_10030609 | |||
| 1287 | Ga0207695_10288429 | |||
| 1288 | Ga0207671_10007405 | |||
| 1289 | Ga0207671_10016770 | |||
| 1290 | Ga0207671_10099981 | |||
| 1291 | Ga0207671_10160811 | |||
| 1292 | Ga0207671_10266705 | |||
| 1293 | Ga0207671_10288343 | |||
| 1294 | Ga0207660_10155061 | |||
| 1295 | Ga0207657_10000008 | |||
| 1296 | Ga0207657_10000192 | |||
| 1297 | Ga0207657_10021104 | |||
| 1298 | Ga0207657_10144447 | |||
| 1299 | Ga0207694_10012623 | |||
| 1300 | Ga0207694_10113317 | |||
| 1301 | Ga0207694_10185503 | |||
| 1302 | Ga0207694_10244111 | |||
| 1303 | Ga0207687_10373091 | |||
| 1304 | Ga0207664_11127008 | |||
| 1305 | Ga0207690_10000013 | |||
| 1306 | Ga0207690_10025017 | |||
| 1307 | Ga0207690_10189329 | |||
| 1308 | Ga0207706_10044176 | |||
| 1309 | Ga0207706_10050822 | |||
| 1310 | Ga0207706_10172071 | |||
| 1311 | Ga0207706_10495620 | |||
| 1312 | Ga0207706_10561211 | |||
| 1313 | Ga0207686_10017470 | |||
| 1314 | Ga0207709_10008532 | |||
| 1315 | Ga0207709_10010427 | |||
| 1316 | Ga0207709_10436978 | |||
| 1317 | Ga0207670_10060892 | |||
| 1318 | Ga0207704_10063809 | |||
| 1319 | Ga0207711_10216108 | |||
| 1320 | Ga0207711_11185249 | |||
| 1321 | Ga0207689_10528010 | |||
| 1322 | Ga0207679_10000154 | |||
| 1323 | Ga0207679_10064425 | |||
| 1324 | Ga0207667_10000273 | |||
| 1325 | Ga0207667_10003101 | |||
| 1326 | Ga0207667_10009746 | |||
| 1327 | Ga0207667_10015652 | |||
| 1328 | Ga0207667_10039180 | |||
| 1329 | Ga0207667_10064971 | |||
| 1330 | Ga0207640_10973570 | |||
| 1331 | Ga0207658_10437472 | |||
| 1332 | Ga0207703_10277059 | |||
| 1333 | Ga0207639_10463346 | |||
| 1334 | Ga0207639_10697764 | |||
| 1335 | Ga0207639_11206266 | |||
| 1336 | Ga0207678_10001041 | |||
| 1337 | Ga0207678_10346232 | |||
| 1338 | Ga0207678_10907369 | |||
| 1339 | Ga0207708_10123694 | |||
| 1340 | Ga0207702_10184381 | |||
| 1341 | Ga0207648_10000006 | |||
| 1342 | Ga0207648_10107853 | |||
| 1343 | Ga0207674_10188279 | |||
| 1344 | Ga0207674_10322231 | |||
| 1345 | Ga0207683_10168058 | |||
| 1346 | Ga0207698_10011839 | |||
| 1347 | Ga0207698_10043411 | |||
| 1348 | Ga0207698_10142926 | |||
| 1349 | Ga0207698_10167412 | |||
| 1350 | Ga0207698_10660144 | |||
| 1351 | Ga0209281_1000074 | |||
| 1352 | Ga0209389_1000831 | |||
| 1353 | Ga0209371_1000065 | |||
| 1354 | Ga0209371_1015544 | |||
| 1355 | Ga0209974_10005833 | |||
| 1356 | Ga0268266_10017033 | |||
| 1357 | Ga0268266_10034628 | |||
| 1358 | Ga0268265_10929145 | |||
| 1359 | Ga0268264_10390059 | |||
| 1360 | Ga0265338_10000022 | |||
| 1361 | Ga0265338_10098424 | |||
| 1362 | Ga0268256_1000118 | |||
| 1363 | Ga0268256_1017243 | |||
| 1364 | Ga0307511_10261041 | |||
| 1365 | Ga0316177_1005603 | |||
| 1366 | Ga0316180_1057521 | |||
| 1367 | Ga0316183_1006639 | |||
| 1368 | Ga0265340_10138979 | |||
| 1369 | Ga0307509_10206247 | |||
| 1370 | Ga0307408_100000191 | |||
| 1371 | Ga0307408_100001241 | |||
| 1372 | Ga0307408_100004007 | |||
| 1373 | Ga0307408_100013788 | |||
| 1374 | Ga0307408_100017461 | |||
| 1375 | Ga0307408_100017765 | |||
| 1376 | Ga0307516_10228823 | |||
| 1377 | Ga0307405_10384582 | |||
| 1378 | Ga0307412_10000003 | |||
| 1379 | Ga0307409_100551558 | |||
| 1380 | Ga0307411_10213387 | |||
| 1381 | Ga0373959_0007713 | |||
| 1382 | Ga0373934_0003204 | |||
| 1383 | Ga0373949_0090496 | |||
| 1384 | Ga0373923_0289357 | |||
| 1385 | Ga0373932_0165776 | |||
| 1386 | Ga0373931_0000156 | |||
| 1387 | Ga0373927_0699894 | |||
| 1388 | Ga0395899_0000041 | |||
| 1389 | Ga0395899_0000141 | |||
| 1390 | Ga0395899_0009226 | |||
| 1391 | Ga0395899_0059143 | |||
| 1392 | Ga0395899_0090836 | |||
| 1393 | Ga0395900_0000077 | |||
| 1394 | Ga0395900_0000097 | |||
| 1395 | Ga0395900_0000550 | |||
| 1396 | Ga0395900_0002226 | |||
| 1397 | Ga0395900_0003642 | |||
| 1398 | Ga0395900_0025526 | |||
| 1399 | Ga0395900_0052880 | |||
| 1400 | Ga0395900_0067410 | |||
| 1401 | Ga0395900_0116663 | |||
| 1402 | Ga0395900_0216592 | |||
| 1403 | Ga0395898_0000322 | |||
| 1404 | Ga0395898_0000936 | |||
| 1405 | Ga0395898_0022797 | |||
| 1406 | Ga0395898_0114762 | |||
| 1407 | Ga0395905_0000041 | |||
| 1408 | Ga0395905_0024802 | |||
| 1409 | Ga0395905_0056095 | |||
| 1410 | Ga0395905_0168542 | |||
| 1411 | Ga0395905_0213943 | |||
| 1412 | Ga0395905_0336528 | |||
| 1413 | Ga0395905_0386112 | |||
| 1414 | Ga0395901_0000011 | |||
| 1415 | Ga0395901_0000073 | |||
| 1416 | Ga0395901_0000085 | |||
| 1417 | Ga0395901_0001346 | |||
| 1418 | Ga0395901_0003050 | |||
| 1419 | Ga0395901_0036048 | |||
| 1420 | Ga0395901_0037810 | |||
| 1421 | Ga0395901_0061473 | |||
| 1422 | Ga0395901_0068282 | |||
| 1423 | Ga0395901_0167462 | |||
| 1424 | Ga0395901_0564311 | |||
| 1425 | Ga0395901_1335662 | |||
| 1426 | Ga0436361_0126092 | |||
| 1427 | Ga0436361_1083859 | |||
| 1428 | Ga0451793_0939722 | |||
| 1429 | Ga0451795_0434151 | |||
| 1430 | Ga0451795_0666079 | |||
| 1431 | Ga0451839_0947087 | |||
| 1432 | Ga0451853_0369105 | |||
| 1433 | Ga0439448_0000195 | |||
| 1434 | Ga0439448_0000244 | |||
| 1435 | Ga0439448_0004918 | |||
| 1436 | Ga0439449_0005188 | |||
| 1437 | Ga0439454_039038 | |||
| 1438 | Ga0450890_000911 | |||
| 1439 | Ga0466969_0000012 | |||
| 1440 | Ga0466969_0002391 | |||
| 1441 | Ga0466969_0017878 | |||
| 1442 | Ga0466969_0020358 | |||
| 1443 | Ga0466969_0269671 | |||
| 1444 | Ga0466972_0000760 | |||
| 1445 | Ga0466972_0006233 | |||
| 1446 | Ga0466972_0009161 | |||
| 1447 | Ga0466972_0076166 | |||
| 1448 | Ga0466972_0250372 | |||
| 1449 | Ga0453683_0017910 | |||
| 1450 | Ga0466965_0008497 | |||
| 1451 | Ga0466965_0008969 | |||
| 1452 | Ga0466965_0055699 | |||
| 1453 | Ga0466965_0218820 | |||
| 1454 | Ga0466965_0314093 | |||
| 1455 | Ga0466966_0000002 | |||
| 1456 | Ga0466966_0002140 | |||
| 1457 | Ga0466966_0023672 | |||
| 1458 | Ga0466966_0040218 | |||
| 1459 | Ga0466966_0049870 | |||
| 1460 | Ga0466966_0093158 | |||
| 1461 | Ga0466966_0101132 | |||
| 1462 | Ga0466961_0000216 | |||
| 1463 | Ga0466961_0038598 | |||
| 1464 | Ga0466961_0061806 | |||
| 1465 | Ga0466961_0068379 | |||
| 1466 | Ga0466961_0092592 | |||
| 1467 | Ga0466963_0005544 | |||
| 1468 | Ga0466963_0008787 | |||
| 1469 | Ga0466963_0016633 | |||
| 1470 | Ga0466963_0024293 | |||
| 1471 | Ga0466964_0002313 | |||
| 1472 | Ga0466964_0014215 | |||
| 1473 | Ga0466964_0025490 | |||
| 1474 | Ga0466964_0036416 | |||
| 1475 | Ga0466964_0309049 | |||
| 1476 | Ga0453684_0122487 | |||
| 1477 | Ga0453684_0292543 | |||
| 1478 | Ga0453684_0446303 | |||
| 1479 | Ga0466971_0000120 | |||
| 1480 | Ga0466971_0039849 | |||
| 1481 | Ga0466971_0047894 | |||
| 1482 | Ga0466971_0048658 | |||
| 1483 | Ga0466971_0095050 | |||
| 1484 | Ga0466971_0117173 | |||
| 1485 | Ga0466968_0018603 | |||
| 1486 | Ga0466968_0142204 | |||
| 1487 | Ga0466970_0004957 | |||
| 1488 | Ga0466970_0010359 | |||
| 1489 | Ga0466957_0001745 | |||
| 1490 | Ga0466957_0004724 | |||
| 1491 | Ga0466957_0017328 | |||
| 1492 | Ga0466957_0032879 | |||
| 1493 | Ga0466957_0037922 | |||
| 1494 | Ga0466957_0042723 | |||
| 1495 | Ga0466957_0043930 | |||
| 1496 | Ga0466957_0074413 | |||
| 1497 | Ga0466957_0233434 | |||
| 1498 | Ga0466960_0114817 | |||
| 1499 | Ga0466959_0010555 | |||
| 1500 | Ga0466959_0010571 | |||
| 1501 | Ga0466959_0039405 | |||
| 1502 | Ga0466959_0044170 | |||
| 1503 | Ga0466959_0151332 | |||
| 1504 | Ga0466959_0191674 | |||
| 1505 | Ga0466959_0584934 | |||
| 1506 | Ga0451576_0006412 | |||
| 1507 | Ga0451576_0716641 | |||
| 1508 | Ga0466958_0003491 | |||
| 1509 | Ga0466958_0016956 | |||
| 1510 | Ga0466958_0020856 | |||
| 1511 | Ga0466958_0045715 | |||
| 1512 | Ga0466958_0087507 | |||
| 1513 | Ga0466958_0293869 | |||
| 1514 | Ga0466958_0381281 | |||
| 1515 | Ga0466967_0011397 | |||
| 1516 | Ga0466967_0115857 | |||
| 1517 | Ga0466967_0298917 | |||
| 1518 | Ga0466967_1313534 | |||
| 1519 | Ga0495617_003209 | |||
| 1520 | Ga0495627_023015 | |||
| 1521 | Ga0495592_0062776 | |||
| 1522 | Ga0495592_0123363 | |||
| 1523 | Ga0495603_0012122 | |||
| 1524 | Ga0495603_0142185 | |||
| 1525 | Ga0495590_0011958 | |||
| 1526 | Ga0495590_0025976 | |||
| 1527 | Ga0495590_0028459 | |||
| 1528 | Ga0495590_0198633 | |||
| 1529 | Ga0495591_000678 | |||
| 1530 | Ga0495629_0000289 | |||
| 1531 | Ga0495629_0001153 | |||
| 1532 | Ga0495629_0012599 | |||
| 1533 | Ga0495629_0017439 | |||
| 1534 | Ga0495638_0018569 | |||
| 1535 | Ga0495638_0112548 | |||
| 1536 | Ga0495638_0159117 | |||
| 1537 | Ga0495641_0025926 | |||
| 1538 | Ga0495641_0069470 | |||
| 1539 | Ga0495651_0003781 | |||
| 1540 | Ga0495651_0200354 | |||
| 1541 | Ga0495653_0002090 | |||
| 1542 | Ga0495653_0024301 | |||
| 1543 | Ga0495653_0062635 | |||
| 1544 | Ga0495653_0083700 | |||
| 1545 | Ga0495650_0005534 | |||
| 1546 | Ga0495650_0028202 | |||
| 1547 | Ga0495650_0187643 | |||
| 1548 | Ga0495650_0215024 | |||
| 1549 | Ga0495580_0000785 | |||
| 1550 | Ga0495580_0000899 | |||
| 1551 | Ga0495580_0003519 | |||
| 1552 | Ga0495580_0010528 | |||
| 1553 | Ga0495580_0038890 | |||
| 1554 | Ga0495580_0053930 | |||
| 1555 | Ga0495580_0057248 | |||
| 1556 | Ga0495582_0003362 | |||
| 1557 | Ga0495582_0011259 | |||
| 1558 | Ga0495582_0079755 | |||
| 1559 | Ga0495605_0001707 | |||
| 1560 | Ga0495605_0004905 | |||
| 1561 | Ga0495605_0011963 | |||
| 1562 | Ga0495605_0012750 | |||
| 1563 | Ga0495605_0013772 | |||
| 1564 | Ga0495605_0095567 | |||
| 1565 | Ga0495605_0163543 | |||
| 1566 | Ga0495662_0004969 | |||
| 1567 | Ga0495662_0115312 | |||
| 1568 | Ga0495664_0004903 | |||
| 1569 | Ga0495664_0007151 | |||
| 1570 | Ga0495664_0007967 | |||
| 1571 | Ga0495664_0111909 | |||
| 1572 | Ga0495664_0250483 | |||
| 1573 | Ga0495584_0000010 | |||
| 1574 | Ga0495584_0000095 | |||
| 1575 | Ga0495584_0006618 | |||
| 1576 | Ga0495584_0007580 | |||
| 1577 | Ga0495584_0037281 | |||
| 1578 | Ga0495584_0155223 | |||
| 1579 | Ga0495585_0000004 | |||
| 1580 | Ga0495585_0000172 | |||
| 1581 | Ga0495585_0000428 | |||
| 1582 | Ga0495585_0006668 | |||
| 1583 | Ga0495585_0013177 | |||
| 1584 | Ga0495585_0022088 | |||
| 1585 | Ga0495585_0039342 | |||
| 1586 | Ga0495585_0046432 | |||
| 1587 | Ga0495594_0187781 | |||
| 1588 | Ga0495596_0008490 | |||
| 1589 | Ga0495596_0011774 | |||
| 1590 | Ga0495596_0012381 | |||
| 1591 | Ga0495596_0071153 | |||
| 1592 | Ga0495607_0000653 | |||
| 1593 | Ga0495607_0001362 | |||
| 1594 | Ga0495607_0022033 | |||
| 1595 | Ga0495607_0025850 | |||
| 1596 | Ga0495607_0054685 | |||
| 1597 | Ga0495607_0212174 | |||
| 1598 | Ga0495583_0000008 | |||
| 1599 | Ga0495583_0000022 | |||
| 1600 | Ga0495583_0000067 | |||
| 1601 | Ga0495583_0000536 | |||
| 1602 | Ga0495583_0008806 | |||
| 1603 | Ga0495583_0010345 | |||
| 1604 | Ga0495583_0057132 | |||
| 1605 | Ga0495606_0002047 | |||
| 1606 | Ga0495606_0010757 | |||
| 1607 | Ga0495606_0011903 | |||
| 1608 | Ga0495606_0031765 | |||
| 1609 | Ga0495606_0033519 | |||
| 1610 | Ga0495606_0054139 | |||
| 1611 | Ga0495606_0193753 | |||
| 1612 | Ga0495608_0023931 | |||
| 1613 | Ga0495608_0031178 | |||
| 1614 | Ga0495610_0000621 | |||
| 1615 | Ga0495616_0000214 | |||
| 1616 | Ga0495616_0001258 | |||
| 1617 | Ga0495616_0006240 | |||
| 1618 | Ga0495616_0057539 | |||
| 1619 | Ga0495618_0003432 | |||
| 1620 | Ga0495618_0037718 | |||
| 1621 | Ga0495620_0014167 | |||
| 1622 | Ga0495620_0054381 | |||
| 1623 | Ga0495628_0006759 | |||
| 1624 | Ga0495628_0007278 | |||
| 1625 | Ga0495628_0039972 | |||
| 1626 | Ga0495628_0084151 | |||
| 1627 | Ga0495628_0190042 | |||
| 1628 | Ga0495628_0224279 | |||
| 1629 | Ga0495630_0008019 | |||
| 1630 | Ga0495630_0022291 | |||
| 1631 | Ga0495630_0024879 | |||
| 1632 | Ga0495630_0038505 | |||
| 1633 | Ga0495631_0010394 | |||
| 1634 | Ga0495631_0243709 | |||
| 1635 | Ga0495632_0003651 | |||
| 1636 | Ga0495643_0050494 | |||
| 1637 | Ga0495643_0059604 | |||
| 1638 | Ga0495643_0088701 | |||
| 1639 | Ga0495644_0009116 | |||
| 1640 | Ga0495644_0011074 | |||
| 1641 | Ga0495648_0000044 | |||
| 1642 | Ga0495648_0001359 | |||
| 1643 | Ga0495648_0007602 | |||
| 1644 | Ga0495648_0014426 | |||
| 1645 | Ga0495648_0031864 | |||
| 1646 | Ga0495663_0004270 | |||
| 1647 | Ga0495663_0004892 | |||
| 1648 | Ga0495666_0005409 | |||
| 1649 | Ga0495666_0022038 | |||
| 1650 | Ga0495666_0050857 | |||
| 1651 | Ga0495666_0118938 | |||
| 1652 | Ga0495642_0002219 | |||
| 1653 | Ga0495642_0003835 | |||
| 1654 | Ga0495652_0048168 | |||
| 1655 | Ga0495652_0215171 | |||
| 1656 | Ga0495652_0227953 | |||
| 1657 | Ga0495654_0041308 | |||
| 1658 | Ga0495654_0115427 | |||
| 1659 | Ga0495665_0004142 | |||
| 1660 | Ga0495665_0034113 | |||
| 1661 | Ga0495665_0048002 | |||
| 1662 | Ga0495665_0067759 | |||
| 1663 | Ga0495640_0030009 | |||
| 1664 | Ga0495640_0031099 | |||
| 1665 | Ga0495640_0052392 | |||
| 1666 | Ga0495586_0008431 | |||
| 1667 | Ga0495586_0013861 | |||
| 1668 | Ga0495587_0000965 | |||
| 1669 | Ga0495587_0004819 | |||
| 1670 | Ga0495609_0000002 | |||
| 1671 | Ga0495609_0001124 | |||
| 1672 | Ga0495609_0008848 | |||
| 1673 | Ga0495609_0020599 | |||
| 1674 | Ga0495609_0021029 | |||
| 1675 | Ga0495609_0021833 | |||
| 1676 | Ga0495597_0002364 | |||
| 1677 | Ga0495597_0015402 | |||
| 1678 | Ga0495645_0022630 | |||
| 1679 | Ga0495645_0028042 | |||
| 1680 | Ga0495645_0058386 | |||
| 1681 | Ga0495622_0000241 | |||
| 1682 | Ga0495622_0022112 | |||
| 1683 | Ga0495633_0000204 | |||
| 1684 | Ga0495633_0001422 | |||
| 1685 | Ga0495633_0002751 | |||
| 1686 | Ga0495633_0005172 | |||
| 1687 | Ga0495633_0005664 | |||
| 1688 | Ga0495633_0031836 | |||
| 1689 | Ga0495633_0146743 | |||
| 1690 | Ga0495656_0007691 | |||
| 1691 | Ga0495656_0007894 | |||
| 1692 | Ga0495656_0013063 | |||
| 1693 | Ga0495656_0029284 | |||
| 1694 | Ga0495656_0449767 | |||
| 1695 | Ga0495668_0002694 | |||
| 1696 | Ga0495668_0029337 | |||
| 1697 | Ga0495634_0009942 | |||
| 1698 | Ga0495634_0027206 | |||
| 1699 | Ga0495634_0111377 | |||
| 1700 | Ga0495611_0001009 | |||
| 1701 | Ga0495611_0005235 | |||
| 1702 | Ga0495611_0024774 | |||
| 1703 | Ga0495625_0005030 | |||
| 1704 | Ga0495625_0014975 | |||
| 1705 | Ga0495625_0017139 | |||
| 1706 | Ga0495625_0104994 | |||
| 1707 | Ga0495635_0008829 | |||
| 1708 | Ga0495635_0028617 | |||
| 1709 | Ga0495635_0030983 | |||
| 1710 | Ga0495659_0000052 | |||
| 1711 | Ga0495659_0133641 | |||
| 1712 | Ga0495661_0000251 | |||
| 1713 | Ga0495661_0006759 | |||
| 1714 | Ga0495661_0009400 | |||
| 1715 | Ga0495661_0030658 | |||
| 1716 | Ga0495661_0123379 | |||
| 1717 | Ga0495661_0164970 | |||
| 1718 | Ga0495661_0231762 | |||
| 1719 | Ga0495588_0000226 | |||
| 1720 | Ga0495588_0235313 | |||
| 1721 | Ga0495657_0007993 | |||
| 1722 | Ga0495657_0375442 | |||
| 1723 | Ga0495599_0002021 | |||
| 1724 | Ga0495599_0008761 | |||
| 1725 | Ga0495599_0034002 | |||
| 1726 | Ga0495599_0040553 | |||
| 1727 | Ga0495623_0014419 | |||
| 1728 | Ga0495623_0117422 | |||
| 1729 | Ga0495623_0139371 | |||
| 1730 | Ga0495646_0012249 | |||
| 1731 | Ga0495646_0026741 | |||
| 1732 | Ga0495646_0026937 | |||
| 1733 | Ga0495646_0038883 | |||
| 1734 | Ga0495646_0135293 | |||
| 1735 | Ga0495669_0030303 | |||
| 1736 | Ga0495613_0004889 | |||
| 1737 | Ga0495613_0007176 | |||
| 1738 | Ga0495613_0114124 | |||
| 1739 | Ga0495624_0024355 | |||
| 1740 | Ga0495624_0040141 | |||
| 1741 | Ga0495624_0122973 | |||
| 1742 | Ga0495670_0005679 | |||
| 1743 | Ga0495670_0014121 | |||
| 1744 | Ga0495671_0000128 | |||
| 1745 | Ga0495671_0006426 | |||
| 1746 | Ga0495671_0419351 | |||
| 1747 | Ga0495649_0001087 | |||
| 1748 | Ga0495649_0006900 | |||
| 1749 | Ga0495649_0007468 | |||
| 1750 | Ga0495649_0108334 | |||
| 1751 | Ga0495649_0135350 | |||
| 1752 | Ga0495649_0304924 | |||
| 1753 | Ga0495589_0000030 | |||
| 1754 | Ga0495589_0001930 | |||
| 1755 | Ga0495589_0004662 | |||
| 1756 | Ga0495589_0007857 | |||
| 1757 | Ga0495589_0074780 | |||
| 1758 | Ga0495600_0002396 | |||
| 1759 | Ga0495600_0086790 | |||
| 1760 | Ga0495600_0270310 | |||
| 1761 | Ga0495660_0001867 | |||
| 1762 | Ga0495660_0002717 | |||
| 1763 | Ga0495660_0003009 | |||
| 1764 | Ga0495660_0225007 | |||
| 1765 | Ga0495581_0003096 | |||
| 1766 | Ga0495581_0003171 | |||
| 1767 | Ga0495581_0039551 | |||
| 1768 | Ga0495604_0003807 | |||
| 1769 | Ga0495604_0117842 | |||
| 1770 | Ga0495604_0177227 | |||
| 1771 | Ga0495604_0323313 | |||
| 1772 | Ga0495636_0000126 | |||
| 1773 | Ga0495636_0021985 | |||
| 1774 | Ga0495674_0083335 | |||
| 1775 | Ga0495674_0084835 | |||
| 1776 | Ga0495674_0104554 | |||
| 1777 | Ga0495674_0109533 | |||
| 1778 | Ga0495674_0116104 | |||
| 1779 | Ga0495674_0217724 | |||
| 1780 | Ga0495672_0000005 | |||
| 1781 | Ga0495672_0000066 | |||
| 1782 | Ga0495672_0003903 | |||
| 1783 | Ga0495672_0013035 | |||
| 1784 | Ga0495672_0021078 | |||
| 1785 | Ga0495672_0024467 | |||
| 1786 | Ga0495672_0067195 | |||
| 1787 | Ga0495672_0108195 | |||
| 1788 | Ga0495672_0140951 | |||
| 1789 | Ga0495676_0026137 | |||
| 1790 | Ga0495676_0140261 | |||
| 1791 | Ga0495676_0144711 | |||
| 1792 | Ga0495676_0198191 | |||
| 1793 | Ga0495680_0002192 | |||
| 1794 | Ga0495680_0027643 | |||
| 1795 | Ga0495680_0196824 | |||
| 1796 | Ga0495680_0294986 | |||
| 1797 | Ga0495683_0000157 | |||
| 1798 | Ga0495683_0001712 | |||
| 1799 | Ga0495683_0002800 | |||
| 1800 | Ga0495683_0006507 | |||
| 1801 | Ga0495683_0006618 | |||
| 1802 | Ga0495683_0014609 | |||
| 1803 | Ga0495683_0016862 | |||
| 1804 | Ga0495683_0031089 | |||
| 1805 | Ga0495687_000047 | |||
| 1806 | Ga0495687_000095 | |||
| 1807 | Ga0495687_000112 | |||
| 1808 | Ga0495687_001241 | |||
| 1809 | Ga0495687_018969 | |||
| 1810 | Ga0495687_038722 | |||
| 1811 | Ga0495687_149089 | |||
| 1812 | Ga0495675_0007329 | |||
| 1813 | Ga0495675_0009649 | |||
| 1814 | Ga0495675_0020246 | |||
| 1815 | Ga0495677_0000052 | |||
| 1816 | Ga0495677_0004589 | |||
| 1817 | Ga0495677_0009036 | |||
| 1818 | Ga0495677_0009136 | |||
| 1819 | Ga0495677_0156873 | |||
| 1820 | Ga0495679_000054 | |||
| 1821 | Ga0495679_001272 | |||
| 1822 | Ga0495679_009408 | |||
| 1823 | Ga0495685_000011 | |||
| 1824 | Ga0495673_0011344 | |||
| 1825 | Ga0495673_0014493 | |||
| 1826 | Ga0495673_0018286 | |||
| 1827 | Ga0495681_0016210 | |||
| 1828 | Ga0495681_0047211 | |||
| 1829 | Ga0495681_0075188 | |||
| 1830 | Ga0495684_0069604 | |||
| 1831 | Ga0495684_0212090 | |||
| 1832 | Ga0495686_0000012 | |||
| 1833 | Ga0495686_0000658 | |||
| 1834 | Ga0495686_0014289 | |||
| 1835 | Ga0495686_0052100 | |||
| 1836 | Ga0495686_0123933 | |||
| 1837 | Ga0495686_0161251 | |||
| 1838 | Ga0495593_0001554 | |||
| 1839 | Ga0495593_0004656 | |||
| 1840 | Ga0495593_0005157 | |||
| 1841 | Ga0495593_0013844 | |||
| 1842 | Ga0495602_0012381 | |||
| 1843 | Ga0495602_0063111 | |||
| 1844 | Ga0495602_0073096 | |||
| 1845 | Ga0495602_0083255 | |||
| 1846 | Ga0495602_0135436 | |||
| 1847 | Ga0495602_0288852 | |||
| 1848 | Ga0495614_0002943 | |||
| 1849 | Ga0495615_0000858 | |||
| 1850 | Ga0495615_0104295 | |||
| 1851 | Ga0495626_0000551 | |||
| 1852 | Ga0495626_0000677 | |||
| 1853 | Ga0495626_0028912 | |||
| 1854 | Ga0495626_0053523 | |||
| 1855 | Ga0496100_0001586 | |||
| 1856 | Ga0496100_0074843 | |||
| 1857 | Ga0496100_0122931 | |||
| 1858 | Ga0496100_0455098 | |||
| 1859 | Ga0496101_0000487 | |||
| 1860 | Ga0496101_1012119 | |||
| 1861 | Ga0496102_0000974 | |||
| 1862 | Ga0496102_0028008 | |||
| 1863 | Ga0496102_0101931 | |||
| 1864 | Ga0496102_0230069 | |||
| 1865 | Ga0496103_0007325 | |||
| 1866 | Ga0496103_0035945 | |||
| 1867 | Ga0496103_0081617 | |||
| 1868 | Ga0496104_0498687 | |||
| 1869 | Ga0496105_0054193 | |||
| 1870 | Ga0496105_0294415 | |||
| 1871 | Ga0496106_0000039 | |||
| 1872 | Ga0496106_0036853 | |||
| 1873 | Ga0496106_0162374 | |||
| 1874 | Ga0496110_0208878 | |||
| 1875 | Ga0496111_0009864 | |||
| 1876 | Ga0496111_0372959 | |||
| 1877 | Ga0496112_0026855 | |||
| 1878 | Ga0496112_0156966 | |||
| 1879 | Ga0496112_0441729 | |||
| 1880 | Ga0496113_0004903 | |||
| 1881 | Ga0496113_0005681 | |||
| 1882 | Ga0496113_0311588 | |||
| 1883 | Ga0496114_0000481 | |||
| 1884 | Ga0496115_0473872 | |||
| 1885 | Ga0496116_0012990 | |||
| 1886 | Ga0496116_0028145 | |||
| 1887 | Ga0496116_0035581 | |||
| 1888 | Ga0496117_0000011 | |||
| 1889 | Ga0496117_0000703 | |||
| 1890 | Ga0496117_0007839 | |||
| 1891 | Ga0496117_0007889 | |||
| 1892 | Ga0496117_0024772 | |||
| 1893 | Ga0496117_0033645 | |||
| 1894 | Ga0496117_0062092 | |||
| 1895 | Ga0496117_0154619 | |||
| 1896 | Ga0496118_0000010 | |||
| 1897 | Ga0496118_0000834 | |||
| 1898 | Ga0496118_0000867 | |||
| 1899 | Ga0496118_0002842 | |||
| 1900 | Ga0496118_0011261 | |||
| 1901 | Ga0496118_0023374 | |||
| 1902 | Ga0496118_0035982 | |||
| 1903 | Ga0496118_0090752 | |||
| 1904 | Ga0496119_0209159 | |||
| 1905 | Ga0496121_0001406 | |||
| 1906 | Ga0496121_0004768 | |||
| 1907 | Ga0496121_0005730 | |||
| 1908 | Ga0496121_0007306 | |||
| 1909 | Ga0496121_0008867 | |||
| 1910 | Ga0496121_0010834 | |||
| 1911 | Ga0496121_0068128 | |||
| 1912 | Ga0496121_0084743 | |||
| 1913 | Ga0496121_0122474 | |||
| 1914 | Ga0496122_0000375 | |||
| 1915 | Ga0496122_0003247 | |||
| 1916 | Ga0496122_0010071 | |||
| 1917 | Ga0496123_0000267 | |||
| 1918 | Ga0496123_0002270 | |||
| 1919 | Ga0496123_0007240 | |||
| 1920 | Ga0496123_0062621 | |||
| 1921 | Ga0496124_0009287 | |||
| 1922 | Ga0496124_0023269 | |||
| 1923 | Ga0496125_0085404 | |||
| 1924 | Ga0496125_0116362 | |||
| 1925 | Ga0496126_0000083 | |||
| 1926 | Ga0496126_0000977 | |||
| 1927 | Ga0496126_0001235 | |||
| 1928 | Ga0496126_0010736 | |||
| 1929 | Ga0496126_0493808 | |||
| 1930 | Ga0496126_0614469 | |||
| 1931 | Ga0501308_028939 | |||
| 1932 | Ga0495678_001683 | |||
| 1933 | Ga0495678_014476 | |||
| 1934 | Ga0495678_104850 | |||
| 1935 | Ga0495682_0000592 | |||
| 1936 | Ga0495682_0005199 | |||
| 1937 | Ga0495682_0005886 | |||
| 1938 | Ga0495682_0036361 | |||
| 1939 | Ga0495682_0039974 | |||
| 1940 | Ga0501222_002985 | |||
| 1941 | Ga0501227_010138 | |||
| 1942 | Ga0501079_0175321 | |||
| 1943 | Ga0501279_000604 | |||
| 1944 | Ga0501279_007476 | |||
| 1945 | Ga0501035_0002298 | |||
| 1946 | Ga0501044_0084631 | |||
| 1947 | nmdc:mga03683_81946_c1 | |||
| 1948 | nmdc:mga0k408_27923_c1 | |||
| 1949 | nmdc:mga0k408_89023_c1 | |||
| 1950 | nmdc:mga07m45_114_c1 | |||
| 1951 | nmdc:mga07m45_122567_c1 | |||
| 1952 | nmdc:mga07m45_27493_c1 | |||
| 1953 | nmdc:mga08y16_222388_c1 | |||
| 1954 | nmdc:mga0a205_908027_c1 | |||
| 1955 | nmdc:mga0sz30_51147_c1 | |||
| 1956 | Ga0500644_0038062 | |||
| 1957 | Ga0500646_0004926 | |||
| 1958 | Ga0500583_0057596 | |||
| 1959 | Ga0500651_0001617 | |||
| 1960 | Ga0500569_005574 | |||
| 1961 | Ga0500617_065104 | |||
| 1962 | Ga0500628_001756 | |||
| 1963 | Ga0500642_0066937 | |||
| 1964 | Ga0500652_001967 | |||
| 1965 | Ga0500568_0023578 | |||
| 1966 | Ga0500577_0017145 | |||
| 1967 | Ga0500579_112193 | |||
| 1968 | Ga0500588_0004849 | |||
| 1969 | Ga0500604_0102309 | |||
| 1970 | Ga0500622_0000142 | |||
| 1971 | Ga0500622_0007351 | |||
| 1972 | Ga0590075_021093 | |||
| 1973 | Ga0587106_025958 | |||
| 1974 | Ga0466962_0001945 | |||
| 1975 | Ga0466962_0005671 | |||
| 1976 | Ga0466962_0020531 | |||
| 1977 | Ga0466962_0041639 | |||
| 1978 | 2738740082 | |||
| 1979 | 2738844158 | |||
| 1980 | 2739274282 | |||
| 1981 | 2739343326 | |||
| 1982 | 8040169719 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ofw-assembly2.cif.gz_F | crystal structure of arabidopsis thaliana dj-1d | 0.9864 | 3 | 188 |
| 3uk7-assembly1.cif.gz_C | crystal structure of arabidopsis thaliana dj-1d | 0.9854 | 3 | 188 |
| 4ogg-assembly1.cif.gz_A | crystal structure of arabidopsis thaliana dj-1d with glyoxylate as substrate analog | 0.9786 | 3 | 193 |
| 4ogg-assembly1.cif.gz_A | crystal structure of arabidopsis thaliana dj-1d with glyoxylate as substrate analog | 0.9636 | 3 | 193 |
| 3l18-assembly1.cif.gz_B | ton1285, an intracellular protease from thermococcus onnurineus na1 | 0.9598 | 3 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q869N4_1_194_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9862 | 2 | 193 | 3.40.50.880 |
| af_Q869N4_1_194_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9761 | 2 | 193 | 3.40.50.880 |
| af_K7LRD9_234_303_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9758 | 131 | 193 | 3.40.50.720 |
| 4oggA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.972 | 2 | 190 | 3.40.50.880 |
| af_K7LRD9_139_233_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9696 | 3 | 104 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352IP49-F1-model_v4 | Protease | 1.003 | 96 | 182 |
GO:0006508
GO:0008233 |
| AF-A0A645H380-F1-model_v4 | Protein/nucleic acid deglycase 2 (EC 3.1.2.-) | 1.002 | 88 | 193 |
GO:0016787
|
| AF-A0A645I3M4-F1-model_v4 | DJ-1/PfpI domain-containing protein | 0.9974 | 114 | 193 |
|
| AF-A0A7C2USW2-F1-model_v4 | Protease | 0.9951 | 103 | 193 |
GO:0006508
GO:0008233 |
| AF-A0A1H7K720-F1-model_v4 | Protease I | 0.9939 | 1 | 193 |
GO:0006508
GO:0008233 |