F487645
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 991 | 398 | 1982 | 289 |
Family's Representative Sequence
| Representative Sequence | 3300048913|Ga0496110_0285480|Ga0496110_0285480_374_1342 |
| Length | 322 |
| Sequence | MSGAGPSQGANRAPPGGSAAAKPHAWGDRASAIARDTLAARAPFDRSLLLVAPATAFMLLLFIYPFLYGLILSFEPAEGGALANYRKFFTTDNLWPTIWTTLRLALPATLINVGVALPIAYKMRVKSRWQRWITTLLVVPITLGTVLIAEGMLTYFGPKGWLAQFLQLLHAYDGSIRLTHNYWGVLISLVISGFPFAFLLILSYVTGIDPVLARAASTLGADAKAQFRHIYLPLLAPGLAMCFCLAFVQAFSVFPSAVLLGAPAGPTRVISIAAYEAAFEQYDYSLASAIAMIMGFVQLIIVAVVLWLRNWFYKGPVTGGKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 223 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 232 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 247 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 264 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 265 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 266 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 267 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 268 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 269 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 270 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 275 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 321 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 322 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 331 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 340 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 343 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 344 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 345 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 346 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 347 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 348 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 349 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 350 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 351 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 352 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 353 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 354 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 355 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 356 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 357 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 358 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 359 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 360 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 361 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 362 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 363 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 364 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 365 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 366 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 367 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 368 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 369 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 370 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 371 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 372 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 373 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 374 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 375 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 376 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 377 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 378 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 379 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 380 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 381 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 382 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 383 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 384 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 385 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 386 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 387 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 388 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 389 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 390 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 391 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 392 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 393 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 394 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 395 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 396 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 397 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 398 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.25 |
| Metatranscriptomes | 0.1 |
| Isolates | 5.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.83 |
| Nodule | 1.01 |
| Rhizoplane | 3.63 |
| Rhizosphere | 86.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496110_0285480 | 3300048913 | Bacteria | 1503 |
| 2 | JGI24743J22301_10006726 | 3300001991 | Bacteria | 1971 |
| 3 | JGI24735J21928_10008671 | 3300002067 | Bacteria | 3282 |
| 4 | JGI24735J21928_10017314 | 3300002067 | Bacteria | 2229 |
| 5 | JGI24751J29686_10040518 | 3300002459 | Bacteria | 964 |
| 6 | rootH1_10003113 | 3300003316 | Bacteria | 2311 |
| 7 | rootH1_10343265 | 3300003323 | Bacteria | 1623 |
| 8 | JGI25160J50197_1000236 | 3300003354 | Bacteria | 42883 |
| 9 | Ga0055532_1000529 | 3300003758 | Bacteria | 16669 |
| 10 | Ga0055532_1001430 | 3300003758 | Bacteria | 6659 |
| 11 | Ga0055532_1004571 | 3300003758 | Bacteria | 2066 |
| 12 | Ga0055527_1000165 | 3300003760 | Bacteria | 45611 |
| 13 | Ga0055527_1000291 | 3300003760 | Bacteria | 29060 |
| 14 | Ga0055535_1000333 | 3300003761 | Bacteria | 47259 |
| 15 | Ga0055535_1000506 | 3300003761 | Bacteria | 34557 |
| 16 | Ga0055542_1000502 | 3300003762 | Bacteria | 35790 |
| 17 | Ga0055542_1002955 | 3300003762 | Bacteria | 4988 |
| 18 | Ga0055529_1000495 | 3300003763 | Bacteria | 35799 |
| 19 | Ga0055528_1001289 | 3300003790 | Bacteria | 15738 |
| 20 | Ga0065165_1011560 | 3300005262 | Bacteria | 3663 |
| 21 | Ga0065712_10078953 | 3300005290 | Bacteria | 3278 |
| 22 | Ga0065715_10108897 | 3300005293 | Bacteria | 2692 |
| 23 | Ga0065715_10126016 | 3300005293 | Bacteria | 2118 |
| 24 | Ga0065715_10193289 | 3300005293 | Bacteria | 1402 |
| 25 | Ga0065715_10203218 | 3300005293 | Bacteria | 1350 |
| 26 | Ga0065715_10251129 | 3300005293 | Bacteria | 1167 |
| 27 | Ga0070658_10006346 | 3300005327 | Bacteria | 9581 |
| 28 | Ga0070658_10006768 | 3300005327 | Bacteria | 9277 |
| 29 | Ga0070658_10062587 | 3300005327 | Bacteria | 3032 |
| 30 | Ga0070658_10157722 | 3300005327 | Bacteria | 1903 |
| 31 | Ga0070658_10196970 | 3300005327 | Bacteria | 1699 |
| 32 | Ga0070676_10003093 | 3300005328 | Bacteria | 8605 |
| 33 | Ga0070676_10004726 | 3300005328 | Bacteria | 7200 |
| 34 | Ga0070676_10049210 | 3300005328 | Bacteria | 2467 |
| 35 | Ga0070676_10060133 | 3300005328 | Bacteria | 2255 |
| 36 | Ga0070676_10093843 | 3300005328 | Bacteria | 1843 |
| 37 | Ga0070676_10105288 | 3300005328 | Bacteria | 1749 |
| 38 | Ga0070676_10199751 | 3300005328 | Bacteria | 1310 |
| 39 | Ga0070683_100000454 | 3300005329 | Bacteria | 28615 |
| 40 | Ga0070683_100031128 | 3300005329 | Bacteria | 4848 |
| 41 | Ga0070683_100046604 | 3300005329 | Bacteria | 4005 |
| 42 | Ga0070690_100028837 | 3300005330 | Bacteria | 3440 |
| 43 | Ga0070670_100001523 | 3300005331 | Bacteria | 18653 |
| 44 | Ga0070670_100002732 | 3300005331 | Bacteria | 14566 |
| 45 | Ga0070670_100004869 | 3300005331 | Bacteria | 11293 |
| 46 | Ga0070670_100028105 | 3300005331 | Bacteria | 4839 |
| 47 | Ga0070670_100089465 | 3300005331 | Bacteria | 2646 |
| 48 | Ga0070677_10000608 | 3300005333 | Bacteria | 12052 |
| 49 | Ga0070677_10098646 | 3300005333 | Unclassified | 1284 |
| 50 | Ga0068869_100000015 | 3300005334 | Bacteria | 70868 |
| 51 | Ga0068869_100004811 | 3300005334 | Bacteria | 8431 |
| 52 | Ga0068869_100006724 | 3300005334 | Bacteria | 7307 |
| 53 | Ga0068869_100012305 | 3300005334 | Bacteria | 5650 |
| 54 | Ga0068869_100041478 | 3300005334 | Bacteria | 3297 |
| 55 | Ga0068869_100158796 | 3300005334 | Bacteria | 1759 |
| 56 | Ga0068869_100209073 | 3300005334 | Bacteria | 1542 |
| 57 | Ga0070666_10001213 | 3300005335 | Bacteria | 15563 |
| 58 | Ga0070666_10001856 | 3300005335 | Bacteria | 12876 |
| 59 | Ga0070666_10004191 | 3300005335 | Bacteria | 8752 |
| 60 | Ga0070666_10019117 | 3300005335 | Bacteria | 4419 |
| 61 | Ga0070666_10043313 | 3300005335 | Bacteria | 3014 |
| 62 | Ga0070680_100002253 | 3300005336 | Bacteria | 14249 |
| 63 | Ga0070680_100011395 | 3300005336 | Bacteria | 6877 |
| 64 | Ga0070680_100021871 | 3300005336 | Bacteria | 5087 |
| 65 | Ga0070682_100004503 | 3300005337 | Bacteria | 7739 |
| 66 | Ga0068868_100002229 | 3300005338 | Bacteria | 13399 |
| 67 | Ga0068868_100163738 | 3300005338 | Bacteria | 1838 |
| 68 | Ga0070660_100000231 | 3300005339 | Bacteria | 37089 |
| 69 | Ga0070660_100004158 | 3300005339 | Bacteria | 9995 |
| 70 | Ga0070660_100037224 | 3300005339 | Bacteria | 3689 |
| 71 | Ga0070660_100039433 | 3300005339 | Bacteria | 3590 |
| 72 | Ga0070660_100102512 | 3300005339 | Bacteria | 2268 |
| 73 | Ga0070689_100019606 | 3300005340 | Bacteria | 5003 |
| 74 | Ga0070689_100064268 | 3300005340 | Bacteria | 2856 |
| 75 | Ga0070689_100067664 | 3300005340 | Bacteria | 2785 |
| 76 | Ga0070689_100076079 | 3300005340 | Bacteria | 2629 |
| 77 | Ga0070689_100196469 | 3300005340 | Bacteria | 1645 |
| 78 | Ga0070687_100017319 | 3300005343 | Bacteria | 3310 |
| 79 | Ga0070661_100011154 | 3300005344 | Bacteria | 6259 |
| 80 | Ga0070661_100049329 | 3300005344 | Bacteria | 3081 |
| 81 | Ga0070661_100082387 | 3300005344 | Bacteria | 2376 |
| 82 | Ga0070661_100123021 | 3300005344 | Bacteria | 1944 |
| 83 | Ga0070661_100125343 | 3300005344 | Bacteria | 1926 |
| 84 | Ga0070692_10021809 | 3300005345 | Bacteria | 3120 |
| 85 | Ga0070692_10154358 | 3300005345 | Bacteria | 1310 |
| 86 | Ga0070668_100001229 | 3300005347 | Bacteria | 18229 |
| 87 | Ga0070668_100004530 | 3300005347 | Bacteria | 10310 |
| 88 | Ga0070668_100008037 | 3300005347 | Bacteria | 7837 |
| 89 | Ga0070668_100033474 | 3300005347 | Bacteria | 3914 |
| 90 | Ga0070668_100327267 | 3300005347 | Bacteria | 1291 |
| 91 | Ga0070669_100005168 | 3300005353 | Bacteria | 9441 |
| 92 | Ga0070669_100026716 | 3300005353 | Bacteria | 4154 |
| 93 | Ga0070669_100103504 | 3300005353 | Bacteria | 2151 |
| 94 | Ga0070675_100004784 | 3300005354 | Bacteria | 10324 |
| 95 | Ga0070675_100013828 | 3300005354 | Bacteria | 6353 |
| 96 | Ga0070675_100058692 | 3300005354 | Bacteria | 3174 |
| 97 | Ga0070675_100108423 | 3300005354 | Bacteria | 2345 |
| 98 | Ga0070675_100120222 | 3300005354 | Bacteria | 2231 |
| 99 | Ga0070671_100004318 | 3300005355 | Bacteria | 11249 |
| 100 | Ga0070671_100013552 | 3300005355 | Bacteria | 6573 |
| 101 | Ga0070671_100018991 | 3300005355 | Bacteria | 5591 |
| 102 | Ga0070671_100021189 | 3300005355 | Bacteria | 5307 |
| 103 | Ga0070671_100024445 | 3300005355 | Bacteria | 4945 |
| 104 | Ga0070671_100053878 | 3300005355 | Bacteria | 3343 |
| 105 | Ga0070674_100018083 | 3300005356 | Bacteria | 4448 |
| 106 | Ga0070674_100053519 | 3300005356 | Bacteria | 2788 |
| 107 | Ga0070674_100121963 | 3300005356 | Bacteria | 1931 |
| 108 | Ga0070674_100131336 | 3300005356 | Bacteria | 1867 |
| 109 | Ga0070674_100172183 | 3300005356 | Bacteria | 1652 |
| 110 | Ga0070674_100247464 | 3300005356 | Bacteria | 1399 |
| 111 | Ga0070673_100001202 | 3300005364 | Bacteria | 14931 |
| 112 | Ga0070673_100001616 | 3300005364 | Bacteria | 13326 |
| 113 | Ga0070673_100005127 | 3300005364 | Bacteria | 8352 |
| 114 | Ga0070673_100145388 | 3300005364 | Bacteria | 2004 |
| 115 | Ga0070673_100156491 | 3300005364 | Bacteria | 1934 |
| 116 | Ga0070688_100011000 | 3300005365 | Bacteria | 5014 |
| 117 | Ga0070688_100017865 | 3300005365 | Bacteria | 4079 |
| 118 | Ga0070688_100025614 | 3300005365 | Bacteria | 3494 |
| 119 | Ga0070659_100000015 | 3300005366 | Bacteria | 176475 |
| 120 | Ga0070659_100098221 | 3300005366 | Bacteria | 2354 |
| 121 | Ga0070659_100187438 | 3300005366 | Bacteria | 1699 |
| 122 | Ga0070659_100293248 | 3300005366 | Bacteria | 1355 |
| 123 | Ga0070667_100005954 | 3300005367 | Bacteria | 10143 |
| 124 | Ga0070667_100014941 | 3300005367 | Bacteria | 6413 |
| 125 | Ga0070667_100023193 | 3300005367 | Bacteria | 5149 |
| 126 | Ga0070667_100023264 | 3300005367 | Bacteria | 5140 |
| 127 | Ga0070667_100058424 | 3300005367 | Bacteria | 3261 |
| 128 | Ga0070667_100122210 | 3300005367 | Bacteria | 2266 |
| 129 | Ga0070667_100176637 | 3300005367 | Bacteria | 1887 |
| 130 | Ga0070709_10048924 | 3300005434 | Bacteria | 2640 |
| 131 | Ga0070714_100083120 | 3300005435 | Bacteria | 2791 |
| 132 | Ga0070714_100413780 | 3300005435 | Bacteria | 1276 |
| 133 | Ga0070713_100001999 | 3300005436 | Bacteria | 13163 |
| 134 | Ga0070713_100003579 | 3300005436 | Bacteria | 10266 |
| 135 | Ga0070713_100059742 | 3300005436 | Bacteria | 3185 |
| 136 | Ga0070710_10004286 | 3300005437 | Bacteria | 6765 |
| 137 | Ga0070710_10016215 | 3300005437 | Bacteria | 3786 |
| 138 | Ga0070710_10034285 | 3300005437 | Bacteria | 2761 |
| 139 | Ga0070701_10196407 | 3300005438 | Bacteria | 1190 |
| 140 | Ga0070711_100099472 | 3300005439 | Bacteria | 2113 |
| 141 | Ga0070711_100289416 | 3300005439 | Bacteria | 1299 |
| 142 | Ga0070705_100002375 | 3300005440 | Bacteria | 9484 |
| 143 | Ga0070705_100021287 | 3300005440 | Bacteria | 3447 |
| 144 | Ga0070694_100139268 | 3300005444 | Bacteria | 1760 |
| 145 | Ga0070708_100001279 | 3300005445 | Bacteria | 19358 |
| 146 | Ga0070708_100284848 | 3300005445 | Bacteria | 1555 |
| 147 | Ga0070708_100431725 | 3300005445 | Bacteria | 1242 |
| 148 | Ga0070663_100017460 | 3300005455 | Bacteria | 4684 |
| 149 | Ga0070663_100023239 | 3300005455 | Bacteria | 4153 |
| 150 | Ga0070663_100031228 | 3300005455 | Bacteria | 3659 |
| 151 | Ga0070663_100045825 | 3300005455 | Bacteria | 3091 |
| 152 | Ga0070663_100127938 | 3300005455 | Bacteria | 1926 |
| 153 | Ga0070663_100181572 | 3300005455 | Bacteria | 1633 |
| 154 | Ga0070678_100000394 | 3300005456 | Bacteria | 20544 |
| 155 | Ga0070678_100002575 | 3300005456 | Bacteria | 9962 |
| 156 | Ga0070678_100041405 | 3300005456 | Bacteria | 3265 |
| 157 | Ga0070678_100089109 | 3300005456 | Bacteria | 2361 |
| 158 | Ga0070678_100264278 | 3300005456 | Bacteria | 1448 |
| 159 | Ga0070662_100015670 | 3300005457 | Bacteria | 5082 |
| 160 | Ga0070662_100066819 | 3300005457 | Bacteria | 2639 |
| 161 | Ga0070662_100102118 | 3300005457 | Bacteria | 2172 |
| 162 | Ga0070681_10012309 | 3300005458 | Bacteria | 8483 |
| 163 | Ga0070681_10257301 | 3300005458 | Bacteria | 1658 |
| 164 | Ga0070681_10359272 | 3300005458 | Bacteria | 1367 |
| 165 | Ga0070681_10447135 | 3300005458 | Bacteria | 1204 |
| 166 | Ga0068867_100009294 | 3300005459 | Bacteria | 6938 |
| 167 | Ga0068867_100028141 | 3300005459 | Bacteria | 4044 |
| 168 | Ga0068867_100074756 | 3300005459 | Bacteria | 2541 |
| 169 | Ga0068867_100194980 | 3300005459 | Bacteria | 1618 |
| 170 | Ga0068867_100200868 | 3300005459 | Bacteria | 1596 |
| 171 | Ga0068867_100267813 | 3300005459 | Bacteria | 1395 |
| 172 | Ga0070685_10022697 | 3300005466 | Bacteria | 3425 |
| 173 | Ga0070685_10078427 | 3300005466 | Bacteria | 1974 |
| 174 | Ga0070706_100053494 | 3300005467 | Bacteria | 3726 |
| 175 | Ga0070706_100109114 | 3300005467 | Bacteria | 2575 |
| 176 | Ga0070706_100245063 | 3300005467 | Bacteria | 1673 |
| 177 | Ga0070706_100249293 | 3300005467 | Bacteria | 1658 |
| 178 | Ga0070707_100131345 | 3300005468 | Bacteria | 2435 |
| 179 | Ga0070707_100377905 | 3300005468 | Bacteria | 1376 |
| 180 | Ga0070698_100056466 | 3300005471 | Bacteria | 3978 |
| 181 | Ga0070698_100271730 | 3300005471 | Bacteria | 1627 |
| 182 | Ga0070699_100004652 | 3300005518 | Bacteria | 12144 |
| 183 | Ga0070699_100008030 | 3300005518 | Bacteria | 9163 |
| 184 | Ga0070699_100020092 | 3300005518 | Bacteria | 5756 |
| 185 | Ga0070699_100061347 | 3300005518 | Bacteria | 3259 |
| 186 | Ga0070699_100369223 | 3300005518 | Bacteria | 1294 |
| 187 | Ga0070679_100009436 | 3300005530 | Bacteria | 9230 |
| 188 | Ga0070679_100070981 | 3300005530 | Bacteria | 3473 |
| 189 | Ga0070679_100072601 | 3300005530 | Bacteria | 3433 |
| 190 | Ga0070679_100192778 | 3300005530 | Bacteria | 2006 |
| 191 | Ga0070684_100006472 | 3300005535 | Bacteria | 9068 |
| 192 | Ga0070684_100025350 | 3300005535 | Bacteria | 4984 |
| 193 | Ga0070697_100099548 | 3300005536 | Bacteria | 2413 |
| 194 | Ga0068853_100019074 | 3300005539 | Bacteria | 5682 |
| 195 | Ga0068853_100092025 | 3300005539 | Bacteria | 2667 |
| 196 | Ga0068853_100324020 | 3300005539 | Bacteria | 1429 |
| 197 | Ga0070672_100000434 | 3300005543 | Bacteria | 24355 |
| 198 | Ga0070672_100003673 | 3300005543 | Bacteria | 9971 |
| 199 | Ga0070672_100007079 | 3300005543 | Bacteria | 7587 |
| 200 | Ga0070672_100016234 | 3300005543 | Bacteria | 5326 |
| 201 | Ga0070672_100118185 | 3300005543 | Bacteria | 2168 |
| 202 | Ga0070672_100235938 | 3300005543 | Bacteria | 1537 |
| 203 | Ga0070672_100268141 | 3300005543 | Bacteria | 1441 |
| 204 | Ga0070686_100021332 | 3300005544 | Bacteria | 3849 |
| 205 | Ga0070695_100005465 | 3300005545 | Bacteria | 7479 |
| 206 | Ga0070695_100034647 | 3300005545 | Bacteria | 3166 |
| 207 | Ga0070695_100135328 | 3300005545 | Bacteria | 1703 |
| 208 | Ga0070696_100022524 | 3300005546 | Bacteria | 4281 |
| 209 | Ga0070696_100149106 | 3300005546 | Bacteria | 1715 |
| 210 | Ga0070696_100181544 | 3300005546 | Bacteria | 1561 |
| 211 | Ga0070693_100003106 | 3300005547 | Bacteria | 7707 |
| 212 | Ga0070693_100063873 | 3300005547 | Bacteria | 2147 |
| 213 | Ga0070693_100326579 | 3300005547 | Bacteria | 1043 |
| 214 | Ga0070693_100418827 | 3300005547 | Bacteria | 933 |
| 215 | Ga0070665_100002535 | 3300005548 | Bacteria | 20073 |
| 216 | Ga0070665_100007703 | 3300005548 | Bacteria | 10936 |
| 217 | Ga0070665_100020584 | 3300005548 | Bacteria | 6629 |
| 218 | Ga0070665_100025223 | 3300005548 | Bacteria | 5989 |
| 219 | Ga0070665_100030674 | 3300005548 | Bacteria | 5409 |
| 220 | Ga0070665_100088880 | 3300005548 | Bacteria | 3095 |
| 221 | Ga0070665_100622016 | 3300005548 | Bacteria | 1093 |
| 222 | Ga0070704_100096513 | 3300005549 | Bacteria | 2216 |
| 223 | Ga0070704_100149735 | 3300005549 | Bacteria | 1833 |
| 224 | Ga0070704_100306464 | 3300005549 | Bacteria | 1325 |
| 225 | Ga0068855_100001505 | 3300005563 | Bacteria | 29183 |
| 226 | Ga0068855_100001891 | 3300005563 | Bacteria | 25987 |
| 227 | Ga0068855_100033764 | 3300005563 | Bacteria | 6104 |
| 228 | Ga0068855_100348031 | 3300005563 | Bacteria | 1633 |
| 229 | Ga0070664_100019567 | 3300005564 | Bacteria | 5571 |
| 230 | Ga0070664_100026663 | 3300005564 | Bacteria | 4796 |
| 231 | Ga0070664_100087648 | 3300005564 | Bacteria | 2691 |
| 232 | Ga0070664_100261454 | 3300005564 | Bacteria | 1557 |
| 233 | Ga0070664_100263493 | 3300005564 | Bacteria | 1551 |
| 234 | Ga0068857_100007630 | 3300005577 | Bacteria | 9320 |
| 235 | Ga0068857_100032159 | 3300005577 | Bacteria | 4638 |
| 236 | Ga0068857_100122774 | 3300005577 | Bacteria | 2340 |
| 237 | Ga0068857_100280452 | 3300005577 | Bacteria | 1533 |
| 238 | Ga0068854_100022522 | 3300005578 | Bacteria | 4294 |
| 239 | Ga0068854_100047307 | 3300005578 | Bacteria | 3065 |
| 240 | Ga0068856_100008479 | 3300005614 | Bacteria | 10001 |
| 241 | Ga0068856_100015479 | 3300005614 | Bacteria | 7370 |
| 242 | Ga0068856_100022650 | 3300005614 | Bacteria | 6108 |
| 243 | Ga0068856_100096635 | 3300005614 | Bacteria | 2943 |
| 244 | Ga0068856_100099001 | 3300005614 | Bacteria | 2906 |
| 245 | Ga0070702_100033335 | 3300005615 | Bacteria | 2832 |
| 246 | Ga0068852_100000645 | 3300005616 | Bacteria | 22820 |
| 247 | Ga0068852_100065433 | 3300005616 | Bacteria | 3171 |
| 248 | Ga0068852_100177147 | 3300005616 | Bacteria | 2003 |
| 249 | Ga0068852_100344926 | 3300005616 | Bacteria | 1452 |
| 250 | Ga0068852_100581214 | 3300005616 | Bacteria | 1123 |
| 251 | Ga0068859_100000331 | 3300005617 | Bacteria | 47138 |
| 252 | Ga0068859_100008681 | 3300005617 | Bacteria | 10273 |
| 253 | Ga0068859_100036470 | 3300005617 | Bacteria | 4936 |
| 254 | Ga0068859_100067230 | 3300005617 | Bacteria | 3618 |
| 255 | Ga0068864_100000526 | 3300005618 | Bacteria | 33060 |
| 256 | Ga0068864_100000849 | 3300005618 | Bacteria | 25790 |
| 257 | Ga0068864_100001068 | 3300005618 | Bacteria | 22999 |
| 258 | Ga0068864_100019211 | 3300005618 | Bacteria | 5712 |
| 259 | Ga0068864_100023542 | 3300005618 | Bacteria | 5172 |
| 260 | Ga0068864_100032679 | 3300005618 | Bacteria | 4422 |
| 261 | Ga0068864_100121637 | 3300005618 | Bacteria | 2335 |
| 262 | Ga0068866_10000993 | 3300005718 | Bacteria | 12483 |
| 263 | Ga0068866_10079879 | 3300005718 | Bacteria | 1754 |
| 264 | Ga0068861_100000187 | 3300005719 | Bacteria | 33035 |
| 265 | Ga0068861_100004897 | 3300005719 | Bacteria | 9015 |
| 266 | Ga0068861_100029305 | 3300005719 | Bacteria | 4027 |
| 267 | Ga0068861_100401363 | 3300005719 | Bacteria | 1216 |
| 268 | Ga0068851_10003217 | 3300005834 | Bacteria | 7239 |
| 269 | Ga0068851_10003822 | 3300005834 | Bacteria | 6739 |
| 270 | Ga0068851_10005867 | 3300005834 | Bacteria | 5592 |
| 271 | Ga0068851_10052719 | 3300005834 | Bacteria | 2069 |
| 272 | Ga0068870_10003294 | 3300005840 | Bacteria | 6825 |
| 273 | Ga0068870_10056459 | 3300005840 | Bacteria | 2096 |
| 274 | Ga0068870_10073684 | 3300005840 | Bacteria | 1868 |
| 275 | Ga0068870_10137404 | 3300005840 | Bacteria | 1427 |
| 276 | Ga0068863_100004993 | 3300005841 | Bacteria | 13078 |
| 277 | Ga0068863_100006237 | 3300005841 | Bacteria | 11709 |
| 278 | Ga0068863_100007018 | 3300005841 | Bacteria | 11038 |
| 279 | Ga0068863_100049048 | 3300005841 | Bacteria | 4003 |
| 280 | Ga0068863_100049372 | 3300005841 | Bacteria | 3990 |
| 281 | Ga0068863_100274003 | 3300005841 | Bacteria | 1634 |
| 282 | Ga0068863_100321709 | 3300005841 | Bacteria | 1502 |
| 283 | Ga0068858_100000899 | 3300005842 | Bacteria | 30862 |
| 284 | Ga0068858_100005057 | 3300005842 | Bacteria | 12927 |
| 285 | Ga0068858_100030165 | 3300005842 | Bacteria | 5036 |
| 286 | Ga0068858_100032019 | 3300005842 | Bacteria | 4885 |
| 287 | Ga0068858_100179701 | 3300005842 | Bacteria | 1997 |
| 288 | Ga0068860_100003702 | 3300005843 | Bacteria | 15736 |
| 289 | Ga0068860_100014070 | 3300005843 | Bacteria | 7850 |
| 290 | Ga0068860_100026558 | 3300005843 | Bacteria | 5580 |
| 291 | Ga0068860_100050577 | 3300005843 | Bacteria | 3955 |
| 292 | Ga0068860_100112383 | 3300005843 | Bacteria | 2605 |
| 293 | Ga0068860_100219385 | 3300005843 | Bacteria | 1847 |
| 294 | Ga0068862_100004170 | 3300005844 | Bacteria | 12238 |
| 295 | Ga0068862_100024488 | 3300005844 | Bacteria | 5065 |
| 296 | Ga0068862_100051250 | 3300005844 | Bacteria | 3529 |
| 297 | Ga0081539_10002047 | 3300005985 | Bacteria | 30305 |
| 298 | Ga0081539_10039266 | 3300005985 | Bacteria | 2796 |
| 299 | Ga0075363_100020671 | 3300006048 | Bacteria | 3304 |
| 300 | Ga0075364_10007258 | 3300006051 | Bacteria | 6571 |
| 301 | Ga0070715_10117600 | 3300006163 | Bacteria | 1263 |
| 302 | Ga0070716_100041774 | 3300006173 | Bacteria | 2557 |
| 303 | Ga0070716_100329657 | 3300006173 | Bacteria | 1073 |
| 304 | Ga0070712_100019398 | 3300006175 | Bacteria | 4435 |
| 305 | Ga0070712_100022948 | 3300006175 | Bacteria | 4114 |
| 306 | Ga0075362_10004680 | 3300006177 | Bacteria | 4938 |
| 307 | Ga0075366_10029864 | 3300006195 | Bacteria | 3203 |
| 308 | Ga0097621_100010681 | 3300006237 | Bacteria | 6728 |
| 309 | Ga0097621_100017997 | 3300006237 | Bacteria | 5384 |
| 310 | Ga0097621_100028099 | 3300006237 | Bacteria | 4431 |
| 311 | Ga0097621_100046797 | 3300006237 | Bacteria | 3502 |
| 312 | Ga0097621_100167735 | 3300006237 | Bacteria | 1891 |
| 313 | Ga0068871_100003956 | 3300006358 | Bacteria | 10230 |
| 314 | Ga0068871_100010868 | 3300006358 | Bacteria | 6666 |
| 315 | Ga0068871_100038158 | 3300006358 | Bacteria | 3834 |
| 316 | Ga0068871_100064178 | 3300006358 | Bacteria | 3006 |
| 317 | Ga0075428_100087287 | 3300006844 | Bacteria | 3403 |
| 318 | Ga0075433_10118470 | 3300006852 | Bacteria | 2350 |
| 319 | Ga0075434_100018468 | 3300006871 | Bacteria | 6738 |
| 320 | Ga0075434_100185691 | 3300006871 | Bacteria | 2100 |
| 321 | Ga0075434_100366464 | 3300006871 | Bacteria | 1462 |
| 322 | Ga0068865_100005913 | 3300006881 | Bacteria | 7445 |
| 323 | Ga0068865_100007669 | 3300006881 | Bacteria | 6649 |
| 324 | Ga0068865_100091202 | 3300006881 | Bacteria | 2211 |
| 325 | Ga0068865_100243130 | 3300006881 | Bacteria | 1417 |
| 326 | Ga0075436_100000314 | 3300006914 | Bacteria | 30875 |
| 327 | Ga0075436_100020104 | 3300006914 | Bacteria | 4582 |
| 328 | Ga0097620_100000331 | 3300006931 | Bacteria | 47138 |
| 329 | Ga0097620_100008681 | 3300006931 | Bacteria | 10273 |
| 330 | Ga0097620_100036471 | 3300006931 | Bacteria | 4936 |
| 331 | Ga0097620_100067228 | 3300006931 | Bacteria | 3618 |
| 332 | Ga0105240_10000989 | 3300009093 | Bacteria | 50717 |
| 333 | Ga0105240_10013066 | 3300009093 | Bacteria | 11427 |
| 334 | Ga0105240_10015022 | 3300009093 | Bacteria | 10542 |
| 335 | Ga0105240_10153070 | 3300009093 | Bacteria | 2745 |
| 336 | Ga0105240_10173891 | 3300009093 | Bacteria | 2548 |
| 337 | Ga0105240_10264569 | 3300009093 | Bacteria | 1983 |
| 338 | Ga0105240_10328494 | 3300009093 | Bacteria | 1741 |
| 339 | Ga0105245_10023880 | 3300009098 | Bacteria | 5366 |
| 340 | Ga0105245_10059715 | 3300009098 | Bacteria | 3434 |
| 341 | Ga0105245_10117418 | 3300009098 | Bacteria | 2482 |
| 342 | Ga0105245_10741868 | 3300009098 | Bacteria | 1017 |
| 343 | Ga0105247_10126230 | 3300009101 | Bacteria | 1663 |
| 344 | Ga0114129_10347583 | 3300009147 | Bacteria | 1965 |
| 345 | Ga0105243_10118299 | 3300009148 | Bacteria | 2229 |
| 346 | Ga0105243_10156967 | 3300009148 | Bacteria | 1957 |
| 347 | Ga0105243_10309682 | 3300009148 | Bacteria | 1434 |
| 348 | Ga0105241_10054017 | 3300009174 | Bacteria | 3074 |
| 349 | Ga0105241_10222684 | 3300009174 | Bacteria | 1587 |
| 350 | Ga0105242_10023311 | 3300009176 | Bacteria | 4879 |
| 351 | Ga0105242_10094435 | 3300009176 | Bacteria | 2523 |
| 352 | Ga0105242_10209776 | 3300009176 | Bacteria | 1735 |
| 353 | Ga0105242_10676333 | 3300009176 | Bacteria | 1007 |
| 354 | Ga0105248_10011677 | 3300009177 | Bacteria | 9679 |
| 355 | Ga0105248_10013964 | 3300009177 | Bacteria | 8836 |
| 356 | Ga0105248_10029084 | 3300009177 | Bacteria | 6160 |
| 357 | Ga0105248_10142305 | 3300009177 | Bacteria | 2705 |
| 358 | Ga0105248_10195608 | 3300009177 | Bacteria | 2278 |
| 359 | Ga0105248_10324946 | 3300009177 | Bacteria | 1733 |
| 360 | Ga0105248_10885332 | 3300009177 | Bacteria | 1008 |
| 361 | Ga0105237_10006471 | 3300009545 | Bacteria | 12986 |
| 362 | Ga0105237_10019311 | 3300009545 | Bacteria | 7040 |
| 363 | Ga0105237_10235797 | 3300009545 | Bacteria | 1831 |
| 364 | Ga0105238_10035626 | 3300009551 | Bacteria | 5058 |
| 365 | Ga0105238_10050615 | 3300009551 | Bacteria | 4181 |
| 366 | Ga0105238_10094427 | 3300009551 | Bacteria | 2979 |
| 367 | Ga0105238_10188636 | 3300009551 | Bacteria | 2038 |
| 368 | Ga0105249_10167153 | 3300009553 | Bacteria | 2130 |
| 369 | Ga0105249_10218750 | 3300009553 | Bacteria | 1873 |
| 370 | Ga0105249_10280411 | 3300009553 | Bacteria | 1664 |
| 371 | Ga0105239_10025705 | 3300010375 | Bacteria | 6484 |
| 372 | Ga0105246_10104550 | 3300011119 | Bacteria | 2068 |
| 373 | Ga0105246_10188645 | 3300011119 | Bacteria | 1594 |
| 374 | Ga0157373_10041727 | 3300013100 | Bacteria | 3281 |
| 375 | Ga0157373_10067873 | 3300013100 | Bacteria | 2521 |
| 376 | Ga0157371_10004781 | 3300013102 | Bacteria | 11675 |
| 377 | Ga0157371_10093005 | 3300013102 | Bacteria | 2136 |
| 378 | Ga0157371_10163036 | 3300013102 | Bacteria | 1592 |
| 379 | Ga0157371_10194751 | 3300013102 | Bacteria | 1452 |
| 380 | Ga0157370_10001647 | 3300013104 | Bacteria | 27561 |
| 381 | Ga0157370_10004665 | 3300013104 | Bacteria | 15650 |
| 382 | Ga0157370_10005411 | 3300013104 | Bacteria | 14324 |
| 383 | Ga0157370_10015482 | 3300013104 | Bacteria | 7752 |
| 384 | Ga0157370_10117236 | 3300013104 | Bacteria | 2487 |
| 385 | Ga0157370_10135432 | 3300013104 | Bacteria | 2296 |
| 386 | Ga0157369_10000559 | 3300013105 | Bacteria | 48965 |
| 387 | Ga0157369_10006053 | 3300013105 | Bacteria | 14039 |
| 388 | Ga0157369_10049870 | 3300013105 | Bacteria | 4536 |
| 389 | Ga0157374_10000126 | 3300013296 | Bacteria | 69928 |
| 390 | Ga0157374_10004928 | 3300013296 | Bacteria | 11200 |
| 391 | Ga0157374_10017827 | 3300013296 | Bacteria | 6256 |
| 392 | Ga0157374_10045124 | 3300013296 | Bacteria | 4078 |
| 393 | Ga0157374_10064044 | 3300013296 | Bacteria | 3449 |
| 394 | Ga0157374_10460168 | 3300013296 | Bacteria | 1274 |
| 395 | Ga0157378_10030159 | 3300013297 | Bacteria | 4791 |
| 396 | Ga0157378_10033507 | 3300013297 | Bacteria | 4542 |
| 397 | Ga0157378_10304685 | 3300013297 | Bacteria | 1543 |
| 398 | Ga0157378_10476124 | 3300013297 | Bacteria | 1243 |
| 399 | Ga0163162_10035080 | 3300013306 | Bacteria | 4995 |
| 400 | Ga0163162_10050785 | 3300013306 | Bacteria | 4159 |
| 401 | Ga0163162_10105385 | 3300013306 | Bacteria | 2914 |
| 402 | Ga0163162_10180838 | 3300013306 | Bacteria | 2235 |
| 403 | Ga0163162_10730839 | 3300013306 | Bacteria | 1110 |
| 404 | Ga0157372_10000580 | 3300013307 | Bacteria | 39970 |
| 405 | Ga0157372_10081827 | 3300013307 | Bacteria | 3655 |
| 406 | Ga0157372_10198972 | 3300013307 | Bacteria | 2321 |
| 407 | Ga0157372_10258955 | 3300013307 | Bacteria | 2020 |
| 408 | Ga0157372_10325277 | 3300013307 | Bacteria | 1790 |
| 409 | Ga0157372_10617941 | 3300013307 | Bacteria | 1263 |
| 410 | Ga0157375_10006657 | 3300013308 | Bacteria | 10059 |
| 411 | Ga0157375_10019767 | 3300013308 | Bacteria | 6137 |
| 412 | Ga0157375_10046714 | 3300013308 | Bacteria | 4224 |
| 413 | Ga0157375_10056170 | 3300013308 | Bacteria | 3885 |
| 414 | Ga0157375_10336961 | 3300013308 | Bacteria | 1674 |
| 415 | Ga0157375_10461184 | 3300013308 | Bacteria | 1436 |
| 416 | Ga0157375_10697649 | 3300013308 | Bacteria | 1169 |
| 417 | Ga0163163_10001056 | 3300014325 | Bacteria | 23365 |
| 418 | Ga0163163_10035766 | 3300014325 | Bacteria | 4821 |
| 419 | Ga0163163_10066386 | 3300014325 | Bacteria | 3583 |
| 420 | Ga0163163_10067380 | 3300014325 | Bacteria | 3559 |
| 421 | Ga0163163_10526028 | 3300014325 | Bacteria | 1245 |
| 422 | Ga0157380_10037615 | 3300014326 | Bacteria | 3750 |
| 423 | Ga0157380_10052474 | 3300014326 | Bacteria | 3229 |
| 424 | Ga0157380_10342180 | 3300014326 | Bacteria | 1396 |
| 425 | Ga0157380_10402408 | 3300014326 | Bacteria | 1299 |
| 426 | Ga0157377_10011431 | 3300014745 | Bacteria | 4431 |
| 427 | Ga0157377_10164946 | 3300014745 | Bacteria | 1381 |
| 428 | Ga0157379_10000045 | 3300014968 | Bacteria | 75128 |
| 429 | Ga0157379_10001972 | 3300014968 | Bacteria | 16977 |
| 430 | Ga0157379_10004399 | 3300014968 | Bacteria | 12070 |
| 431 | Ga0157379_10024081 | 3300014968 | Bacteria | 5403 |
| 432 | Ga0157376_10017442 | 3300014969 | Bacteria | 5477 |
| 433 | Ga0157376_10028128 | 3300014969 | Bacteria | 4465 |
| 434 | Ga0157376_10046564 | 3300014969 | Bacteria | 3577 |
| 435 | Ga0157376_10049836 | 3300014969 | Bacteria | 3470 |
| 436 | Ga0157376_10565346 | 3300014969 | Bacteria | 1127 |
| 437 | Ga0182006_1014521 | 3300015261 | Bacteria | 3392 |
| 438 | Ga0183361_10002 | 3300016635 | Bacteria | 907642 |
| 439 | Ga0163161_10031880 | 3300017792 | Bacteria | 3759 |
| 440 | Ga0163161_10116683 | 3300017792 | Bacteria | 2002 |
| 441 | Ga0163161_10260664 | 3300017792 | Bacteria | 1354 |
| 442 | Ga0213872_10082080 | 3300021361 | Bacteria | 1448 |
| 443 | Ga0213876_10009758 | 3300021384 | Bacteria | 5166 |
| 444 | Ga0213875_10000544 | 3300021388 | Bacteria | 30876 |
| 445 | Ga0209566_100258 | 3300025225 | Bacteria | 50542 |
| 446 | Ga0209672_100037 | 3300025228 | Bacteria | 287776 |
| 447 | Ga0209672_100080 | 3300025228 | Bacteria | 143481 |
| 448 | Ga0209147_100049 | 3300025229 | Bacteria | 274980 |
| 449 | Ga0209147_100071 | 3300025229 | Bacteria | 215861 |
| 450 | Ga0209147_100091 | 3300025229 | Bacteria | 168353 |
| 451 | Ga0209258_100066 | 3300025242 | Bacteria | 287776 |
| 452 | Ga0209258_100082 | 3300025242 | Bacteria | 247739 |
| 453 | Ga0209148_1000195 | 3300025254 | Bacteria | 109654 |
| 454 | Ga0209148_1000664 | 3300025254 | Bacteria | 29497 |
| 455 | Ga0209759_1002833 | 3300025256 | Bacteria | 7313 |
| 456 | Ga0209759_1010607 | 3300025256 | Bacteria | 2688 |
| 457 | Ga0207666_1000977 | 3300025271 | Bacteria | 3394 |
| 458 | Ga0209455_1000172 | 3300025272 | Bacteria | 109654 |
| 459 | Ga0209455_1000530 | 3300025272 | Bacteria | 26704 |
| 460 | Ga0209673_1000076 | 3300025273 | Bacteria | 230907 |
| 461 | Ga0209130_1007823 | 3300025284 | Bacteria | 3242 |
| 462 | Ga0207673_1005919 | 3300025290 | Bacteria | 1503 |
| 463 | Ga0209564_1004566 | 3300025295 | Bacteria | 8388 |
| 464 | Ga0207426_1000021 | 3300025302 | Bacteria | 556343 |
| 465 | Ga0207697_10000594 | 3300025315 | Bacteria | 20589 |
| 466 | Ga0207697_10042841 | 3300025315 | Bacteria | 1860 |
| 467 | Ga0207656_10002348 | 3300025321 | Bacteria | 6355 |
| 468 | Ga0207656_10038973 | 3300025321 | Bacteria | 2007 |
| 469 | Ga0207682_10000298 | 3300025893 | Bacteria | 22419 |
| 470 | Ga0207682_10002121 | 3300025893 | Bacteria | 8985 |
| 471 | Ga0207682_10002878 | 3300025893 | Bacteria | 7597 |
| 472 | Ga0207682_10070846 | 3300025893 | Bacteria | 1477 |
| 473 | Ga0207682_10082468 | 3300025893 | Bacteria | 1381 |
| 474 | Ga0207682_10093231 | 3300025893 | Bacteria | 1308 |
| 475 | Ga0207692_10014897 | 3300025898 | Bacteria | 3408 |
| 476 | Ga0207642_10019328 | 3300025899 | Bacteria | 2636 |
| 477 | Ga0207642_10216183 | 3300025899 | Bacteria | 1068 |
| 478 | Ga0207688_10000914 | 3300025901 | Bacteria | 14900 |
| 479 | Ga0207680_10003569 | 3300025903 | Bacteria | 7315 |
| 480 | Ga0207680_10007043 | 3300025903 | Bacteria | 5463 |
| 481 | Ga0207680_10027223 | 3300025903 | Bacteria | 3180 |
| 482 | Ga0207680_10030223 | 3300025903 | Bacteria | 3053 |
| 483 | Ga0207680_10059696 | 3300025903 | Bacteria | 2318 |
| 484 | Ga0207647_10001075 | 3300025904 | Bacteria | 21061 |
| 485 | Ga0207647_10002066 | 3300025904 | Bacteria | 15341 |
| 486 | Ga0207647_10036553 | 3300025904 | Bacteria | 3120 |
| 487 | Ga0207647_10065560 | 3300025904 | Bacteria | 2204 |
| 488 | Ga0207699_10036232 | 3300025906 | Bacteria | 2811 |
| 489 | Ga0207645_10002475 | 3300025907 | Bacteria | 14495 |
| 490 | Ga0207645_10035948 | 3300025907 | Bacteria | 3180 |
| 491 | Ga0207645_10045426 | 3300025907 | Bacteria | 2807 |
| 492 | Ga0207645_10094920 | 3300025907 | Bacteria | 1920 |
| 493 | Ga0207643_10000777 | 3300025908 | Bacteria | 19461 |
| 494 | Ga0207643_10018919 | 3300025908 | Bacteria | 3772 |
| 495 | Ga0207643_10071662 | 3300025908 | Bacteria | 1995 |
| 496 | Ga0207643_10076519 | 3300025908 | Bacteria | 1933 |
| 497 | Ga0207643_10200029 | 3300025908 | Bacteria | 1216 |
| 498 | Ga0207705_10010614 | 3300025909 | Bacteria | 6693 |
| 499 | Ga0207705_10038414 | 3300025909 | Bacteria | 3427 |
| 500 | Ga0207705_10307194 | 3300025909 | Bacteria | 1217 |
| 501 | Ga0207684_10047181 | 3300025910 | Bacteria | 3654 |
| 502 | Ga0207654_10030006 | 3300025911 | Bacteria | 2981 |
| 503 | Ga0207654_10197242 | 3300025911 | Bacteria | 1323 |
| 504 | Ga0207707_10012372 | 3300025912 | Bacteria | 7416 |
| 505 | Ga0207707_10023744 | 3300025912 | Bacteria | 5362 |
| 506 | Ga0207707_10028294 | 3300025912 | Bacteria | 4899 |
| 507 | Ga0207707_10199572 | 3300025912 | Bacteria | 1744 |
| 508 | Ga0207695_10002708 | 3300025913 | Bacteria | 25849 |
| 509 | Ga0207695_10039807 | 3300025913 | Bacteria | 5049 |
| 510 | Ga0207695_10041810 | 3300025913 | Bacteria | 4903 |
| 511 | Ga0207695_10087808 | 3300025913 | Bacteria | 3132 |
| 512 | Ga0207695_10191350 | 3300025913 | Bacteria | 1963 |
| 513 | Ga0207695_10279198 | 3300025913 | Bacteria | 1564 |
| 514 | Ga0207671_10041955 | 3300025914 | Bacteria | 3386 |
| 515 | Ga0207693_10000415 | 3300025915 | Bacteria | 38698 |
| 516 | Ga0207693_10008998 | 3300025915 | Bacteria | 8151 |
| 517 | Ga0207663_10014895 | 3300025916 | Bacteria | 4273 |
| 518 | Ga0207660_10016821 | 3300025917 | Bacteria | 4849 |
| 519 | Ga0207660_10029744 | 3300025917 | Bacteria | 3750 |
| 520 | Ga0207660_10214737 | 3300025917 | Bacteria | 1507 |
| 521 | Ga0207662_10014678 | 3300025918 | Bacteria | 4397 |
| 522 | Ga0207662_10186065 | 3300025918 | Bacteria | 1338 |
| 523 | Ga0207657_10000014 | 3300025919 | Bacteria | 175779 |
| 524 | Ga0207657_10000709 | 3300025919 | Bacteria | 35416 |
| 525 | Ga0207657_10001175 | 3300025919 | Bacteria | 27784 |
| 526 | Ga0207657_10003742 | 3300025919 | Bacteria | 16166 |
| 527 | Ga0207657_10013752 | 3300025919 | Bacteria | 7923 |
| 528 | Ga0207657_10076189 | 3300025919 | Bacteria | 2830 |
| 529 | Ga0207657_10080360 | 3300025919 | Bacteria | 2740 |
| 530 | Ga0207649_10044429 | 3300025920 | Bacteria | 2720 |
| 531 | Ga0207649_10068338 | 3300025920 | Bacteria | 2259 |
| 532 | Ga0207649_10108906 | 3300025920 | Bacteria | 1847 |
| 533 | Ga0207652_10020779 | 3300025921 | Bacteria | 5410 |
| 534 | Ga0207652_10029911 | 3300025921 | Bacteria | 4559 |
| 535 | Ga0207652_10052490 | 3300025921 | Bacteria | 3499 |
| 536 | Ga0207652_10072891 | 3300025921 | Bacteria | 2987 |
| 537 | Ga0207646_10091523 | 3300025922 | Bacteria | 2722 |
| 538 | Ga0207646_10101913 | 3300025922 | Bacteria | 2573 |
| 539 | Ga0207681_10003673 | 3300025923 | Bacteria | 9538 |
| 540 | Ga0207681_10029729 | 3300025923 | Bacteria | 3554 |
| 541 | Ga0207681_10101134 | 3300025923 | Bacteria | 2079 |
| 542 | Ga0207681_10354124 | 3300025923 | Bacteria | 1176 |
| 543 | Ga0207694_10028254 | 3300025924 | Bacteria | 4276 |
| 544 | Ga0207694_10128776 | 3300025924 | Bacteria | 2027 |
| 545 | Ga0207694_10355315 | 3300025924 | Bacteria | 1213 |
| 546 | Ga0207650_10002369 | 3300025925 | Bacteria | 13105 |
| 547 | Ga0207650_10002799 | 3300025925 | Bacteria | 12042 |
| 548 | Ga0207650_10002854 | 3300025925 | Bacteria | 11930 |
| 549 | Ga0207650_10004490 | 3300025925 | Bacteria | 9539 |
| 550 | Ga0207650_10007113 | 3300025925 | Bacteria | 7624 |
| 551 | Ga0207650_10041860 | 3300025925 | Bacteria | 3359 |
| 552 | Ga0207650_10043355 | 3300025925 | Bacteria | 3302 |
| 553 | Ga0207650_10158407 | 3300025925 | Bacteria | 1792 |
| 554 | Ga0207659_10002875 | 3300025926 | Bacteria | 10249 |
| 555 | Ga0207659_10003272 | 3300025926 | Bacteria | 9704 |
| 556 | Ga0207659_10004738 | 3300025926 | Bacteria | 8247 |
| 557 | Ga0207659_10008158 | 3300025926 | Bacteria | 6483 |
| 558 | Ga0207687_10018080 | 3300025927 | Bacteria | 4651 |
| 559 | Ga0207687_10043270 | 3300025927 | Bacteria | 3103 |
| 560 | Ga0207687_10100502 | 3300025927 | Bacteria | 2128 |
| 561 | Ga0207687_10539758 | 3300025927 | Bacteria | 977 |
| 562 | Ga0207700_10000031 | 3300025928 | Bacteria | 130086 |
| 563 | Ga0207700_10005665 | 3300025928 | Bacteria | 7496 |
| 564 | Ga0207700_10105967 | 3300025928 | Bacteria | 2252 |
| 565 | Ga0207664_10007727 | 3300025929 | Bacteria | 7463 |
| 566 | Ga0207664_10137430 | 3300025929 | Bacteria | 2064 |
| 567 | Ga0207664_10436044 | 3300025929 | Bacteria | 1168 |
| 568 | Ga0207644_10002148 | 3300025931 | Bacteria | 12793 |
| 569 | Ga0207644_10005225 | 3300025931 | Bacteria | 8476 |
| 570 | Ga0207644_10008481 | 3300025931 | Bacteria | 6728 |
| 571 | Ga0207644_10010560 | 3300025931 | Bacteria | 6088 |
| 572 | Ga0207644_10044073 | 3300025931 | Bacteria | 3168 |
| 573 | Ga0207644_10229802 | 3300025931 | Bacteria | 1473 |
| 574 | Ga0207644_10300976 | 3300025931 | Bacteria | 1292 |
| 575 | Ga0207644_10396917 | 3300025931 | Bacteria | 1127 |
| 576 | Ga0207690_10000023 | 3300025932 | Bacteria | 196155 |
| 577 | Ga0207690_10290936 | 3300025932 | Bacteria | 1275 |
| 578 | Ga0207706_10000002 | 3300025933 | Bacteria | 360309 |
| 579 | Ga0207706_10001696 | 3300025933 | Bacteria | 21719 |
| 580 | Ga0207706_10056698 | 3300025933 | Bacteria | 3453 |
| 581 | Ga0207706_10102213 | 3300025933 | Bacteria | 2522 |
| 582 | Ga0207706_10386439 | 3300025933 | Bacteria | 1214 |
| 583 | Ga0207686_10000198 | 3300025934 | Bacteria | 46402 |
| 584 | Ga0207686_10012324 | 3300025934 | Bacteria | 4700 |
| 585 | Ga0207670_10002399 | 3300025936 | Bacteria | 9820 |
| 586 | Ga0207670_10072361 | 3300025936 | Bacteria | 2386 |
| 587 | Ga0207670_10124562 | 3300025936 | Bacteria | 1879 |
| 588 | Ga0207669_10006740 | 3300025937 | Bacteria | 5271 |
| 589 | Ga0207669_10012415 | 3300025937 | Bacteria | 4187 |
| 590 | Ga0207669_10019474 | 3300025937 | Bacteria | 3534 |
| 591 | Ga0207669_10146878 | 3300025937 | Bacteria | 1645 |
| 592 | Ga0207669_10302292 | 3300025937 | Bacteria | 1216 |
| 593 | Ga0207704_10014838 | 3300025938 | Bacteria | 3949 |
| 594 | Ga0207704_10146046 | 3300025938 | Bacteria | 1662 |
| 595 | Ga0207704_10168223 | 3300025938 | Bacteria | 1569 |
| 596 | Ga0207704_10253054 | 3300025938 | Bacteria | 1323 |
| 597 | Ga0207665_10004770 | 3300025939 | Bacteria | 9019 |
| 598 | Ga0207665_10049697 | 3300025939 | Bacteria | 2818 |
| 599 | Ga0207665_10382225 | 3300025939 | Bacteria | 1069 |
| 600 | Ga0207691_10000006 | 3300025940 | Bacteria | 161922 |
| 601 | Ga0207691_10001801 | 3300025940 | Bacteria | 21033 |
| 602 | Ga0207691_10004008 | 3300025940 | Bacteria | 14283 |
| 603 | Ga0207691_10006366 | 3300025940 | Bacteria | 11408 |
| 604 | Ga0207691_10006549 | 3300025940 | Bacteria | 11245 |
| 605 | Ga0207691_10019166 | 3300025940 | Bacteria | 6478 |
| 606 | Ga0207691_10032269 | 3300025940 | Bacteria | 4884 |
| 607 | Ga0207691_10117216 | 3300025940 | Bacteria | 2363 |
| 608 | Ga0207691_10153618 | 3300025940 | Bacteria | 2023 |
| 609 | Ga0207691_10165842 | 3300025940 | Bacteria | 1936 |
| 610 | Ga0207691_10342118 | 3300025940 | Bacteria | 1280 |
| 611 | Ga0207691_10343379 | 3300025940 | Bacteria | 1278 |
| 612 | Ga0207691_10374549 | 3300025940 | Bacteria | 1216 |
| 613 | Ga0207711_10000961 | 3300025941 | Bacteria | 27639 |
| 614 | Ga0207711_10007443 | 3300025941 | Bacteria | 9164 |
| 615 | Ga0207711_10024416 | 3300025941 | Bacteria | 5065 |
| 616 | Ga0207711_10054146 | 3300025941 | Bacteria | 3442 |
| 617 | Ga0207711_10149358 | 3300025941 | Bacteria | 2108 |
| 618 | Ga0207689_10000030 | 3300025942 | Bacteria | 97584 |
| 619 | Ga0207689_10008383 | 3300025942 | Bacteria | 9002 |
| 620 | Ga0207689_10009443 | 3300025942 | Bacteria | 8423 |
| 621 | Ga0207689_10027139 | 3300025942 | Bacteria | 4794 |
| 622 | Ga0207689_10123975 | 3300025942 | Bacteria | 2125 |
| 623 | Ga0207689_10180238 | 3300025942 | Bacteria | 1742 |
| 624 | Ga0207689_10233456 | 3300025942 | Bacteria | 1520 |
| 625 | Ga0207661_10033927 | 3300025944 | Bacteria | 3964 |
| 626 | Ga0207661_10040821 | 3300025944 | Bacteria | 3650 |
| 627 | Ga0207661_10047817 | 3300025944 | Bacteria | 3398 |
| 628 | Ga0207661_10177634 | 3300025944 | Bacteria | 1857 |
| 629 | Ga0207661_10199834 | 3300025944 | Bacteria | 1757 |
| 630 | Ga0207679_10035876 | 3300025945 | Bacteria | 3512 |
| 631 | Ga0207679_10158837 | 3300025945 | Bacteria | 1849 |
| 632 | Ga0207679_10242166 | 3300025945 | Bacteria | 1529 |
| 633 | Ga0207679_10265352 | 3300025945 | Bacteria | 1466 |
| 634 | Ga0207679_10289628 | 3300025945 | Bacteria | 1407 |
| 635 | Ga0207667_10003662 | 3300025949 | Bacteria | 18949 |
| 636 | Ga0207667_10009443 | 3300025949 | Bacteria | 11485 |
| 637 | Ga0207667_10059631 | 3300025949 | Bacteria | 3996 |
| 638 | Ga0207667_10134162 | 3300025949 | Bacteria | 2550 |
| 639 | Ga0207667_10157659 | 3300025949 | Bacteria | 2335 |
| 640 | Ga0207667_10191190 | 3300025949 | Bacteria | 2100 |
| 641 | Ga0207667_10205686 | 3300025949 | Bacteria | 2018 |
| 642 | Ga0207651_10002592 | 3300025960 | Bacteria | 8641 |
| 643 | Ga0207651_10023718 | 3300025960 | Bacteria | 3780 |
| 644 | Ga0207651_10039250 | 3300025960 | Bacteria | 3120 |
| 645 | Ga0207651_10212521 | 3300025960 | Bacteria | 1558 |
| 646 | Ga0207651_10225909 | 3300025960 | Bacteria | 1516 |
| 647 | Ga0207651_10283516 | 3300025960 | Bacteria | 1370 |
| 648 | Ga0207712_10130951 | 3300025961 | Bacteria | 1911 |
| 649 | Ga0207712_10238117 | 3300025961 | Bacteria | 1465 |
| 650 | Ga0207668_10002769 | 3300025972 | Bacteria | 10253 |
| 651 | Ga0207668_10018612 | 3300025972 | Bacteria | 4375 |
| 652 | Ga0207668_10018640 | 3300025972 | Bacteria | 4373 |
| 653 | Ga0207668_10022062 | 3300025972 | Bacteria | 4069 |
| 654 | Ga0207668_10030471 | 3300025972 | Bacteria | 3545 |
| 655 | Ga0207668_10299067 | 3300025972 | Bacteria | 1327 |
| 656 | Ga0207668_10383285 | 3300025972 | Bacteria | 1184 |
| 657 | Ga0207668_10626073 | 3300025972 | Bacteria | 939 |
| 658 | Ga0207640_10011255 | 3300025981 | Bacteria | 5060 |
| 659 | Ga0207640_10171378 | 3300025981 | Bacteria | 1618 |
| 660 | Ga0207640_10211937 | 3300025981 | Bacteria | 1476 |
| 661 | Ga0207658_10001775 | 3300025986 | Bacteria | 16178 |
| 662 | Ga0207658_10002011 | 3300025986 | Bacteria | 15164 |
| 663 | Ga0207658_10016664 | 3300025986 | Bacteria | 5057 |
| 664 | Ga0207658_10020229 | 3300025986 | Bacteria | 4609 |
| 665 | Ga0207658_10024305 | 3300025986 | Bacteria | 4238 |
| 666 | Ga0207658_10054986 | 3300025986 | Bacteria | 2948 |
| 667 | Ga0207658_10101189 | 3300025986 | Bacteria | 2258 |
| 668 | Ga0207658_10316662 | 3300025986 | Bacteria | 1349 |
| 669 | Ga0207677_10000439 | 3300026023 | Bacteria | 28110 |
| 670 | Ga0207677_10020379 | 3300026023 | Bacteria | 4025 |
| 671 | Ga0207677_10242232 | 3300026023 | Bacteria | 1460 |
| 672 | Ga0207703_10000143 | 3300026035 | Bacteria | 84508 |
| 673 | Ga0207703_10001820 | 3300026035 | Bacteria | 19010 |
| 674 | Ga0207703_10038014 | 3300026035 | Bacteria | 3838 |
| 675 | Ga0207703_10053414 | 3300026035 | Bacteria | 3284 |
| 676 | Ga0207703_10115770 | 3300026035 | Bacteria | 2294 |
| 677 | Ga0207703_10337312 | 3300026035 | Bacteria | 1384 |
| 678 | Ga0207639_10023378 | 3300026041 | Bacteria | 4463 |
| 679 | Ga0207639_10026067 | 3300026041 | Bacteria | 4245 |
| 680 | Ga0207639_10231799 | 3300026041 | Bacteria | 1601 |
| 681 | Ga0207678_10003787 | 3300026067 | Bacteria | 13604 |
| 682 | Ga0207678_10019516 | 3300026067 | Bacteria | 5956 |
| 683 | Ga0207678_10024311 | 3300026067 | Bacteria | 5292 |
| 684 | Ga0207678_10041187 | 3300026067 | Bacteria | 4005 |
| 685 | Ga0207678_10120114 | 3300026067 | Bacteria | 2243 |
| 686 | Ga0207678_10199556 | 3300026067 | Bacteria | 1710 |
| 687 | Ga0207678_10345233 | 3300026067 | Bacteria | 1283 |
| 688 | Ga0207708_10035205 | 3300026075 | Bacteria | 3810 |
| 689 | Ga0207702_10003558 | 3300026078 | Bacteria | 14181 |
| 690 | Ga0207702_10014339 | 3300026078 | Bacteria | 6581 |
| 691 | Ga0207702_10014885 | 3300026078 | Bacteria | 6452 |
| 692 | Ga0207702_10046919 | 3300026078 | Bacteria | 3638 |
| 693 | Ga0207702_10155657 | 3300026078 | Bacteria | 2083 |
| 694 | Ga0207641_10002451 | 3300026088 | Bacteria | 17145 |
| 695 | Ga0207641_10002867 | 3300026088 | Bacteria | 15645 |
| 696 | Ga0207641_10009339 | 3300026088 | Bacteria | 8089 |
| 697 | Ga0207641_10021722 | 3300026088 | Bacteria | 5275 |
| 698 | Ga0207641_10032744 | 3300026088 | Bacteria | 4317 |
| 699 | Ga0207641_10038927 | 3300026088 | Bacteria | 3975 |
| 700 | Ga0207641_10050400 | 3300026088 | Bacteria | 3522 |
| 701 | Ga0207641_10664980 | 3300026088 | Bacteria | 1024 |
| 702 | Ga0207648_10001949 | 3300026089 | Bacteria | 22555 |
| 703 | Ga0207648_10011138 | 3300026089 | Bacteria | 8484 |
| 704 | Ga0207648_10020408 | 3300026089 | Bacteria | 5966 |
| 705 | Ga0207648_10031224 | 3300026089 | Bacteria | 4709 |
| 706 | Ga0207648_10048524 | 3300026089 | Bacteria | 3716 |
| 707 | Ga0207648_10049066 | 3300026089 | Bacteria | 3696 |
| 708 | Ga0207648_10235016 | 3300026089 | Bacteria | 1631 |
| 709 | Ga0207676_10001099 | 3300026095 | Bacteria | 20429 |
| 710 | Ga0207676_10001806 | 3300026095 | Bacteria | 15688 |
| 711 | Ga0207676_10002733 | 3300026095 | Bacteria | 12556 |
| 712 | Ga0207676_10031793 | 3300026095 | Bacteria | 3971 |
| 713 | Ga0207676_10097367 | 3300026095 | Bacteria | 2430 |
| 714 | Ga0207676_10197383 | 3300026095 | Bacteria | 1775 |
| 715 | Ga0207674_10001272 | 3300026116 | Bacteria | 32948 |
| 716 | Ga0207674_10001685 | 3300026116 | Bacteria | 28374 |
| 717 | Ga0207674_10008968 | 3300026116 | Bacteria | 11494 |
| 718 | Ga0207674_10017603 | 3300026116 | Bacteria | 7795 |
| 719 | Ga0207674_10151784 | 3300026116 | Bacteria | 2273 |
| 720 | Ga0207674_10324418 | 3300026116 | Bacteria | 1489 |
| 721 | Ga0207675_100003099 | 3300026118 | Bacteria | 16290 |
| 722 | Ga0207675_100021077 | 3300026118 | Bacteria | 6074 |
| 723 | Ga0207675_100021286 | 3300026118 | Bacteria | 6039 |
| 724 | Ga0207675_100039504 | 3300026118 | Bacteria | 4404 |
| 725 | Ga0207683_10000011 | 3300026121 | Bacteria | 140261 |
| 726 | Ga0207683_10000235 | 3300026121 | Bacteria | 49040 |
| 727 | Ga0207683_10006617 | 3300026121 | Bacteria | 9918 |
| 728 | Ga0207683_10012514 | 3300026121 | Bacteria | 7239 |
| 729 | Ga0207683_10061620 | 3300026121 | Bacteria | 3302 |
| 730 | Ga0207683_10113946 | 3300026121 | Bacteria | 2422 |
| 731 | Ga0207698_10021405 | 3300026142 | Bacteria | 4471 |
| 732 | Ga0207698_10036797 | 3300026142 | Bacteria | 3597 |
| 733 | Ga0207698_10130548 | 3300026142 | Bacteria | 2146 |
| 734 | Ga0207698_10339454 | 3300026142 | Bacteria | 1414 |
| 735 | Ga0207698_10361703 | 3300026142 | Bacteria | 1374 |
| 736 | Ga0209371_1000713 | 3300027312 | Bacteria | 28089 |
| 737 | Ga0209982_1006264 | 3300027552 | Bacteria | 1728 |
| 738 | Ga0209974_10039673 | 3300027876 | Bacteria | 1566 |
| 739 | Ga0207428_10122320 | 3300027907 | Bacteria | 1995 |
| 740 | Ga0268266_10015819 | 3300028379 | Bacteria | 6460 |
| 741 | Ga0268266_10039426 | 3300028379 | Bacteria | 4024 |
| 742 | Ga0268266_10060694 | 3300028379 | Bacteria | 3260 |
| 743 | Ga0268266_10549733 | 3300028379 | Bacteria | 1106 |
| 744 | Ga0268265_10040737 | 3300028380 | Bacteria | 3432 |
| 745 | Ga0268265_10051581 | 3300028380 | Bacteria | 3106 |
| 746 | Ga0268265_10314273 | 3300028380 | Bacteria | 1416 |
| 747 | Ga0268265_10593518 | 3300028380 | Bacteria | 1057 |
| 748 | Ga0268264_10004002 | 3300028381 | Bacteria | 12614 |
| 749 | Ga0268264_10036916 | 3300028381 | Bacteria | 4027 |
| 750 | Ga0268264_10191704 | 3300028381 | Bacteria | 1864 |
| 751 | Ga0268264_10290682 | 3300028381 | Bacteria | 1535 |
| 752 | Ga0265318_10000258 | 3300028577 | Bacteria | 46107 |
| 753 | Ga0268256_1000608 | 3300030500 | Bacteria | 28089 |
| 754 | Ga0265330_10002502 | 3300031235 | Bacteria | 9995 |
| 755 | Ga0265332_10000138 | 3300031238 | Bacteria | 60108 |
| 756 | Ga0265332_10000707 | 3300031238 | Bacteria | 21147 |
| 757 | Ga0265320_10000284 | 3300031240 | Bacteria | 40965 |
| 758 | Ga0265329_10000076 | 3300031242 | Bacteria | 44517 |
| 759 | Ga0265329_10008238 | 3300031242 | Bacteria | 3963 |
| 760 | Ga0265340_10000468 | 3300031247 | Bacteria | 21877 |
| 761 | Ga0265339_10000961 | 3300031249 | Bacteria | 22055 |
| 762 | Ga0265331_10000310 | 3300031250 | Bacteria | 53265 |
| 763 | Ga0265331_10003288 | 3300031250 | Bacteria | 10510 |
| 764 | Ga0265331_10122666 | 3300031250 | Bacteria | 1188 |
| 765 | Ga0265327_10003395 | 3300031251 | Bacteria | 15300 |
| 766 | Ga0265327_10016933 | 3300031251 | Bacteria | 4601 |
| 767 | Ga0265316_10002148 | 3300031344 | Bacteria | 20727 |
| 768 | Ga0265316_10137696 | 3300031344 | Bacteria | 1836 |
| 769 | Ga0307408_100070513 | 3300031548 | Bacteria | 2580 |
| 770 | Ga0265313_10000089 | 3300031595 | Bacteria | 90452 |
| 771 | Ga0265314_10000211 | 3300031711 | Bacteria | 86370 |
| 772 | Ga0265314_10054250 | 3300031711 | Bacteria | 2775 |
| 773 | Ga0265342_10000390 | 3300031712 | Bacteria | 48465 |
| 774 | Ga0265342_10012918 | 3300031712 | Bacteria | 5630 |
| 775 | Ga0307405_10037797 | 3300031731 | Bacteria | 2904 |
| 776 | Ga0307413_10000069 | 3300031824 | Bacteria | 25469 |
| 777 | Ga0307410_10014522 | 3300031852 | Bacteria | 4637 |
| 778 | Ga0307406_10013056 | 3300031901 | Bacteria | 4748 |
| 779 | Ga0307407_10020270 | 3300031903 | Bacteria | 3403 |
| 780 | Ga0307412_10000039 | 3300031911 | Bacteria | 182976 |
| 781 | Ga0307412_10027150 | 3300031911 | Bacteria | 3566 |
| 782 | Ga0307409_100006556 | 3300031995 | Bacteria | 6857 |
| 783 | Ga0307416_100054913 | 3300032002 | Bacteria | 3204 |
| 784 | Ga0307416_100254409 | 3300032002 | Bacteria | 1712 |
| 785 | Ga0307411_10004260 | 3300032005 | Bacteria | 6816 |
| 786 | Ga0373926_0007908 | 3300035083 | Bacteria | 3543 |
| 787 | Ga0373934_0025723 | 3300035086 | Bacteria | 2282 |
| 788 | Ga0373953_0003180 | 3300035117 | Bacteria | 5083 |
| 789 | Ga0373954_0002627 | 3300035118 | Bacteria | 7562 |
| 790 | Ga0373954_0022208 | 3300035118 | Bacteria | 2876 |
| 791 | Ga0373956_0128260 | 3300035119 | Bacteria | 1187 |
| 792 | Ga0373955_0002970 | 3300035172 | Bacteria | 7428 |
| 793 | Ga0373955_0040742 | 3300035172 | Bacteria | 2486 |
| 794 | Ga0373955_0158570 | 3300035172 | Bacteria | 1334 |
| 795 | Ga0373924_0030605 | 3300035410 | Bacteria | 2159 |
| 796 | Ga0373935_0028386 | 3300035692 | Bacteria | 3459 |
| 797 | Ga0373935_0271960 | 3300035692 | Bacteria | 1191 |
| 798 | Ga0373927_0008088 | 3300035695 | Bacteria | 7098 |
| 799 | Ga0373927_0097169 | 3300035695 | Bacteria | 1914 |
| 800 | Ga0373937_0084051 | 3300036401 | Bacteria | 2944 |
| 801 | Ga0373937_0135525 | 3300036401 | Bacteria | 2302 |
| 802 | Ga0373937_0168887 | 3300036401 | Bacteria | 2052 |
| 803 | Ga0373937_0280184 | 3300036401 | Bacteria | 1574 |
| 804 | Ga0373925_0063963 | 3300037068 | Bacteria | 2768 |
| 805 | Ga0373925_0425478 | 3300037068 | Bacteria | 1085 |
| 806 | Ga0395900_0000986 | 3300037418 | Bacteria | 37037 |
| 807 | Ga0395900_0257250 | 3300037418 | Bacteria | 1745 |
| 808 | Ga0395898_0031382 | 3300037466 | Bacteria | 5309 |
| 809 | Ga0395898_0085169 | 3300037466 | Bacteria | 3046 |
| 810 | Ga0395898_0637838 | 3300037466 | Bacteria | 1008 |
| 811 | Ga0395905_0000160 | 3300037471 | Bacteria | 111265 |
| 812 | Ga0395905_0026803 | 3300037471 | Bacteria | 5436 |
| 813 | Ga0436364_0439553 | 3300037853 | Bacteria | 5248 |
| 814 | Ga0436364_1346273 | 3300037853 | Bacteria | 1440 |
| 815 | Ga0395901_0398462 | 3300038443 | Bacteria | 1414 |
| 816 | Ga0436365_0989741 | 3300039437 | Bacteria | 1635 |
| 817 | Ga0436365_1069777 | 3300039437 | Bacteria | 2252 |
| 818 | Ga0436365_1151289 | 3300039437 | Bacteria | 1586 |
| 819 | Ga0436361_0117653 | 3300039447 | Bacteria | 5759 |
| 820 | Ga0436361_0354175 | 3300039447 | Bacteria | 2379 |
| 821 | Ga0436363_0104264 | 3300039450 | Bacteria | 1273 |
| 822 | Ga0439448_0004602 | 3300042005 | Bacteria | 3902 |
| 823 | Ga0466969_0006212 | 3300044656 | Bacteria | 6357 |
| 824 | Ga0466969_0020802 | 3300044656 | Bacteria | 3395 |
| 825 | Ga0466972_0062670 | 3300044658 | Bacteria | 1782 |
| 826 | Ga0466973_0026204 | 3300044659 | Bacteria | 5596 |
| 827 | Ga0466977_0000069 | 3300044666 | Bacteria | 19753 |
| 828 | Ga0466965_0025867 | 3300044683 | Bacteria | 2843 |
| 829 | Ga0466966_0005693 | 3300044684 | Bacteria | 8198 |
| 830 | Ga0466966_0009878 | 3300044684 | Bacteria | 6325 |
| 831 | Ga0466961_0113759 | 3300044693 | Bacteria | 1701 |
| 832 | Ga0466963_0032526 | 3300044694 | Bacteria | 3378 |
| 833 | Ga0466963_0170948 | 3300044694 | Bacteria | 1515 |
| 834 | Ga0466971_0097913 | 3300044719 | Bacteria | 1346 |
| 835 | Ga0466968_0017187 | 3300044735 | Bacteria | 2888 |
| 836 | Ga0466959_0000837 | 3300045049 | Bacteria | 18178 |
| 837 | Ga0466959_0047353 | 3300045049 | Bacteria | 3162 |
| 838 | Ga0466958_0022018 | 3300045836 | Bacteria | 3728 |
| 839 | Ga0495629_0019844 | 3300046459 | Bacteria | 4797 |
| 840 | Ga0495629_0067247 | 3300046459 | Bacteria | 2501 |
| 841 | Ga0495653_0142085 | 3300046463 | Bacteria | 1687 |
| 842 | Ga0495580_0057535 | 3300046472 | Bacteria | 2736 |
| 843 | Ga0495582_0041168 | 3300046473 | Bacteria | 2545 |
| 844 | Ga0495605_0013576 | 3300046474 | Bacteria | 4483 |
| 845 | Ga0495605_0051053 | 3300046474 | Bacteria | 2015 |
| 846 | Ga0495664_0008665 | 3300046477 | Bacteria | 5677 |
| 847 | Ga0495596_0023423 | 3300046500 | Bacteria | 2505 |
| 848 | Ga0495583_0031381 | 3300046506 | Bacteria | 2576 |
| 849 | Ga0495606_0166417 | 3300046507 | Bacteria | 1282 |
| 850 | Ga0495610_0024855 | 3300046512 | Bacteria | 3227 |
| 851 | Ga0495648_0013399 | 3300046524 | Bacteria | 6066 |
| 852 | Ga0495665_0024299 | 3300046531 | Bacteria | 3255 |
| 853 | Ga0495598_0038443 | 3300046537 | Bacteria | 1386 |
| 854 | Ga0495635_0008216 | 3300046663 | Bacteria | 7288 |
| 855 | Ga0495659_0051317 | 3300046664 | Bacteria | 1502 |
| 856 | Ga0495623_0146348 | 3300046679 | Bacteria | 1401 |
| 857 | Ga0495647_0017671 | 3300046681 | Bacteria | 2526 |
| 858 | Ga0495613_0042427 | 3300046689 | Bacteria | 3366 |
| 859 | Ga0495636_0100533 | 3300047318 | Bacteria | 1264 |
| 860 | Ga0495674_0095615 | 3300047319 | Bacteria | 2533 |
| 861 | Ga0495672_0014413 | 3300047320 | Bacteria | 5414 |
| 862 | Ga0495683_0067655 | 3300047323 | Bacteria | 1758 |
| 863 | Ga0495687_019914 | 3300047443 | Bacteria | 3280 |
| 864 | Ga0495687_084586 | 3300047443 | Bacteria | 1232 |
| 865 | Ga0495684_0093925 | 3300047471 | Bacteria | 2271 |
| 866 | Ga0495593_0127147 | 3300047673 | Bacteria | 1295 |
| 867 | Ga0495615_0007432 | 3300048090 | Bacteria | 2079 |
| 868 | Ga0495626_0046475 | 3300048091 | Bacteria | 2022 |
| 869 | Ga0496100_0030828 | 3300048903 | Bacteria | 3329 |
| 870 | Ga0496100_0143847 | 3300048903 | Bacteria | 1693 |
| 871 | Ga0496101_0038170 | 3300048904 | Bacteria | 3410 |
| 872 | Ga0496101_0069189 | 3300048904 | Bacteria | 2582 |
| 873 | Ga0496101_0072351 | 3300048904 | Bacteria | 2531 |
| 874 | Ga0496102_0002582 | 3300048905 | Bacteria | 15446 |
| 875 | Ga0496102_0143312 | 3300048905 | Bacteria | 2241 |
| 876 | Ga0496102_0231893 | 3300048905 | Bacteria | 1740 |
| 877 | Ga0496103_0038910 | 3300048906 | Bacteria | 2921 |
| 878 | Ga0496103_0059035 | 3300048906 | Bacteria | 2384 |
| 879 | Ga0496103_0091988 | 3300048906 | Bacteria | 1915 |
| 880 | Ga0496104_0009506 | 3300048907 | Bacteria | 8653 |
| 881 | Ga0496104_0023137 | 3300048907 | Bacteria | 5712 |
| 882 | Ga0496104_0054849 | 3300048907 | Bacteria | 3767 |
| 883 | Ga0496105_0105237 | 3300048908 | Bacteria | 2329 |
| 884 | Ga0496105_0154036 | 3300048908 | Bacteria | 1888 |
| 885 | Ga0496106_0064413 | 3300048909 | Bacteria | 2788 |
| 886 | Ga0496106_0202793 | 3300048909 | Bacteria | 1579 |
| 887 | Ga0496108_0001057 | 3300048911 | Bacteria | 21487 |
| 888 | Ga0496108_0017131 | 3300048911 | Bacteria | 5926 |
| 889 | Ga0496108_0485151 | 3300048911 | Bacteria | 1080 |
| 890 | Ga0496109_0023824 | 3300048912 | Bacteria | 5434 |
| 891 | Ga0496109_0112987 | 3300048912 | Bacteria | 2526 |
| 892 | Ga0496110_0132683 | 3300048913 | Bacteria | 2250 |
| 893 | Ga0496110_0191840 | 3300048913 | Bacteria | 1855 |
| 894 | Ga0496112_0001350 | 3300048915 | Bacteria | 18677 |
| 895 | Ga0496112_0013251 | 3300048915 | Bacteria | 7610 |
| 896 | Ga0496113_0244932 | 3300048916 | Bacteria | 1431 |
| 897 | Ga0496114_0064889 | 3300048917 | Bacteria | 3059 |
| 898 | Ga0496114_0095615 | 3300048917 | Bacteria | 2528 |
| 899 | Ga0496114_0148498 | 3300048917 | Bacteria | 2033 |
| 900 | Ga0496114_0446199 | 3300048917 | Bacteria | 1146 |
| 901 | Ga0496115_0178285 | 3300048918 | Bacteria | 1757 |
| 902 | Ga0496117_0017379 | 3300048920 | Bacteria | 6006 |
| 903 | Ga0496117_0033407 | 3300048920 | Bacteria | 3890 |
| 904 | Ga0496118_0003264 | 3300048921 | Bacteria | 20662 |
| 905 | Ga0496118_0057278 | 3300048921 | Bacteria | 2922 |
| 906 | Ga0496119_0150569 | 3300048922 | Bacteria | 1247 |
| 907 | Ga0496120_0128379 | 3300048923 | Bacteria | 1302 |
| 908 | Ga0496121_0007027 | 3300048924 | Bacteria | 13673 |
| 909 | Ga0496121_0086724 | 3300048924 | Bacteria | 2459 |
| 910 | Ga0496125_0000136 | 3300048928 | Bacteria | 160544 |
| 911 | Ga0496125_0008155 | 3300048928 | Bacteria | 11026 |
| 912 | Ga0496126_0108721 | 3300048929 | Bacteria | 2417 |
| 913 | Ga0495678_049273 | 3300049459 | Bacteria | 1638 |
| 914 | Ga0501043_0128768 | 3300049579 | Bacteria | 1984 |
| 915 | Ga0501067_0145785 | 3300049583 | Bacteria | 1319 |
| 916 | Ga0501083_0205537 | 3300049744 | Bacteria | 1284 |
| 917 | nmdc:mga03683_45948_c1 | 3300050489 | Bacteria | 1809 |
| 918 | nmdc:mga0k408_1287_c1 | 3300050493 | Bacteria | 13598 |
| 919 | nmdc:mga07m45_52653_c1 | 3300050496 | Bacteria | 2298 |
| 920 | nmdc:mga05p37_112460_c1 | 3300050507 | Bacteria | 3348 |
| 921 | nmdc:mga05p37_852801_c1 | 3300050507 | Bacteria | 989 |
| 922 | nmdc:mga0n895_183492_c1 | 3300050512 | Bacteria | 2124 |
| 923 | nmdc:mga0n895_257996_c1 | 3300050512 | Bacteria | 1769 |
| 924 | nmdc:mga0rr50_341425_c1 | 3300050513 | Bacteria | 1258 |
| 925 | nmdc:mga08x19_14029_c1 | 3300050514 | Bacteria | 4855 |
| 926 | nmdc:mga08x19_41812_c1 | 3300050514 | Bacteria | 2919 |
| 927 | nmdc:mga08x19_6410_c1 | 3300050514 | Bacteria | 6966 |
| 928 | nmdc:mga0a205_15898_c1 | 3300050515 | Bacteria | 5955 |
| 929 | nmdc:mga0a205_226439_c1 | 3300050515 | Bacteria | 1754 |
| 930 | Ga0495619_0102608 | 3300053085 | Bacteria | 1948 |
| 931 | Ga0500616_0011005 | 3300053153 | Bacteria | 5384 |
| 932 | Ga0500637_0151428 | 3300053178 | Bacteria | 1340 |
| 933 | Ga0587077_009432 | 3300059493 | Bacteria | 1481 |
| 934 | Ga0501082_0000206 | 3300060353 | Bacteria | 51494 |
| 935 | Ga0466962_0045313 | 3300061719 | Bacteria | 2102 |
| 936 | 2514053686 | 2513237166 | Bacteria | 10373764 |
| 937 | 2515689024 | 2515154123 | Bacteria | 6387382 |
| 938 | 2527077229 | 2526164713 | Bacteria | 6780608 |
| 939 | 2563060585 | 2562617112 | Bacteria | 10918404 |
| 940 | 2599741555 | 2599185239 | Bacteria | 8686614 |
| 941 | 2600811191 | 2600255067 | Bacteria | 6795583 |
| 942 | 2713475762 | 2711768613 | Bacteria | 11048459 |
| 943 | 2738819364 | 2738541296 | Bacteria | 7285013 |
| 944 | 2738831843 | 2738541298 | Bacteria | 7286732 |
| 945 | 2738873371 | 2738541306 | Bacteria | 7284992 |
| 946 | 2739185001 | 2738543002 | Bacteria | 7284546 |
| 947 | 2739219970 | 2738543008 | Bacteria | 7282815 |
| 948 | 2753265639 | 2751185782 | Bacteria | 11227053 |
| 949 | 2772642989 | 2772190715 | Bacteria | 6959372 |
| 950 | 2792838811 | 2791355137 | Bacteria | 9654227 |
| 951 | 2819630769 | 2818991452 | Bacteria | 8442785 |
| 952 | 2855673035 | 2855670206 | Bacteria | 7120389 |
| 953 | 2855679196 | 2855676851 | Bacteria | 7063653 |
| 954 | 2857293771 | 2857288857 | Bacteria | 7189066 |
| 955 | 2858851055 | 2858848962 | Bacteria | 6963058 |
| 956 | 2858884419 | 2858882152 | Bacteria | 7230291 |
| 957 | 2858893667 | 2858888857 | Bacteria | 7060307 |
| 958 | 2858896806 | 2858895516 | Bacteria | 7378898 |
| 959 | 2863424610 | 2863421361 | Bacteria | 7300805 |
| 960 | 2869053606 | 2869048445 | Bacteria | 6875584 |
| 961 | 2869062990 | 2869061728 | Bacteria | 7112407 |
| 962 | 2869069157 | 2869068681 | Bacteria | 7205615 |
| 963 | 2870071460 | 2870068957 | Bacteria | 8925310 |
| 964 | 2880491850 | 2880489317 | Bacteria | 7096270 |
| 965 | 2880500454 | 2880495981 | Bacteria | 7340502 |
| 966 | 2904568602 | 2904564687 | Bacteria | 7609577 |
| 967 | 2904575644 | 2904571731 | Bacteria | 7608790 |
| 968 | 2904625190 | 2904615490 | Bacteria | 10047340 |
| 969 | 2928160396 | 2928157003 | Bacteria | 7522202 |
| 970 | 2928170641 | 2928163908 | Bacteria | 7561269 |
| 971 | 2928172574 | 2928170801 | Bacteria | 8785406 |
| 972 | 2928540665 | 2928536128 | Bacteria | 7657547 |
| 973 | 2929224121 | 2929219909 | Bacteria | 6984360 |
| 974 | 2929228959 | 2929226422 | Bacteria | 7248583 |
| 975 | 2945940378 | 2945934425 | Bacteria | 7444609 |
| 976 | 2981996297 | 2981990288 | Bacteria | 7590678 |
| 977 | 2990707506 | 2990703756 | Bacteria | 7715990 |
| 978 | 642423947 | 641736151 | Bacteria | 7477263 |
| 979 | 642418214 | 641736154 | Bacteria | 7689995 |
| 980 | 642596198 | 642555112 | Bacteria | 8676562 |
| 981 | 8003831352 | 8003830390 | Bacteria | 6541657 |
| 982 | 8003873781 | 8003870546 | Bacteria | 7396674 |
| 983 | 8018846742 | 8018845410 | Bacteria | 8933938 |
| 984 | 8020941428 | 8020938398 | Bacteria | 7472757 |
| 985 | 8020949381 | 8020945358 | Bacteria | 8467355 |
| 986 | 8020957783 | 8020953355 | Bacteria | 7439080 |
| 987 | 8021127997 | 8021120328 | Bacteria | 8782274 |
| 988 | 8054706347 | 8054704163 | Bacteria | 7247792 |
| 989 | 8054727921 | 8054727385 | Bacteria | 7558670 |
| 990 | 8054736839 | 8054734606 | Bacteria | 6947278 |
| 991 | 8055267789 | 8055266321 | Bacteria | 7999742 |
| 992 | Ga0496110_0285480 | |||
| 993 | JGI24743J22301_10006726 | |||
| 994 | JGI24735J21928_10008671 | |||
| 995 | JGI24735J21928_10017314 | |||
| 996 | JGI24751J29686_10040518 | |||
| 997 | rootH1_10003113 | |||
| 998 | rootH1_10343265 | |||
| 999 | JGI25160J50197_1000236 | |||
| 1000 | Ga0055532_1000529 | |||
| 1001 | Ga0055532_1001430 | |||
| 1002 | Ga0055532_1004571 | |||
| 1003 | Ga0055527_1000165 | |||
| 1004 | Ga0055527_1000291 | |||
| 1005 | Ga0055535_1000333 | |||
| 1006 | Ga0055535_1000506 | |||
| 1007 | Ga0055542_1000502 | |||
| 1008 | Ga0055542_1002955 | |||
| 1009 | Ga0055529_1000495 | |||
| 1010 | Ga0055528_1001289 | |||
| 1011 | Ga0065165_1011560 | |||
| 1012 | Ga0065712_10078953 | |||
| 1013 | Ga0065715_10108897 | |||
| 1014 | Ga0065715_10126016 | |||
| 1015 | Ga0065715_10193289 | |||
| 1016 | Ga0065715_10203218 | |||
| 1017 | Ga0065715_10251129 | |||
| 1018 | Ga0070658_10006346 | |||
| 1019 | Ga0070658_10006768 | |||
| 1020 | Ga0070658_10062587 | |||
| 1021 | Ga0070658_10157722 | |||
| 1022 | Ga0070658_10196970 | |||
| 1023 | Ga0070676_10003093 | |||
| 1024 | Ga0070676_10004726 | |||
| 1025 | Ga0070676_10049210 | |||
| 1026 | Ga0070676_10060133 | |||
| 1027 | Ga0070676_10093843 | |||
| 1028 | Ga0070676_10105288 | |||
| 1029 | Ga0070676_10199751 | |||
| 1030 | Ga0070683_100000454 | |||
| 1031 | Ga0070683_100031128 | |||
| 1032 | Ga0070683_100046604 | |||
| 1033 | Ga0070690_100028837 | |||
| 1034 | Ga0070670_100001523 | |||
| 1035 | Ga0070670_100002732 | |||
| 1036 | Ga0070670_100004869 | |||
| 1037 | Ga0070670_100028105 | |||
| 1038 | Ga0070670_100089465 | |||
| 1039 | Ga0070677_10000608 | |||
| 1040 | Ga0070677_10098646 | |||
| 1041 | Ga0068869_100000015 | |||
| 1042 | Ga0068869_100004811 | |||
| 1043 | Ga0068869_100006724 | |||
| 1044 | Ga0068869_100012305 | |||
| 1045 | Ga0068869_100041478 | |||
| 1046 | Ga0068869_100158796 | |||
| 1047 | Ga0068869_100209073 | |||
| 1048 | Ga0070666_10001213 | |||
| 1049 | Ga0070666_10001856 | |||
| 1050 | Ga0070666_10004191 | |||
| 1051 | Ga0070666_10019117 | |||
| 1052 | Ga0070666_10043313 | |||
| 1053 | Ga0070680_100002253 | |||
| 1054 | Ga0070680_100011395 | |||
| 1055 | Ga0070680_100021871 | |||
| 1056 | Ga0070682_100004503 | |||
| 1057 | Ga0068868_100002229 | |||
| 1058 | Ga0068868_100163738 | |||
| 1059 | Ga0070660_100000231 | |||
| 1060 | Ga0070660_100004158 | |||
| 1061 | Ga0070660_100037224 | |||
| 1062 | Ga0070660_100039433 | |||
| 1063 | Ga0070660_100102512 | |||
| 1064 | Ga0070689_100019606 | |||
| 1065 | Ga0070689_100064268 | |||
| 1066 | Ga0070689_100067664 | |||
| 1067 | Ga0070689_100076079 | |||
| 1068 | Ga0070689_100196469 | |||
| 1069 | Ga0070687_100017319 | |||
| 1070 | Ga0070661_100011154 | |||
| 1071 | Ga0070661_100049329 | |||
| 1072 | Ga0070661_100082387 | |||
| 1073 | Ga0070661_100123021 | |||
| 1074 | Ga0070661_100125343 | |||
| 1075 | Ga0070692_10021809 | |||
| 1076 | Ga0070692_10154358 | |||
| 1077 | Ga0070668_100001229 | |||
| 1078 | Ga0070668_100004530 | |||
| 1079 | Ga0070668_100008037 | |||
| 1080 | Ga0070668_100033474 | |||
| 1081 | Ga0070668_100327267 | |||
| 1082 | Ga0070669_100005168 | |||
| 1083 | Ga0070669_100026716 | |||
| 1084 | Ga0070669_100103504 | |||
| 1085 | Ga0070675_100004784 | |||
| 1086 | Ga0070675_100013828 | |||
| 1087 | Ga0070675_100058692 | |||
| 1088 | Ga0070675_100108423 | |||
| 1089 | Ga0070675_100120222 | |||
| 1090 | Ga0070671_100004318 | |||
| 1091 | Ga0070671_100013552 | |||
| 1092 | Ga0070671_100018991 | |||
| 1093 | Ga0070671_100021189 | |||
| 1094 | Ga0070671_100024445 | |||
| 1095 | Ga0070671_100053878 | |||
| 1096 | Ga0070674_100018083 | |||
| 1097 | Ga0070674_100053519 | |||
| 1098 | Ga0070674_100121963 | |||
| 1099 | Ga0070674_100131336 | |||
| 1100 | Ga0070674_100172183 | |||
| 1101 | Ga0070674_100247464 | |||
| 1102 | Ga0070673_100001202 | |||
| 1103 | Ga0070673_100001616 | |||
| 1104 | Ga0070673_100005127 | |||
| 1105 | Ga0070673_100145388 | |||
| 1106 | Ga0070673_100156491 | |||
| 1107 | Ga0070688_100011000 | |||
| 1108 | Ga0070688_100017865 | |||
| 1109 | Ga0070688_100025614 | |||
| 1110 | Ga0070659_100000015 | |||
| 1111 | Ga0070659_100098221 | |||
| 1112 | Ga0070659_100187438 | |||
| 1113 | Ga0070659_100293248 | |||
| 1114 | Ga0070667_100005954 | |||
| 1115 | Ga0070667_100014941 | |||
| 1116 | Ga0070667_100023193 | |||
| 1117 | Ga0070667_100023264 | |||
| 1118 | Ga0070667_100058424 | |||
| 1119 | Ga0070667_100122210 | |||
| 1120 | Ga0070667_100176637 | |||
| 1121 | Ga0070709_10048924 | |||
| 1122 | Ga0070714_100083120 | |||
| 1123 | Ga0070714_100413780 | |||
| 1124 | Ga0070713_100001999 | |||
| 1125 | Ga0070713_100003579 | |||
| 1126 | Ga0070713_100059742 | |||
| 1127 | Ga0070710_10004286 | |||
| 1128 | Ga0070710_10016215 | |||
| 1129 | Ga0070710_10034285 | |||
| 1130 | Ga0070701_10196407 | |||
| 1131 | Ga0070711_100099472 | |||
| 1132 | Ga0070711_100289416 | |||
| 1133 | Ga0070705_100002375 | |||
| 1134 | Ga0070705_100021287 | |||
| 1135 | Ga0070694_100139268 | |||
| 1136 | Ga0070708_100001279 | |||
| 1137 | Ga0070708_100284848 | |||
| 1138 | Ga0070708_100431725 | |||
| 1139 | Ga0070663_100017460 | |||
| 1140 | Ga0070663_100023239 | |||
| 1141 | Ga0070663_100031228 | |||
| 1142 | Ga0070663_100045825 | |||
| 1143 | Ga0070663_100127938 | |||
| 1144 | Ga0070663_100181572 | |||
| 1145 | Ga0070678_100000394 | |||
| 1146 | Ga0070678_100002575 | |||
| 1147 | Ga0070678_100041405 | |||
| 1148 | Ga0070678_100089109 | |||
| 1149 | Ga0070678_100264278 | |||
| 1150 | Ga0070662_100015670 | |||
| 1151 | Ga0070662_100066819 | |||
| 1152 | Ga0070662_100102118 | |||
| 1153 | Ga0070681_10012309 | |||
| 1154 | Ga0070681_10257301 | |||
| 1155 | Ga0070681_10359272 | |||
| 1156 | Ga0070681_10447135 | |||
| 1157 | Ga0068867_100009294 | |||
| 1158 | Ga0068867_100028141 | |||
| 1159 | Ga0068867_100074756 | |||
| 1160 | Ga0068867_100194980 | |||
| 1161 | Ga0068867_100200868 | |||
| 1162 | Ga0068867_100267813 | |||
| 1163 | Ga0070685_10022697 | |||
| 1164 | Ga0070685_10078427 | |||
| 1165 | Ga0070706_100053494 | |||
| 1166 | Ga0070706_100109114 | |||
| 1167 | Ga0070706_100245063 | |||
| 1168 | Ga0070706_100249293 | |||
| 1169 | Ga0070707_100131345 | |||
| 1170 | Ga0070707_100377905 | |||
| 1171 | Ga0070698_100056466 | |||
| 1172 | Ga0070698_100271730 | |||
| 1173 | Ga0070699_100004652 | |||
| 1174 | Ga0070699_100008030 | |||
| 1175 | Ga0070699_100020092 | |||
| 1176 | Ga0070699_100061347 | |||
| 1177 | Ga0070699_100369223 | |||
| 1178 | Ga0070679_100009436 | |||
| 1179 | Ga0070679_100070981 | |||
| 1180 | Ga0070679_100072601 | |||
| 1181 | Ga0070679_100192778 | |||
| 1182 | Ga0070684_100006472 | |||
| 1183 | Ga0070684_100025350 | |||
| 1184 | Ga0070697_100099548 | |||
| 1185 | Ga0068853_100019074 | |||
| 1186 | Ga0068853_100092025 | |||
| 1187 | Ga0068853_100324020 | |||
| 1188 | Ga0070672_100000434 | |||
| 1189 | Ga0070672_100003673 | |||
| 1190 | Ga0070672_100007079 | |||
| 1191 | Ga0070672_100016234 | |||
| 1192 | Ga0070672_100118185 | |||
| 1193 | Ga0070672_100235938 | |||
| 1194 | Ga0070672_100268141 | |||
| 1195 | Ga0070686_100021332 | |||
| 1196 | Ga0070695_100005465 | |||
| 1197 | Ga0070695_100034647 | |||
| 1198 | Ga0070695_100135328 | |||
| 1199 | Ga0070696_100022524 | |||
| 1200 | Ga0070696_100149106 | |||
| 1201 | Ga0070696_100181544 | |||
| 1202 | Ga0070693_100003106 | |||
| 1203 | Ga0070693_100063873 | |||
| 1204 | Ga0070693_100326579 | |||
| 1205 | Ga0070693_100418827 | |||
| 1206 | Ga0070665_100002535 | |||
| 1207 | Ga0070665_100007703 | |||
| 1208 | Ga0070665_100020584 | |||
| 1209 | Ga0070665_100025223 | |||
| 1210 | Ga0070665_100030674 | |||
| 1211 | Ga0070665_100088880 | |||
| 1212 | Ga0070665_100622016 | |||
| 1213 | Ga0070704_100096513 | |||
| 1214 | Ga0070704_100149735 | |||
| 1215 | Ga0070704_100306464 | |||
| 1216 | Ga0068855_100001505 | |||
| 1217 | Ga0068855_100001891 | |||
| 1218 | Ga0068855_100033764 | |||
| 1219 | Ga0068855_100348031 | |||
| 1220 | Ga0070664_100019567 | |||
| 1221 | Ga0070664_100026663 | |||
| 1222 | Ga0070664_100087648 | |||
| 1223 | Ga0070664_100261454 | |||
| 1224 | Ga0070664_100263493 | |||
| 1225 | Ga0068857_100007630 | |||
| 1226 | Ga0068857_100032159 | |||
| 1227 | Ga0068857_100122774 | |||
| 1228 | Ga0068857_100280452 | |||
| 1229 | Ga0068854_100022522 | |||
| 1230 | Ga0068854_100047307 | |||
| 1231 | Ga0068856_100008479 | |||
| 1232 | Ga0068856_100015479 | |||
| 1233 | Ga0068856_100022650 | |||
| 1234 | Ga0068856_100096635 | |||
| 1235 | Ga0068856_100099001 | |||
| 1236 | Ga0070702_100033335 | |||
| 1237 | Ga0068852_100000645 | |||
| 1238 | Ga0068852_100065433 | |||
| 1239 | Ga0068852_100177147 | |||
| 1240 | Ga0068852_100344926 | |||
| 1241 | Ga0068852_100581214 | |||
| 1242 | Ga0068859_100000331 | |||
| 1243 | Ga0068859_100008681 | |||
| 1244 | Ga0068859_100036470 | |||
| 1245 | Ga0068859_100067230 | |||
| 1246 | Ga0068864_100000526 | |||
| 1247 | Ga0068864_100000849 | |||
| 1248 | Ga0068864_100001068 | |||
| 1249 | Ga0068864_100019211 | |||
| 1250 | Ga0068864_100023542 | |||
| 1251 | Ga0068864_100032679 | |||
| 1252 | Ga0068864_100121637 | |||
| 1253 | Ga0068866_10000993 | |||
| 1254 | Ga0068866_10079879 | |||
| 1255 | Ga0068861_100000187 | |||
| 1256 | Ga0068861_100004897 | |||
| 1257 | Ga0068861_100029305 | |||
| 1258 | Ga0068861_100401363 | |||
| 1259 | Ga0068851_10003217 | |||
| 1260 | Ga0068851_10003822 | |||
| 1261 | Ga0068851_10005867 | |||
| 1262 | Ga0068851_10052719 | |||
| 1263 | Ga0068870_10003294 | |||
| 1264 | Ga0068870_10056459 | |||
| 1265 | Ga0068870_10073684 | |||
| 1266 | Ga0068870_10137404 | |||
| 1267 | Ga0068863_100004993 | |||
| 1268 | Ga0068863_100006237 | |||
| 1269 | Ga0068863_100007018 | |||
| 1270 | Ga0068863_100049048 | |||
| 1271 | Ga0068863_100049372 | |||
| 1272 | Ga0068863_100274003 | |||
| 1273 | Ga0068863_100321709 | |||
| 1274 | Ga0068858_100000899 | |||
| 1275 | Ga0068858_100005057 | |||
| 1276 | Ga0068858_100030165 | |||
| 1277 | Ga0068858_100032019 | |||
| 1278 | Ga0068858_100179701 | |||
| 1279 | Ga0068860_100003702 | |||
| 1280 | Ga0068860_100014070 | |||
| 1281 | Ga0068860_100026558 | |||
| 1282 | Ga0068860_100050577 | |||
| 1283 | Ga0068860_100112383 | |||
| 1284 | Ga0068860_100219385 | |||
| 1285 | Ga0068862_100004170 | |||
| 1286 | Ga0068862_100024488 | |||
| 1287 | Ga0068862_100051250 | |||
| 1288 | Ga0081539_10002047 | |||
| 1289 | Ga0081539_10039266 | |||
| 1290 | Ga0075363_100020671 | |||
| 1291 | Ga0075364_10007258 | |||
| 1292 | Ga0070715_10117600 | |||
| 1293 | Ga0070716_100041774 | |||
| 1294 | Ga0070716_100329657 | |||
| 1295 | Ga0070712_100019398 | |||
| 1296 | Ga0070712_100022948 | |||
| 1297 | Ga0075362_10004680 | |||
| 1298 | Ga0075366_10029864 | |||
| 1299 | Ga0097621_100010681 | |||
| 1300 | Ga0097621_100017997 | |||
| 1301 | Ga0097621_100028099 | |||
| 1302 | Ga0097621_100046797 | |||
| 1303 | Ga0097621_100167735 | |||
| 1304 | Ga0068871_100003956 | |||
| 1305 | Ga0068871_100010868 | |||
| 1306 | Ga0068871_100038158 | |||
| 1307 | Ga0068871_100064178 | |||
| 1308 | Ga0075428_100087287 | |||
| 1309 | Ga0075433_10118470 | |||
| 1310 | Ga0075434_100018468 | |||
| 1311 | Ga0075434_100185691 | |||
| 1312 | Ga0075434_100366464 | |||
| 1313 | Ga0068865_100005913 | |||
| 1314 | Ga0068865_100007669 | |||
| 1315 | Ga0068865_100091202 | |||
| 1316 | Ga0068865_100243130 | |||
| 1317 | Ga0075436_100000314 | |||
| 1318 | Ga0075436_100020104 | |||
| 1319 | Ga0097620_100000331 | |||
| 1320 | Ga0097620_100008681 | |||
| 1321 | Ga0097620_100036471 | |||
| 1322 | Ga0097620_100067228 | |||
| 1323 | Ga0105240_10000989 | |||
| 1324 | Ga0105240_10013066 | |||
| 1325 | Ga0105240_10015022 | |||
| 1326 | Ga0105240_10153070 | |||
| 1327 | Ga0105240_10173891 | |||
| 1328 | Ga0105240_10264569 | |||
| 1329 | Ga0105240_10328494 | |||
| 1330 | Ga0105245_10023880 | |||
| 1331 | Ga0105245_10059715 | |||
| 1332 | Ga0105245_10117418 | |||
| 1333 | Ga0105245_10741868 | |||
| 1334 | Ga0105247_10126230 | |||
| 1335 | Ga0114129_10347583 | |||
| 1336 | Ga0105243_10118299 | |||
| 1337 | Ga0105243_10156967 | |||
| 1338 | Ga0105243_10309682 | |||
| 1339 | Ga0105241_10054017 | |||
| 1340 | Ga0105241_10222684 | |||
| 1341 | Ga0105242_10023311 | |||
| 1342 | Ga0105242_10094435 | |||
| 1343 | Ga0105242_10209776 | |||
| 1344 | Ga0105242_10676333 | |||
| 1345 | Ga0105248_10011677 | |||
| 1346 | Ga0105248_10013964 | |||
| 1347 | Ga0105248_10029084 | |||
| 1348 | Ga0105248_10142305 | |||
| 1349 | Ga0105248_10195608 | |||
| 1350 | Ga0105248_10324946 | |||
| 1351 | Ga0105248_10885332 | |||
| 1352 | Ga0105237_10006471 | |||
| 1353 | Ga0105237_10019311 | |||
| 1354 | Ga0105237_10235797 | |||
| 1355 | Ga0105238_10035626 | |||
| 1356 | Ga0105238_10050615 | |||
| 1357 | Ga0105238_10094427 | |||
| 1358 | Ga0105238_10188636 | |||
| 1359 | Ga0105249_10167153 | |||
| 1360 | Ga0105249_10218750 | |||
| 1361 | Ga0105249_10280411 | |||
| 1362 | Ga0105239_10025705 | |||
| 1363 | Ga0105246_10104550 | |||
| 1364 | Ga0105246_10188645 | |||
| 1365 | Ga0157373_10041727 | |||
| 1366 | Ga0157373_10067873 | |||
| 1367 | Ga0157371_10004781 | |||
| 1368 | Ga0157371_10093005 | |||
| 1369 | Ga0157371_10163036 | |||
| 1370 | Ga0157371_10194751 | |||
| 1371 | Ga0157370_10001647 | |||
| 1372 | Ga0157370_10004665 | |||
| 1373 | Ga0157370_10005411 | |||
| 1374 | Ga0157370_10015482 | |||
| 1375 | Ga0157370_10117236 | |||
| 1376 | Ga0157370_10135432 | |||
| 1377 | Ga0157369_10000559 | |||
| 1378 | Ga0157369_10006053 | |||
| 1379 | Ga0157369_10049870 | |||
| 1380 | Ga0157374_10000126 | |||
| 1381 | Ga0157374_10004928 | |||
| 1382 | Ga0157374_10017827 | |||
| 1383 | Ga0157374_10045124 | |||
| 1384 | Ga0157374_10064044 | |||
| 1385 | Ga0157374_10460168 | |||
| 1386 | Ga0157378_10030159 | |||
| 1387 | Ga0157378_10033507 | |||
| 1388 | Ga0157378_10304685 | |||
| 1389 | Ga0157378_10476124 | |||
| 1390 | Ga0163162_10035080 | |||
| 1391 | Ga0163162_10050785 | |||
| 1392 | Ga0163162_10105385 | |||
| 1393 | Ga0163162_10180838 | |||
| 1394 | Ga0163162_10730839 | |||
| 1395 | Ga0157372_10000580 | |||
| 1396 | Ga0157372_10081827 | |||
| 1397 | Ga0157372_10198972 | |||
| 1398 | Ga0157372_10258955 | |||
| 1399 | Ga0157372_10325277 | |||
| 1400 | Ga0157372_10617941 | |||
| 1401 | Ga0157375_10006657 | |||
| 1402 | Ga0157375_10019767 | |||
| 1403 | Ga0157375_10046714 | |||
| 1404 | Ga0157375_10056170 | |||
| 1405 | Ga0157375_10336961 | |||
| 1406 | Ga0157375_10461184 | |||
| 1407 | Ga0157375_10697649 | |||
| 1408 | Ga0163163_10001056 | |||
| 1409 | Ga0163163_10035766 | |||
| 1410 | Ga0163163_10066386 | |||
| 1411 | Ga0163163_10067380 | |||
| 1412 | Ga0163163_10526028 | |||
| 1413 | Ga0157380_10037615 | |||
| 1414 | Ga0157380_10052474 | |||
| 1415 | Ga0157380_10342180 | |||
| 1416 | Ga0157380_10402408 | |||
| 1417 | Ga0157377_10011431 | |||
| 1418 | Ga0157377_10164946 | |||
| 1419 | Ga0157379_10000045 | |||
| 1420 | Ga0157379_10001972 | |||
| 1421 | Ga0157379_10004399 | |||
| 1422 | Ga0157379_10024081 | |||
| 1423 | Ga0157376_10017442 | |||
| 1424 | Ga0157376_10028128 | |||
| 1425 | Ga0157376_10046564 | |||
| 1426 | Ga0157376_10049836 | |||
| 1427 | Ga0157376_10565346 | |||
| 1428 | Ga0182006_1014521 | |||
| 1429 | Ga0183361_10002 | |||
| 1430 | Ga0163161_10031880 | |||
| 1431 | Ga0163161_10116683 | |||
| 1432 | Ga0163161_10260664 | |||
| 1433 | Ga0213872_10082080 | |||
| 1434 | Ga0213876_10009758 | |||
| 1435 | Ga0213875_10000544 | |||
| 1436 | Ga0209566_100258 | |||
| 1437 | Ga0209672_100037 | |||
| 1438 | Ga0209672_100080 | |||
| 1439 | Ga0209147_100049 | |||
| 1440 | Ga0209147_100071 | |||
| 1441 | Ga0209147_100091 | |||
| 1442 | Ga0209258_100066 | |||
| 1443 | Ga0209258_100082 | |||
| 1444 | Ga0209148_1000195 | |||
| 1445 | Ga0209148_1000664 | |||
| 1446 | Ga0209759_1002833 | |||
| 1447 | Ga0209759_1010607 | |||
| 1448 | Ga0207666_1000977 | |||
| 1449 | Ga0209455_1000172 | |||
| 1450 | Ga0209455_1000530 | |||
| 1451 | Ga0209673_1000076 | |||
| 1452 | Ga0209130_1007823 | |||
| 1453 | Ga0207673_1005919 | |||
| 1454 | Ga0209564_1004566 | |||
| 1455 | Ga0207426_1000021 | |||
| 1456 | Ga0207697_10000594 | |||
| 1457 | Ga0207697_10042841 | |||
| 1458 | Ga0207656_10002348 | |||
| 1459 | Ga0207656_10038973 | |||
| 1460 | Ga0207682_10000298 | |||
| 1461 | Ga0207682_10002121 | |||
| 1462 | Ga0207682_10002878 | |||
| 1463 | Ga0207682_10070846 | |||
| 1464 | Ga0207682_10082468 | |||
| 1465 | Ga0207682_10093231 | |||
| 1466 | Ga0207692_10014897 | |||
| 1467 | Ga0207642_10019328 | |||
| 1468 | Ga0207642_10216183 | |||
| 1469 | Ga0207688_10000914 | |||
| 1470 | Ga0207680_10003569 | |||
| 1471 | Ga0207680_10007043 | |||
| 1472 | Ga0207680_10027223 | |||
| 1473 | Ga0207680_10030223 | |||
| 1474 | Ga0207680_10059696 | |||
| 1475 | Ga0207647_10001075 | |||
| 1476 | Ga0207647_10002066 | |||
| 1477 | Ga0207647_10036553 | |||
| 1478 | Ga0207647_10065560 | |||
| 1479 | Ga0207699_10036232 | |||
| 1480 | Ga0207645_10002475 | |||
| 1481 | Ga0207645_10035948 | |||
| 1482 | Ga0207645_10045426 | |||
| 1483 | Ga0207645_10094920 | |||
| 1484 | Ga0207643_10000777 | |||
| 1485 | Ga0207643_10018919 | |||
| 1486 | Ga0207643_10071662 | |||
| 1487 | Ga0207643_10076519 | |||
| 1488 | Ga0207643_10200029 | |||
| 1489 | Ga0207705_10010614 | |||
| 1490 | Ga0207705_10038414 | |||
| 1491 | Ga0207705_10307194 | |||
| 1492 | Ga0207684_10047181 | |||
| 1493 | Ga0207654_10030006 | |||
| 1494 | Ga0207654_10197242 | |||
| 1495 | Ga0207707_10012372 | |||
| 1496 | Ga0207707_10023744 | |||
| 1497 | Ga0207707_10028294 | |||
| 1498 | Ga0207707_10199572 | |||
| 1499 | Ga0207695_10002708 | |||
| 1500 | Ga0207695_10039807 | |||
| 1501 | Ga0207695_10041810 | |||
| 1502 | Ga0207695_10087808 | |||
| 1503 | Ga0207695_10191350 | |||
| 1504 | Ga0207695_10279198 | |||
| 1505 | Ga0207671_10041955 | |||
| 1506 | Ga0207693_10000415 | |||
| 1507 | Ga0207693_10008998 | |||
| 1508 | Ga0207663_10014895 | |||
| 1509 | Ga0207660_10016821 | |||
| 1510 | Ga0207660_10029744 | |||
| 1511 | Ga0207660_10214737 | |||
| 1512 | Ga0207662_10014678 | |||
| 1513 | Ga0207662_10186065 | |||
| 1514 | Ga0207657_10000014 | |||
| 1515 | Ga0207657_10000709 | |||
| 1516 | Ga0207657_10001175 | |||
| 1517 | Ga0207657_10003742 | |||
| 1518 | Ga0207657_10013752 | |||
| 1519 | Ga0207657_10076189 | |||
| 1520 | Ga0207657_10080360 | |||
| 1521 | Ga0207649_10044429 | |||
| 1522 | Ga0207649_10068338 | |||
| 1523 | Ga0207649_10108906 | |||
| 1524 | Ga0207652_10020779 | |||
| 1525 | Ga0207652_10029911 | |||
| 1526 | Ga0207652_10052490 | |||
| 1527 | Ga0207652_10072891 | |||
| 1528 | Ga0207646_10091523 | |||
| 1529 | Ga0207646_10101913 | |||
| 1530 | Ga0207681_10003673 | |||
| 1531 | Ga0207681_10029729 | |||
| 1532 | Ga0207681_10101134 | |||
| 1533 | Ga0207681_10354124 | |||
| 1534 | Ga0207694_10028254 | |||
| 1535 | Ga0207694_10128776 | |||
| 1536 | Ga0207694_10355315 | |||
| 1537 | Ga0207650_10002369 | |||
| 1538 | Ga0207650_10002799 | |||
| 1539 | Ga0207650_10002854 | |||
| 1540 | Ga0207650_10004490 | |||
| 1541 | Ga0207650_10007113 | |||
| 1542 | Ga0207650_10041860 | |||
| 1543 | Ga0207650_10043355 | |||
| 1544 | Ga0207650_10158407 | |||
| 1545 | Ga0207659_10002875 | |||
| 1546 | Ga0207659_10003272 | |||
| 1547 | Ga0207659_10004738 | |||
| 1548 | Ga0207659_10008158 | |||
| 1549 | Ga0207687_10018080 | |||
| 1550 | Ga0207687_10043270 | |||
| 1551 | Ga0207687_10100502 | |||
| 1552 | Ga0207687_10539758 | |||
| 1553 | Ga0207700_10000031 | |||
| 1554 | Ga0207700_10005665 | |||
| 1555 | Ga0207700_10105967 | |||
| 1556 | Ga0207664_10007727 | |||
| 1557 | Ga0207664_10137430 | |||
| 1558 | Ga0207664_10436044 | |||
| 1559 | Ga0207644_10002148 | |||
| 1560 | Ga0207644_10005225 | |||
| 1561 | Ga0207644_10008481 | |||
| 1562 | Ga0207644_10010560 | |||
| 1563 | Ga0207644_10044073 | |||
| 1564 | Ga0207644_10229802 | |||
| 1565 | Ga0207644_10300976 | |||
| 1566 | Ga0207644_10396917 | |||
| 1567 | Ga0207690_10000023 | |||
| 1568 | Ga0207690_10290936 | |||
| 1569 | Ga0207706_10000002 | |||
| 1570 | Ga0207706_10001696 | |||
| 1571 | Ga0207706_10056698 | |||
| 1572 | Ga0207706_10102213 | |||
| 1573 | Ga0207706_10386439 | |||
| 1574 | Ga0207686_10000198 | |||
| 1575 | Ga0207686_10012324 | |||
| 1576 | Ga0207670_10002399 | |||
| 1577 | Ga0207670_10072361 | |||
| 1578 | Ga0207670_10124562 | |||
| 1579 | Ga0207669_10006740 | |||
| 1580 | Ga0207669_10012415 | |||
| 1581 | Ga0207669_10019474 | |||
| 1582 | Ga0207669_10146878 | |||
| 1583 | Ga0207669_10302292 | |||
| 1584 | Ga0207704_10014838 | |||
| 1585 | Ga0207704_10146046 | |||
| 1586 | Ga0207704_10168223 | |||
| 1587 | Ga0207704_10253054 | |||
| 1588 | Ga0207665_10004770 | |||
| 1589 | Ga0207665_10049697 | |||
| 1590 | Ga0207665_10382225 | |||
| 1591 | Ga0207691_10000006 | |||
| 1592 | Ga0207691_10001801 | |||
| 1593 | Ga0207691_10004008 | |||
| 1594 | Ga0207691_10006366 | |||
| 1595 | Ga0207691_10006549 | |||
| 1596 | Ga0207691_10019166 | |||
| 1597 | Ga0207691_10032269 | |||
| 1598 | Ga0207691_10117216 | |||
| 1599 | Ga0207691_10153618 | |||
| 1600 | Ga0207691_10165842 | |||
| 1601 | Ga0207691_10342118 | |||
| 1602 | Ga0207691_10343379 | |||
| 1603 | Ga0207691_10374549 | |||
| 1604 | Ga0207711_10000961 | |||
| 1605 | Ga0207711_10007443 | |||
| 1606 | Ga0207711_10024416 | |||
| 1607 | Ga0207711_10054146 | |||
| 1608 | Ga0207711_10149358 | |||
| 1609 | Ga0207689_10000030 | |||
| 1610 | Ga0207689_10008383 | |||
| 1611 | Ga0207689_10009443 | |||
| 1612 | Ga0207689_10027139 | |||
| 1613 | Ga0207689_10123975 | |||
| 1614 | Ga0207689_10180238 | |||
| 1615 | Ga0207689_10233456 | |||
| 1616 | Ga0207661_10033927 | |||
| 1617 | Ga0207661_10040821 | |||
| 1618 | Ga0207661_10047817 | |||
| 1619 | Ga0207661_10177634 | |||
| 1620 | Ga0207661_10199834 | |||
| 1621 | Ga0207679_10035876 | |||
| 1622 | Ga0207679_10158837 | |||
| 1623 | Ga0207679_10242166 | |||
| 1624 | Ga0207679_10265352 | |||
| 1625 | Ga0207679_10289628 | |||
| 1626 | Ga0207667_10003662 | |||
| 1627 | Ga0207667_10009443 | |||
| 1628 | Ga0207667_10059631 | |||
| 1629 | Ga0207667_10134162 | |||
| 1630 | Ga0207667_10157659 | |||
| 1631 | Ga0207667_10191190 | |||
| 1632 | Ga0207667_10205686 | |||
| 1633 | Ga0207651_10002592 | |||
| 1634 | Ga0207651_10023718 | |||
| 1635 | Ga0207651_10039250 | |||
| 1636 | Ga0207651_10212521 | |||
| 1637 | Ga0207651_10225909 | |||
| 1638 | Ga0207651_10283516 | |||
| 1639 | Ga0207712_10130951 | |||
| 1640 | Ga0207712_10238117 | |||
| 1641 | Ga0207668_10002769 | |||
| 1642 | Ga0207668_10018612 | |||
| 1643 | Ga0207668_10018640 | |||
| 1644 | Ga0207668_10022062 | |||
| 1645 | Ga0207668_10030471 | |||
| 1646 | Ga0207668_10299067 | |||
| 1647 | Ga0207668_10383285 | |||
| 1648 | Ga0207668_10626073 | |||
| 1649 | Ga0207640_10011255 | |||
| 1650 | Ga0207640_10171378 | |||
| 1651 | Ga0207640_10211937 | |||
| 1652 | Ga0207658_10001775 | |||
| 1653 | Ga0207658_10002011 | |||
| 1654 | Ga0207658_10016664 | |||
| 1655 | Ga0207658_10020229 | |||
| 1656 | Ga0207658_10024305 | |||
| 1657 | Ga0207658_10054986 | |||
| 1658 | Ga0207658_10101189 | |||
| 1659 | Ga0207658_10316662 | |||
| 1660 | Ga0207677_10000439 | |||
| 1661 | Ga0207677_10020379 | |||
| 1662 | Ga0207677_10242232 | |||
| 1663 | Ga0207703_10000143 | |||
| 1664 | Ga0207703_10001820 | |||
| 1665 | Ga0207703_10038014 | |||
| 1666 | Ga0207703_10053414 | |||
| 1667 | Ga0207703_10115770 | |||
| 1668 | Ga0207703_10337312 | |||
| 1669 | Ga0207639_10023378 | |||
| 1670 | Ga0207639_10026067 | |||
| 1671 | Ga0207639_10231799 | |||
| 1672 | Ga0207678_10003787 | |||
| 1673 | Ga0207678_10019516 | |||
| 1674 | Ga0207678_10024311 | |||
| 1675 | Ga0207678_10041187 | |||
| 1676 | Ga0207678_10120114 | |||
| 1677 | Ga0207678_10199556 | |||
| 1678 | Ga0207678_10345233 | |||
| 1679 | Ga0207708_10035205 | |||
| 1680 | Ga0207702_10003558 | |||
| 1681 | Ga0207702_10014339 | |||
| 1682 | Ga0207702_10014885 | |||
| 1683 | Ga0207702_10046919 | |||
| 1684 | Ga0207702_10155657 | |||
| 1685 | Ga0207641_10002451 | |||
| 1686 | Ga0207641_10002867 | |||
| 1687 | Ga0207641_10009339 | |||
| 1688 | Ga0207641_10021722 | |||
| 1689 | Ga0207641_10032744 | |||
| 1690 | Ga0207641_10038927 | |||
| 1691 | Ga0207641_10050400 | |||
| 1692 | Ga0207641_10664980 | |||
| 1693 | Ga0207648_10001949 | |||
| 1694 | Ga0207648_10011138 | |||
| 1695 | Ga0207648_10020408 | |||
| 1696 | Ga0207648_10031224 | |||
| 1697 | Ga0207648_10048524 | |||
| 1698 | Ga0207648_10049066 | |||
| 1699 | Ga0207648_10235016 | |||
| 1700 | Ga0207676_10001099 | |||
| 1701 | Ga0207676_10001806 | |||
| 1702 | Ga0207676_10002733 | |||
| 1703 | Ga0207676_10031793 | |||
| 1704 | Ga0207676_10097367 | |||
| 1705 | Ga0207676_10197383 | |||
| 1706 | Ga0207674_10001272 | |||
| 1707 | Ga0207674_10001685 | |||
| 1708 | Ga0207674_10008968 | |||
| 1709 | Ga0207674_10017603 | |||
| 1710 | Ga0207674_10151784 | |||
| 1711 | Ga0207674_10324418 | |||
| 1712 | Ga0207675_100003099 | |||
| 1713 | Ga0207675_100021077 | |||
| 1714 | Ga0207675_100021286 | |||
| 1715 | Ga0207675_100039504 | |||
| 1716 | Ga0207683_10000011 | |||
| 1717 | Ga0207683_10000235 | |||
| 1718 | Ga0207683_10006617 | |||
| 1719 | Ga0207683_10012514 | |||
| 1720 | Ga0207683_10061620 | |||
| 1721 | Ga0207683_10113946 | |||
| 1722 | Ga0207698_10021405 | |||
| 1723 | Ga0207698_10036797 | |||
| 1724 | Ga0207698_10130548 | |||
| 1725 | Ga0207698_10339454 | |||
| 1726 | Ga0207698_10361703 | |||
| 1727 | Ga0209371_1000713 | |||
| 1728 | Ga0209982_1006264 | |||
| 1729 | Ga0209974_10039673 | |||
| 1730 | Ga0207428_10122320 | |||
| 1731 | Ga0268266_10015819 | |||
| 1732 | Ga0268266_10039426 | |||
| 1733 | Ga0268266_10060694 | |||
| 1734 | Ga0268266_10549733 | |||
| 1735 | Ga0268265_10040737 | |||
| 1736 | Ga0268265_10051581 | |||
| 1737 | Ga0268265_10314273 | |||
| 1738 | Ga0268265_10593518 | |||
| 1739 | Ga0268264_10004002 | |||
| 1740 | Ga0268264_10036916 | |||
| 1741 | Ga0268264_10191704 | |||
| 1742 | Ga0268264_10290682 | |||
| 1743 | Ga0265318_10000258 | |||
| 1744 | Ga0268256_1000608 | |||
| 1745 | Ga0265330_10002502 | |||
| 1746 | Ga0265332_10000138 | |||
| 1747 | Ga0265332_10000707 | |||
| 1748 | Ga0265320_10000284 | |||
| 1749 | Ga0265329_10000076 | |||
| 1750 | Ga0265329_10008238 | |||
| 1751 | Ga0265340_10000468 | |||
| 1752 | Ga0265339_10000961 | |||
| 1753 | Ga0265331_10000310 | |||
| 1754 | Ga0265331_10003288 | |||
| 1755 | Ga0265331_10122666 | |||
| 1756 | Ga0265327_10003395 | |||
| 1757 | Ga0265327_10016933 | |||
| 1758 | Ga0265316_10002148 | |||
| 1759 | Ga0265316_10137696 | |||
| 1760 | Ga0307408_100070513 | |||
| 1761 | Ga0265313_10000089 | |||
| 1762 | Ga0265314_10000211 | |||
| 1763 | Ga0265314_10054250 | |||
| 1764 | Ga0265342_10000390 | |||
| 1765 | Ga0265342_10012918 | |||
| 1766 | Ga0307405_10037797 | |||
| 1767 | Ga0307413_10000069 | |||
| 1768 | Ga0307410_10014522 | |||
| 1769 | Ga0307406_10013056 | |||
| 1770 | Ga0307407_10020270 | |||
| 1771 | Ga0307412_10000039 | |||
| 1772 | Ga0307412_10027150 | |||
| 1773 | Ga0307409_100006556 | |||
| 1774 | Ga0307416_100054913 | |||
| 1775 | Ga0307416_100254409 | |||
| 1776 | Ga0307411_10004260 | |||
| 1777 | Ga0373926_0007908 | |||
| 1778 | Ga0373934_0025723 | |||
| 1779 | Ga0373953_0003180 | |||
| 1780 | Ga0373954_0002627 | |||
| 1781 | Ga0373954_0022208 | |||
| 1782 | Ga0373956_0128260 | |||
| 1783 | Ga0373955_0002970 | |||
| 1784 | Ga0373955_0040742 | |||
| 1785 | Ga0373955_0158570 | |||
| 1786 | Ga0373924_0030605 | |||
| 1787 | Ga0373935_0028386 | |||
| 1788 | Ga0373935_0271960 | |||
| 1789 | Ga0373927_0008088 | |||
| 1790 | Ga0373927_0097169 | |||
| 1791 | Ga0373937_0084051 | |||
| 1792 | Ga0373937_0135525 | |||
| 1793 | Ga0373937_0168887 | |||
| 1794 | Ga0373937_0280184 | |||
| 1795 | Ga0373925_0063963 | |||
| 1796 | Ga0373925_0425478 | |||
| 1797 | Ga0395900_0000986 | |||
| 1798 | Ga0395900_0257250 | |||
| 1799 | Ga0395898_0031382 | |||
| 1800 | Ga0395898_0085169 | |||
| 1801 | Ga0395898_0637838 | |||
| 1802 | Ga0395905_0000160 | |||
| 1803 | Ga0395905_0026803 | |||
| 1804 | Ga0436364_0439553 | |||
| 1805 | Ga0436364_1346273 | |||
| 1806 | Ga0395901_0398462 | |||
| 1807 | Ga0436365_0989741 | |||
| 1808 | Ga0436365_1069777 | |||
| 1809 | Ga0436365_1151289 | |||
| 1810 | Ga0436361_0117653 | |||
| 1811 | Ga0436361_0354175 | |||
| 1812 | Ga0436363_0104264 | |||
| 1813 | Ga0439448_0004602 | |||
| 1814 | Ga0466969_0006212 | |||
| 1815 | Ga0466969_0020802 | |||
| 1816 | Ga0466972_0062670 | |||
| 1817 | Ga0466973_0026204 | |||
| 1818 | Ga0466977_0000069 | |||
| 1819 | Ga0466965_0025867 | |||
| 1820 | Ga0466966_0005693 | |||
| 1821 | Ga0466966_0009878 | |||
| 1822 | Ga0466961_0113759 | |||
| 1823 | Ga0466963_0032526 | |||
| 1824 | Ga0466963_0170948 | |||
| 1825 | Ga0466971_0097913 | |||
| 1826 | Ga0466968_0017187 | |||
| 1827 | Ga0466959_0000837 | |||
| 1828 | Ga0466959_0047353 | |||
| 1829 | Ga0466958_0022018 | |||
| 1830 | Ga0495629_0019844 | |||
| 1831 | Ga0495629_0067247 | |||
| 1832 | Ga0495653_0142085 | |||
| 1833 | Ga0495580_0057535 | |||
| 1834 | Ga0495582_0041168 | |||
| 1835 | Ga0495605_0013576 | |||
| 1836 | Ga0495605_0051053 | |||
| 1837 | Ga0495664_0008665 | |||
| 1838 | Ga0495596_0023423 | |||
| 1839 | Ga0495583_0031381 | |||
| 1840 | Ga0495606_0166417 | |||
| 1841 | Ga0495610_0024855 | |||
| 1842 | Ga0495648_0013399 | |||
| 1843 | Ga0495665_0024299 | |||
| 1844 | Ga0495598_0038443 | |||
| 1845 | Ga0495635_0008216 | |||
| 1846 | Ga0495659_0051317 | |||
| 1847 | Ga0495623_0146348 | |||
| 1848 | Ga0495647_0017671 | |||
| 1849 | Ga0495613_0042427 | |||
| 1850 | Ga0495636_0100533 | |||
| 1851 | Ga0495674_0095615 | |||
| 1852 | Ga0495672_0014413 | |||
| 1853 | Ga0495683_0067655 | |||
| 1854 | Ga0495687_019914 | |||
| 1855 | Ga0495687_084586 | |||
| 1856 | Ga0495684_0093925 | |||
| 1857 | Ga0495593_0127147 | |||
| 1858 | Ga0495615_0007432 | |||
| 1859 | Ga0495626_0046475 | |||
| 1860 | Ga0496100_0030828 | |||
| 1861 | Ga0496100_0143847 | |||
| 1862 | Ga0496101_0038170 | |||
| 1863 | Ga0496101_0069189 | |||
| 1864 | Ga0496101_0072351 | |||
| 1865 | Ga0496102_0002582 | |||
| 1866 | Ga0496102_0143312 | |||
| 1867 | Ga0496102_0231893 | |||
| 1868 | Ga0496103_0038910 | |||
| 1869 | Ga0496103_0059035 | |||
| 1870 | Ga0496103_0091988 | |||
| 1871 | Ga0496104_0009506 | |||
| 1872 | Ga0496104_0023137 | |||
| 1873 | Ga0496104_0054849 | |||
| 1874 | Ga0496105_0105237 | |||
| 1875 | Ga0496105_0154036 | |||
| 1876 | Ga0496106_0064413 | |||
| 1877 | Ga0496106_0202793 | |||
| 1878 | Ga0496108_0001057 | |||
| 1879 | Ga0496108_0017131 | |||
| 1880 | Ga0496108_0485151 | |||
| 1881 | Ga0496109_0023824 | |||
| 1882 | Ga0496109_0112987 | |||
| 1883 | Ga0496110_0132683 | |||
| 1884 | Ga0496110_0191840 | |||
| 1885 | Ga0496112_0001350 | |||
| 1886 | Ga0496112_0013251 | |||
| 1887 | Ga0496113_0244932 | |||
| 1888 | Ga0496114_0064889 | |||
| 1889 | Ga0496114_0095615 | |||
| 1890 | Ga0496114_0148498 | |||
| 1891 | Ga0496114_0446199 | |||
| 1892 | Ga0496115_0178285 | |||
| 1893 | Ga0496117_0017379 | |||
| 1894 | Ga0496117_0033407 | |||
| 1895 | Ga0496118_0003264 | |||
| 1896 | Ga0496118_0057278 | |||
| 1897 | Ga0496119_0150569 | |||
| 1898 | Ga0496120_0128379 | |||
| 1899 | Ga0496121_0007027 | |||
| 1900 | Ga0496121_0086724 | |||
| 1901 | Ga0496125_0000136 | |||
| 1902 | Ga0496125_0008155 | |||
| 1903 | Ga0496126_0108721 | |||
| 1904 | Ga0495678_049273 | |||
| 1905 | Ga0501043_0128768 | |||
| 1906 | Ga0501067_0145785 | |||
| 1907 | Ga0501083_0205537 | |||
| 1908 | nmdc:mga03683_45948_c1 | |||
| 1909 | nmdc:mga0k408_1287_c1 | |||
| 1910 | nmdc:mga07m45_52653_c1 | |||
| 1911 | nmdc:mga05p37_112460_c1 | |||
| 1912 | nmdc:mga05p37_852801_c1 | |||
| 1913 | nmdc:mga0n895_183492_c1 | |||
| 1914 | nmdc:mga0n895_257996_c1 | |||
| 1915 | nmdc:mga0rr50_341425_c1 | |||
| 1916 | nmdc:mga08x19_14029_c1 | |||
| 1917 | nmdc:mga08x19_41812_c1 | |||
| 1918 | nmdc:mga08x19_6410_c1 | |||
| 1919 | nmdc:mga0a205_15898_c1 | |||
| 1920 | nmdc:mga0a205_226439_c1 | |||
| 1921 | Ga0495619_0102608 | |||
| 1922 | Ga0500616_0011005 | |||
| 1923 | Ga0500637_0151428 | |||
| 1924 | Ga0587077_009432 | |||
| 1925 | Ga0501082_0000206 | |||
| 1926 | Ga0466962_0045313 | |||
| 1927 | 2514053686 | |||
| 1928 | 2515689024 | |||
| 1929 | 2527077229 | |||
| 1930 | 2563060585 | |||
| 1931 | 2599741555 | |||
| 1932 | 2600811191 | |||
| 1933 | 2713475762 | |||
| 1934 | 2738819364 | |||
| 1935 | 2738831843 | |||
| 1936 | 2738873371 | |||
| 1937 | 2739185001 | |||
| 1938 | 2739219970 | |||
| 1939 | 2753265639 | |||
| 1940 | 2772642989 | |||
| 1941 | 2792838811 | |||
| 1942 | 2819630769 | |||
| 1943 | 2855673035 | |||
| 1944 | 2855679196 | |||
| 1945 | 2857293771 | |||
| 1946 | 2858851055 | |||
| 1947 | 2858884419 | |||
| 1948 | 2858893667 | |||
| 1949 | 2858896806 | |||
| 1950 | 2863424610 | |||
| 1951 | 2869053606 | |||
| 1952 | 2869062990 | |||
| 1953 | 2869069157 | |||
| 1954 | 2870071460 | |||
| 1955 | 2880491850 | |||
| 1956 | 2880500454 | |||
| 1957 | 2904568602 | |||
| 1958 | 2904575644 | |||
| 1959 | 2904625190 | |||
| 1960 | 2928160396 | |||
| 1961 | 2928170641 | |||
| 1962 | 2928172574 | |||
| 1963 | 2928540665 | |||
| 1964 | 2929224121 | |||
| 1965 | 2929228959 | |||
| 1966 | 2945940378 | |||
| 1967 | 2981996297 | |||
| 1968 | 2990707506 | |||
| 1969 | 642423947 | |||
| 1970 | 642418214 | |||
| 1971 | 642596198 | |||
| 1972 | 8003831352 | |||
| 1973 | 8003873781 | |||
| 1974 | 8018846742 | |||
| 1975 | 8020941428 | |||
| 1976 | 8020949381 | |||
| 1977 | 8020957783 | |||
| 1978 | 8021127997 | |||
| 1979 | 8054706347 | |||
| 1980 | 8054727921 | |||
| 1981 | 8054736839 | |||
| 1982 | 8055267789 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
112
316
0.87
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8465 | 14 | 275 |
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.8304 | 14 | 277 |
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.8298 | 14 | 275 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8021 | 14 | 275 |
| 4xtc-assembly1.cif.gz_M | crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein | 0.7936 | 14 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WG03_18_293_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8457 | 14 | 273 | 1.10.3720.10 |
| af_P71746_10_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8434 | 16 | 277 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8342 | 45 | 280 | 1.10.3720.10 |
| af_P71745_27_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8298 | 18 | 279 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8283 | 49 | 277 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A263DID1-F1-model_v4 | ABC transporter permease | 0.8733 | 12 | 289 |
GO:0005886
GO:0055085 |
| AF-A0A3D6DDR0-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.8693 | 16 | 284 |
GO:0005886
GO:0055085 |
| AF-A0A838K4Z3-F1-model_v4 | Sugar ABC transporter permease | 0.868 | 15 | 289 |
GO:0005886
GO:0055085 |
| AF-A0A4Q6EVX7-F1-model_v4 | deleted | 0.868 | 15 | 272 |
|
| AF-A0A263DID1-F1-model_v4 | ABC transporter permease | 0.8675 | 12 | 289 |
GO:0005886
GO:0055085 |