F487645

General Info

Members Datasets Scaffolds Average Seq Length
991 398 1982 289

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0285480|Ga0496110_0285480_374_1342
Length 322
Sequence MSGAGPSQGANRAPPGGSAAAKPHAWGDRASAIARDTLAARAPFDRSLLLVAPATAFMLLLFIYPFLYGLILSFEPAEGGALANYRKFFTTDNLWPTIWTTLRLALPATLINVGVALPIAYKMRVKSRWQRWITTLLVVPITLGTVLIAEGMLTYFGPKGWLAQFLQLLHAYDGSIRLTHNYWGVLISLVISGFPFAFLLILSYVTGIDPVLARAASTLGADAKAQFRHIYLPLLAPGLAMCFCLAFVQAFSVFPSAVLLGAPAGPTRVISIAAYEAAFEQYDYSLASAIAMIMGFVQLIIVAVVLWLRNWFYKGPVTGGKG

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
223 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
224 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
225 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
226 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
227 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
230 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
231 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
235 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
236 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
248 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
249 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
250 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
264 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
265 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
268 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
269 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
270 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
275 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
285 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
286 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
287 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
300 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
303 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
304 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
340 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
342 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
343 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
344 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
345 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
346 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
347 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
348 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
349 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
350 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
351 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
352 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
353 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
354 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
355 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
356 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
357 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
358 2818991452 Burkholderia cepacia 561 Isolate Unclassified
359 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
360 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
361 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
362 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
363 2858882152 Micromonospora noduli MED15 Isolate Nodule
364 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
365 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
366 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
367 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
368 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
369 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
370 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
371 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
372 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
373 2904564687 Burkholderia sp. 571 Isolate Unclassified
374 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
375 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
376 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
377 2928163908 Burkholderia sp. 567 Isolate Unclassified
378 2928170801 Burkholderia sp. 572 Isolate Unclassified
379 2928536128 Burkholderia sola 565 Isolate Unclassified
380 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
381 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
382 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
383 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
384 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
385 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
386 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
387 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
388 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
389 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
390 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
391 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
392 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
393 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
394 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
395 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
396 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
397 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
398 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.25
Metatranscriptomes 0.1
Isolates 5.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 1.01
Rhizoplane 3.63
Rhizosphere 86.07
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0285480 3300048913 Bacteria 1503
2 JGI24743J22301_10006726 3300001991 Bacteria 1971
3 JGI24735J21928_10008671 3300002067 Bacteria 3282
4 JGI24735J21928_10017314 3300002067 Bacteria 2229
5 JGI24751J29686_10040518 3300002459 Bacteria 964
6 rootH1_10003113 3300003316 Bacteria 2311
7 rootH1_10343265 3300003323 Bacteria 1623
8 JGI25160J50197_1000236 3300003354 Bacteria 42883
9 Ga0055532_1000529 3300003758 Bacteria 16669
10 Ga0055532_1001430 3300003758 Bacteria 6659
11 Ga0055532_1004571 3300003758 Bacteria 2066
12 Ga0055527_1000165 3300003760 Bacteria 45611
13 Ga0055527_1000291 3300003760 Bacteria 29060
14 Ga0055535_1000333 3300003761 Bacteria 47259
15 Ga0055535_1000506 3300003761 Bacteria 34557
16 Ga0055542_1000502 3300003762 Bacteria 35790
17 Ga0055542_1002955 3300003762 Bacteria 4988
18 Ga0055529_1000495 3300003763 Bacteria 35799
19 Ga0055528_1001289 3300003790 Bacteria 15738
20 Ga0065165_1011560 3300005262 Bacteria 3663
21 Ga0065712_10078953 3300005290 Bacteria 3278
22 Ga0065715_10108897 3300005293 Bacteria 2692
23 Ga0065715_10126016 3300005293 Bacteria 2118
24 Ga0065715_10193289 3300005293 Bacteria 1402
25 Ga0065715_10203218 3300005293 Bacteria 1350
26 Ga0065715_10251129 3300005293 Bacteria 1167
27 Ga0070658_10006346 3300005327 Bacteria 9581
28 Ga0070658_10006768 3300005327 Bacteria 9277
29 Ga0070658_10062587 3300005327 Bacteria 3032
30 Ga0070658_10157722 3300005327 Bacteria 1903
31 Ga0070658_10196970 3300005327 Bacteria 1699
32 Ga0070676_10003093 3300005328 Bacteria 8605
33 Ga0070676_10004726 3300005328 Bacteria 7200
34 Ga0070676_10049210 3300005328 Bacteria 2467
35 Ga0070676_10060133 3300005328 Bacteria 2255
36 Ga0070676_10093843 3300005328 Bacteria 1843
37 Ga0070676_10105288 3300005328 Bacteria 1749
38 Ga0070676_10199751 3300005328 Bacteria 1310
39 Ga0070683_100000454 3300005329 Bacteria 28615
40 Ga0070683_100031128 3300005329 Bacteria 4848
41 Ga0070683_100046604 3300005329 Bacteria 4005
42 Ga0070690_100028837 3300005330 Bacteria 3440
43 Ga0070670_100001523 3300005331 Bacteria 18653
44 Ga0070670_100002732 3300005331 Bacteria 14566
45 Ga0070670_100004869 3300005331 Bacteria 11293
46 Ga0070670_100028105 3300005331 Bacteria 4839
47 Ga0070670_100089465 3300005331 Bacteria 2646
48 Ga0070677_10000608 3300005333 Bacteria 12052
49 Ga0070677_10098646 3300005333 Unclassified 1284
50 Ga0068869_100000015 3300005334 Bacteria 70868
51 Ga0068869_100004811 3300005334 Bacteria 8431
52 Ga0068869_100006724 3300005334 Bacteria 7307
53 Ga0068869_100012305 3300005334 Bacteria 5650
54 Ga0068869_100041478 3300005334 Bacteria 3297
55 Ga0068869_100158796 3300005334 Bacteria 1759
56 Ga0068869_100209073 3300005334 Bacteria 1542
57 Ga0070666_10001213 3300005335 Bacteria 15563
58 Ga0070666_10001856 3300005335 Bacteria 12876
59 Ga0070666_10004191 3300005335 Bacteria 8752
60 Ga0070666_10019117 3300005335 Bacteria 4419
61 Ga0070666_10043313 3300005335 Bacteria 3014
62 Ga0070680_100002253 3300005336 Bacteria 14249
63 Ga0070680_100011395 3300005336 Bacteria 6877
64 Ga0070680_100021871 3300005336 Bacteria 5087
65 Ga0070682_100004503 3300005337 Bacteria 7739
66 Ga0068868_100002229 3300005338 Bacteria 13399
67 Ga0068868_100163738 3300005338 Bacteria 1838
68 Ga0070660_100000231 3300005339 Bacteria 37089
69 Ga0070660_100004158 3300005339 Bacteria 9995
70 Ga0070660_100037224 3300005339 Bacteria 3689
71 Ga0070660_100039433 3300005339 Bacteria 3590
72 Ga0070660_100102512 3300005339 Bacteria 2268
73 Ga0070689_100019606 3300005340 Bacteria 5003
74 Ga0070689_100064268 3300005340 Bacteria 2856
75 Ga0070689_100067664 3300005340 Bacteria 2785
76 Ga0070689_100076079 3300005340 Bacteria 2629
77 Ga0070689_100196469 3300005340 Bacteria 1645
78 Ga0070687_100017319 3300005343 Bacteria 3310
79 Ga0070661_100011154 3300005344 Bacteria 6259
80 Ga0070661_100049329 3300005344 Bacteria 3081
81 Ga0070661_100082387 3300005344 Bacteria 2376
82 Ga0070661_100123021 3300005344 Bacteria 1944
83 Ga0070661_100125343 3300005344 Bacteria 1926
84 Ga0070692_10021809 3300005345 Bacteria 3120
85 Ga0070692_10154358 3300005345 Bacteria 1310
86 Ga0070668_100001229 3300005347 Bacteria 18229
87 Ga0070668_100004530 3300005347 Bacteria 10310
88 Ga0070668_100008037 3300005347 Bacteria 7837
89 Ga0070668_100033474 3300005347 Bacteria 3914
90 Ga0070668_100327267 3300005347 Bacteria 1291
91 Ga0070669_100005168 3300005353 Bacteria 9441
92 Ga0070669_100026716 3300005353 Bacteria 4154
93 Ga0070669_100103504 3300005353 Bacteria 2151
94 Ga0070675_100004784 3300005354 Bacteria 10324
95 Ga0070675_100013828 3300005354 Bacteria 6353
96 Ga0070675_100058692 3300005354 Bacteria 3174
97 Ga0070675_100108423 3300005354 Bacteria 2345
98 Ga0070675_100120222 3300005354 Bacteria 2231
99 Ga0070671_100004318 3300005355 Bacteria 11249
100 Ga0070671_100013552 3300005355 Bacteria 6573
101 Ga0070671_100018991 3300005355 Bacteria 5591
102 Ga0070671_100021189 3300005355 Bacteria 5307
103 Ga0070671_100024445 3300005355 Bacteria 4945
104 Ga0070671_100053878 3300005355 Bacteria 3343
105 Ga0070674_100018083 3300005356 Bacteria 4448
106 Ga0070674_100053519 3300005356 Bacteria 2788
107 Ga0070674_100121963 3300005356 Bacteria 1931
108 Ga0070674_100131336 3300005356 Bacteria 1867
109 Ga0070674_100172183 3300005356 Bacteria 1652
110 Ga0070674_100247464 3300005356 Bacteria 1399
111 Ga0070673_100001202 3300005364 Bacteria 14931
112 Ga0070673_100001616 3300005364 Bacteria 13326
113 Ga0070673_100005127 3300005364 Bacteria 8352
114 Ga0070673_100145388 3300005364 Bacteria 2004
115 Ga0070673_100156491 3300005364 Bacteria 1934
116 Ga0070688_100011000 3300005365 Bacteria 5014
117 Ga0070688_100017865 3300005365 Bacteria 4079
118 Ga0070688_100025614 3300005365 Bacteria 3494
119 Ga0070659_100000015 3300005366 Bacteria 176475
120 Ga0070659_100098221 3300005366 Bacteria 2354
121 Ga0070659_100187438 3300005366 Bacteria 1699
122 Ga0070659_100293248 3300005366 Bacteria 1355
123 Ga0070667_100005954 3300005367 Bacteria 10143
124 Ga0070667_100014941 3300005367 Bacteria 6413
125 Ga0070667_100023193 3300005367 Bacteria 5149
126 Ga0070667_100023264 3300005367 Bacteria 5140
127 Ga0070667_100058424 3300005367 Bacteria 3261
128 Ga0070667_100122210 3300005367 Bacteria 2266
129 Ga0070667_100176637 3300005367 Bacteria 1887
130 Ga0070709_10048924 3300005434 Bacteria 2640
131 Ga0070714_100083120 3300005435 Bacteria 2791
132 Ga0070714_100413780 3300005435 Bacteria 1276
133 Ga0070713_100001999 3300005436 Bacteria 13163
134 Ga0070713_100003579 3300005436 Bacteria 10266
135 Ga0070713_100059742 3300005436 Bacteria 3185
136 Ga0070710_10004286 3300005437 Bacteria 6765
137 Ga0070710_10016215 3300005437 Bacteria 3786
138 Ga0070710_10034285 3300005437 Bacteria 2761
139 Ga0070701_10196407 3300005438 Bacteria 1190
140 Ga0070711_100099472 3300005439 Bacteria 2113
141 Ga0070711_100289416 3300005439 Bacteria 1299
142 Ga0070705_100002375 3300005440 Bacteria 9484
143 Ga0070705_100021287 3300005440 Bacteria 3447
144 Ga0070694_100139268 3300005444 Bacteria 1760
145 Ga0070708_100001279 3300005445 Bacteria 19358
146 Ga0070708_100284848 3300005445 Bacteria 1555
147 Ga0070708_100431725 3300005445 Bacteria 1242
148 Ga0070663_100017460 3300005455 Bacteria 4684
149 Ga0070663_100023239 3300005455 Bacteria 4153
150 Ga0070663_100031228 3300005455 Bacteria 3659
151 Ga0070663_100045825 3300005455 Bacteria 3091
152 Ga0070663_100127938 3300005455 Bacteria 1926
153 Ga0070663_100181572 3300005455 Bacteria 1633
154 Ga0070678_100000394 3300005456 Bacteria 20544
155 Ga0070678_100002575 3300005456 Bacteria 9962
156 Ga0070678_100041405 3300005456 Bacteria 3265
157 Ga0070678_100089109 3300005456 Bacteria 2361
158 Ga0070678_100264278 3300005456 Bacteria 1448
159 Ga0070662_100015670 3300005457 Bacteria 5082
160 Ga0070662_100066819 3300005457 Bacteria 2639
161 Ga0070662_100102118 3300005457 Bacteria 2172
162 Ga0070681_10012309 3300005458 Bacteria 8483
163 Ga0070681_10257301 3300005458 Bacteria 1658
164 Ga0070681_10359272 3300005458 Bacteria 1367
165 Ga0070681_10447135 3300005458 Bacteria 1204
166 Ga0068867_100009294 3300005459 Bacteria 6938
167 Ga0068867_100028141 3300005459 Bacteria 4044
168 Ga0068867_100074756 3300005459 Bacteria 2541
169 Ga0068867_100194980 3300005459 Bacteria 1618
170 Ga0068867_100200868 3300005459 Bacteria 1596
171 Ga0068867_100267813 3300005459 Bacteria 1395
172 Ga0070685_10022697 3300005466 Bacteria 3425
173 Ga0070685_10078427 3300005466 Bacteria 1974
174 Ga0070706_100053494 3300005467 Bacteria 3726
175 Ga0070706_100109114 3300005467 Bacteria 2575
176 Ga0070706_100245063 3300005467 Bacteria 1673
177 Ga0070706_100249293 3300005467 Bacteria 1658
178 Ga0070707_100131345 3300005468 Bacteria 2435
179 Ga0070707_100377905 3300005468 Bacteria 1376
180 Ga0070698_100056466 3300005471 Bacteria 3978
181 Ga0070698_100271730 3300005471 Bacteria 1627
182 Ga0070699_100004652 3300005518 Bacteria 12144
183 Ga0070699_100008030 3300005518 Bacteria 9163
184 Ga0070699_100020092 3300005518 Bacteria 5756
185 Ga0070699_100061347 3300005518 Bacteria 3259
186 Ga0070699_100369223 3300005518 Bacteria 1294
187 Ga0070679_100009436 3300005530 Bacteria 9230
188 Ga0070679_100070981 3300005530 Bacteria 3473
189 Ga0070679_100072601 3300005530 Bacteria 3433
190 Ga0070679_100192778 3300005530 Bacteria 2006
191 Ga0070684_100006472 3300005535 Bacteria 9068
192 Ga0070684_100025350 3300005535 Bacteria 4984
193 Ga0070697_100099548 3300005536 Bacteria 2413
194 Ga0068853_100019074 3300005539 Bacteria 5682
195 Ga0068853_100092025 3300005539 Bacteria 2667
196 Ga0068853_100324020 3300005539 Bacteria 1429
197 Ga0070672_100000434 3300005543 Bacteria 24355
198 Ga0070672_100003673 3300005543 Bacteria 9971
199 Ga0070672_100007079 3300005543 Bacteria 7587
200 Ga0070672_100016234 3300005543 Bacteria 5326
201 Ga0070672_100118185 3300005543 Bacteria 2168
202 Ga0070672_100235938 3300005543 Bacteria 1537
203 Ga0070672_100268141 3300005543 Bacteria 1441
204 Ga0070686_100021332 3300005544 Bacteria 3849
205 Ga0070695_100005465 3300005545 Bacteria 7479
206 Ga0070695_100034647 3300005545 Bacteria 3166
207 Ga0070695_100135328 3300005545 Bacteria 1703
208 Ga0070696_100022524 3300005546 Bacteria 4281
209 Ga0070696_100149106 3300005546 Bacteria 1715
210 Ga0070696_100181544 3300005546 Bacteria 1561
211 Ga0070693_100003106 3300005547 Bacteria 7707
212 Ga0070693_100063873 3300005547 Bacteria 2147
213 Ga0070693_100326579 3300005547 Bacteria 1043
214 Ga0070693_100418827 3300005547 Bacteria 933
215 Ga0070665_100002535 3300005548 Bacteria 20073
216 Ga0070665_100007703 3300005548 Bacteria 10936
217 Ga0070665_100020584 3300005548 Bacteria 6629
218 Ga0070665_100025223 3300005548 Bacteria 5989
219 Ga0070665_100030674 3300005548 Bacteria 5409
220 Ga0070665_100088880 3300005548 Bacteria 3095
221 Ga0070665_100622016 3300005548 Bacteria 1093
222 Ga0070704_100096513 3300005549 Bacteria 2216
223 Ga0070704_100149735 3300005549 Bacteria 1833
224 Ga0070704_100306464 3300005549 Bacteria 1325
225 Ga0068855_100001505 3300005563 Bacteria 29183
226 Ga0068855_100001891 3300005563 Bacteria 25987
227 Ga0068855_100033764 3300005563 Bacteria 6104
228 Ga0068855_100348031 3300005563 Bacteria 1633
229 Ga0070664_100019567 3300005564 Bacteria 5571
230 Ga0070664_100026663 3300005564 Bacteria 4796
231 Ga0070664_100087648 3300005564 Bacteria 2691
232 Ga0070664_100261454 3300005564 Bacteria 1557
233 Ga0070664_100263493 3300005564 Bacteria 1551
234 Ga0068857_100007630 3300005577 Bacteria 9320
235 Ga0068857_100032159 3300005577 Bacteria 4638
236 Ga0068857_100122774 3300005577 Bacteria 2340
237 Ga0068857_100280452 3300005577 Bacteria 1533
238 Ga0068854_100022522 3300005578 Bacteria 4294
239 Ga0068854_100047307 3300005578 Bacteria 3065
240 Ga0068856_100008479 3300005614 Bacteria 10001
241 Ga0068856_100015479 3300005614 Bacteria 7370
242 Ga0068856_100022650 3300005614 Bacteria 6108
243 Ga0068856_100096635 3300005614 Bacteria 2943
244 Ga0068856_100099001 3300005614 Bacteria 2906
245 Ga0070702_100033335 3300005615 Bacteria 2832
246 Ga0068852_100000645 3300005616 Bacteria 22820
247 Ga0068852_100065433 3300005616 Bacteria 3171
248 Ga0068852_100177147 3300005616 Bacteria 2003
249 Ga0068852_100344926 3300005616 Bacteria 1452
250 Ga0068852_100581214 3300005616 Bacteria 1123
251 Ga0068859_100000331 3300005617 Bacteria 47138
252 Ga0068859_100008681 3300005617 Bacteria 10273
253 Ga0068859_100036470 3300005617 Bacteria 4936
254 Ga0068859_100067230 3300005617 Bacteria 3618
255 Ga0068864_100000526 3300005618 Bacteria 33060
256 Ga0068864_100000849 3300005618 Bacteria 25790
257 Ga0068864_100001068 3300005618 Bacteria 22999
258 Ga0068864_100019211 3300005618 Bacteria 5712
259 Ga0068864_100023542 3300005618 Bacteria 5172
260 Ga0068864_100032679 3300005618 Bacteria 4422
261 Ga0068864_100121637 3300005618 Bacteria 2335
262 Ga0068866_10000993 3300005718 Bacteria 12483
263 Ga0068866_10079879 3300005718 Bacteria 1754
264 Ga0068861_100000187 3300005719 Bacteria 33035
265 Ga0068861_100004897 3300005719 Bacteria 9015
266 Ga0068861_100029305 3300005719 Bacteria 4027
267 Ga0068861_100401363 3300005719 Bacteria 1216
268 Ga0068851_10003217 3300005834 Bacteria 7239
269 Ga0068851_10003822 3300005834 Bacteria 6739
270 Ga0068851_10005867 3300005834 Bacteria 5592
271 Ga0068851_10052719 3300005834 Bacteria 2069
272 Ga0068870_10003294 3300005840 Bacteria 6825
273 Ga0068870_10056459 3300005840 Bacteria 2096
274 Ga0068870_10073684 3300005840 Bacteria 1868
275 Ga0068870_10137404 3300005840 Bacteria 1427
276 Ga0068863_100004993 3300005841 Bacteria 13078
277 Ga0068863_100006237 3300005841 Bacteria 11709
278 Ga0068863_100007018 3300005841 Bacteria 11038
279 Ga0068863_100049048 3300005841 Bacteria 4003
280 Ga0068863_100049372 3300005841 Bacteria 3990
281 Ga0068863_100274003 3300005841 Bacteria 1634
282 Ga0068863_100321709 3300005841 Bacteria 1502
283 Ga0068858_100000899 3300005842 Bacteria 30862
284 Ga0068858_100005057 3300005842 Bacteria 12927
285 Ga0068858_100030165 3300005842 Bacteria 5036
286 Ga0068858_100032019 3300005842 Bacteria 4885
287 Ga0068858_100179701 3300005842 Bacteria 1997
288 Ga0068860_100003702 3300005843 Bacteria 15736
289 Ga0068860_100014070 3300005843 Bacteria 7850
290 Ga0068860_100026558 3300005843 Bacteria 5580
291 Ga0068860_100050577 3300005843 Bacteria 3955
292 Ga0068860_100112383 3300005843 Bacteria 2605
293 Ga0068860_100219385 3300005843 Bacteria 1847
294 Ga0068862_100004170 3300005844 Bacteria 12238
295 Ga0068862_100024488 3300005844 Bacteria 5065
296 Ga0068862_100051250 3300005844 Bacteria 3529
297 Ga0081539_10002047 3300005985 Bacteria 30305
298 Ga0081539_10039266 3300005985 Bacteria 2796
299 Ga0075363_100020671 3300006048 Bacteria 3304
300 Ga0075364_10007258 3300006051 Bacteria 6571
301 Ga0070715_10117600 3300006163 Bacteria 1263
302 Ga0070716_100041774 3300006173 Bacteria 2557
303 Ga0070716_100329657 3300006173 Bacteria 1073
304 Ga0070712_100019398 3300006175 Bacteria 4435
305 Ga0070712_100022948 3300006175 Bacteria 4114
306 Ga0075362_10004680 3300006177 Bacteria 4938
307 Ga0075366_10029864 3300006195 Bacteria 3203
308 Ga0097621_100010681 3300006237 Bacteria 6728
309 Ga0097621_100017997 3300006237 Bacteria 5384
310 Ga0097621_100028099 3300006237 Bacteria 4431
311 Ga0097621_100046797 3300006237 Bacteria 3502
312 Ga0097621_100167735 3300006237 Bacteria 1891
313 Ga0068871_100003956 3300006358 Bacteria 10230
314 Ga0068871_100010868 3300006358 Bacteria 6666
315 Ga0068871_100038158 3300006358 Bacteria 3834
316 Ga0068871_100064178 3300006358 Bacteria 3006
317 Ga0075428_100087287 3300006844 Bacteria 3403
318 Ga0075433_10118470 3300006852 Bacteria 2350
319 Ga0075434_100018468 3300006871 Bacteria 6738
320 Ga0075434_100185691 3300006871 Bacteria 2100
321 Ga0075434_100366464 3300006871 Bacteria 1462
322 Ga0068865_100005913 3300006881 Bacteria 7445
323 Ga0068865_100007669 3300006881 Bacteria 6649
324 Ga0068865_100091202 3300006881 Bacteria 2211
325 Ga0068865_100243130 3300006881 Bacteria 1417
326 Ga0075436_100000314 3300006914 Bacteria 30875
327 Ga0075436_100020104 3300006914 Bacteria 4582
328 Ga0097620_100000331 3300006931 Bacteria 47138
329 Ga0097620_100008681 3300006931 Bacteria 10273
330 Ga0097620_100036471 3300006931 Bacteria 4936
331 Ga0097620_100067228 3300006931 Bacteria 3618
332 Ga0105240_10000989 3300009093 Bacteria 50717
333 Ga0105240_10013066 3300009093 Bacteria 11427
334 Ga0105240_10015022 3300009093 Bacteria 10542
335 Ga0105240_10153070 3300009093 Bacteria 2745
336 Ga0105240_10173891 3300009093 Bacteria 2548
337 Ga0105240_10264569 3300009093 Bacteria 1983
338 Ga0105240_10328494 3300009093 Bacteria 1741
339 Ga0105245_10023880 3300009098 Bacteria 5366
340 Ga0105245_10059715 3300009098 Bacteria 3434
341 Ga0105245_10117418 3300009098 Bacteria 2482
342 Ga0105245_10741868 3300009098 Bacteria 1017
343 Ga0105247_10126230 3300009101 Bacteria 1663
344 Ga0114129_10347583 3300009147 Bacteria 1965
345 Ga0105243_10118299 3300009148 Bacteria 2229
346 Ga0105243_10156967 3300009148 Bacteria 1957
347 Ga0105243_10309682 3300009148 Bacteria 1434
348 Ga0105241_10054017 3300009174 Bacteria 3074
349 Ga0105241_10222684 3300009174 Bacteria 1587
350 Ga0105242_10023311 3300009176 Bacteria 4879
351 Ga0105242_10094435 3300009176 Bacteria 2523
352 Ga0105242_10209776 3300009176 Bacteria 1735
353 Ga0105242_10676333 3300009176 Bacteria 1007
354 Ga0105248_10011677 3300009177 Bacteria 9679
355 Ga0105248_10013964 3300009177 Bacteria 8836
356 Ga0105248_10029084 3300009177 Bacteria 6160
357 Ga0105248_10142305 3300009177 Bacteria 2705
358 Ga0105248_10195608 3300009177 Bacteria 2278
359 Ga0105248_10324946 3300009177 Bacteria 1733
360 Ga0105248_10885332 3300009177 Bacteria 1008
361 Ga0105237_10006471 3300009545 Bacteria 12986
362 Ga0105237_10019311 3300009545 Bacteria 7040
363 Ga0105237_10235797 3300009545 Bacteria 1831
364 Ga0105238_10035626 3300009551 Bacteria 5058
365 Ga0105238_10050615 3300009551 Bacteria 4181
366 Ga0105238_10094427 3300009551 Bacteria 2979
367 Ga0105238_10188636 3300009551 Bacteria 2038
368 Ga0105249_10167153 3300009553 Bacteria 2130
369 Ga0105249_10218750 3300009553 Bacteria 1873
370 Ga0105249_10280411 3300009553 Bacteria 1664
371 Ga0105239_10025705 3300010375 Bacteria 6484
372 Ga0105246_10104550 3300011119 Bacteria 2068
373 Ga0105246_10188645 3300011119 Bacteria 1594
374 Ga0157373_10041727 3300013100 Bacteria 3281
375 Ga0157373_10067873 3300013100 Bacteria 2521
376 Ga0157371_10004781 3300013102 Bacteria 11675
377 Ga0157371_10093005 3300013102 Bacteria 2136
378 Ga0157371_10163036 3300013102 Bacteria 1592
379 Ga0157371_10194751 3300013102 Bacteria 1452
380 Ga0157370_10001647 3300013104 Bacteria 27561
381 Ga0157370_10004665 3300013104 Bacteria 15650
382 Ga0157370_10005411 3300013104 Bacteria 14324
383 Ga0157370_10015482 3300013104 Bacteria 7752
384 Ga0157370_10117236 3300013104 Bacteria 2487
385 Ga0157370_10135432 3300013104 Bacteria 2296
386 Ga0157369_10000559 3300013105 Bacteria 48965
387 Ga0157369_10006053 3300013105 Bacteria 14039
388 Ga0157369_10049870 3300013105 Bacteria 4536
389 Ga0157374_10000126 3300013296 Bacteria 69928
390 Ga0157374_10004928 3300013296 Bacteria 11200
391 Ga0157374_10017827 3300013296 Bacteria 6256
392 Ga0157374_10045124 3300013296 Bacteria 4078
393 Ga0157374_10064044 3300013296 Bacteria 3449
394 Ga0157374_10460168 3300013296 Bacteria 1274
395 Ga0157378_10030159 3300013297 Bacteria 4791
396 Ga0157378_10033507 3300013297 Bacteria 4542
397 Ga0157378_10304685 3300013297 Bacteria 1543
398 Ga0157378_10476124 3300013297 Bacteria 1243
399 Ga0163162_10035080 3300013306 Bacteria 4995
400 Ga0163162_10050785 3300013306 Bacteria 4159
401 Ga0163162_10105385 3300013306 Bacteria 2914
402 Ga0163162_10180838 3300013306 Bacteria 2235
403 Ga0163162_10730839 3300013306 Bacteria 1110
404 Ga0157372_10000580 3300013307 Bacteria 39970
405 Ga0157372_10081827 3300013307 Bacteria 3655
406 Ga0157372_10198972 3300013307 Bacteria 2321
407 Ga0157372_10258955 3300013307 Bacteria 2020
408 Ga0157372_10325277 3300013307 Bacteria 1790
409 Ga0157372_10617941 3300013307 Bacteria 1263
410 Ga0157375_10006657 3300013308 Bacteria 10059
411 Ga0157375_10019767 3300013308 Bacteria 6137
412 Ga0157375_10046714 3300013308 Bacteria 4224
413 Ga0157375_10056170 3300013308 Bacteria 3885
414 Ga0157375_10336961 3300013308 Bacteria 1674
415 Ga0157375_10461184 3300013308 Bacteria 1436
416 Ga0157375_10697649 3300013308 Bacteria 1169
417 Ga0163163_10001056 3300014325 Bacteria 23365
418 Ga0163163_10035766 3300014325 Bacteria 4821
419 Ga0163163_10066386 3300014325 Bacteria 3583
420 Ga0163163_10067380 3300014325 Bacteria 3559
421 Ga0163163_10526028 3300014325 Bacteria 1245
422 Ga0157380_10037615 3300014326 Bacteria 3750
423 Ga0157380_10052474 3300014326 Bacteria 3229
424 Ga0157380_10342180 3300014326 Bacteria 1396
425 Ga0157380_10402408 3300014326 Bacteria 1299
426 Ga0157377_10011431 3300014745 Bacteria 4431
427 Ga0157377_10164946 3300014745 Bacteria 1381
428 Ga0157379_10000045 3300014968 Bacteria 75128
429 Ga0157379_10001972 3300014968 Bacteria 16977
430 Ga0157379_10004399 3300014968 Bacteria 12070
431 Ga0157379_10024081 3300014968 Bacteria 5403
432 Ga0157376_10017442 3300014969 Bacteria 5477
433 Ga0157376_10028128 3300014969 Bacteria 4465
434 Ga0157376_10046564 3300014969 Bacteria 3577
435 Ga0157376_10049836 3300014969 Bacteria 3470
436 Ga0157376_10565346 3300014969 Bacteria 1127
437 Ga0182006_1014521 3300015261 Bacteria 3392
438 Ga0183361_10002 3300016635 Bacteria 907642
439 Ga0163161_10031880 3300017792 Bacteria 3759
440 Ga0163161_10116683 3300017792 Bacteria 2002
441 Ga0163161_10260664 3300017792 Bacteria 1354
442 Ga0213872_10082080 3300021361 Bacteria 1448
443 Ga0213876_10009758 3300021384 Bacteria 5166
444 Ga0213875_10000544 3300021388 Bacteria 30876
445 Ga0209566_100258 3300025225 Bacteria 50542
446 Ga0209672_100037 3300025228 Bacteria 287776
447 Ga0209672_100080 3300025228 Bacteria 143481
448 Ga0209147_100049 3300025229 Bacteria 274980
449 Ga0209147_100071 3300025229 Bacteria 215861
450 Ga0209147_100091 3300025229 Bacteria 168353
451 Ga0209258_100066 3300025242 Bacteria 287776
452 Ga0209258_100082 3300025242 Bacteria 247739
453 Ga0209148_1000195 3300025254 Bacteria 109654
454 Ga0209148_1000664 3300025254 Bacteria 29497
455 Ga0209759_1002833 3300025256 Bacteria 7313
456 Ga0209759_1010607 3300025256 Bacteria 2688
457 Ga0207666_1000977 3300025271 Bacteria 3394
458 Ga0209455_1000172 3300025272 Bacteria 109654
459 Ga0209455_1000530 3300025272 Bacteria 26704
460 Ga0209673_1000076 3300025273 Bacteria 230907
461 Ga0209130_1007823 3300025284 Bacteria 3242
462 Ga0207673_1005919 3300025290 Bacteria 1503
463 Ga0209564_1004566 3300025295 Bacteria 8388
464 Ga0207426_1000021 3300025302 Bacteria 556343
465 Ga0207697_10000594 3300025315 Bacteria 20589
466 Ga0207697_10042841 3300025315 Bacteria 1860
467 Ga0207656_10002348 3300025321 Bacteria 6355
468 Ga0207656_10038973 3300025321 Bacteria 2007
469 Ga0207682_10000298 3300025893 Bacteria 22419
470 Ga0207682_10002121 3300025893 Bacteria 8985
471 Ga0207682_10002878 3300025893 Bacteria 7597
472 Ga0207682_10070846 3300025893 Bacteria 1477
473 Ga0207682_10082468 3300025893 Bacteria 1381
474 Ga0207682_10093231 3300025893 Bacteria 1308
475 Ga0207692_10014897 3300025898 Bacteria 3408
476 Ga0207642_10019328 3300025899 Bacteria 2636
477 Ga0207642_10216183 3300025899 Bacteria 1068
478 Ga0207688_10000914 3300025901 Bacteria 14900
479 Ga0207680_10003569 3300025903 Bacteria 7315
480 Ga0207680_10007043 3300025903 Bacteria 5463
481 Ga0207680_10027223 3300025903 Bacteria 3180
482 Ga0207680_10030223 3300025903 Bacteria 3053
483 Ga0207680_10059696 3300025903 Bacteria 2318
484 Ga0207647_10001075 3300025904 Bacteria 21061
485 Ga0207647_10002066 3300025904 Bacteria 15341
486 Ga0207647_10036553 3300025904 Bacteria 3120
487 Ga0207647_10065560 3300025904 Bacteria 2204
488 Ga0207699_10036232 3300025906 Bacteria 2811
489 Ga0207645_10002475 3300025907 Bacteria 14495
490 Ga0207645_10035948 3300025907 Bacteria 3180
491 Ga0207645_10045426 3300025907 Bacteria 2807
492 Ga0207645_10094920 3300025907 Bacteria 1920
493 Ga0207643_10000777 3300025908 Bacteria 19461
494 Ga0207643_10018919 3300025908 Bacteria 3772
495 Ga0207643_10071662 3300025908 Bacteria 1995
496 Ga0207643_10076519 3300025908 Bacteria 1933
497 Ga0207643_10200029 3300025908 Bacteria 1216
498 Ga0207705_10010614 3300025909 Bacteria 6693
499 Ga0207705_10038414 3300025909 Bacteria 3427
500 Ga0207705_10307194 3300025909 Bacteria 1217
501 Ga0207684_10047181 3300025910 Bacteria 3654
502 Ga0207654_10030006 3300025911 Bacteria 2981
503 Ga0207654_10197242 3300025911 Bacteria 1323
504 Ga0207707_10012372 3300025912 Bacteria 7416
505 Ga0207707_10023744 3300025912 Bacteria 5362
506 Ga0207707_10028294 3300025912 Bacteria 4899
507 Ga0207707_10199572 3300025912 Bacteria 1744
508 Ga0207695_10002708 3300025913 Bacteria 25849
509 Ga0207695_10039807 3300025913 Bacteria 5049
510 Ga0207695_10041810 3300025913 Bacteria 4903
511 Ga0207695_10087808 3300025913 Bacteria 3132
512 Ga0207695_10191350 3300025913 Bacteria 1963
513 Ga0207695_10279198 3300025913 Bacteria 1564
514 Ga0207671_10041955 3300025914 Bacteria 3386
515 Ga0207693_10000415 3300025915 Bacteria 38698
516 Ga0207693_10008998 3300025915 Bacteria 8151
517 Ga0207663_10014895 3300025916 Bacteria 4273
518 Ga0207660_10016821 3300025917 Bacteria 4849
519 Ga0207660_10029744 3300025917 Bacteria 3750
520 Ga0207660_10214737 3300025917 Bacteria 1507
521 Ga0207662_10014678 3300025918 Bacteria 4397
522 Ga0207662_10186065 3300025918 Bacteria 1338
523 Ga0207657_10000014 3300025919 Bacteria 175779
524 Ga0207657_10000709 3300025919 Bacteria 35416
525 Ga0207657_10001175 3300025919 Bacteria 27784
526 Ga0207657_10003742 3300025919 Bacteria 16166
527 Ga0207657_10013752 3300025919 Bacteria 7923
528 Ga0207657_10076189 3300025919 Bacteria 2830
529 Ga0207657_10080360 3300025919 Bacteria 2740
530 Ga0207649_10044429 3300025920 Bacteria 2720
531 Ga0207649_10068338 3300025920 Bacteria 2259
532 Ga0207649_10108906 3300025920 Bacteria 1847
533 Ga0207652_10020779 3300025921 Bacteria 5410
534 Ga0207652_10029911 3300025921 Bacteria 4559
535 Ga0207652_10052490 3300025921 Bacteria 3499
536 Ga0207652_10072891 3300025921 Bacteria 2987
537 Ga0207646_10091523 3300025922 Bacteria 2722
538 Ga0207646_10101913 3300025922 Bacteria 2573
539 Ga0207681_10003673 3300025923 Bacteria 9538
540 Ga0207681_10029729 3300025923 Bacteria 3554
541 Ga0207681_10101134 3300025923 Bacteria 2079
542 Ga0207681_10354124 3300025923 Bacteria 1176
543 Ga0207694_10028254 3300025924 Bacteria 4276
544 Ga0207694_10128776 3300025924 Bacteria 2027
545 Ga0207694_10355315 3300025924 Bacteria 1213
546 Ga0207650_10002369 3300025925 Bacteria 13105
547 Ga0207650_10002799 3300025925 Bacteria 12042
548 Ga0207650_10002854 3300025925 Bacteria 11930
549 Ga0207650_10004490 3300025925 Bacteria 9539
550 Ga0207650_10007113 3300025925 Bacteria 7624
551 Ga0207650_10041860 3300025925 Bacteria 3359
552 Ga0207650_10043355 3300025925 Bacteria 3302
553 Ga0207650_10158407 3300025925 Bacteria 1792
554 Ga0207659_10002875 3300025926 Bacteria 10249
555 Ga0207659_10003272 3300025926 Bacteria 9704
556 Ga0207659_10004738 3300025926 Bacteria 8247
557 Ga0207659_10008158 3300025926 Bacteria 6483
558 Ga0207687_10018080 3300025927 Bacteria 4651
559 Ga0207687_10043270 3300025927 Bacteria 3103
560 Ga0207687_10100502 3300025927 Bacteria 2128
561 Ga0207687_10539758 3300025927 Bacteria 977
562 Ga0207700_10000031 3300025928 Bacteria 130086
563 Ga0207700_10005665 3300025928 Bacteria 7496
564 Ga0207700_10105967 3300025928 Bacteria 2252
565 Ga0207664_10007727 3300025929 Bacteria 7463
566 Ga0207664_10137430 3300025929 Bacteria 2064
567 Ga0207664_10436044 3300025929 Bacteria 1168
568 Ga0207644_10002148 3300025931 Bacteria 12793
569 Ga0207644_10005225 3300025931 Bacteria 8476
570 Ga0207644_10008481 3300025931 Bacteria 6728
571 Ga0207644_10010560 3300025931 Bacteria 6088
572 Ga0207644_10044073 3300025931 Bacteria 3168
573 Ga0207644_10229802 3300025931 Bacteria 1473
574 Ga0207644_10300976 3300025931 Bacteria 1292
575 Ga0207644_10396917 3300025931 Bacteria 1127
576 Ga0207690_10000023 3300025932 Bacteria 196155
577 Ga0207690_10290936 3300025932 Bacteria 1275
578 Ga0207706_10000002 3300025933 Bacteria 360309
579 Ga0207706_10001696 3300025933 Bacteria 21719
580 Ga0207706_10056698 3300025933 Bacteria 3453
581 Ga0207706_10102213 3300025933 Bacteria 2522
582 Ga0207706_10386439 3300025933 Bacteria 1214
583 Ga0207686_10000198 3300025934 Bacteria 46402
584 Ga0207686_10012324 3300025934 Bacteria 4700
585 Ga0207670_10002399 3300025936 Bacteria 9820
586 Ga0207670_10072361 3300025936 Bacteria 2386
587 Ga0207670_10124562 3300025936 Bacteria 1879
588 Ga0207669_10006740 3300025937 Bacteria 5271
589 Ga0207669_10012415 3300025937 Bacteria 4187
590 Ga0207669_10019474 3300025937 Bacteria 3534
591 Ga0207669_10146878 3300025937 Bacteria 1645
592 Ga0207669_10302292 3300025937 Bacteria 1216
593 Ga0207704_10014838 3300025938 Bacteria 3949
594 Ga0207704_10146046 3300025938 Bacteria 1662
595 Ga0207704_10168223 3300025938 Bacteria 1569
596 Ga0207704_10253054 3300025938 Bacteria 1323
597 Ga0207665_10004770 3300025939 Bacteria 9019
598 Ga0207665_10049697 3300025939 Bacteria 2818
599 Ga0207665_10382225 3300025939 Bacteria 1069
600 Ga0207691_10000006 3300025940 Bacteria 161922
601 Ga0207691_10001801 3300025940 Bacteria 21033
602 Ga0207691_10004008 3300025940 Bacteria 14283
603 Ga0207691_10006366 3300025940 Bacteria 11408
604 Ga0207691_10006549 3300025940 Bacteria 11245
605 Ga0207691_10019166 3300025940 Bacteria 6478
606 Ga0207691_10032269 3300025940 Bacteria 4884
607 Ga0207691_10117216 3300025940 Bacteria 2363
608 Ga0207691_10153618 3300025940 Bacteria 2023
609 Ga0207691_10165842 3300025940 Bacteria 1936
610 Ga0207691_10342118 3300025940 Bacteria 1280
611 Ga0207691_10343379 3300025940 Bacteria 1278
612 Ga0207691_10374549 3300025940 Bacteria 1216
613 Ga0207711_10000961 3300025941 Bacteria 27639
614 Ga0207711_10007443 3300025941 Bacteria 9164
615 Ga0207711_10024416 3300025941 Bacteria 5065
616 Ga0207711_10054146 3300025941 Bacteria 3442
617 Ga0207711_10149358 3300025941 Bacteria 2108
618 Ga0207689_10000030 3300025942 Bacteria 97584
619 Ga0207689_10008383 3300025942 Bacteria 9002
620 Ga0207689_10009443 3300025942 Bacteria 8423
621 Ga0207689_10027139 3300025942 Bacteria 4794
622 Ga0207689_10123975 3300025942 Bacteria 2125
623 Ga0207689_10180238 3300025942 Bacteria 1742
624 Ga0207689_10233456 3300025942 Bacteria 1520
625 Ga0207661_10033927 3300025944 Bacteria 3964
626 Ga0207661_10040821 3300025944 Bacteria 3650
627 Ga0207661_10047817 3300025944 Bacteria 3398
628 Ga0207661_10177634 3300025944 Bacteria 1857
629 Ga0207661_10199834 3300025944 Bacteria 1757
630 Ga0207679_10035876 3300025945 Bacteria 3512
631 Ga0207679_10158837 3300025945 Bacteria 1849
632 Ga0207679_10242166 3300025945 Bacteria 1529
633 Ga0207679_10265352 3300025945 Bacteria 1466
634 Ga0207679_10289628 3300025945 Bacteria 1407
635 Ga0207667_10003662 3300025949 Bacteria 18949
636 Ga0207667_10009443 3300025949 Bacteria 11485
637 Ga0207667_10059631 3300025949 Bacteria 3996
638 Ga0207667_10134162 3300025949 Bacteria 2550
639 Ga0207667_10157659 3300025949 Bacteria 2335
640 Ga0207667_10191190 3300025949 Bacteria 2100
641 Ga0207667_10205686 3300025949 Bacteria 2018
642 Ga0207651_10002592 3300025960 Bacteria 8641
643 Ga0207651_10023718 3300025960 Bacteria 3780
644 Ga0207651_10039250 3300025960 Bacteria 3120
645 Ga0207651_10212521 3300025960 Bacteria 1558
646 Ga0207651_10225909 3300025960 Bacteria 1516
647 Ga0207651_10283516 3300025960 Bacteria 1370
648 Ga0207712_10130951 3300025961 Bacteria 1911
649 Ga0207712_10238117 3300025961 Bacteria 1465
650 Ga0207668_10002769 3300025972 Bacteria 10253
651 Ga0207668_10018612 3300025972 Bacteria 4375
652 Ga0207668_10018640 3300025972 Bacteria 4373
653 Ga0207668_10022062 3300025972 Bacteria 4069
654 Ga0207668_10030471 3300025972 Bacteria 3545
655 Ga0207668_10299067 3300025972 Bacteria 1327
656 Ga0207668_10383285 3300025972 Bacteria 1184
657 Ga0207668_10626073 3300025972 Bacteria 939
658 Ga0207640_10011255 3300025981 Bacteria 5060
659 Ga0207640_10171378 3300025981 Bacteria 1618
660 Ga0207640_10211937 3300025981 Bacteria 1476
661 Ga0207658_10001775 3300025986 Bacteria 16178
662 Ga0207658_10002011 3300025986 Bacteria 15164
663 Ga0207658_10016664 3300025986 Bacteria 5057
664 Ga0207658_10020229 3300025986 Bacteria 4609
665 Ga0207658_10024305 3300025986 Bacteria 4238
666 Ga0207658_10054986 3300025986 Bacteria 2948
667 Ga0207658_10101189 3300025986 Bacteria 2258
668 Ga0207658_10316662 3300025986 Bacteria 1349
669 Ga0207677_10000439 3300026023 Bacteria 28110
670 Ga0207677_10020379 3300026023 Bacteria 4025
671 Ga0207677_10242232 3300026023 Bacteria 1460
672 Ga0207703_10000143 3300026035 Bacteria 84508
673 Ga0207703_10001820 3300026035 Bacteria 19010
674 Ga0207703_10038014 3300026035 Bacteria 3838
675 Ga0207703_10053414 3300026035 Bacteria 3284
676 Ga0207703_10115770 3300026035 Bacteria 2294
677 Ga0207703_10337312 3300026035 Bacteria 1384
678 Ga0207639_10023378 3300026041 Bacteria 4463
679 Ga0207639_10026067 3300026041 Bacteria 4245
680 Ga0207639_10231799 3300026041 Bacteria 1601
681 Ga0207678_10003787 3300026067 Bacteria 13604
682 Ga0207678_10019516 3300026067 Bacteria 5956
683 Ga0207678_10024311 3300026067 Bacteria 5292
684 Ga0207678_10041187 3300026067 Bacteria 4005
685 Ga0207678_10120114 3300026067 Bacteria 2243
686 Ga0207678_10199556 3300026067 Bacteria 1710
687 Ga0207678_10345233 3300026067 Bacteria 1283
688 Ga0207708_10035205 3300026075 Bacteria 3810
689 Ga0207702_10003558 3300026078 Bacteria 14181
690 Ga0207702_10014339 3300026078 Bacteria 6581
691 Ga0207702_10014885 3300026078 Bacteria 6452
692 Ga0207702_10046919 3300026078 Bacteria 3638
693 Ga0207702_10155657 3300026078 Bacteria 2083
694 Ga0207641_10002451 3300026088 Bacteria 17145
695 Ga0207641_10002867 3300026088 Bacteria 15645
696 Ga0207641_10009339 3300026088 Bacteria 8089
697 Ga0207641_10021722 3300026088 Bacteria 5275
698 Ga0207641_10032744 3300026088 Bacteria 4317
699 Ga0207641_10038927 3300026088 Bacteria 3975
700 Ga0207641_10050400 3300026088 Bacteria 3522
701 Ga0207641_10664980 3300026088 Bacteria 1024
702 Ga0207648_10001949 3300026089 Bacteria 22555
703 Ga0207648_10011138 3300026089 Bacteria 8484
704 Ga0207648_10020408 3300026089 Bacteria 5966
705 Ga0207648_10031224 3300026089 Bacteria 4709
706 Ga0207648_10048524 3300026089 Bacteria 3716
707 Ga0207648_10049066 3300026089 Bacteria 3696
708 Ga0207648_10235016 3300026089 Bacteria 1631
709 Ga0207676_10001099 3300026095 Bacteria 20429
710 Ga0207676_10001806 3300026095 Bacteria 15688
711 Ga0207676_10002733 3300026095 Bacteria 12556
712 Ga0207676_10031793 3300026095 Bacteria 3971
713 Ga0207676_10097367 3300026095 Bacteria 2430
714 Ga0207676_10197383 3300026095 Bacteria 1775
715 Ga0207674_10001272 3300026116 Bacteria 32948
716 Ga0207674_10001685 3300026116 Bacteria 28374
717 Ga0207674_10008968 3300026116 Bacteria 11494
718 Ga0207674_10017603 3300026116 Bacteria 7795
719 Ga0207674_10151784 3300026116 Bacteria 2273
720 Ga0207674_10324418 3300026116 Bacteria 1489
721 Ga0207675_100003099 3300026118 Bacteria 16290
722 Ga0207675_100021077 3300026118 Bacteria 6074
723 Ga0207675_100021286 3300026118 Bacteria 6039
724 Ga0207675_100039504 3300026118 Bacteria 4404
725 Ga0207683_10000011 3300026121 Bacteria 140261
726 Ga0207683_10000235 3300026121 Bacteria 49040
727 Ga0207683_10006617 3300026121 Bacteria 9918
728 Ga0207683_10012514 3300026121 Bacteria 7239
729 Ga0207683_10061620 3300026121 Bacteria 3302
730 Ga0207683_10113946 3300026121 Bacteria 2422
731 Ga0207698_10021405 3300026142 Bacteria 4471
732 Ga0207698_10036797 3300026142 Bacteria 3597
733 Ga0207698_10130548 3300026142 Bacteria 2146
734 Ga0207698_10339454 3300026142 Bacteria 1414
735 Ga0207698_10361703 3300026142 Bacteria 1374
736 Ga0209371_1000713 3300027312 Bacteria 28089
737 Ga0209982_1006264 3300027552 Bacteria 1728
738 Ga0209974_10039673 3300027876 Bacteria 1566
739 Ga0207428_10122320 3300027907 Bacteria 1995
740 Ga0268266_10015819 3300028379 Bacteria 6460
741 Ga0268266_10039426 3300028379 Bacteria 4024
742 Ga0268266_10060694 3300028379 Bacteria 3260
743 Ga0268266_10549733 3300028379 Bacteria 1106
744 Ga0268265_10040737 3300028380 Bacteria 3432
745 Ga0268265_10051581 3300028380 Bacteria 3106
746 Ga0268265_10314273 3300028380 Bacteria 1416
747 Ga0268265_10593518 3300028380 Bacteria 1057
748 Ga0268264_10004002 3300028381 Bacteria 12614
749 Ga0268264_10036916 3300028381 Bacteria 4027
750 Ga0268264_10191704 3300028381 Bacteria 1864
751 Ga0268264_10290682 3300028381 Bacteria 1535
752 Ga0265318_10000258 3300028577 Bacteria 46107
753 Ga0268256_1000608 3300030500 Bacteria 28089
754 Ga0265330_10002502 3300031235 Bacteria 9995
755 Ga0265332_10000138 3300031238 Bacteria 60108
756 Ga0265332_10000707 3300031238 Bacteria 21147
757 Ga0265320_10000284 3300031240 Bacteria 40965
758 Ga0265329_10000076 3300031242 Bacteria 44517
759 Ga0265329_10008238 3300031242 Bacteria 3963
760 Ga0265340_10000468 3300031247 Bacteria 21877
761 Ga0265339_10000961 3300031249 Bacteria 22055
762 Ga0265331_10000310 3300031250 Bacteria 53265
763 Ga0265331_10003288 3300031250 Bacteria 10510
764 Ga0265331_10122666 3300031250 Bacteria 1188
765 Ga0265327_10003395 3300031251 Bacteria 15300
766 Ga0265327_10016933 3300031251 Bacteria 4601
767 Ga0265316_10002148 3300031344 Bacteria 20727
768 Ga0265316_10137696 3300031344 Bacteria 1836
769 Ga0307408_100070513 3300031548 Bacteria 2580
770 Ga0265313_10000089 3300031595 Bacteria 90452
771 Ga0265314_10000211 3300031711 Bacteria 86370
772 Ga0265314_10054250 3300031711 Bacteria 2775
773 Ga0265342_10000390 3300031712 Bacteria 48465
774 Ga0265342_10012918 3300031712 Bacteria 5630
775 Ga0307405_10037797 3300031731 Bacteria 2904
776 Ga0307413_10000069 3300031824 Bacteria 25469
777 Ga0307410_10014522 3300031852 Bacteria 4637
778 Ga0307406_10013056 3300031901 Bacteria 4748
779 Ga0307407_10020270 3300031903 Bacteria 3403
780 Ga0307412_10000039 3300031911 Bacteria 182976
781 Ga0307412_10027150 3300031911 Bacteria 3566
782 Ga0307409_100006556 3300031995 Bacteria 6857
783 Ga0307416_100054913 3300032002 Bacteria 3204
784 Ga0307416_100254409 3300032002 Bacteria 1712
785 Ga0307411_10004260 3300032005 Bacteria 6816
786 Ga0373926_0007908 3300035083 Bacteria 3543
787 Ga0373934_0025723 3300035086 Bacteria 2282
788 Ga0373953_0003180 3300035117 Bacteria 5083
789 Ga0373954_0002627 3300035118 Bacteria 7562
790 Ga0373954_0022208 3300035118 Bacteria 2876
791 Ga0373956_0128260 3300035119 Bacteria 1187
792 Ga0373955_0002970 3300035172 Bacteria 7428
793 Ga0373955_0040742 3300035172 Bacteria 2486
794 Ga0373955_0158570 3300035172 Bacteria 1334
795 Ga0373924_0030605 3300035410 Bacteria 2159
796 Ga0373935_0028386 3300035692 Bacteria 3459
797 Ga0373935_0271960 3300035692 Bacteria 1191
798 Ga0373927_0008088 3300035695 Bacteria 7098
799 Ga0373927_0097169 3300035695 Bacteria 1914
800 Ga0373937_0084051 3300036401 Bacteria 2944
801 Ga0373937_0135525 3300036401 Bacteria 2302
802 Ga0373937_0168887 3300036401 Bacteria 2052
803 Ga0373937_0280184 3300036401 Bacteria 1574
804 Ga0373925_0063963 3300037068 Bacteria 2768
805 Ga0373925_0425478 3300037068 Bacteria 1085
806 Ga0395900_0000986 3300037418 Bacteria 37037
807 Ga0395900_0257250 3300037418 Bacteria 1745
808 Ga0395898_0031382 3300037466 Bacteria 5309
809 Ga0395898_0085169 3300037466 Bacteria 3046
810 Ga0395898_0637838 3300037466 Bacteria 1008
811 Ga0395905_0000160 3300037471 Bacteria 111265
812 Ga0395905_0026803 3300037471 Bacteria 5436
813 Ga0436364_0439553 3300037853 Bacteria 5248
814 Ga0436364_1346273 3300037853 Bacteria 1440
815 Ga0395901_0398462 3300038443 Bacteria 1414
816 Ga0436365_0989741 3300039437 Bacteria 1635
817 Ga0436365_1069777 3300039437 Bacteria 2252
818 Ga0436365_1151289 3300039437 Bacteria 1586
819 Ga0436361_0117653 3300039447 Bacteria 5759
820 Ga0436361_0354175 3300039447 Bacteria 2379
821 Ga0436363_0104264 3300039450 Bacteria 1273
822 Ga0439448_0004602 3300042005 Bacteria 3902
823 Ga0466969_0006212 3300044656 Bacteria 6357
824 Ga0466969_0020802 3300044656 Bacteria 3395
825 Ga0466972_0062670 3300044658 Bacteria 1782
826 Ga0466973_0026204 3300044659 Bacteria 5596
827 Ga0466977_0000069 3300044666 Bacteria 19753
828 Ga0466965_0025867 3300044683 Bacteria 2843
829 Ga0466966_0005693 3300044684 Bacteria 8198
830 Ga0466966_0009878 3300044684 Bacteria 6325
831 Ga0466961_0113759 3300044693 Bacteria 1701
832 Ga0466963_0032526 3300044694 Bacteria 3378
833 Ga0466963_0170948 3300044694 Bacteria 1515
834 Ga0466971_0097913 3300044719 Bacteria 1346
835 Ga0466968_0017187 3300044735 Bacteria 2888
836 Ga0466959_0000837 3300045049 Bacteria 18178
837 Ga0466959_0047353 3300045049 Bacteria 3162
838 Ga0466958_0022018 3300045836 Bacteria 3728
839 Ga0495629_0019844 3300046459 Bacteria 4797
840 Ga0495629_0067247 3300046459 Bacteria 2501
841 Ga0495653_0142085 3300046463 Bacteria 1687
842 Ga0495580_0057535 3300046472 Bacteria 2736
843 Ga0495582_0041168 3300046473 Bacteria 2545
844 Ga0495605_0013576 3300046474 Bacteria 4483
845 Ga0495605_0051053 3300046474 Bacteria 2015
846 Ga0495664_0008665 3300046477 Bacteria 5677
847 Ga0495596_0023423 3300046500 Bacteria 2505
848 Ga0495583_0031381 3300046506 Bacteria 2576
849 Ga0495606_0166417 3300046507 Bacteria 1282
850 Ga0495610_0024855 3300046512 Bacteria 3227
851 Ga0495648_0013399 3300046524 Bacteria 6066
852 Ga0495665_0024299 3300046531 Bacteria 3255
853 Ga0495598_0038443 3300046537 Bacteria 1386
854 Ga0495635_0008216 3300046663 Bacteria 7288
855 Ga0495659_0051317 3300046664 Bacteria 1502
856 Ga0495623_0146348 3300046679 Bacteria 1401
857 Ga0495647_0017671 3300046681 Bacteria 2526
858 Ga0495613_0042427 3300046689 Bacteria 3366
859 Ga0495636_0100533 3300047318 Bacteria 1264
860 Ga0495674_0095615 3300047319 Bacteria 2533
861 Ga0495672_0014413 3300047320 Bacteria 5414
862 Ga0495683_0067655 3300047323 Bacteria 1758
863 Ga0495687_019914 3300047443 Bacteria 3280
864 Ga0495687_084586 3300047443 Bacteria 1232
865 Ga0495684_0093925 3300047471 Bacteria 2271
866 Ga0495593_0127147 3300047673 Bacteria 1295
867 Ga0495615_0007432 3300048090 Bacteria 2079
868 Ga0495626_0046475 3300048091 Bacteria 2022
869 Ga0496100_0030828 3300048903 Bacteria 3329
870 Ga0496100_0143847 3300048903 Bacteria 1693
871 Ga0496101_0038170 3300048904 Bacteria 3410
872 Ga0496101_0069189 3300048904 Bacteria 2582
873 Ga0496101_0072351 3300048904 Bacteria 2531
874 Ga0496102_0002582 3300048905 Bacteria 15446
875 Ga0496102_0143312 3300048905 Bacteria 2241
876 Ga0496102_0231893 3300048905 Bacteria 1740
877 Ga0496103_0038910 3300048906 Bacteria 2921
878 Ga0496103_0059035 3300048906 Bacteria 2384
879 Ga0496103_0091988 3300048906 Bacteria 1915
880 Ga0496104_0009506 3300048907 Bacteria 8653
881 Ga0496104_0023137 3300048907 Bacteria 5712
882 Ga0496104_0054849 3300048907 Bacteria 3767
883 Ga0496105_0105237 3300048908 Bacteria 2329
884 Ga0496105_0154036 3300048908 Bacteria 1888
885 Ga0496106_0064413 3300048909 Bacteria 2788
886 Ga0496106_0202793 3300048909 Bacteria 1579
887 Ga0496108_0001057 3300048911 Bacteria 21487
888 Ga0496108_0017131 3300048911 Bacteria 5926
889 Ga0496108_0485151 3300048911 Bacteria 1080
890 Ga0496109_0023824 3300048912 Bacteria 5434
891 Ga0496109_0112987 3300048912 Bacteria 2526
892 Ga0496110_0132683 3300048913 Bacteria 2250
893 Ga0496110_0191840 3300048913 Bacteria 1855
894 Ga0496112_0001350 3300048915 Bacteria 18677
895 Ga0496112_0013251 3300048915 Bacteria 7610
896 Ga0496113_0244932 3300048916 Bacteria 1431
897 Ga0496114_0064889 3300048917 Bacteria 3059
898 Ga0496114_0095615 3300048917 Bacteria 2528
899 Ga0496114_0148498 3300048917 Bacteria 2033
900 Ga0496114_0446199 3300048917 Bacteria 1146
901 Ga0496115_0178285 3300048918 Bacteria 1757
902 Ga0496117_0017379 3300048920 Bacteria 6006
903 Ga0496117_0033407 3300048920 Bacteria 3890
904 Ga0496118_0003264 3300048921 Bacteria 20662
905 Ga0496118_0057278 3300048921 Bacteria 2922
906 Ga0496119_0150569 3300048922 Bacteria 1247
907 Ga0496120_0128379 3300048923 Bacteria 1302
908 Ga0496121_0007027 3300048924 Bacteria 13673
909 Ga0496121_0086724 3300048924 Bacteria 2459
910 Ga0496125_0000136 3300048928 Bacteria 160544
911 Ga0496125_0008155 3300048928 Bacteria 11026
912 Ga0496126_0108721 3300048929 Bacteria 2417
913 Ga0495678_049273 3300049459 Bacteria 1638
914 Ga0501043_0128768 3300049579 Bacteria 1984
915 Ga0501067_0145785 3300049583 Bacteria 1319
916 Ga0501083_0205537 3300049744 Bacteria 1284
917 nmdc:mga03683_45948_c1 3300050489 Bacteria 1809
918 nmdc:mga0k408_1287_c1 3300050493 Bacteria 13598
919 nmdc:mga07m45_52653_c1 3300050496 Bacteria 2298
920 nmdc:mga05p37_112460_c1 3300050507 Bacteria 3348
921 nmdc:mga05p37_852801_c1 3300050507 Bacteria 989
922 nmdc:mga0n895_183492_c1 3300050512 Bacteria 2124
923 nmdc:mga0n895_257996_c1 3300050512 Bacteria 1769
924 nmdc:mga0rr50_341425_c1 3300050513 Bacteria 1258
925 nmdc:mga08x19_14029_c1 3300050514 Bacteria 4855
926 nmdc:mga08x19_41812_c1 3300050514 Bacteria 2919
927 nmdc:mga08x19_6410_c1 3300050514 Bacteria 6966
928 nmdc:mga0a205_15898_c1 3300050515 Bacteria 5955
929 nmdc:mga0a205_226439_c1 3300050515 Bacteria 1754
930 Ga0495619_0102608 3300053085 Bacteria 1948
931 Ga0500616_0011005 3300053153 Bacteria 5384
932 Ga0500637_0151428 3300053178 Bacteria 1340
933 Ga0587077_009432 3300059493 Bacteria 1481
934 Ga0501082_0000206 3300060353 Bacteria 51494
935 Ga0466962_0045313 3300061719 Bacteria 2102
936 2514053686 2513237166 Bacteria 10373764
937 2515689024 2515154123 Bacteria 6387382
938 2527077229 2526164713 Bacteria 6780608
939 2563060585 2562617112 Bacteria 10918404
940 2599741555 2599185239 Bacteria 8686614
941 2600811191 2600255067 Bacteria 6795583
942 2713475762 2711768613 Bacteria 11048459
943 2738819364 2738541296 Bacteria 7285013
944 2738831843 2738541298 Bacteria 7286732
945 2738873371 2738541306 Bacteria 7284992
946 2739185001 2738543002 Bacteria 7284546
947 2739219970 2738543008 Bacteria 7282815
948 2753265639 2751185782 Bacteria 11227053
949 2772642989 2772190715 Bacteria 6959372
950 2792838811 2791355137 Bacteria 9654227
951 2819630769 2818991452 Bacteria 8442785
952 2855673035 2855670206 Bacteria 7120389
953 2855679196 2855676851 Bacteria 7063653
954 2857293771 2857288857 Bacteria 7189066
955 2858851055 2858848962 Bacteria 6963058
956 2858884419 2858882152 Bacteria 7230291
957 2858893667 2858888857 Bacteria 7060307
958 2858896806 2858895516 Bacteria 7378898
959 2863424610 2863421361 Bacteria 7300805
960 2869053606 2869048445 Bacteria 6875584
961 2869062990 2869061728 Bacteria 7112407
962 2869069157 2869068681 Bacteria 7205615
963 2870071460 2870068957 Bacteria 8925310
964 2880491850 2880489317 Bacteria 7096270
965 2880500454 2880495981 Bacteria 7340502
966 2904568602 2904564687 Bacteria 7609577
967 2904575644 2904571731 Bacteria 7608790
968 2904625190 2904615490 Bacteria 10047340
969 2928160396 2928157003 Bacteria 7522202
970 2928170641 2928163908 Bacteria 7561269
971 2928172574 2928170801 Bacteria 8785406
972 2928540665 2928536128 Bacteria 7657547
973 2929224121 2929219909 Bacteria 6984360
974 2929228959 2929226422 Bacteria 7248583
975 2945940378 2945934425 Bacteria 7444609
976 2981996297 2981990288 Bacteria 7590678
977 2990707506 2990703756 Bacteria 7715990
978 642423947 641736151 Bacteria 7477263
979 642418214 641736154 Bacteria 7689995
980 642596198 642555112 Bacteria 8676562
981 8003831352 8003830390 Bacteria 6541657
982 8003873781 8003870546 Bacteria 7396674
983 8018846742 8018845410 Bacteria 8933938
984 8020941428 8020938398 Bacteria 7472757
985 8020949381 8020945358 Bacteria 8467355
986 8020957783 8020953355 Bacteria 7439080
987 8021127997 8021120328 Bacteria 8782274
988 8054706347 8054704163 Bacteria 7247792
989 8054727921 8054727385 Bacteria 7558670
990 8054736839 8054734606 Bacteria 6947278
991 8055267789 8055266321 Bacteria 7999742
992 Ga0496110_0285480
993 JGI24743J22301_10006726
994 JGI24735J21928_10008671
995 JGI24735J21928_10017314
996 JGI24751J29686_10040518
997 rootH1_10003113
998 rootH1_10343265
999 JGI25160J50197_1000236
1000 Ga0055532_1000529
1001 Ga0055532_1001430
1002 Ga0055532_1004571
1003 Ga0055527_1000165
1004 Ga0055527_1000291
1005 Ga0055535_1000333
1006 Ga0055535_1000506
1007 Ga0055542_1000502
1008 Ga0055542_1002955
1009 Ga0055529_1000495
1010 Ga0055528_1001289
1011 Ga0065165_1011560
1012 Ga0065712_10078953
1013 Ga0065715_10108897
1014 Ga0065715_10126016
1015 Ga0065715_10193289
1016 Ga0065715_10203218
1017 Ga0065715_10251129
1018 Ga0070658_10006346
1019 Ga0070658_10006768
1020 Ga0070658_10062587
1021 Ga0070658_10157722
1022 Ga0070658_10196970
1023 Ga0070676_10003093
1024 Ga0070676_10004726
1025 Ga0070676_10049210
1026 Ga0070676_10060133
1027 Ga0070676_10093843
1028 Ga0070676_10105288
1029 Ga0070676_10199751
1030 Ga0070683_100000454
1031 Ga0070683_100031128
1032 Ga0070683_100046604
1033 Ga0070690_100028837
1034 Ga0070670_100001523
1035 Ga0070670_100002732
1036 Ga0070670_100004869
1037 Ga0070670_100028105
1038 Ga0070670_100089465
1039 Ga0070677_10000608
1040 Ga0070677_10098646
1041 Ga0068869_100000015
1042 Ga0068869_100004811
1043 Ga0068869_100006724
1044 Ga0068869_100012305
1045 Ga0068869_100041478
1046 Ga0068869_100158796
1047 Ga0068869_100209073
1048 Ga0070666_10001213
1049 Ga0070666_10001856
1050 Ga0070666_10004191
1051 Ga0070666_10019117
1052 Ga0070666_10043313
1053 Ga0070680_100002253
1054 Ga0070680_100011395
1055 Ga0070680_100021871
1056 Ga0070682_100004503
1057 Ga0068868_100002229
1058 Ga0068868_100163738
1059 Ga0070660_100000231
1060 Ga0070660_100004158
1061 Ga0070660_100037224
1062 Ga0070660_100039433
1063 Ga0070660_100102512
1064 Ga0070689_100019606
1065 Ga0070689_100064268
1066 Ga0070689_100067664
1067 Ga0070689_100076079
1068 Ga0070689_100196469
1069 Ga0070687_100017319
1070 Ga0070661_100011154
1071 Ga0070661_100049329
1072 Ga0070661_100082387
1073 Ga0070661_100123021
1074 Ga0070661_100125343
1075 Ga0070692_10021809
1076 Ga0070692_10154358
1077 Ga0070668_100001229
1078 Ga0070668_100004530
1079 Ga0070668_100008037
1080 Ga0070668_100033474
1081 Ga0070668_100327267
1082 Ga0070669_100005168
1083 Ga0070669_100026716
1084 Ga0070669_100103504
1085 Ga0070675_100004784
1086 Ga0070675_100013828
1087 Ga0070675_100058692
1088 Ga0070675_100108423
1089 Ga0070675_100120222
1090 Ga0070671_100004318
1091 Ga0070671_100013552
1092 Ga0070671_100018991
1093 Ga0070671_100021189
1094 Ga0070671_100024445
1095 Ga0070671_100053878
1096 Ga0070674_100018083
1097 Ga0070674_100053519
1098 Ga0070674_100121963
1099 Ga0070674_100131336
1100 Ga0070674_100172183
1101 Ga0070674_100247464
1102 Ga0070673_100001202
1103 Ga0070673_100001616
1104 Ga0070673_100005127
1105 Ga0070673_100145388
1106 Ga0070673_100156491
1107 Ga0070688_100011000
1108 Ga0070688_100017865
1109 Ga0070688_100025614
1110 Ga0070659_100000015
1111 Ga0070659_100098221
1112 Ga0070659_100187438
1113 Ga0070659_100293248
1114 Ga0070667_100005954
1115 Ga0070667_100014941
1116 Ga0070667_100023193
1117 Ga0070667_100023264
1118 Ga0070667_100058424
1119 Ga0070667_100122210
1120 Ga0070667_100176637
1121 Ga0070709_10048924
1122 Ga0070714_100083120
1123 Ga0070714_100413780
1124 Ga0070713_100001999
1125 Ga0070713_100003579
1126 Ga0070713_100059742
1127 Ga0070710_10004286
1128 Ga0070710_10016215
1129 Ga0070710_10034285
1130 Ga0070701_10196407
1131 Ga0070711_100099472
1132 Ga0070711_100289416
1133 Ga0070705_100002375
1134 Ga0070705_100021287
1135 Ga0070694_100139268
1136 Ga0070708_100001279
1137 Ga0070708_100284848
1138 Ga0070708_100431725
1139 Ga0070663_100017460
1140 Ga0070663_100023239
1141 Ga0070663_100031228
1142 Ga0070663_100045825
1143 Ga0070663_100127938
1144 Ga0070663_100181572
1145 Ga0070678_100000394
1146 Ga0070678_100002575
1147 Ga0070678_100041405
1148 Ga0070678_100089109
1149 Ga0070678_100264278
1150 Ga0070662_100015670
1151 Ga0070662_100066819
1152 Ga0070662_100102118
1153 Ga0070681_10012309
1154 Ga0070681_10257301
1155 Ga0070681_10359272
1156 Ga0070681_10447135
1157 Ga0068867_100009294
1158 Ga0068867_100028141
1159 Ga0068867_100074756
1160 Ga0068867_100194980
1161 Ga0068867_100200868
1162 Ga0068867_100267813
1163 Ga0070685_10022697
1164 Ga0070685_10078427
1165 Ga0070706_100053494
1166 Ga0070706_100109114
1167 Ga0070706_100245063
1168 Ga0070706_100249293
1169 Ga0070707_100131345
1170 Ga0070707_100377905
1171 Ga0070698_100056466
1172 Ga0070698_100271730
1173 Ga0070699_100004652
1174 Ga0070699_100008030
1175 Ga0070699_100020092
1176 Ga0070699_100061347
1177 Ga0070699_100369223
1178 Ga0070679_100009436
1179 Ga0070679_100070981
1180 Ga0070679_100072601
1181 Ga0070679_100192778
1182 Ga0070684_100006472
1183 Ga0070684_100025350
1184 Ga0070697_100099548
1185 Ga0068853_100019074
1186 Ga0068853_100092025
1187 Ga0068853_100324020
1188 Ga0070672_100000434
1189 Ga0070672_100003673
1190 Ga0070672_100007079
1191 Ga0070672_100016234
1192 Ga0070672_100118185
1193 Ga0070672_100235938
1194 Ga0070672_100268141
1195 Ga0070686_100021332
1196 Ga0070695_100005465
1197 Ga0070695_100034647
1198 Ga0070695_100135328
1199 Ga0070696_100022524
1200 Ga0070696_100149106
1201 Ga0070696_100181544
1202 Ga0070693_100003106
1203 Ga0070693_100063873
1204 Ga0070693_100326579
1205 Ga0070693_100418827
1206 Ga0070665_100002535
1207 Ga0070665_100007703
1208 Ga0070665_100020584
1209 Ga0070665_100025223
1210 Ga0070665_100030674
1211 Ga0070665_100088880
1212 Ga0070665_100622016
1213 Ga0070704_100096513
1214 Ga0070704_100149735
1215 Ga0070704_100306464
1216 Ga0068855_100001505
1217 Ga0068855_100001891
1218 Ga0068855_100033764
1219 Ga0068855_100348031
1220 Ga0070664_100019567
1221 Ga0070664_100026663
1222 Ga0070664_100087648
1223 Ga0070664_100261454
1224 Ga0070664_100263493
1225 Ga0068857_100007630
1226 Ga0068857_100032159
1227 Ga0068857_100122774
1228 Ga0068857_100280452
1229 Ga0068854_100022522
1230 Ga0068854_100047307
1231 Ga0068856_100008479
1232 Ga0068856_100015479
1233 Ga0068856_100022650
1234 Ga0068856_100096635
1235 Ga0068856_100099001
1236 Ga0070702_100033335
1237 Ga0068852_100000645
1238 Ga0068852_100065433
1239 Ga0068852_100177147
1240 Ga0068852_100344926
1241 Ga0068852_100581214
1242 Ga0068859_100000331
1243 Ga0068859_100008681
1244 Ga0068859_100036470
1245 Ga0068859_100067230
1246 Ga0068864_100000526
1247 Ga0068864_100000849
1248 Ga0068864_100001068
1249 Ga0068864_100019211
1250 Ga0068864_100023542
1251 Ga0068864_100032679
1252 Ga0068864_100121637
1253 Ga0068866_10000993
1254 Ga0068866_10079879
1255 Ga0068861_100000187
1256 Ga0068861_100004897
1257 Ga0068861_100029305
1258 Ga0068861_100401363
1259 Ga0068851_10003217
1260 Ga0068851_10003822
1261 Ga0068851_10005867
1262 Ga0068851_10052719
1263 Ga0068870_10003294
1264 Ga0068870_10056459
1265 Ga0068870_10073684
1266 Ga0068870_10137404
1267 Ga0068863_100004993
1268 Ga0068863_100006237
1269 Ga0068863_100007018
1270 Ga0068863_100049048
1271 Ga0068863_100049372
1272 Ga0068863_100274003
1273 Ga0068863_100321709
1274 Ga0068858_100000899
1275 Ga0068858_100005057
1276 Ga0068858_100030165
1277 Ga0068858_100032019
1278 Ga0068858_100179701
1279 Ga0068860_100003702
1280 Ga0068860_100014070
1281 Ga0068860_100026558
1282 Ga0068860_100050577
1283 Ga0068860_100112383
1284 Ga0068860_100219385
1285 Ga0068862_100004170
1286 Ga0068862_100024488
1287 Ga0068862_100051250
1288 Ga0081539_10002047
1289 Ga0081539_10039266
1290 Ga0075363_100020671
1291 Ga0075364_10007258
1292 Ga0070715_10117600
1293 Ga0070716_100041774
1294 Ga0070716_100329657
1295 Ga0070712_100019398
1296 Ga0070712_100022948
1297 Ga0075362_10004680
1298 Ga0075366_10029864
1299 Ga0097621_100010681
1300 Ga0097621_100017997
1301 Ga0097621_100028099
1302 Ga0097621_100046797
1303 Ga0097621_100167735
1304 Ga0068871_100003956
1305 Ga0068871_100010868
1306 Ga0068871_100038158
1307 Ga0068871_100064178
1308 Ga0075428_100087287
1309 Ga0075433_10118470
1310 Ga0075434_100018468
1311 Ga0075434_100185691
1312 Ga0075434_100366464
1313 Ga0068865_100005913
1314 Ga0068865_100007669
1315 Ga0068865_100091202
1316 Ga0068865_100243130
1317 Ga0075436_100000314
1318 Ga0075436_100020104
1319 Ga0097620_100000331
1320 Ga0097620_100008681
1321 Ga0097620_100036471
1322 Ga0097620_100067228
1323 Ga0105240_10000989
1324 Ga0105240_10013066
1325 Ga0105240_10015022
1326 Ga0105240_10153070
1327 Ga0105240_10173891
1328 Ga0105240_10264569
1329 Ga0105240_10328494
1330 Ga0105245_10023880
1331 Ga0105245_10059715
1332 Ga0105245_10117418
1333 Ga0105245_10741868
1334 Ga0105247_10126230
1335 Ga0114129_10347583
1336 Ga0105243_10118299
1337 Ga0105243_10156967
1338 Ga0105243_10309682
1339 Ga0105241_10054017
1340 Ga0105241_10222684
1341 Ga0105242_10023311
1342 Ga0105242_10094435
1343 Ga0105242_10209776
1344 Ga0105242_10676333
1345 Ga0105248_10011677
1346 Ga0105248_10013964
1347 Ga0105248_10029084
1348 Ga0105248_10142305
1349 Ga0105248_10195608
1350 Ga0105248_10324946
1351 Ga0105248_10885332
1352 Ga0105237_10006471
1353 Ga0105237_10019311
1354 Ga0105237_10235797
1355 Ga0105238_10035626
1356 Ga0105238_10050615
1357 Ga0105238_10094427
1358 Ga0105238_10188636
1359 Ga0105249_10167153
1360 Ga0105249_10218750
1361 Ga0105249_10280411
1362 Ga0105239_10025705
1363 Ga0105246_10104550
1364 Ga0105246_10188645
1365 Ga0157373_10041727
1366 Ga0157373_10067873
1367 Ga0157371_10004781
1368 Ga0157371_10093005
1369 Ga0157371_10163036
1370 Ga0157371_10194751
1371 Ga0157370_10001647
1372 Ga0157370_10004665
1373 Ga0157370_10005411
1374 Ga0157370_10015482
1375 Ga0157370_10117236
1376 Ga0157370_10135432
1377 Ga0157369_10000559
1378 Ga0157369_10006053
1379 Ga0157369_10049870
1380 Ga0157374_10000126
1381 Ga0157374_10004928
1382 Ga0157374_10017827
1383 Ga0157374_10045124
1384 Ga0157374_10064044
1385 Ga0157374_10460168
1386 Ga0157378_10030159
1387 Ga0157378_10033507
1388 Ga0157378_10304685
1389 Ga0157378_10476124
1390 Ga0163162_10035080
1391 Ga0163162_10050785
1392 Ga0163162_10105385
1393 Ga0163162_10180838
1394 Ga0163162_10730839
1395 Ga0157372_10000580
1396 Ga0157372_10081827
1397 Ga0157372_10198972
1398 Ga0157372_10258955
1399 Ga0157372_10325277
1400 Ga0157372_10617941
1401 Ga0157375_10006657
1402 Ga0157375_10019767
1403 Ga0157375_10046714
1404 Ga0157375_10056170
1405 Ga0157375_10336961
1406 Ga0157375_10461184
1407 Ga0157375_10697649
1408 Ga0163163_10001056
1409 Ga0163163_10035766
1410 Ga0163163_10066386
1411 Ga0163163_10067380
1412 Ga0163163_10526028
1413 Ga0157380_10037615
1414 Ga0157380_10052474
1415 Ga0157380_10342180
1416 Ga0157380_10402408
1417 Ga0157377_10011431
1418 Ga0157377_10164946
1419 Ga0157379_10000045
1420 Ga0157379_10001972
1421 Ga0157379_10004399
1422 Ga0157379_10024081
1423 Ga0157376_10017442
1424 Ga0157376_10028128
1425 Ga0157376_10046564
1426 Ga0157376_10049836
1427 Ga0157376_10565346
1428 Ga0182006_1014521
1429 Ga0183361_10002
1430 Ga0163161_10031880
1431 Ga0163161_10116683
1432 Ga0163161_10260664
1433 Ga0213872_10082080
1434 Ga0213876_10009758
1435 Ga0213875_10000544
1436 Ga0209566_100258
1437 Ga0209672_100037
1438 Ga0209672_100080
1439 Ga0209147_100049
1440 Ga0209147_100071
1441 Ga0209147_100091
1442 Ga0209258_100066
1443 Ga0209258_100082
1444 Ga0209148_1000195
1445 Ga0209148_1000664
1446 Ga0209759_1002833
1447 Ga0209759_1010607
1448 Ga0207666_1000977
1449 Ga0209455_1000172
1450 Ga0209455_1000530
1451 Ga0209673_1000076
1452 Ga0209130_1007823
1453 Ga0207673_1005919
1454 Ga0209564_1004566
1455 Ga0207426_1000021
1456 Ga0207697_10000594
1457 Ga0207697_10042841
1458 Ga0207656_10002348
1459 Ga0207656_10038973
1460 Ga0207682_10000298
1461 Ga0207682_10002121
1462 Ga0207682_10002878
1463 Ga0207682_10070846
1464 Ga0207682_10082468
1465 Ga0207682_10093231
1466 Ga0207692_10014897
1467 Ga0207642_10019328
1468 Ga0207642_10216183
1469 Ga0207688_10000914
1470 Ga0207680_10003569
1471 Ga0207680_10007043
1472 Ga0207680_10027223
1473 Ga0207680_10030223
1474 Ga0207680_10059696
1475 Ga0207647_10001075
1476 Ga0207647_10002066
1477 Ga0207647_10036553
1478 Ga0207647_10065560
1479 Ga0207699_10036232
1480 Ga0207645_10002475
1481 Ga0207645_10035948
1482 Ga0207645_10045426
1483 Ga0207645_10094920
1484 Ga0207643_10000777
1485 Ga0207643_10018919
1486 Ga0207643_10071662
1487 Ga0207643_10076519
1488 Ga0207643_10200029
1489 Ga0207705_10010614
1490 Ga0207705_10038414
1491 Ga0207705_10307194
1492 Ga0207684_10047181
1493 Ga0207654_10030006
1494 Ga0207654_10197242
1495 Ga0207707_10012372
1496 Ga0207707_10023744
1497 Ga0207707_10028294
1498 Ga0207707_10199572
1499 Ga0207695_10002708
1500 Ga0207695_10039807
1501 Ga0207695_10041810
1502 Ga0207695_10087808
1503 Ga0207695_10191350
1504 Ga0207695_10279198
1505 Ga0207671_10041955
1506 Ga0207693_10000415
1507 Ga0207693_10008998
1508 Ga0207663_10014895
1509 Ga0207660_10016821
1510 Ga0207660_10029744
1511 Ga0207660_10214737
1512 Ga0207662_10014678
1513 Ga0207662_10186065
1514 Ga0207657_10000014
1515 Ga0207657_10000709
1516 Ga0207657_10001175
1517 Ga0207657_10003742
1518 Ga0207657_10013752
1519 Ga0207657_10076189
1520 Ga0207657_10080360
1521 Ga0207649_10044429
1522 Ga0207649_10068338
1523 Ga0207649_10108906
1524 Ga0207652_10020779
1525 Ga0207652_10029911
1526 Ga0207652_10052490
1527 Ga0207652_10072891
1528 Ga0207646_10091523
1529 Ga0207646_10101913
1530 Ga0207681_10003673
1531 Ga0207681_10029729
1532 Ga0207681_10101134
1533 Ga0207681_10354124
1534 Ga0207694_10028254
1535 Ga0207694_10128776
1536 Ga0207694_10355315
1537 Ga0207650_10002369
1538 Ga0207650_10002799
1539 Ga0207650_10002854
1540 Ga0207650_10004490
1541 Ga0207650_10007113
1542 Ga0207650_10041860
1543 Ga0207650_10043355
1544 Ga0207650_10158407
1545 Ga0207659_10002875
1546 Ga0207659_10003272
1547 Ga0207659_10004738
1548 Ga0207659_10008158
1549 Ga0207687_10018080
1550 Ga0207687_10043270
1551 Ga0207687_10100502
1552 Ga0207687_10539758
1553 Ga0207700_10000031
1554 Ga0207700_10005665
1555 Ga0207700_10105967
1556 Ga0207664_10007727
1557 Ga0207664_10137430
1558 Ga0207664_10436044
1559 Ga0207644_10002148
1560 Ga0207644_10005225
1561 Ga0207644_10008481
1562 Ga0207644_10010560
1563 Ga0207644_10044073
1564 Ga0207644_10229802
1565 Ga0207644_10300976
1566 Ga0207644_10396917
1567 Ga0207690_10000023
1568 Ga0207690_10290936
1569 Ga0207706_10000002
1570 Ga0207706_10001696
1571 Ga0207706_10056698
1572 Ga0207706_10102213
1573 Ga0207706_10386439
1574 Ga0207686_10000198
1575 Ga0207686_10012324
1576 Ga0207670_10002399
1577 Ga0207670_10072361
1578 Ga0207670_10124562
1579 Ga0207669_10006740
1580 Ga0207669_10012415
1581 Ga0207669_10019474
1582 Ga0207669_10146878
1583 Ga0207669_10302292
1584 Ga0207704_10014838
1585 Ga0207704_10146046
1586 Ga0207704_10168223
1587 Ga0207704_10253054
1588 Ga0207665_10004770
1589 Ga0207665_10049697
1590 Ga0207665_10382225
1591 Ga0207691_10000006
1592 Ga0207691_10001801
1593 Ga0207691_10004008
1594 Ga0207691_10006366
1595 Ga0207691_10006549
1596 Ga0207691_10019166
1597 Ga0207691_10032269
1598 Ga0207691_10117216
1599 Ga0207691_10153618
1600 Ga0207691_10165842
1601 Ga0207691_10342118
1602 Ga0207691_10343379
1603 Ga0207691_10374549
1604 Ga0207711_10000961
1605 Ga0207711_10007443
1606 Ga0207711_10024416
1607 Ga0207711_10054146
1608 Ga0207711_10149358
1609 Ga0207689_10000030
1610 Ga0207689_10008383
1611 Ga0207689_10009443
1612 Ga0207689_10027139
1613 Ga0207689_10123975
1614 Ga0207689_10180238
1615 Ga0207689_10233456
1616 Ga0207661_10033927
1617 Ga0207661_10040821
1618 Ga0207661_10047817
1619 Ga0207661_10177634
1620 Ga0207661_10199834
1621 Ga0207679_10035876
1622 Ga0207679_10158837
1623 Ga0207679_10242166
1624 Ga0207679_10265352
1625 Ga0207679_10289628
1626 Ga0207667_10003662
1627 Ga0207667_10009443
1628 Ga0207667_10059631
1629 Ga0207667_10134162
1630 Ga0207667_10157659
1631 Ga0207667_10191190
1632 Ga0207667_10205686
1633 Ga0207651_10002592
1634 Ga0207651_10023718
1635 Ga0207651_10039250
1636 Ga0207651_10212521
1637 Ga0207651_10225909
1638 Ga0207651_10283516
1639 Ga0207712_10130951
1640 Ga0207712_10238117
1641 Ga0207668_10002769
1642 Ga0207668_10018612
1643 Ga0207668_10018640
1644 Ga0207668_10022062
1645 Ga0207668_10030471
1646 Ga0207668_10299067
1647 Ga0207668_10383285
1648 Ga0207668_10626073
1649 Ga0207640_10011255
1650 Ga0207640_10171378
1651 Ga0207640_10211937
1652 Ga0207658_10001775
1653 Ga0207658_10002011
1654 Ga0207658_10016664
1655 Ga0207658_10020229
1656 Ga0207658_10024305
1657 Ga0207658_10054986
1658 Ga0207658_10101189
1659 Ga0207658_10316662
1660 Ga0207677_10000439
1661 Ga0207677_10020379
1662 Ga0207677_10242232
1663 Ga0207703_10000143
1664 Ga0207703_10001820
1665 Ga0207703_10038014
1666 Ga0207703_10053414
1667 Ga0207703_10115770
1668 Ga0207703_10337312
1669 Ga0207639_10023378
1670 Ga0207639_10026067
1671 Ga0207639_10231799
1672 Ga0207678_10003787
1673 Ga0207678_10019516
1674 Ga0207678_10024311
1675 Ga0207678_10041187
1676 Ga0207678_10120114
1677 Ga0207678_10199556
1678 Ga0207678_10345233
1679 Ga0207708_10035205
1680 Ga0207702_10003558
1681 Ga0207702_10014339
1682 Ga0207702_10014885
1683 Ga0207702_10046919
1684 Ga0207702_10155657
1685 Ga0207641_10002451
1686 Ga0207641_10002867
1687 Ga0207641_10009339
1688 Ga0207641_10021722
1689 Ga0207641_10032744
1690 Ga0207641_10038927
1691 Ga0207641_10050400
1692 Ga0207641_10664980
1693 Ga0207648_10001949
1694 Ga0207648_10011138
1695 Ga0207648_10020408
1696 Ga0207648_10031224
1697 Ga0207648_10048524
1698 Ga0207648_10049066
1699 Ga0207648_10235016
1700 Ga0207676_10001099
1701 Ga0207676_10001806
1702 Ga0207676_10002733
1703 Ga0207676_10031793
1704 Ga0207676_10097367
1705 Ga0207676_10197383
1706 Ga0207674_10001272
1707 Ga0207674_10001685
1708 Ga0207674_10008968
1709 Ga0207674_10017603
1710 Ga0207674_10151784
1711 Ga0207674_10324418
1712 Ga0207675_100003099
1713 Ga0207675_100021077
1714 Ga0207675_100021286
1715 Ga0207675_100039504
1716 Ga0207683_10000011
1717 Ga0207683_10000235
1718 Ga0207683_10006617
1719 Ga0207683_10012514
1720 Ga0207683_10061620
1721 Ga0207683_10113946
1722 Ga0207698_10021405
1723 Ga0207698_10036797
1724 Ga0207698_10130548
1725 Ga0207698_10339454
1726 Ga0207698_10361703
1727 Ga0209371_1000713
1728 Ga0209982_1006264
1729 Ga0209974_10039673
1730 Ga0207428_10122320
1731 Ga0268266_10015819
1732 Ga0268266_10039426
1733 Ga0268266_10060694
1734 Ga0268266_10549733
1735 Ga0268265_10040737
1736 Ga0268265_10051581
1737 Ga0268265_10314273
1738 Ga0268265_10593518
1739 Ga0268264_10004002
1740 Ga0268264_10036916
1741 Ga0268264_10191704
1742 Ga0268264_10290682
1743 Ga0265318_10000258
1744 Ga0268256_1000608
1745 Ga0265330_10002502
1746 Ga0265332_10000138
1747 Ga0265332_10000707
1748 Ga0265320_10000284
1749 Ga0265329_10000076
1750 Ga0265329_10008238
1751 Ga0265340_10000468
1752 Ga0265339_10000961
1753 Ga0265331_10000310
1754 Ga0265331_10003288
1755 Ga0265331_10122666
1756 Ga0265327_10003395
1757 Ga0265327_10016933
1758 Ga0265316_10002148
1759 Ga0265316_10137696
1760 Ga0307408_100070513
1761 Ga0265313_10000089
1762 Ga0265314_10000211
1763 Ga0265314_10054250
1764 Ga0265342_10000390
1765 Ga0265342_10012918
1766 Ga0307405_10037797
1767 Ga0307413_10000069
1768 Ga0307410_10014522
1769 Ga0307406_10013056
1770 Ga0307407_10020270
1771 Ga0307412_10000039
1772 Ga0307412_10027150
1773 Ga0307409_100006556
1774 Ga0307416_100054913
1775 Ga0307416_100254409
1776 Ga0307411_10004260
1777 Ga0373926_0007908
1778 Ga0373934_0025723
1779 Ga0373953_0003180
1780 Ga0373954_0002627
1781 Ga0373954_0022208
1782 Ga0373956_0128260
1783 Ga0373955_0002970
1784 Ga0373955_0040742
1785 Ga0373955_0158570
1786 Ga0373924_0030605
1787 Ga0373935_0028386
1788 Ga0373935_0271960
1789 Ga0373927_0008088
1790 Ga0373927_0097169
1791 Ga0373937_0084051
1792 Ga0373937_0135525
1793 Ga0373937_0168887
1794 Ga0373937_0280184
1795 Ga0373925_0063963
1796 Ga0373925_0425478
1797 Ga0395900_0000986
1798 Ga0395900_0257250
1799 Ga0395898_0031382
1800 Ga0395898_0085169
1801 Ga0395898_0637838
1802 Ga0395905_0000160
1803 Ga0395905_0026803
1804 Ga0436364_0439553
1805 Ga0436364_1346273
1806 Ga0395901_0398462
1807 Ga0436365_0989741
1808 Ga0436365_1069777
1809 Ga0436365_1151289
1810 Ga0436361_0117653
1811 Ga0436361_0354175
1812 Ga0436363_0104264
1813 Ga0439448_0004602
1814 Ga0466969_0006212
1815 Ga0466969_0020802
1816 Ga0466972_0062670
1817 Ga0466973_0026204
1818 Ga0466977_0000069
1819 Ga0466965_0025867
1820 Ga0466966_0005693
1821 Ga0466966_0009878
1822 Ga0466961_0113759
1823 Ga0466963_0032526
1824 Ga0466963_0170948
1825 Ga0466971_0097913
1826 Ga0466968_0017187
1827 Ga0466959_0000837
1828 Ga0466959_0047353
1829 Ga0466958_0022018
1830 Ga0495629_0019844
1831 Ga0495629_0067247
1832 Ga0495653_0142085
1833 Ga0495580_0057535
1834 Ga0495582_0041168
1835 Ga0495605_0013576
1836 Ga0495605_0051053
1837 Ga0495664_0008665
1838 Ga0495596_0023423
1839 Ga0495583_0031381
1840 Ga0495606_0166417
1841 Ga0495610_0024855
1842 Ga0495648_0013399
1843 Ga0495665_0024299
1844 Ga0495598_0038443
1845 Ga0495635_0008216
1846 Ga0495659_0051317
1847 Ga0495623_0146348
1848 Ga0495647_0017671
1849 Ga0495613_0042427
1850 Ga0495636_0100533
1851 Ga0495674_0095615
1852 Ga0495672_0014413
1853 Ga0495683_0067655
1854 Ga0495687_019914
1855 Ga0495687_084586
1856 Ga0495684_0093925
1857 Ga0495593_0127147
1858 Ga0495615_0007432
1859 Ga0495626_0046475
1860 Ga0496100_0030828
1861 Ga0496100_0143847
1862 Ga0496101_0038170
1863 Ga0496101_0069189
1864 Ga0496101_0072351
1865 Ga0496102_0002582
1866 Ga0496102_0143312
1867 Ga0496102_0231893
1868 Ga0496103_0038910
1869 Ga0496103_0059035
1870 Ga0496103_0091988
1871 Ga0496104_0009506
1872 Ga0496104_0023137
1873 Ga0496104_0054849
1874 Ga0496105_0105237
1875 Ga0496105_0154036
1876 Ga0496106_0064413
1877 Ga0496106_0202793
1878 Ga0496108_0001057
1879 Ga0496108_0017131
1880 Ga0496108_0485151
1881 Ga0496109_0023824
1882 Ga0496109_0112987
1883 Ga0496110_0132683
1884 Ga0496110_0191840
1885 Ga0496112_0001350
1886 Ga0496112_0013251
1887 Ga0496113_0244932
1888 Ga0496114_0064889
1889 Ga0496114_0095615
1890 Ga0496114_0148498
1891 Ga0496114_0446199
1892 Ga0496115_0178285
1893 Ga0496117_0017379
1894 Ga0496117_0033407
1895 Ga0496118_0003264
1896 Ga0496118_0057278
1897 Ga0496119_0150569
1898 Ga0496120_0128379
1899 Ga0496121_0007027
1900 Ga0496121_0086724
1901 Ga0496125_0000136
1902 Ga0496125_0008155
1903 Ga0496126_0108721
1904 Ga0495678_049273
1905 Ga0501043_0128768
1906 Ga0501067_0145785
1907 Ga0501083_0205537
1908 nmdc:mga03683_45948_c1
1909 nmdc:mga0k408_1287_c1
1910 nmdc:mga07m45_52653_c1
1911 nmdc:mga05p37_112460_c1
1912 nmdc:mga05p37_852801_c1
1913 nmdc:mga0n895_183492_c1
1914 nmdc:mga0n895_257996_c1
1915 nmdc:mga0rr50_341425_c1
1916 nmdc:mga08x19_14029_c1
1917 nmdc:mga08x19_41812_c1
1918 nmdc:mga08x19_6410_c1
1919 nmdc:mga0a205_15898_c1
1920 nmdc:mga0a205_226439_c1
1921 Ga0495619_0102608
1922 Ga0500616_0011005
1923 Ga0500637_0151428
1924 Ga0587077_009432
1925 Ga0501082_0000206
1926 Ga0466962_0045313
1927 2514053686
1928 2515689024
1929 2527077229
1930 2563060585
1931 2599741555
1932 2600811191
1933 2713475762
1934 2738819364
1935 2738831843
1936 2738873371
1937 2739185001
1938 2739219970
1939 2753265639
1940 2772642989
1941 2792838811
1942 2819630769
1943 2855673035
1944 2855679196
1945 2857293771
1946 2858851055
1947 2858884419
1948 2858893667
1949 2858896806
1950 2863424610
1951 2869053606
1952 2869062990
1953 2869069157
1954 2870071460
1955 2880491850
1956 2880500454
1957 2904568602
1958 2904575644
1959 2904625190
1960 2928160396
1961 2928170641
1962 2928172574
1963 2928540665
1964 2929224121
1965 2929228959
1966 2945940378
1967 2981996297
1968 2990707506
1969 642423947
1970 642418214
1971 642596198
1972 8003831352
1973 8003873781
1974 8018846742
1975 8020941428
1976 8020949381
1977 8020957783
1978 8021127997
1979 8054706347
1980 8054727921
1981 8054736839
1982 8055267789

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

112

316

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8465 14 275
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8304 14 277
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8298 14 275
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8021 14 275
4xtc-assembly1.cif.gz_M crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein 0.7936 14 284
ID Description Score Start End Superfamily
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8457 14 273 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8434 16 277 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8342 45 280 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8298 18 279 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8283 49 277 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A263DID1-F1-model_v4 ABC transporter permease 0.8733 12 289 GO:0005886
GO:0055085
AF-A0A3D6DDR0-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8693 16 284 GO:0005886
GO:0055085
AF-A0A838K4Z3-F1-model_v4 Sugar ABC transporter permease 0.868 15 289 GO:0005886
GO:0055085
AF-A0A4Q6EVX7-F1-model_v4 deleted 0.868 15 272
AF-A0A263DID1-F1-model_v4 ABC transporter permease 0.8675 12 289 GO:0005886
GO:0055085

Map