F487649

General Info

Members Datasets Scaffolds Average Seq Length
991 420 1978 271

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0111220|Ga0501084_0111220_490_1356
Length 288
Sequence MVPENSLDWRAFTSNCAQTSGGLPMLTSQAVARELPRLRRYARALTGNQTSGDAYVTATLEALAEDPSSLNADDDISIGLFSAFTRIWNSVELNTSSSAGGLIDEHIRGMTPLPRQAFLLVSLEDFAEPAAAKILDVPVIELRRLIEEAGRELAAEIATEVLIIEDEPLIAMDLEGLVESLGHSVTGIGRTQKEAVALAKEKPPGLILADIRLADMSSGVDAVNEMLQDLEVPVIFITAYPEQLLTGERPEPAFLITKPFRPTTVAAVISQALFFGRKATTRKKAVEA

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
157 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
158 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
159 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
160 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
161 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
245 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
250 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
251 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
252 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
253 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
254 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
255 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
256 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
257 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
258 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
259 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
260 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
261 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
267 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
275 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
276 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
284 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
285 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
287 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
288 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
289 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
290 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
291 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
292 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
297 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
302 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
303 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
304 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
305 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
306 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
318 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
391 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
397 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
398 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
401 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
408 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
411 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
412 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
413 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
414 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
415 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
419 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
420 2842694124 Methylopila sp. R-72369 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0.91
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 0
Rhizoplane 5.65
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0111220 3300054114 Bacteria 2302
2 2214572714 2209111006 Bacteria 5910
3 ARcpr5oldR_c000130 3300000041 Bacteria 13090
4 ARSoilYngRDRAFT_c00118 3300000042 Bacteria 13503
5 ARcpr5yngRDRAFT_c000035 3300000043 Bacteria 21396
6 ARCol0yngRDRAFT_1000209 3300000652 Bacteria 9893
7 JGI24752J21851_1013069 3300001976 Bacteria 1084
8 JGI24746J21847_1000683 3300001977 Bacteria 5199
9 JGI24747J21853_1003746 3300001978 Bacteria 1327
10 JGI24739J22299_10000158 3300001989 Bacteria 22012
11 JGI24737J22298_10001510 3300001990 Bacteria 8284
12 JGI24737J22298_10001948 3300001990 Bacteria 7386
13 JGI24743J22301_10018083 3300001991 Bacteria 1329
14 JGI24745J21846_1001135 3300002073 Bacteria 2534
15 JGI24748J21848_1000574 3300002074 Bacteria 3956
16 JGI24748J21848_1000699 3300002074 Bacteria 3614
17 JGI24738J21930_10003334 3300002075 Bacteria 4072
18 JGI24749J21850_1005514 3300002076 Bacteria 1771
19 JGI24749J21850_1012555 3300002076 Bacteria 1189
20 JGI24744J21845_10001094 3300002077 Bacteria 5249
21 JGI24035J26624_1000023 3300002126 Bacteria 11063
22 JGI24033J26618_1001768 3300002155 Bacteria 2161
23 JGI24034J26672_10001325 3300002239 Bacteria 3266
24 JGI24742J22300_10000706 3300002244 Bacteria 5053
25 JGI24751J29686_10002998 3300002459 Bacteria 3409
26 JGI24751J29686_10008505 3300002459 Bacteria 2101
27 JGI25405J52794_10031077 3300003911 Bacteria 1109
28 Ga0065712_10007917 3300005290 Bacteria 6107
29 Ga0065712_10089850 3300005290 Bacteria 2450
30 Ga0065715_10089004 3300005293 Bacteria 17365
31 Ga0065707_10143694 3300005295 Unclassified 1723
32 Ga0070658_10006919 3300005327 Bacteria 9160
33 Ga0070676_10001138 3300005328 Bacteria 13281
34 Ga0070676_10126576 3300005328 Unclassified 1610
35 Ga0070676_10182049 3300005328 Bacteria 1367
36 Ga0070683_100163764 3300005329 Bacteria 2110
37 Ga0070690_100000727 3300005330 Bacteria 16862
38 Ga0070690_100126144 3300005330 Bacteria 1723
39 Ga0070670_100004168 3300005331 Bacteria 12095
40 Ga0070670_100060563 3300005331 Bacteria 3250
41 Ga0070670_100110934 3300005331 Bacteria 2364
42 Ga0070677_10003207 3300005333 Bacteria 5264
43 Ga0070677_10003757 3300005333 Bacteria 4911
44 Ga0068869_100087385 3300005334 Bacteria 2339
45 Ga0070666_10018444 3300005335 Bacteria 4487
46 Ga0070666_10018621 3300005335 Bacteria 4469
47 Ga0070680_100006389 3300005336 Bacteria 8955
48 Ga0070680_100024710 3300005336 Bacteria 4802
49 Ga0070680_100067076 3300005336 Bacteria 2943
50 Ga0070680_100135083 3300005336 Bacteria 2066
51 Ga0070680_100193681 3300005336 Bacteria 1713
52 Ga0070682_100007941 3300005337 Bacteria 5969
53 Ga0070682_100096561 3300005337 Bacteria 1943
54 Ga0068868_100000944 3300005338 Bacteria 19746
55 Ga0068868_100050586 3300005338 Bacteria 3264
56 Ga0068868_100115031 3300005338 Bacteria 2189
57 Ga0068868_100302318 3300005338 Bacteria 1359
58 Ga0070660_100015021 3300005339 Bacteria 5585
59 Ga0070660_100048298 3300005339 Bacteria 3269
60 Ga0070660_100084985 3300005339 Bacteria 2488
61 Ga0070660_100117966 3300005339 Bacteria 2116
62 Ga0070660_100126808 3300005339 Bacteria 2040
63 Ga0070660_100143923 3300005339 Bacteria 1914
64 Ga0070689_100000646 3300005340 Bacteria 21086
65 Ga0070689_100002989 3300005340 Bacteria 11115
66 Ga0070689_100006613 3300005340 Bacteria 8049
67 Ga0070689_100009931 3300005340 Bacteria 6770
68 Ga0070689_100027299 3300005340 Bacteria 4303
69 Ga0070689_100086479 3300005340 Bacteria 2466
70 Ga0070691_10000125 3300005341 Bacteria 23286
71 Ga0070687_100000773 3300005343 Bacteria 10637
72 Ga0070687_100050373 3300005343 Bacteria 2150
73 Ga0070687_100115673 3300005343 Bacteria 1525
74 Ga0070661_100013869 3300005344 Bacteria 5662
75 Ga0070661_100018561 3300005344 Bacteria 4947
76 Ga0070692_10038970 3300005345 Bacteria 2425
77 Ga0070669_100172652 3300005353 Bacteria 1686
78 Ga0070675_100005686 3300005354 Bacteria 9545
79 Ga0070675_100112209 3300005354 Bacteria 2308
80 Ga0070671_100000170 3300005355 Bacteria 42992
81 Ga0070671_100032596 3300005355 Bacteria 4306
82 Ga0070671_100053267 3300005355 Bacteria 3363
83 Ga0070671_100054894 3300005355 Bacteria 3313
84 Ga0070674_100026051 3300005356 Bacteria 3815
85 Ga0070674_100053517 3300005356 Bacteria 2788
86 Ga0070673_100015366 3300005364 Bacteria 5375
87 Ga0070673_100020936 3300005364 Bacteria 4728
88 Ga0070673_100136776 3300005364 Unclassified 2063
89 Ga0070673_100154134 3300005364 Bacteria 1948
90 Ga0070688_100001455 3300005365 Bacteria 11770
91 Ga0070688_100002194 3300005365 Bacteria 9852
92 Ga0070688_100008402 3300005365 Bacteria 5602
93 Ga0070688_100081413 3300005365 Bacteria 2096
94 Ga0070688_100091355 3300005365 Bacteria 1989
95 Ga0070659_100000621 3300005366 Bacteria 25919
96 Ga0070659_100128803 3300005366 Bacteria 2054
97 Ga0070667_100044536 3300005367 Bacteria 3727
98 Ga0070667_100133608 3300005367 Bacteria 2168
99 Ga0070667_100139072 3300005367 Unclassified 2125
100 Ga0070703_10001450 3300005406 Bacteria 7142
101 Ga0070709_10006995 3300005434 Bacteria 6165
102 Ga0070709_10019522 3300005434 Bacteria 3920
103 Ga0070709_10113191 3300005434 Unclassified 1827
104 Ga0070714_100037912 3300005435 Bacteria 4053
105 Ga0070714_100095284 3300005435 Bacteria 2614
106 Ga0070714_100099561 3300005435 Bacteria 2559
107 Ga0070713_100019242 3300005436 Bacteria 5207
108 Ga0070713_100029152 3300005436 Bacteria 4367
109 Ga0070713_100067156 3300005436 Bacteria 3018
110 Ga0070713_100167387 3300005436 Bacteria 1966
111 Ga0070713_100256266 3300005436 Bacteria 1598
112 Ga0070710_10014458 3300005437 Bacteria 3975
113 Ga0070710_10016436 3300005437 Bacteria 3766
114 Ga0070710_10062381 3300005437 Bacteria 2125
115 Ga0070711_100008373 3300005439 Bacteria 6335
116 Ga0070711_100050862 3300005439 Bacteria 2843
117 Ga0070711_100336725 3300005439 Bacteria 1209
118 Ga0070705_100004061 3300005440 Bacteria 7149
119 Ga0070705_100172914 3300005440 Bacteria 1456
120 Ga0070700_100080805 3300005441 Unclassified 2098
121 Ga0070694_100002007 3300005444 Bacteria 12098
122 Ga0070694_100004869 3300005444 Bacteria 8086
123 Ga0070708_100053874 3300005445 Bacteria 3572
124 Ga0070663_100016477 3300005455 Bacteria 4802
125 Ga0070663_100030911 3300005455 Bacteria 3674
126 Ga0070663_100076820 3300005455 Bacteria 2443
127 Ga0070663_100225669 3300005455 Bacteria 1473
128 Ga0070678_100051868 3300005456 Bacteria 2976
129 Ga0070678_100073272 3300005456 Bacteria 2570
130 Ga0070678_100109769 3300005456 Bacteria 2156
131 Ga0070662_100016774 3300005457 Bacteria 4923
132 Ga0070662_100033442 3300005457 Bacteria 3620
133 Ga0070662_100050943 3300005457 Bacteria 2988
134 Ga0070681_10004332 3300005458 Bacteria 13487
135 Ga0070681_10016792 3300005458 Bacteria 7309
136 Ga0070681_10017562 3300005458 Bacteria 7149
137 Ga0070681_10034345 3300005458 Bacteria 5091
138 Ga0070681_10101784 3300005458 Bacteria 2818
139 Ga0070681_10131805 3300005458 Bacteria 2432
140 Ga0068867_100007473 3300005459 Bacteria 7727
141 Ga0068867_100540740 3300005459 Bacteria 1007
142 Ga0070685_10018648 3300005466 Bacteria 3735
143 Ga0070685_10019896 3300005466 Bacteria 3627
144 Ga0070685_10034894 3300005466 Bacteria 2836
145 Ga0070698_100056891 3300005471 Bacteria 3960
146 Ga0070698_100141478 3300005471 Bacteria 2357
147 Ga0070699_100065967 3300005518 Bacteria 3142
148 Ga0070699_100148577 3300005518 Bacteria 2072
149 Ga0070679_100021073 3300005530 Bacteria 6360
150 Ga0070679_100102549 3300005530 Bacteria 2847
151 Ga0070679_100106382 3300005530 Bacteria 2791
152 Ga0070679_100592576 3300005530 Bacteria 1052
153 Ga0070684_100005730 3300005535 Bacteria 9545
154 Ga0070684_100096228 3300005535 Bacteria 2639
155 Ga0068853_100073930 3300005539 Bacteria 2973
156 Ga0068853_100175892 3300005539 Bacteria 1939
157 Ga0068853_100239910 3300005539 Bacteria 1661
158 Ga0070672_100000557 3300005543 Bacteria 21802
159 Ga0070672_100066989 3300005543 Bacteria 2844
160 Ga0070672_100154999 3300005543 Bacteria 1897
161 Ga0070672_100372903 3300005543 Unclassified 1220
162 Ga0070686_100002869 3300005544 Bacteria 9472
163 Ga0070686_100003376 3300005544 Bacteria 8749
164 Ga0070686_100010566 3300005544 Bacteria 5210
165 Ga0070686_100077078 3300005544 Bacteria 2197
166 Ga0070695_100009085 3300005545 Bacteria 5907
167 Ga0070696_100026503 3300005546 Bacteria 3944
168 Ga0070696_100133658 3300005546 Bacteria 1807
169 Ga0070693_100009465 3300005547 Bacteria 4847
170 Ga0070665_100021216 3300005548 Bacteria 6530
171 Ga0070704_100004070 3300005549 Bacteria 8436
172 Ga0070704_100008436 3300005549 Bacteria 6180
173 Ga0068855_100016277 3300005563 Bacteria 8943
174 Ga0068855_100106615 3300005563 Bacteria 3220
175 Ga0068855_100303236 3300005563 Bacteria 1769
176 Ga0070664_100000263 3300005564 Bacteria 37910
177 Ga0070664_100033520 3300005564 Bacteria 4303
178 Ga0070664_100052452 3300005564 Bacteria 3455
179 Ga0070664_100086013 3300005564 Bacteria 2716
180 Ga0070664_100171002 3300005564 Bacteria 1928
181 Ga0068857_100000888 3300005577 Bacteria 22595
182 Ga0068857_100032844 3300005577 Bacteria 4587
183 Ga0068854_100005378 3300005578 Bacteria 8082
184 Ga0068856_100003260 3300005614 Bacteria 16512
185 Ga0068856_100384779 3300005614 Bacteria 1422
186 Ga0070702_100001911 3300005615 Bacteria 8749
187 Ga0068852_100000579 3300005616 Bacteria 24117
188 Ga0068852_100020377 3300005616 Bacteria 5274
189 Ga0068852_100156337 3300005616 Bacteria 2124
190 Ga0068859_100003690 3300005617 Bacteria 15603
191 Ga0068859_100047890 3300005617 Bacteria 4295
192 Ga0068859_100077356 3300005617 Bacteria 3368
193 Ga0068859_100154435 3300005617 Bacteria 2372
194 Ga0068859_100206704 3300005617 Unclassified 2048
195 Ga0068864_100001260 3300005618 Bacteria 21062
196 Ga0068864_100032661 3300005618 Bacteria 4423
197 Ga0068864_100082174 3300005618 Bacteria 2826
198 Ga0068866_10001077 3300005718 Bacteria 12040
199 Ga0068866_10082741 3300005718 Bacteria 1728
200 Ga0068861_100001782 3300005719 Bacteria 13850
201 Ga0068861_100033648 3300005719 Bacteria 3783
202 Ga0068861_100129105 3300005719 Bacteria 2049
203 Ga0068861_100291730 3300005719 Bacteria 1409
204 Ga0068851_10200170 3300005834 Bacteria 1114
205 Ga0068870_10000108 3300005840 Bacteria 28313
206 Ga0068863_100001201 3300005841 Bacteria 25868
207 Ga0068863_100025548 3300005841 Bacteria 5631
208 Ga0068863_100064839 3300005841 Bacteria 3455
209 Ga0068858_100000419 3300005842 Bacteria 44155
210 Ga0068858_100027844 3300005842 Bacteria 5250
211 Ga0068858_100046567 3300005842 Bacteria 4020
212 Ga0068858_100181425 3300005842 Bacteria 1988
213 Ga0068858_100327084 3300005842 Bacteria 1466
214 Ga0068860_100001359 3300005843 Bacteria 26585
215 Ga0068860_100020550 3300005843 Bacteria 6396
216 Ga0068860_100059646 3300005843 Bacteria 3627
217 Ga0068860_100162464 3300005843 Bacteria 2154
218 Ga0068862_100005815 3300005844 Bacteria 10279
219 Ga0068862_100217261 3300005844 Bacteria 1729
220 Ga0068862_100438684 3300005844 Bacteria 1229
221 Ga0068862_100689519 3300005844 Bacteria 989
222 Ga0081455_10000009 3300005937 Bacteria 249885
223 Ga0081455_10004299 3300005937 Bacteria 16034
224 Ga0081455_10009512 3300005937 Bacteria 9988
225 Ga0081455_10031917 3300005937 Bacteria 4755
226 Ga0081455_10052863 3300005937 Bacteria 3474
227 Ga0081455_10109166 3300005937 Bacteria 2202
228 Ga0081538_10004153 3300005981 Bacteria 13436
229 Ga0081538_10025193 3300005981 Bacteria 4204
230 Ga0081538_10123568 3300005981 Bacteria 1237
231 Ga0081540_1003051 3300005983 Bacteria 13420
232 Ga0081539_10002606 3300005985 Bacteria 24730
233 Ga0070717_10012616 3300006028 Bacteria 6447
234 Ga0070717_10060095 3300006028 Bacteria 3147
235 Ga0070717_10166732 3300006028 Bacteria 1913
236 Ga0075365_10061816 3300006038 Bacteria 2502
237 Ga0075365_10382844 3300006038 Bacteria 992
238 Ga0075368_10015550 3300006042 Bacteria 2825
239 Ga0075368_10041123 3300006042 Bacteria 1816
240 Ga0075432_10005568 3300006058 Bacteria 4290
241 Ga0075432_10024861 3300006058 Bacteria 2054
242 Ga0075432_10102466 3300006058 Bacteria 1059
243 Ga0070715_10008072 3300006163 Bacteria 3653
244 Ga0070716_100004485 3300006173 Bacteria 6678
245 Ga0070716_100049983 3300006173 Unclassified 2371
246 Ga0070716_100515807 3300006173 Bacteria 885
247 Ga0070712_100005677 3300006175 Bacteria 7715
248 Ga0070712_100005829 3300006175 Bacteria 7623
249 Ga0070712_100011711 3300006175 Bacteria 5573
250 Ga0070712_100026436 3300006175 Bacteria 3866
251 Ga0070712_100040984 3300006175 Bacteria 3177
252 Ga0070712_100123361 3300006175 Bacteria 1953
253 Ga0075367_10023664 3300006178 Bacteria 3458
254 Ga0075366_10006561 3300006195 Bacteria 6382
255 Ga0097621_100002584 3300006237 Bacteria 12403
256 Ga0097621_100012651 3300006237 Bacteria 6265
257 Ga0097621_100043375 3300006237 Bacteria 3626
258 Ga0075370_10029418 3300006353 Bacteria 3061
259 Ga0075370_10031420 3300006353 Bacteria 2964
260 Ga0068871_100000417 3300006358 Bacteria 29416
261 Ga0068871_100011895 3300006358 Bacteria 6403
262 Ga0068871_100013278 3300006358 Bacteria 6110
263 Ga0075428_100003881 3300006844 Bacteria 16432
264 Ga0075428_100131390 3300006844 Bacteria 2723
265 Ga0075428_100244896 3300006844 Bacteria 1934
266 Ga0075428_100248253 3300006844 Bacteria 1918
267 Ga0075428_100266783 3300006844 Bacteria 1843
268 Ga0075428_100300619 3300006844 Bacteria 1725
269 Ga0075428_100325983 3300006844 Bacteria 1650
270 Ga0075430_100001576 3300006846 Bacteria 18645
271 Ga0075430_100003854 3300006846 Bacteria 12635
272 Ga0075430_100019980 3300006846 Bacteria 5701
273 Ga0075430_100022460 3300006846 Bacteria 5369
274 Ga0075430_100157543 3300006846 Bacteria 1890
275 Ga0075430_100346115 3300006846 Bacteria 1228
276 Ga0075431_100003990 3300006847 Bacteria 14380
277 Ga0075431_100061408 3300006847 Bacteria 3877
278 Ga0075431_100071416 3300006847 Bacteria 3582
279 Ga0075431_100133607 3300006847 Bacteria 2558
280 Ga0075431_100150388 3300006847 Bacteria 2397
281 Ga0075431_100187571 3300006847 Bacteria 2120
282 Ga0075431_100231619 3300006847 Bacteria 1882
283 Ga0075431_100304756 3300006847 Bacteria 1609
284 Ga0075433_10000187 3300006852 Bacteria 34883
285 Ga0075433_10140923 3300006852 Bacteria 2143
286 Ga0075433_10172118 3300006852 Bacteria 1927
287 Ga0075434_100001354 3300006871 Bacteria 20567
288 Ga0075434_100002767 3300006871 Bacteria 15520
289 Ga0075434_100050801 3300006871 Bacteria 4119
290 Ga0075434_100076390 3300006871 Bacteria 3344
291 Ga0075434_100084508 3300006871 Bacteria 3173
292 Ga0075434_100085012 3300006871 Bacteria 3163
293 Ga0075434_100420353 3300006871 Bacteria 1358
294 Ga0075429_100027801 3300006880 Bacteria 4909
295 Ga0075429_100149796 3300006880 Bacteria 2042
296 Ga0075429_100212877 3300006880 Bacteria 1693
297 Ga0068865_100000450 3300006881 Bacteria 22865
298 Ga0068865_100075220 3300006881 Unclassified 2408
299 Ga0075436_100034598 3300006914 Bacteria 3484
300 Ga0075436_100304814 3300006914 Bacteria 1142
301 Ga0097620_100003690 3300006931 Bacteria 15603
302 Ga0097620_100047890 3300006931 Bacteria 4295
303 Ga0097620_100077356 3300006931 Bacteria 3368
304 Ga0097620_100154423 3300006931 Bacteria 2372
305 Ga0097620_100206713 3300006931 Unclassified 2048
306 Ga0075435_100036177 3300007076 Bacteria 3922
307 Ga0075435_100425497 3300007076 Bacteria 1144
308 Ga0099795_10003382 3300007788 Bacteria 3937
309 Ga0099795_10062088 3300007788 Bacteria 1389
310 Ga0105244_10121696 3300009036 Bacteria 1263
311 Ga0105240_10038333 3300009093 Bacteria 6147
312 Ga0111539_10006363 3300009094 Bacteria 15229
313 Ga0111539_10039525 3300009094 Bacteria 5684
314 Ga0111539_10048283 3300009094 Bacteria 5083
315 Ga0111539_10201534 3300009094 Bacteria 2320
316 Ga0111539_10363797 3300009094 Bacteria 1684
317 Ga0111539_10886496 3300009094 Bacteria 1038
318 Ga0105245_10000898 3300009098 Bacteria 27086
319 Ga0105245_10019401 3300009098 Bacteria 5956
320 Ga0105245_10058770 3300009098 Bacteria 3461
321 Ga0105245_10142916 3300009098 Bacteria 2255
322 Ga0105247_10003526 3300009101 Bacteria 10172
323 Ga0105247_10052803 3300009101 Bacteria 2507
324 Ga0114129_10000995 3300009147 Bacteria 37077
325 Ga0114129_10043385 3300009147 Bacteria 6327
326 Ga0114129_10066405 3300009147 Bacteria 5032
327 Ga0114129_10068674 3300009147 Bacteria 4941
328 Ga0114129_10266962 3300009147 Bacteria 2291
329 Ga0114129_10353298 3300009147 Bacteria 1946
330 Ga0105243_10002051 3300009148 Bacteria 17085
331 Ga0105243_10089977 3300009148 Bacteria 2525
332 Ga0105243_10203901 3300009148 Bacteria 1736
333 Ga0105243_10708890 3300009148 Bacteria 982
334 Ga0105241_10001526 3300009174 Bacteria 17741
335 Ga0105241_10152988 3300009174 Bacteria 1889
336 Ga0105242_10000399 3300009176 Bacteria 34466
337 Ga0105242_10247102 3300009176 Bacteria 1606
338 Ga0105248_10004145 3300009177 Bacteria 16029
339 Ga0105248_10026703 3300009177 Bacteria 6420
340 Ga0105248_10031820 3300009177 Bacteria 5895
341 Ga0105248_10078259 3300009177 Bacteria 3717
342 Ga0105248_10081870 3300009177 Bacteria 3629
343 Ga0105248_10095812 3300009177 Bacteria 3341
344 Ga0105248_10571375 3300009177 Bacteria 1276
345 Ga0105237_10006666 3300009545 Bacteria 12762
346 Ga0105237_10075814 3300009545 Bacteria 3354
347 Ga0105238_10017057 3300009551 Bacteria 7372
348 Ga0105238_10059456 3300009551 Bacteria 3829
349 Ga0105238_10100771 3300009551 Bacteria 2871
350 Ga0105238_10171795 3300009551 Bacteria 2144
351 Ga0105238_10183822 3300009551 Bacteria 2067
352 Ga0105249_10002756 3300009553 Bacteria 15191
353 Ga0099796_10023205 3300010159 Bacteria 1934
354 Ga0105239_10009796 3300010375 Bacteria 10767
355 Ga0105239_10184640 3300010375 Bacteria 2334
356 Ga0105239_10432739 3300010375 Bacteria 1491
357 Ga0105246_10000033 3300011119 Bacteria 50575
358 Ga0105246_10188930 3300011119 Bacteria 1593
359 Ga0105246_10223477 3300011119 Bacteria 1477
360 Ga0157373_10006645 3300013100 Bacteria 8615
361 Ga0157371_10033300 3300013102 Bacteria 3703
362 Ga0157371_10068893 3300013102 Bacteria 2505
363 Ga0157370_10198539 3300013104 Bacteria 1861
364 Ga0157374_10002423 3300013296 Bacteria 15718
365 Ga0157374_10054544 3300013296 Bacteria 3729
366 Ga0157374_10444840 3300013296 Bacteria 1297
367 Ga0157378_10011328 3300013297 Bacteria 7804
368 Ga0163162_10001526 3300013306 Bacteria 21576
369 Ga0163162_10068838 3300013306 Bacteria 3591
370 Ga0163162_10642162 3300013306 Bacteria 1185
371 Ga0163162_10795344 3300013306 Bacteria 1063
372 Ga0157372_10001162 3300013307 Bacteria 28497
373 Ga0157375_10000124 3300013308 Bacteria 76003
374 Ga0157375_10017274 3300013308 Bacteria 6507
375 Ga0157375_10217286 3300013308 Bacteria 2070
376 Ga0157375_10614352 3300013308 Bacteria 1245
377 Ga0163163_10000745 3300014325 Bacteria 27709
378 Ga0163163_10019246 3300014325 Bacteria 6408
379 Ga0157380_10000140 3300014326 Bacteria 40628
380 Ga0157380_10064645 3300014326 Bacteria 2938
381 Ga0157377_10000117 3300014745 Bacteria 53219
382 Ga0157379_10000785 3300014968 Bacteria 25777
383 Ga0157379_10317925 3300014968 Bacteria 1421
384 Ga0157379_10393996 3300014968 Bacteria 1272
385 Ga0157376_10000034 3300014969 Bacteria 161526
386 Ga0157376_10023138 3300014969 Bacteria 4858
387 Ga0163161_10000448 3300017792 Bacteria 34334
388 Ga0163161_10250117 3300017792 Bacteria 1381
389 Ga0206352_10618637 3300020078 Bacteria 849
390 Ga0206350_10087095 3300020080 Bacteria 847
391 Ga0213873_10076792 3300021358 Bacteria 929
392 Ga0213872_10018295 3300021361 Bacteria 3232
393 Ga0213875_10000025 3300021388 Bacteria 197787
394 Ga0224572_1005633 3300024225 Bacteria 2241
395 Ga0228598_1003747 3300024227 Bacteria 3248
396 Ga0228598_1019940 3300024227 Bacteria 1321
397 Ga0207666_1000017 3300025271 Bacteria 40049
398 Ga0207666_1000125 3300025271 Bacteria 11954
399 Ga0207673_1000060 3300025290 Bacteria 9200
400 Ga0207697_10000009 3300025315 Bacteria 67526
401 Ga0207697_10001569 3300025315 Bacteria 12343
402 Ga0207713_1032298 3300025735 Bacteria 2301
403 Ga0207653_10001876 3300025885 Bacteria 6729
404 Ga0207653_10015121 3300025885 Unclassified 2422
405 Ga0207682_10000301 3300025893 Bacteria 22279
406 Ga0207682_10010412 3300025893 Bacteria 3645
407 Ga0207692_10005014 3300025898 Bacteria 5272
408 Ga0207692_10019482 3300025898 Bacteria 3067
409 Ga0207692_10083224 3300025898 Bacteria 1716
410 Ga0207642_10002547 3300025899 Bacteria 5673
411 Ga0207642_10317890 3300025899 Bacteria 908
412 Ga0207710_10011377 3300025900 Bacteria 3747
413 Ga0207710_10013038 3300025900 Bacteria 3503
414 Ga0207710_10036104 3300025900 Bacteria 2178
415 Ga0207688_10000012 3300025901 Bacteria 60353
416 Ga0207688_10005642 3300025901 Bacteria 6806
417 Ga0207688_10133339 3300025901 Bacteria 1457
418 Ga0207680_10004369 3300025903 Bacteria 6700
419 Ga0207680_10027612 3300025903 Bacteria 3163
420 Ga0207680_10335967 3300025903 Bacteria 1059
421 Ga0207647_10005111 3300025904 Bacteria 9660
422 Ga0207647_10005834 3300025904 Bacteria 8979
423 Ga0207685_10013690 3300025905 Bacteria 2517
424 Ga0207685_10044633 3300025905 Bacteria 1677
425 Ga0207699_10005829 3300025906 Bacteria 5928
426 Ga0207699_10100296 3300025906 Bacteria 1836
427 Ga0207699_10125698 3300025906 Bacteria 1665
428 Ga0207645_10000124 3300025907 Bacteria 58746
429 Ga0207645_10032352 3300025907 Bacteria 3362
430 Ga0207645_10036464 3300025907 Bacteria 3157
431 Ga0207645_10054407 3300025907 Bacteria 2556
432 Ga0207643_10000046 3300025908 Bacteria 80736
433 Ga0207643_10080377 3300025908 Bacteria 1888
434 Ga0207705_10108072 3300025909 Bacteria 2053
435 Ga0207654_10003867 3300025911 Bacteria 7546
436 Ga0207654_10062488 3300025911 Bacteria 2182
437 Ga0207707_10036253 3300025912 Bacteria 4313
438 Ga0207707_10190039 3300025912 Bacteria 1792
439 Ga0207707_10214100 3300025912 Bacteria 1678
440 Ga0207707_10350297 3300025912 Bacteria 1272
441 Ga0207695_10065683 3300025913 Bacteria 3729
442 Ga0207695_10184013 3300025913 Bacteria 2009
443 Ga0207671_10127298 3300025914 Bacteria 1952
444 Ga0207671_10228930 3300025914 Bacteria 1458
445 Ga0207693_10004620 3300025915 Bacteria 11619
446 Ga0207693_10005130 3300025915 Bacteria 10967
447 Ga0207693_10013189 3300025915 Bacteria 6667
448 Ga0207693_10046296 3300025915 Bacteria 3417
449 Ga0207693_10172981 3300025915 Bacteria 1700
450 Ga0207663_10011495 3300025916 Bacteria 4753
451 Ga0207663_10163433 3300025916 Bacteria 1574
452 Ga0207663_10214114 3300025916 Bacteria 1398
453 Ga0207660_10000489 3300025917 Bacteria 26431
454 Ga0207660_10020291 3300025917 Bacteria 4456
455 Ga0207660_10049252 3300025917 Bacteria 2985
456 Ga0207660_10202880 3300025917 Bacteria 1549
457 Ga0207660_10277299 3300025917 Bacteria 1329
458 Ga0207662_10008508 3300025918 Bacteria 5620
459 Ga0207662_10025829 3300025918 Bacteria 3384
460 Ga0207662_10034499 3300025918 Bacteria 2953
461 Ga0207662_10076811 3300025918 Bacteria 2030
462 Ga0207662_10115546 3300025918 Bacteria 1677
463 Ga0207657_10000162 3300025919 Bacteria 68121
464 Ga0207657_10008982 3300025919 Bacteria 10097
465 Ga0207657_10039314 3300025919 Bacteria 4206
466 Ga0207657_10085018 3300025919 Bacteria 2651
467 Ga0207657_10223662 3300025919 Bacteria 1507
468 Ga0207649_10000798 3300025920 Bacteria 20284
469 Ga0207649_10412506 3300025920 Bacteria 1013
470 Ga0207652_10028398 3300025921 Bacteria 4668
471 Ga0207652_10092934 3300025921 Bacteria 2654
472 Ga0207652_10137907 3300025921 Bacteria 2179
473 Ga0207652_10534187 3300025921 Bacteria 1055
474 Ga0207646_10059826 3300025922 Bacteria 3402
475 Ga0207646_10673409 3300025922 Bacteria 926
476 Ga0207681_10011712 3300025923 Bacteria 5391
477 Ga0207681_10203594 3300025923 Bacteria 1521
478 Ga0207694_10043046 3300025924 Bacteria 3485
479 Ga0207694_10065822 3300025924 Bacteria 2826
480 Ga0207694_10102049 3300025924 Bacteria 2274
481 Ga0207694_10218328 3300025924 Bacteria 1554
482 Ga0207650_10087109 3300025925 Bacteria 2379
483 Ga0207659_10000017 3300025926 Bacteria 159908
484 Ga0207687_10006873 3300025927 Bacteria 7495
485 Ga0207687_10024743 3300025927 Bacteria 4013
486 Ga0207687_10188644 3300025927 Bacteria 1603
487 Ga0207687_10406477 3300025927 Bacteria 1121
488 Ga0207700_10001122 3300025928 Bacteria 15358
489 Ga0207700_10178476 3300025928 Bacteria 1776
490 Ga0207664_10044126 3300025929 Bacteria 3490
491 Ga0207664_10082606 3300025929 Bacteria 2617
492 Ga0207664_10086393 3300025929 Bacteria 2562
493 Ga0207664_10103171 3300025929 Bacteria 2359
494 Ga0207644_10012971 3300025931 Bacteria 5544
495 Ga0207644_10013070 3300025931 Bacteria 5526
496 Ga0207644_10036024 3300025931 Bacteria 3471
497 Ga0207644_10043725 3300025931 Bacteria 3180
498 Ga0207644_10510269 3300025931 Bacteria 992
499 Ga0207690_10000151 3300025932 Bacteria 54897
500 Ga0207706_10000368 3300025933 Bacteria 48834
501 Ga0207706_10007484 3300025933 Bacteria 10098
502 Ga0207706_10008477 3300025933 Bacteria 9481
503 Ga0207706_10017363 3300025933 Bacteria 6483
504 Ga0207706_10018620 3300025933 Bacteria 6247
505 Ga0207686_10003886 3300025934 Bacteria 8011
506 Ga0207686_10016902 3300025934 Bacteria 4100
507 Ga0207686_10023460 3300025934 Bacteria 3564
508 Ga0207709_10000256 3300025935 Bacteria 63853
509 Ga0207709_10022765 3300025935 Bacteria 3557
510 Ga0207709_10139977 3300025935 Unclassified 1662
511 Ga0207709_10616639 3300025935 Bacteria 860
512 Ga0207670_10000086 3300025936 Bacteria 63570
513 Ga0207670_10027694 3300025936 Bacteria 3587
514 Ga0207670_10068924 3300025936 Bacteria 2438
515 Ga0207670_10085467 3300025936 Bacteria 2217
516 Ga0207670_10098770 3300025936 Bacteria 2081
517 Ga0207670_10170788 3300025936 Bacteria 1630
518 Ga0207669_10001765 3300025937 Bacteria 9180
519 Ga0207669_10014117 3300025937 Bacteria 3995
520 Ga0207669_10021878 3300025937 Bacteria 3386
521 Ga0207669_10069684 3300025937 Bacteria 2201
522 Ga0207669_10196812 3300025937 Bacteria 1459
523 Ga0207669_10312254 3300025937 Bacteria 1199
524 Ga0207704_10002423 3300025938 Bacteria 8389
525 Ga0207704_10052873 3300025938 Unclassified 2465
526 Ga0207704_10160794 3300025938 Bacteria 1598
527 Ga0207665_10010248 3300025939 Bacteria 6157
528 Ga0207665_10042186 3300025939 Bacteria 3049
529 Ga0207665_10210897 3300025939 Bacteria 1419
530 Ga0207691_10000303 3300025940 Bacteria 48873
531 Ga0207691_10004340 3300025940 Bacteria 13762
532 Ga0207691_10203100 3300025940 Bacteria 1724
533 Ga0207691_10397324 3300025940 Bacteria 1176
534 Ga0207711_10013210 3300025941 Bacteria 6859
535 Ga0207711_10057541 3300025941 Bacteria 3342
536 Ga0207711_10121154 3300025941 Bacteria 2335
537 Ga0207711_10348899 3300025941 Bacteria 1370
538 Ga0207711_10375601 3300025941 Bacteria 1319
539 Ga0207689_10000109 3300025942 Bacteria 67941
540 Ga0207689_10037728 3300025942 Bacteria 4005
541 Ga0207661_10010457 3300025944 Bacteria 6680
542 Ga0207661_10218844 3300025944 Bacteria 1682
543 Ga0207661_10333953 3300025944 Bacteria 1365
544 Ga0207679_10000031 3300025945 Bacteria 165962
545 Ga0207679_10133638 3300025945 Bacteria 1994
546 Ga0207679_10640370 3300025945 Bacteria 961
547 Ga0207667_10002481 3300025949 Bacteria 22990
548 Ga0207667_10044884 3300025949 Bacteria 4682
549 Ga0207651_10000044 3300025960 Bacteria 58072
550 Ga0207651_10049035 3300025960 Bacteria 2858
551 Ga0207651_10061834 3300025960 Unclassified 2607
552 Ga0207712_10001848 3300025961 Bacteria 13972
553 Ga0207712_10057628 3300025961 Bacteria 2742
554 Ga0207668_10001339 3300025972 Bacteria 14601
555 Ga0207668_10233163 3300025972 Unclassified 1485
556 Ga0207640_10210056 3300025981 Bacteria 1482
557 Ga0207658_10025019 3300025986 Bacteria 4179
558 Ga0207658_10032961 3300025986 Bacteria 3692
559 Ga0207658_10034292 3300025986 Bacteria 3627
560 Ga0207658_10103050 3300025986 Bacteria 2239
561 Ga0207658_10316734 3300025986 Bacteria 1349
562 Ga0207658_10438273 3300025986 Bacteria 1155
563 Ga0207677_10006203 3300026023 Bacteria 6535
564 Ga0207677_10056419 3300026023 Bacteria 2691
565 Ga0207703_10018118 3300026035 Bacteria 5500
566 Ga0207703_10031219 3300026035 Bacteria 4211
567 Ga0207703_10170841 3300026035 Bacteria 1912
568 Ga0207703_10202260 3300026035 Bacteria 1765
569 Ga0207703_10459859 3300026035 Unclassified 1190
570 Ga0207639_10053044 3300026041 Bacteria 3092
571 Ga0207639_10374939 3300026041 Unclassified 1276
572 Ga0207678_10000158 3300026067 Bacteria 56255
573 Ga0207678_10031192 3300026067 Bacteria 4650
574 Ga0207678_10047158 3300026067 Bacteria 3727
575 Ga0207708_10000098 3300026075 Bacteria 67005
576 Ga0207708_10005985 3300026075 Bacteria 9009
577 Ga0207702_10008602 3300026078 Bacteria 8606
578 Ga0207702_10425025 3300026078 Bacteria 1285
579 Ga0207641_10000408 3300026088 Bacteria 50477
580 Ga0207648_10000696 3300026089 Bacteria 37592
581 Ga0207648_10014142 3300026089 Bacteria 7382
582 Ga0207648_10055376 3300026089 Bacteria 3462
583 Ga0207676_10037167 3300026095 Bacteria 3709
584 Ga0207676_10117072 3300026095 Bacteria 2240
585 Ga0207676_10190212 3300026095 Bacteria 1805
586 Ga0207674_10000420 3300026116 Bacteria 55287
587 Ga0207674_10010481 3300026116 Bacteria 10494
588 Ga0207675_100001146 3300026118 Bacteria 26264
589 Ga0207675_100024805 3300026118 Bacteria 5579
590 Ga0207675_100085001 3300026118 Bacteria 2969
591 Ga0207675_100470399 3300026118 Bacteria 1248
592 Ga0207683_10000004 3300026121 Bacteria 188086
593 Ga0207683_10001766 3300026121 Bacteria 19131
594 Ga0207683_10017083 3300026121 Bacteria 6176
595 Ga0207683_10065450 3300026121 Bacteria 3205
596 Ga0207683_10078238 3300026121 Bacteria 2930
597 Ga0207698_10005316 3300026142 Bacteria 7936
598 Ga0207698_10615545 3300026142 Bacteria 1072
599 Ga0209179_1008391 3300027512 Unclassified 1740
600 Ga0209179_1016983 3300027512 Bacteria 1372
601 Ga0209983_1012408 3300027665 Bacteria 1749
602 Ga0209971_1021584 3300027682 Bacteria 1532
603 Ga0209966_1001342 3300027695 Bacteria 4312
604 Ga0209966_1034142 3300027695 Bacteria 1040
605 Ga0209998_10001259 3300027717 Bacteria 6207
606 Ga0209998_10003935 3300027717 Bacteria 3199
607 Ga0209813_10016575 3300027866 Bacteria 2013
608 Ga0209813_10035088 3300027866 Bacteria 1500
609 Ga0209974_10000117 3300027876 Bacteria 23200
610 Ga0209974_10006843 3300027876 Bacteria 3956
611 Ga0209974_10028923 3300027876 Unclassified 1836
612 Ga0209974_10029881 3300027876 Bacteria 1806
613 Ga0207428_10000250 3300027907 Bacteria 73217
614 Ga0207428_10001707 3300027907 Bacteria 22539
615 Ga0207428_10006503 3300027907 Bacteria 10786
616 Ga0207428_10007251 3300027907 Bacteria 10137
617 Ga0207428_10023620 3300027907 Bacteria 5167
618 Ga0268266_10019723 3300028379 Bacteria 5745
619 Ga0268266_10064479 3300028379 Bacteria 3165
620 Ga0268266_10070409 3300028379 Bacteria 3031
621 Ga0268265_10005880 3300028380 Bacteria 8360
622 Ga0268264_10018374 3300028381 Bacteria 5717
623 Ga0268264_10074225 3300028381 Bacteria 2888
624 Ga0268264_10365487 3300028381 Bacteria 1378
625 Ga0268264_10415273 3300028381 Bacteria 1296
626 Ga0265762_1005243 3300030760 Bacteria 2323
627 Ga0265760_10031613 3300031090 Bacteria 1561
628 Ga0265330_10156849 3300031235 Bacteria 967
629 Ga0265325_10064261 3300031241 Bacteria 1855
630 Ga0265325_10200729 3300031241 Bacteria 920
631 Ga0265340_10007163 3300031247 Bacteria 6075
632 Ga0265340_10012516 3300031247 Bacteria 4478
633 Ga0265340_10017482 3300031247 Bacteria 3710
634 Ga0265340_10075396 3300031247 Bacteria 1594
635 Ga0265339_10001522 3300031249 Bacteria 17112
636 Ga0265339_10106548 3300031249 Bacteria 1454
637 Ga0265316_10006562 3300031344 Bacteria 11097
638 Ga0265316_10289717 3300031344 Bacteria 1195
639 Ga0307509_10001384 3300031507 Bacteria 41108
640 Ga0265313_10000181 3300031595 Bacteria 67263
641 Ga0265313_10007831 3300031595 Bacteria 7212
642 Ga0265313_10008019 3300031595 Bacteria 7088
643 Ga0265313_10011961 3300031595 Bacteria 5350
644 Ga0265313_10073281 3300031595 Bacteria 1572
645 Ga0265342_10005915 3300031712 Bacteria 9216
646 Ga0265342_10008745 3300031712 Bacteria 7222
647 Ga0265342_10067079 3300031712 Bacteria 2101
648 Ga0307409_100285899 3300031995 Bacteria 1527
649 Ga0316583_10032105 3300032133 Bacteria 1867
650 Ga0373958_0021183 3300034819 Bacteria 1204
651 Ga0373959_0033533 3300034820 Bacteria 1048
652 Ga0373938_0000421 3300034957 Bacteria 6838
653 Ga0373926_0007240 3300035083 Bacteria 3698
654 Ga0373928_0034835 3300035084 Bacteria 1132
655 Ga0373934_0033278 3300035086 Bacteria 2023
656 Ga0373940_0031602 3300035088 Bacteria 1414
657 Ga0373949_0001809 3300035090 Bacteria 5846
658 Ga0373951_0009831 3300035091 Bacteria 2150
659 Ga0373952_0002647 3300035092 Bacteria 3231
660 Ga0373923_0158125 3300035111 Bacteria 1033
661 Ga0373932_0001391 3300035112 Bacteria 6783
662 Ga0373939_0010614 3300035114 Bacteria 2308
663 Ga0373941_0009316 3300035115 Bacteria 2469
664 Ga0373954_0143184 3300035118 Bacteria 1167
665 Ga0373956_0100444 3300035119 Bacteria 1342
666 Ga0373957_0000917 3300035120 Bacteria 7716
667 Ga0373960_0003777 3300035121 Bacteria 3443
668 Ga0373943_0037316 3300035170 Bacteria 2332
669 Ga0373946_0002428 3300035171 Bacteria 6588
670 Ga0373946_0019518 3300035171 Bacteria 2612
671 Ga0373955_0023921 3300035172 Bacteria 3117
672 Ga0373961_0046212 3300035241 Bacteria 1275
673 Ga0373962_0003202 3300035242 Bacteria 3926
674 Ga0373924_0002733 3300035410 Bacteria 5961
675 Ga0373924_0028043 3300035410 Bacteria 2242
676 Ga0373931_0000034 3300035691 Bacteria 86665
677 Ga0373931_0001311 3300035691 Bacteria 10650
678 Ga0373931_0022363 3300035691 Bacteria 3182
679 Ga0373931_0051906 3300035691 Bacteria 2185
680 Ga0373935_0008152 3300035692 Bacteria 6280
681 Ga0373935_0147022 3300035692 Bacteria 1596
682 Ga0373935_0325535 3300035692 Bacteria 1091
683 Ga0373935_0377021 3300035692 Bacteria 1015
684 Ga0373927_0000839 3300035695 Bacteria 23542
685 Ga0373927_0099229 3300035695 Bacteria 1894
686 Ga0373927_0148020 3300035695 Bacteria 1537
687 Ga0373933_0012620 3300035724 Bacteria 4668
688 Ga0373933_0272572 3300035724 Bacteria 1092
689 Ga0373947_0000796 3300035725 Bacteria 18989
690 Ga0373947_0276004 3300035725 Bacteria 1116
691 Ga0373937_0019531 3300036401 Bacteria 6063
692 Ga0373937_0323068 3300036401 Bacteria 1460
693 Ga0316582_0001394 3300036647 Bacteria 10541
694 Ga0316582_0192382 3300036647 Bacteria 1390
695 Ga0316584_0166581 3300036712 Bacteria 1636
696 Ga0373925_0002955 3300037068 Bacteria 13418
697 Ga0373925_0021172 3300037068 Bacteria 4738
698 Ga0373925_0217275 3300037068 Bacteria 1525
699 Ga0395898_0027542 3300037466 Bacteria 5702
700 Ga0436364_0273714 3300037853 Bacteria 1285
701 Ga0436364_1209910 3300037853 Bacteria 45322
702 Ga0436364_1454759 3300037853 Bacteria 1725
703 Ga0395901_0014197 3300038443 Bacteria 8109
704 Ga0436365_1309021 3300039437 Bacteria 2428
705 Ga0436365_1311189 3300039437 Bacteria 2624
706 Ga0436365_1565429 3300039437 Bacteria 1603
707 Ga0436361_0379330 3300039447 Bacteria 1943
708 Ga0436361_0743304 3300039447 Bacteria 4652
709 Ga0439450_002141 3300042008 Bacteria 3047
710 Ga0466963_0052011 3300044694 Bacteria 2717
711 Ga0466963_0110995 3300044694 Bacteria 1883
712 Ga0466957_0028996 3300044842 Bacteria 3297
713 Ga0466957_0065742 3300044842 Bacteria 2234
714 Ga0466958_0040840 3300045836 Bacteria 2788
715 Ga0466958_0097744 3300045836 Bacteria 1822
716 Ga0466967_0151147 3300045976 Bacteria 2170
717 Ga0495592_0020986 3300046454 Bacteria 4967
718 Ga0495603_0020845 3300046455 Bacteria 3968
719 Ga0495651_0004824 3300046462 Bacteria 10317
720 Ga0495651_0017751 3300046462 Bacteria 5509
721 Ga0495580_0042600 3300046472 Bacteria 3233
722 Ga0495582_0029880 3300046473 Bacteria 2991
723 Ga0495605_0038453 3300046474 Bacteria 2400
724 Ga0495639_0038306 3300046475 Bacteria 2153
725 Ga0495662_0004502 3300046476 Bacteria 6992
726 Ga0495664_0004807 3300046477 Bacteria 7389
727 Ga0495664_0006400 3300046477 Bacteria 6504
728 Ga0495584_0094389 3300046491 Bacteria 1510
729 Ga0495594_0024062 3300046499 Bacteria 3268
730 Ga0495608_0010475 3300046511 Bacteria 6470
731 Ga0495608_0135213 3300046511 Bacteria 1576
732 Ga0495618_0000917 3300046514 Bacteria 20251
733 Ga0495618_0108433 3300046514 Bacteria 1778
734 Ga0495618_0183340 3300046514 Bacteria 1329
735 Ga0495628_0007281 3300046516 Bacteria 9588
736 Ga0495630_0011479 3300046517 Bacteria 6415
737 Ga0495630_0061315 3300046517 Bacteria 2824
738 Ga0495666_0012399 3300046526 Bacteria 4249
739 Ga0495652_0010662 3300046529 Bacteria 8324
740 Ga0495652_0021608 3300046529 Bacteria 5719
741 Ga0495652_0177800 3300046529 Bacteria 1636
742 Ga0495665_0012185 3300046531 Bacteria 4652
743 Ga0495665_0092134 3300046531 Bacteria 1593
744 Ga0495640_0003215 3300046533 Bacteria 13152
745 Ga0495640_0005374 3300046533 Bacteria 10189
746 Ga0495640_0093106 3300046533 Bacteria 1986
747 Ga0495587_0026356 3300046536 Bacteria 3545
748 Ga0495598_0014273 3300046537 Bacteria 1984
749 Ga0495645_0001763 3300046543 Bacteria 14717
750 Ga0495645_0004378 3300046543 Bacteria 9645
751 Ga0495667_0000256 3300046559 Bacteria 34418
752 Ga0495667_0092950 3300046559 Bacteria 1953
753 Ga0495634_0003473 3300046642 Bacteria 12621
754 Ga0495634_0044121 3300046642 Bacteria 3019
755 Ga0495634_0098678 3300046642 Bacteria 1889
756 Ga0495635_0001674 3300046663 Bacteria 14916
757 Ga0495635_0003010 3300046663 Bacteria 11578
758 Ga0495635_0019505 3300046663 Bacteria 4726
759 Ga0495635_0389808 3300046663 Bacteria 926
760 Ga0495588_0052958 3300046674 Bacteria 2092
761 Ga0495657_0002838 3300046675 Bacteria 14378
762 Ga0495599_0002175 3300046678 Bacteria 11380
763 Ga0495623_0008613 3300046679 Bacteria 6623
764 Ga0495646_0001535 3300046680 Bacteria 13774
765 Ga0495647_0010400 3300046681 Bacteria 3166
766 Ga0495647_0059631 3300046681 Bacteria 1503
767 Ga0495658_0040583 3300046683 Bacteria 2588
768 Ga0495613_0095948 3300046689 Bacteria 2144
769 Ga0495624_0002424 3300046690 Bacteria 14161
770 Ga0495624_0040939 3300046690 Bacteria 2966
771 Ga0495600_0008376 3300046809 Bacteria 6350
772 Ga0495581_0008086 3300047315 Bacteria 6089
773 Ga0495604_0012925 3300047317 Bacteria 6652
774 Ga0495604_0175636 3300047317 Bacteria 1502
775 Ga0495674_0001984 3300047319 Bacteria 20115
776 Ga0495674_0004803 3300047319 Bacteria 13003
777 Ga0495674_0345711 3300047319 Bacteria 1208
778 Ga0495674_0379723 3300047319 Bacteria 1143
779 Ga0495676_0299706 3300047321 Bacteria 1084
780 Ga0495680_0005564 3300047322 Bacteria 11827
781 Ga0495680_0008253 3300047322 Bacteria 9484
782 Ga0495675_0000532 3300047444 Bacteria 24684
783 Ga0495685_004853 3300047447 Bacteria 4365
784 Ga0495684_0000987 3300047471 Bacteria 23140
785 Ga0495684_0009836 3300047471 Bacteria 7378
786 Ga0495593_0082439 3300047673 Bacteria 1662
787 Ga0495602_0005750 3300048088 Bacteria 13013
788 Ga0495615_0009209 3300048090 Bacteria 1935
789 Ga0495615_0012574 3300048090 Bacteria 1748
790 Ga0496100_0000842 3300048903 Bacteria 14711
791 Ga0496100_0073931 3300048903 Bacteria 2282
792 Ga0496101_0007404 3300048904 Bacteria 7112
793 Ga0496101_0017864 3300048904 Bacteria 4814
794 Ga0496101_0077127 3300048904 Bacteria 2455
795 Ga0496101_0135469 3300048904 Bacteria 1873
796 Ga0496101_0160773 3300048904 Bacteria 1722
797 Ga0496102_0001935 3300048905 Bacteria 17830
798 Ga0496102_0011713 3300048905 Bacteria 7569
799 Ga0496102_0051622 3300048905 Bacteria 3746
800 Ga0496103_0004653 3300048906 Bacteria 8311
801 Ga0496103_0010777 3300048906 Bacteria 5409
802 Ga0496104_0011266 3300048907 Bacteria 8004
803 Ga0496104_0084266 3300048907 Bacteria 3033
804 Ga0496104_0172235 3300048907 Bacteria 2075
805 Ga0496104_0230375 3300048907 Bacteria 1764
806 Ga0496104_0642583 3300048907 Bacteria 970
807 Ga0496105_0041290 3300048908 Bacteria 3802
808 Ga0496105_0186660 3300048908 Bacteria 1696
809 Ga0496106_0000405 3300048909 Bacteria 30644
810 Ga0496106_0055867 3300048909 Bacteria 2984
811 Ga0496107_0004066 3300048910 Bacteria 9849
812 Ga0496107_0005799 3300048910 Bacteria 8453
813 Ga0496107_0034287 3300048910 Bacteria 3635
814 Ga0496107_0050462 3300048910 Bacteria 2999
815 Ga0496108_0001198 3300048911 Bacteria 20317
816 Ga0496108_0025837 3300048911 Bacteria 4842
817 Ga0496108_0032267 3300048911 Bacteria 4350
818 Ga0496108_0034437 3300048911 Bacteria 4208
819 Ga0496108_0049561 3300048911 Bacteria 3512
820 Ga0496108_0141846 3300048911 Bacteria 2070
821 Ga0496109_0151200 3300048912 Bacteria 2173
822 Ga0496110_0010646 3300048913 Bacteria 7486
823 Ga0496110_0041865 3300048913 Bacteria 3999
824 Ga0496110_0070107 3300048913 Bacteria 3105
825 Ga0496110_0494729 3300048913 Bacteria 1113
826 Ga0496111_0004338 3300048914 Bacteria 8949
827 Ga0496111_0009762 3300048914 Bacteria 6415
828 Ga0496111_0069131 3300048914 Bacteria 2568
829 Ga0496111_0194583 3300048914 Bacteria 1507
830 Ga0496112_0047842 3300048915 Bacteria 4195
831 Ga0496112_0143557 3300048915 Bacteria 2356
832 Ga0496113_0002604 3300048916 Bacteria 10547
833 Ga0496113_0079720 3300048916 Bacteria 2507
834 Ga0496113_0150213 3300048916 Bacteria 1837
835 Ga0496113_0170106 3300048916 Bacteria 1725
836 Ga0496114_0005575 3300048917 Bacteria 9865
837 Ga0496114_0016691 3300048917 Bacteria 5920
838 Ga0496114_0018204 3300048917 Bacteria 5676
839 Ga0496114_0071524 3300048917 Bacteria 2915
840 Ga0496114_0147538 3300048917 Bacteria 2040
841 Ga0496115_0053006 3300048918 Bacteria 3255
842 Ga0496115_0067368 3300048918 Bacteria 2895
843 Ga0496115_0191993 3300048918 Bacteria 1687
844 Ga0496115_0211939 3300048918 Bacteria 1600
845 Ga0496115_0478452 3300048918 Bacteria 1003
846 Ga0496119_0000893 3300048922 Bacteria 39064
847 Ga0496122_0002944 3300048925 Bacteria 23216
848 Ga0496123_0001139 3300048926 Bacteria 39727
849 Ga0501031_0228033 3300049568 Bacteria 1212
850 Ga0501032_0005175 3300049569 Bacteria 9721
851 Ga0501033_0029607 3300049570 Bacteria 4115
852 Ga0501033_0083303 3300049570 Bacteria 2344
853 Ga0501033_0129315 3300049570 Bacteria 1830
854 Ga0501034_0164419 3300049571 Bacteria 2188
855 Ga0501034_0184946 3300049571 Bacteria 2047
856 Ga0501034_0257328 3300049571 Bacteria 1689
857 Ga0501036_0009276 3300049572 Bacteria 8086
858 Ga0501036_0327333 3300049572 Bacteria 1280
859 Ga0501037_0001340 3300049573 Bacteria 18079
860 Ga0501038_0001023 3300049574 Bacteria 25193
861 Ga0501039_0015388 3300049575 Bacteria 5856
862 Ga0501039_0529808 3300049575 Bacteria 925
863 Ga0501042_0299785 3300049578 Bacteria 1161
864 Ga0501043_0025349 3300049579 Bacteria 4652
865 Ga0501043_0192196 3300049579 Bacteria 1587
866 Ga0501046_0000060 3300049580 Bacteria 125548
867 Ga0501046_0008699 3300049580 Bacteria 8822
868 Ga0501046_0038257 3300049580 Bacteria 3852
869 Ga0501047_0055872 3300049581 Bacteria 3817
870 Ga0501047_0061462 3300049581 Bacteria 3624
871 Ga0501047_0195600 3300049581 Bacteria 1884
872 Ga0501047_0419955 3300049581 Bacteria 1169
873 Ga0501048_0002666 3300049582 Bacteria 13620
874 Ga0501048_0087158 3300049582 Bacteria 2203
875 Ga0501048_0335918 3300049582 Bacteria 1077
876 Ga0501067_0005961 3300049583 Bacteria 6758
877 Ga0501067_0083621 3300049583 Bacteria 1771
878 Ga0501069_0005453 3300049585 Bacteria 6615
879 Ga0501070_0025730 3300049586 Bacteria 4936
880 Ga0501070_0043988 3300049586 Bacteria 3716
881 Ga0501070_0063526 3300049586 Bacteria 3058
882 Ga0501071_0021832 3300049587 Bacteria 4461
883 Ga0501072_0313549 3300049588 Bacteria 1247
884 Ga0501072_0374429 3300049588 Bacteria 1130
885 Ga0501072_0396274 3300049588 Bacteria 1095
886 Ga0501073_0017253 3300049589 Bacteria 5229
887 Ga0501073_0142636 3300049589 Bacteria 1660
888 Ga0501074_0008132 3300049590 Bacteria 7601
889 Ga0501074_0060646 3300049590 Bacteria 2725
890 Ga0501074_0212813 3300049590 Bacteria 1377
891 Ga0501075_0274824 3300049591 Bacteria 1284
892 Ga0501076_0106477 3300049592 Bacteria 2264
893 Ga0501077_0046198 3300049593 Bacteria 2767
894 Ga0501079_0006545 3300049741 Bacteria 8757
895 Ga0501079_0086067 3300049741 Bacteria 2433
896 Ga0501079_0426513 3300049741 Bacteria 1041
897 Ga0501080_0099237 3300049742 Bacteria 2702
898 Ga0501080_0254987 3300049742 Bacteria 1599
899 Ga0501083_0007790 3300049744 Bacteria 7588
900 Ga0501083_0012367 3300049744 Bacteria 5972
901 Ga0501083_0089078 3300049744 Bacteria 2039
902 Ga0501083_0149372 3300049744 Bacteria 1530
903 Ga0501035_0206329 3300049822 Bacteria 1683
904 Ga0501035_0294822 3300049822 Bacteria 1368
905 Ga0501035_0352720 3300049822 Bacteria 1231
906 Ga0501044_0000260 3300049823 Bacteria 67087
907 Ga0501044_0008573 3300049823 Bacteria 11199
908 Ga0501044_0010896 3300049823 Bacteria 9868
909 Ga0501044_0322843 3300049823 Bacteria 1468
910 Ga0501044_0487609 3300049823 Bacteria 1135
911 Ga0501045_0490490 3300049824 Bacteria 912
912 nmdc:mga03683_41279_c1 3300050489 Bacteria 1895
913 nmdc:mga03n38_79548_c1 3300050490 Bacteria 1537
914 nmdc:mga00v17_19362_c1 3300050491 Bacteria 3885
915 nmdc:mga0yw44_383517_c1 3300050492 Bacteria 949
916 nmdc:mga0yw44_63367_c1 3300050492 Bacteria 2273
917 nmdc:mga0yw44_75835_c1 3300050492 Bacteria 2098
918 nmdc:mga0k408_55917_c1 3300050493 Bacteria 2289
919 nmdc:mga06z11_113993_c1 3300050494 Bacteria 1500
920 nmdc:mga06z11_53313_c1 3300050494 Bacteria 2080
921 nmdc:mga04h51_29994_c1 3300050495 Bacteria 1708
922 nmdc:mga07m45_147397_c1 3300050496 Bacteria 1364
923 nmdc:mga07m45_15773_c1 3300050496 Bacteria 4037
924 nmdc:mga07m45_26560_c1 3300050496 Bacteria 3184
925 nmdc:mga07m45_27289_c1 3300050496 Bacteria 3144
926 nmdc:mga05p37_153275_c1 3300050507 Bacteria 2817
927 nmdc:mga05p37_163552_c1 3300050507 Bacteria 2717
928 nmdc:mga05p37_290189_c1 3300050507 Bacteria 1947
929 nmdc:mga05p37_354142_c1 3300050507 Bacteria 1728
930 nmdc:mga05p37_5377_c1 3300050507 Bacteria 15055
931 nmdc:mga09592_170167_c1 3300050508 Bacteria 1884
932 nmdc:mga09592_21364_c1 3300050508 Bacteria 5335
933 nmdc:mga09592_29378_c1 3300050508 Bacteria 4573
934 nmdc:mga0qj67_151963_c1 3300050509 Bacteria 1878
935 nmdc:mga0qj67_28_c1 3300050509 Bacteria 102760
936 nmdc:mga0qj67_341240_c1 3300050509 Bacteria 1212
937 nmdc:mga0qj67_82924_c1 3300050509 Bacteria 2570
938 nmdc:mga0qj67_97253_c1 3300050509 Bacteria 2370
939 nmdc:mga06r32_270079_c1 3300050510 Bacteria 1688
940 nmdc:mga06r32_322976_c1 3300050510 Bacteria 1529
941 nmdc:mga06r32_383161_c1 3300050510 Bacteria 1389
942 nmdc:mga06r32_507731_c1 3300050510 Bacteria 1182
943 nmdc:mga06r32_752703_c1 3300050510 Bacteria 937
944 nmdc:mga08y16_22572_c1 3300050511 Bacteria 6645
945 nmdc:mga08y16_409669_c1 3300050511 Bacteria 1387
946 nmdc:mga08y16_590_c1 3300050511 Bacteria 33818
947 nmdc:mga0n895_33397_c1 3300050512 Bacteria 4945
948 nmdc:mga0n895_425283_c1 3300050512 Bacteria 1342
949 nmdc:mga0n895_4459_c1 3300050512 Bacteria 11502
950 nmdc:mga0n895_947751_c1 3300050512 Bacteria 844
951 nmdc:mga0rr50_39320_c1 3300050513 Bacteria 3430
952 nmdc:mga0rr50_8026_c1 3300050513 Bacteria 6547
953 nmdc:mga0rr50_85462_c1 3300050513 Bacteria 2445
954 nmdc:mga0a205_3619_c1 3300050515 Bacteria 13829
955 nmdc:mga0a205_733_c2 3300050515 Bacteria 10917
956 nmdc:mga0sz30_4070_c1 3300050516 Bacteria 5264
957 Ga0495601_0000418 3300053077 Bacteria 22241
958 Ga0495601_0010781 3300053077 Bacteria 5453
959 Ga0495601_0012231 3300053077 Bacteria 5146
960 Ga0495601_0039644 3300053077 Bacteria 2950
961 Ga0495612_0000251 3300053078 Bacteria 22251
962 Ga0495612_0003654 3300053078 Bacteria 6376
963 Ga0495612_0138888 3300053078 Bacteria 1053
964 Ga0495595_0002778 3300053084 Bacteria 6878
965 Ga0495619_0002566 3300053085 Bacteria 11887
966 Ga0495619_0037784 3300053085 Bacteria 3149
967 Ga0495619_0090917 3300053085 Bacteria 2066
968 Ga0495619_0165320 3300053085 Bacteria 1529
969 Ga0500556_0000363 3300053104 Bacteria 33629
970 Ga0500652_003832 3300053131 Bacteria 4595
971 Ga0500568_0016297 3300053139 Bacteria 3308
972 Ga0500568_0052466 3300053139 Bacteria 1601
973 Ga0500645_024021 3300053730 Bacteria 1866
974 Ga0501084_0049531 3300054114 Bacteria 3517
975 Ga0501084_0208885 3300054114 Bacteria 1647
976 Ga0501084_0275634 3300054114 Bacteria 1420
977 Ga0501084_0292547 3300054114 Bacteria 1375
978 Ga0501084_0317794 3300054114 Bacteria 1315
979 Ga0587073_0039083 3300059492 Bacteria 1024
980 Ga0587073_0044354 3300059492 Bacteria 983
981 Ga0587073_0054520 3300059492 Bacteria 917
982 Ga0587083_0049489 3300059505 Bacteria 911
983 Ga0587075_017536 3300059644 Bacteria 1031
984 Ga0501082_0007563 3300060353 Bacteria 9373
985 Ga0501082_0231755 3300060353 Bacteria 1607
986 Ga0501082_0259670 3300060353 Bacteria 1511
987 Ga0501082_0317955 3300060353 Bacteria 1356
988 Ga0530510_0164077 3300061734 Bacteria 1644
989 2842695434 2842694124 Bacteria 4063419
990 Ga0501084_0111220
991 2214572714
992 ARcpr5oldR_c000130
993 ARSoilYngRDRAFT_c00118
994 ARcpr5yngRDRAFT_c000035
995 ARCol0yngRDRAFT_1000209
996 JGI24752J21851_1013069
997 JGI24746J21847_1000683
998 JGI24747J21853_1003746
999 JGI24739J22299_10000158
1000 JGI24737J22298_10001510
1001 JGI24737J22298_10001948
1002 JGI24743J22301_10018083
1003 JGI24745J21846_1001135
1004 JGI24748J21848_1000574
1005 JGI24748J21848_1000699
1006 JGI24738J21930_10003334
1007 JGI24749J21850_1005514
1008 JGI24749J21850_1012555
1009 JGI24744J21845_10001094
1010 JGI24035J26624_1000023
1011 JGI24033J26618_1001768
1012 JGI24034J26672_10001325
1013 JGI24742J22300_10000706
1014 JGI24751J29686_10002998
1015 JGI24751J29686_10008505
1016 JGI25405J52794_10031077
1017 Ga0065712_10007917
1018 Ga0065712_10089850
1019 Ga0065715_10089004
1020 Ga0065707_10143694
1021 Ga0070658_10006919
1022 Ga0070676_10001138
1023 Ga0070676_10126576
1024 Ga0070676_10182049
1025 Ga0070683_100163764
1026 Ga0070690_100000727
1027 Ga0070690_100126144
1028 Ga0070670_100004168
1029 Ga0070670_100060563
1030 Ga0070670_100110934
1031 Ga0070677_10003207
1032 Ga0070677_10003757
1033 Ga0068869_100087385
1034 Ga0070666_10018444
1035 Ga0070666_10018621
1036 Ga0070680_100006389
1037 Ga0070680_100024710
1038 Ga0070680_100067076
1039 Ga0070680_100135083
1040 Ga0070680_100193681
1041 Ga0070682_100007941
1042 Ga0070682_100096561
1043 Ga0068868_100000944
1044 Ga0068868_100050586
1045 Ga0068868_100115031
1046 Ga0068868_100302318
1047 Ga0070660_100015021
1048 Ga0070660_100048298
1049 Ga0070660_100084985
1050 Ga0070660_100117966
1051 Ga0070660_100126808
1052 Ga0070660_100143923
1053 Ga0070689_100000646
1054 Ga0070689_100002989
1055 Ga0070689_100006613
1056 Ga0070689_100009931
1057 Ga0070689_100027299
1058 Ga0070689_100086479
1059 Ga0070691_10000125
1060 Ga0070687_100000773
1061 Ga0070687_100050373
1062 Ga0070687_100115673
1063 Ga0070661_100013869
1064 Ga0070661_100018561
1065 Ga0070692_10038970
1066 Ga0070669_100172652
1067 Ga0070675_100005686
1068 Ga0070675_100112209
1069 Ga0070671_100000170
1070 Ga0070671_100032596
1071 Ga0070671_100053267
1072 Ga0070671_100054894
1073 Ga0070674_100026051
1074 Ga0070674_100053517
1075 Ga0070673_100015366
1076 Ga0070673_100020936
1077 Ga0070673_100136776
1078 Ga0070673_100154134
1079 Ga0070688_100001455
1080 Ga0070688_100002194
1081 Ga0070688_100008402
1082 Ga0070688_100081413
1083 Ga0070688_100091355
1084 Ga0070659_100000621
1085 Ga0070659_100128803
1086 Ga0070667_100044536
1087 Ga0070667_100133608
1088 Ga0070667_100139072
1089 Ga0070703_10001450
1090 Ga0070709_10006995
1091 Ga0070709_10019522
1092 Ga0070709_10113191
1093 Ga0070714_100037912
1094 Ga0070714_100095284
1095 Ga0070714_100099561
1096 Ga0070713_100019242
1097 Ga0070713_100029152
1098 Ga0070713_100067156
1099 Ga0070713_100167387
1100 Ga0070713_100256266
1101 Ga0070710_10014458
1102 Ga0070710_10016436
1103 Ga0070710_10062381
1104 Ga0070711_100008373
1105 Ga0070711_100050862
1106 Ga0070711_100336725
1107 Ga0070705_100004061
1108 Ga0070705_100172914
1109 Ga0070700_100080805
1110 Ga0070694_100002007
1111 Ga0070694_100004869
1112 Ga0070708_100053874
1113 Ga0070663_100016477
1114 Ga0070663_100030911
1115 Ga0070663_100076820
1116 Ga0070663_100225669
1117 Ga0070678_100051868
1118 Ga0070678_100073272
1119 Ga0070678_100109769
1120 Ga0070662_100016774
1121 Ga0070662_100033442
1122 Ga0070662_100050943
1123 Ga0070681_10004332
1124 Ga0070681_10016792
1125 Ga0070681_10017562
1126 Ga0070681_10034345
1127 Ga0070681_10101784
1128 Ga0070681_10131805
1129 Ga0068867_100007473
1130 Ga0068867_100540740
1131 Ga0070685_10018648
1132 Ga0070685_10019896
1133 Ga0070685_10034894
1134 Ga0070698_100056891
1135 Ga0070698_100141478
1136 Ga0070699_100065967
1137 Ga0070699_100148577
1138 Ga0070679_100021073
1139 Ga0070679_100102549
1140 Ga0070679_100106382
1141 Ga0070679_100592576
1142 Ga0070684_100005730
1143 Ga0070684_100096228
1144 Ga0068853_100073930
1145 Ga0068853_100175892
1146 Ga0068853_100239910
1147 Ga0070672_100000557
1148 Ga0070672_100066989
1149 Ga0070672_100154999
1150 Ga0070672_100372903
1151 Ga0070686_100002869
1152 Ga0070686_100003376
1153 Ga0070686_100010566
1154 Ga0070686_100077078
1155 Ga0070695_100009085
1156 Ga0070696_100026503
1157 Ga0070696_100133658
1158 Ga0070693_100009465
1159 Ga0070665_100021216
1160 Ga0070704_100004070
1161 Ga0070704_100008436
1162 Ga0068855_100016277
1163 Ga0068855_100106615
1164 Ga0068855_100303236
1165 Ga0070664_100000263
1166 Ga0070664_100033520
1167 Ga0070664_100052452
1168 Ga0070664_100086013
1169 Ga0070664_100171002
1170 Ga0068857_100000888
1171 Ga0068857_100032844
1172 Ga0068854_100005378
1173 Ga0068856_100003260
1174 Ga0068856_100384779
1175 Ga0070702_100001911
1176 Ga0068852_100000579
1177 Ga0068852_100020377
1178 Ga0068852_100156337
1179 Ga0068859_100003690
1180 Ga0068859_100047890
1181 Ga0068859_100077356
1182 Ga0068859_100154435
1183 Ga0068859_100206704
1184 Ga0068864_100001260
1185 Ga0068864_100032661
1186 Ga0068864_100082174
1187 Ga0068866_10001077
1188 Ga0068866_10082741
1189 Ga0068861_100001782
1190 Ga0068861_100033648
1191 Ga0068861_100129105
1192 Ga0068861_100291730
1193 Ga0068851_10200170
1194 Ga0068870_10000108
1195 Ga0068863_100001201
1196 Ga0068863_100025548
1197 Ga0068863_100064839
1198 Ga0068858_100000419
1199 Ga0068858_100027844
1200 Ga0068858_100046567
1201 Ga0068858_100181425
1202 Ga0068858_100327084
1203 Ga0068860_100001359
1204 Ga0068860_100020550
1205 Ga0068860_100059646
1206 Ga0068860_100162464
1207 Ga0068862_100005815
1208 Ga0068862_100217261
1209 Ga0068862_100438684
1210 Ga0068862_100689519
1211 Ga0081455_10000009
1212 Ga0081455_10004299
1213 Ga0081455_10009512
1214 Ga0081455_10031917
1215 Ga0081455_10052863
1216 Ga0081455_10109166
1217 Ga0081538_10004153
1218 Ga0081538_10025193
1219 Ga0081538_10123568
1220 Ga0081540_1003051
1221 Ga0081539_10002606
1222 Ga0070717_10012616
1223 Ga0070717_10060095
1224 Ga0070717_10166732
1225 Ga0075365_10061816
1226 Ga0075365_10382844
1227 Ga0075368_10015550
1228 Ga0075368_10041123
1229 Ga0075432_10005568
1230 Ga0075432_10024861
1231 Ga0075432_10102466
1232 Ga0070715_10008072
1233 Ga0070716_100004485
1234 Ga0070716_100049983
1235 Ga0070716_100515807
1236 Ga0070712_100005677
1237 Ga0070712_100005829
1238 Ga0070712_100011711
1239 Ga0070712_100026436
1240 Ga0070712_100040984
1241 Ga0070712_100123361
1242 Ga0075367_10023664
1243 Ga0075366_10006561
1244 Ga0097621_100002584
1245 Ga0097621_100012651
1246 Ga0097621_100043375
1247 Ga0075370_10029418
1248 Ga0075370_10031420
1249 Ga0068871_100000417
1250 Ga0068871_100011895
1251 Ga0068871_100013278
1252 Ga0075428_100003881
1253 Ga0075428_100131390
1254 Ga0075428_100244896
1255 Ga0075428_100248253
1256 Ga0075428_100266783
1257 Ga0075428_100300619
1258 Ga0075428_100325983
1259 Ga0075430_100001576
1260 Ga0075430_100003854
1261 Ga0075430_100019980
1262 Ga0075430_100022460
1263 Ga0075430_100157543
1264 Ga0075430_100346115
1265 Ga0075431_100003990
1266 Ga0075431_100061408
1267 Ga0075431_100071416
1268 Ga0075431_100133607
1269 Ga0075431_100150388
1270 Ga0075431_100187571
1271 Ga0075431_100231619
1272 Ga0075431_100304756
1273 Ga0075433_10000187
1274 Ga0075433_10140923
1275 Ga0075433_10172118
1276 Ga0075434_100001354
1277 Ga0075434_100002767
1278 Ga0075434_100050801
1279 Ga0075434_100076390
1280 Ga0075434_100084508
1281 Ga0075434_100085012
1282 Ga0075434_100420353
1283 Ga0075429_100027801
1284 Ga0075429_100149796
1285 Ga0075429_100212877
1286 Ga0068865_100000450
1287 Ga0068865_100075220
1288 Ga0075436_100034598
1289 Ga0075436_100304814
1290 Ga0097620_100003690
1291 Ga0097620_100047890
1292 Ga0097620_100077356
1293 Ga0097620_100154423
1294 Ga0097620_100206713
1295 Ga0075435_100036177
1296 Ga0075435_100425497
1297 Ga0099795_10003382
1298 Ga0099795_10062088
1299 Ga0105244_10121696
1300 Ga0105240_10038333
1301 Ga0111539_10006363
1302 Ga0111539_10039525
1303 Ga0111539_10048283
1304 Ga0111539_10201534
1305 Ga0111539_10363797
1306 Ga0111539_10886496
1307 Ga0105245_10000898
1308 Ga0105245_10019401
1309 Ga0105245_10058770
1310 Ga0105245_10142916
1311 Ga0105247_10003526
1312 Ga0105247_10052803
1313 Ga0114129_10000995
1314 Ga0114129_10043385
1315 Ga0114129_10066405
1316 Ga0114129_10068674
1317 Ga0114129_10266962
1318 Ga0114129_10353298
1319 Ga0105243_10002051
1320 Ga0105243_10089977
1321 Ga0105243_10203901
1322 Ga0105243_10708890
1323 Ga0105241_10001526
1324 Ga0105241_10152988
1325 Ga0105242_10000399
1326 Ga0105242_10247102
1327 Ga0105248_10004145
1328 Ga0105248_10026703
1329 Ga0105248_10031820
1330 Ga0105248_10078259
1331 Ga0105248_10081870
1332 Ga0105248_10095812
1333 Ga0105248_10571375
1334 Ga0105237_10006666
1335 Ga0105237_10075814
1336 Ga0105238_10017057
1337 Ga0105238_10059456
1338 Ga0105238_10100771
1339 Ga0105238_10171795
1340 Ga0105238_10183822
1341 Ga0105249_10002756
1342 Ga0099796_10023205
1343 Ga0105239_10009796
1344 Ga0105239_10184640
1345 Ga0105239_10432739
1346 Ga0105246_10000033
1347 Ga0105246_10188930
1348 Ga0105246_10223477
1349 Ga0157373_10006645
1350 Ga0157371_10033300
1351 Ga0157371_10068893
1352 Ga0157370_10198539
1353 Ga0157374_10002423
1354 Ga0157374_10054544
1355 Ga0157374_10444840
1356 Ga0157378_10011328
1357 Ga0163162_10001526
1358 Ga0163162_10068838
1359 Ga0163162_10642162
1360 Ga0163162_10795344
1361 Ga0157372_10001162
1362 Ga0157375_10000124
1363 Ga0157375_10017274
1364 Ga0157375_10217286
1365 Ga0157375_10614352
1366 Ga0163163_10000745
1367 Ga0163163_10019246
1368 Ga0157380_10000140
1369 Ga0157380_10064645
1370 Ga0157377_10000117
1371 Ga0157379_10000785
1372 Ga0157379_10317925
1373 Ga0157379_10393996
1374 Ga0157376_10000034
1375 Ga0157376_10023138
1376 Ga0163161_10000448
1377 Ga0163161_10250117
1378 Ga0206352_10618637
1379 Ga0206350_10087095
1380 Ga0213873_10076792
1381 Ga0213872_10018295
1382 Ga0213875_10000025
1383 Ga0224572_1005633
1384 Ga0228598_1003747
1385 Ga0228598_1019940
1386 Ga0207666_1000017
1387 Ga0207666_1000125
1388 Ga0207673_1000060
1389 Ga0207697_10000009
1390 Ga0207697_10001569
1391 Ga0207713_1032298
1392 Ga0207653_10001876
1393 Ga0207653_10015121
1394 Ga0207682_10000301
1395 Ga0207682_10010412
1396 Ga0207692_10005014
1397 Ga0207692_10019482
1398 Ga0207692_10083224
1399 Ga0207642_10002547
1400 Ga0207642_10317890
1401 Ga0207710_10011377
1402 Ga0207710_10013038
1403 Ga0207710_10036104
1404 Ga0207688_10000012
1405 Ga0207688_10005642
1406 Ga0207688_10133339
1407 Ga0207680_10004369
1408 Ga0207680_10027612
1409 Ga0207680_10335967
1410 Ga0207647_10005111
1411 Ga0207647_10005834
1412 Ga0207685_10013690
1413 Ga0207685_10044633
1414 Ga0207699_10005829
1415 Ga0207699_10100296
1416 Ga0207699_10125698
1417 Ga0207645_10000124
1418 Ga0207645_10032352
1419 Ga0207645_10036464
1420 Ga0207645_10054407
1421 Ga0207643_10000046
1422 Ga0207643_10080377
1423 Ga0207705_10108072
1424 Ga0207654_10003867
1425 Ga0207654_10062488
1426 Ga0207707_10036253
1427 Ga0207707_10190039
1428 Ga0207707_10214100
1429 Ga0207707_10350297
1430 Ga0207695_10065683
1431 Ga0207695_10184013
1432 Ga0207671_10127298
1433 Ga0207671_10228930
1434 Ga0207693_10004620
1435 Ga0207693_10005130
1436 Ga0207693_10013189
1437 Ga0207693_10046296
1438 Ga0207693_10172981
1439 Ga0207663_10011495
1440 Ga0207663_10163433
1441 Ga0207663_10214114
1442 Ga0207660_10000489
1443 Ga0207660_10020291
1444 Ga0207660_10049252
1445 Ga0207660_10202880
1446 Ga0207660_10277299
1447 Ga0207662_10008508
1448 Ga0207662_10025829
1449 Ga0207662_10034499
1450 Ga0207662_10076811
1451 Ga0207662_10115546
1452 Ga0207657_10000162
1453 Ga0207657_10008982
1454 Ga0207657_10039314
1455 Ga0207657_10085018
1456 Ga0207657_10223662
1457 Ga0207649_10000798
1458 Ga0207649_10412506
1459 Ga0207652_10028398
1460 Ga0207652_10092934
1461 Ga0207652_10137907
1462 Ga0207652_10534187
1463 Ga0207646_10059826
1464 Ga0207646_10673409
1465 Ga0207681_10011712
1466 Ga0207681_10203594
1467 Ga0207694_10043046
1468 Ga0207694_10065822
1469 Ga0207694_10102049
1470 Ga0207694_10218328
1471 Ga0207650_10087109
1472 Ga0207659_10000017
1473 Ga0207687_10006873
1474 Ga0207687_10024743
1475 Ga0207687_10188644
1476 Ga0207687_10406477
1477 Ga0207700_10001122
1478 Ga0207700_10178476
1479 Ga0207664_10044126
1480 Ga0207664_10082606
1481 Ga0207664_10086393
1482 Ga0207664_10103171
1483 Ga0207644_10012971
1484 Ga0207644_10013070
1485 Ga0207644_10036024
1486 Ga0207644_10043725
1487 Ga0207644_10510269
1488 Ga0207690_10000151
1489 Ga0207706_10000368
1490 Ga0207706_10007484
1491 Ga0207706_10008477
1492 Ga0207706_10017363
1493 Ga0207706_10018620
1494 Ga0207686_10003886
1495 Ga0207686_10016902
1496 Ga0207686_10023460
1497 Ga0207709_10000256
1498 Ga0207709_10022765
1499 Ga0207709_10139977
1500 Ga0207709_10616639
1501 Ga0207670_10000086
1502 Ga0207670_10027694
1503 Ga0207670_10068924
1504 Ga0207670_10085467
1505 Ga0207670_10098770
1506 Ga0207670_10170788
1507 Ga0207669_10001765
1508 Ga0207669_10014117
1509 Ga0207669_10021878
1510 Ga0207669_10069684
1511 Ga0207669_10196812
1512 Ga0207669_10312254
1513 Ga0207704_10002423
1514 Ga0207704_10052873
1515 Ga0207704_10160794
1516 Ga0207665_10010248
1517 Ga0207665_10042186
1518 Ga0207665_10210897
1519 Ga0207691_10000303
1520 Ga0207691_10004340
1521 Ga0207691_10203100
1522 Ga0207691_10397324
1523 Ga0207711_10013210
1524 Ga0207711_10057541
1525 Ga0207711_10121154
1526 Ga0207711_10348899
1527 Ga0207711_10375601
1528 Ga0207689_10000109
1529 Ga0207689_10037728
1530 Ga0207661_10010457
1531 Ga0207661_10218844
1532 Ga0207661_10333953
1533 Ga0207679_10000031
1534 Ga0207679_10133638
1535 Ga0207679_10640370
1536 Ga0207667_10002481
1537 Ga0207667_10044884
1538 Ga0207651_10000044
1539 Ga0207651_10049035
1540 Ga0207651_10061834
1541 Ga0207712_10001848
1542 Ga0207712_10057628
1543 Ga0207668_10001339
1544 Ga0207668_10233163
1545 Ga0207640_10210056
1546 Ga0207658_10025019
1547 Ga0207658_10032961
1548 Ga0207658_10034292
1549 Ga0207658_10103050
1550 Ga0207658_10316734
1551 Ga0207658_10438273
1552 Ga0207677_10006203
1553 Ga0207677_10056419
1554 Ga0207703_10018118
1555 Ga0207703_10031219
1556 Ga0207703_10170841
1557 Ga0207703_10202260
1558 Ga0207703_10459859
1559 Ga0207639_10053044
1560 Ga0207639_10374939
1561 Ga0207678_10000158
1562 Ga0207678_10031192
1563 Ga0207678_10047158
1564 Ga0207708_10000098
1565 Ga0207708_10005985
1566 Ga0207702_10008602
1567 Ga0207702_10425025
1568 Ga0207641_10000408
1569 Ga0207648_10000696
1570 Ga0207648_10014142
1571 Ga0207648_10055376
1572 Ga0207676_10037167
1573 Ga0207676_10117072
1574 Ga0207676_10190212
1575 Ga0207674_10000420
1576 Ga0207674_10010481
1577 Ga0207675_100001146
1578 Ga0207675_100024805
1579 Ga0207675_100085001
1580 Ga0207675_100470399
1581 Ga0207683_10000004
1582 Ga0207683_10001766
1583 Ga0207683_10017083
1584 Ga0207683_10065450
1585 Ga0207683_10078238
1586 Ga0207698_10005316
1587 Ga0207698_10615545
1588 Ga0209179_1008391
1589 Ga0209179_1016983
1590 Ga0209983_1012408
1591 Ga0209971_1021584
1592 Ga0209966_1001342
1593 Ga0209966_1034142
1594 Ga0209998_10001259
1595 Ga0209998_10003935
1596 Ga0209813_10016575
1597 Ga0209813_10035088
1598 Ga0209974_10000117
1599 Ga0209974_10006843
1600 Ga0209974_10028923
1601 Ga0209974_10029881
1602 Ga0207428_10000250
1603 Ga0207428_10001707
1604 Ga0207428_10006503
1605 Ga0207428_10007251
1606 Ga0207428_10023620
1607 Ga0268266_10019723
1608 Ga0268266_10064479
1609 Ga0268266_10070409
1610 Ga0268265_10005880
1611 Ga0268264_10018374
1612 Ga0268264_10074225
1613 Ga0268264_10365487
1614 Ga0268264_10415273
1615 Ga0265762_1005243
1616 Ga0265760_10031613
1617 Ga0265330_10156849
1618 Ga0265325_10064261
1619 Ga0265325_10200729
1620 Ga0265340_10007163
1621 Ga0265340_10012516
1622 Ga0265340_10017482
1623 Ga0265340_10075396
1624 Ga0265339_10001522
1625 Ga0265339_10106548
1626 Ga0265316_10006562
1627 Ga0265316_10289717
1628 Ga0307509_10001384
1629 Ga0265313_10000181
1630 Ga0265313_10007831
1631 Ga0265313_10008019
1632 Ga0265313_10011961
1633 Ga0265313_10073281
1634 Ga0265342_10005915
1635 Ga0265342_10008745
1636 Ga0265342_10067079
1637 Ga0307409_100285899
1638 Ga0316583_10032105
1639 Ga0373958_0021183
1640 Ga0373959_0033533
1641 Ga0373938_0000421
1642 Ga0373926_0007240
1643 Ga0373928_0034835
1644 Ga0373934_0033278
1645 Ga0373940_0031602
1646 Ga0373949_0001809
1647 Ga0373951_0009831
1648 Ga0373952_0002647
1649 Ga0373923_0158125
1650 Ga0373932_0001391
1651 Ga0373939_0010614
1652 Ga0373941_0009316
1653 Ga0373954_0143184
1654 Ga0373956_0100444
1655 Ga0373957_0000917
1656 Ga0373960_0003777
1657 Ga0373943_0037316
1658 Ga0373946_0002428
1659 Ga0373946_0019518
1660 Ga0373955_0023921
1661 Ga0373961_0046212
1662 Ga0373962_0003202
1663 Ga0373924_0002733
1664 Ga0373924_0028043
1665 Ga0373931_0000034
1666 Ga0373931_0001311
1667 Ga0373931_0022363
1668 Ga0373931_0051906
1669 Ga0373935_0008152
1670 Ga0373935_0147022
1671 Ga0373935_0325535
1672 Ga0373935_0377021
1673 Ga0373927_0000839
1674 Ga0373927_0099229
1675 Ga0373927_0148020
1676 Ga0373933_0012620
1677 Ga0373933_0272572
1678 Ga0373947_0000796
1679 Ga0373947_0276004
1680 Ga0373937_0019531
1681 Ga0373937_0323068
1682 Ga0316582_0001394
1683 Ga0316582_0192382
1684 Ga0316584_0166581
1685 Ga0373925_0002955
1686 Ga0373925_0021172
1687 Ga0373925_0217275
1688 Ga0395898_0027542
1689 Ga0436364_0273714
1690 Ga0436364_1209910
1691 Ga0436364_1454759
1692 Ga0395901_0014197
1693 Ga0436365_1309021
1694 Ga0436365_1311189
1695 Ga0436365_1565429
1696 Ga0436361_0379330
1697 Ga0436361_0743304
1698 Ga0439450_002141
1699 Ga0466963_0052011
1700 Ga0466963_0110995
1701 Ga0466957_0028996
1702 Ga0466957_0065742
1703 Ga0466958_0040840
1704 Ga0466958_0097744
1705 Ga0466967_0151147
1706 Ga0495592_0020986
1707 Ga0495603_0020845
1708 Ga0495651_0004824
1709 Ga0495651_0017751
1710 Ga0495580_0042600
1711 Ga0495582_0029880
1712 Ga0495605_0038453
1713 Ga0495639_0038306
1714 Ga0495662_0004502
1715 Ga0495664_0004807
1716 Ga0495664_0006400
1717 Ga0495584_0094389
1718 Ga0495594_0024062
1719 Ga0495608_0010475
1720 Ga0495608_0135213
1721 Ga0495618_0000917
1722 Ga0495618_0108433
1723 Ga0495618_0183340
1724 Ga0495628_0007281
1725 Ga0495630_0011479
1726 Ga0495630_0061315
1727 Ga0495666_0012399
1728 Ga0495652_0010662
1729 Ga0495652_0021608
1730 Ga0495652_0177800
1731 Ga0495665_0012185
1732 Ga0495665_0092134
1733 Ga0495640_0003215
1734 Ga0495640_0005374
1735 Ga0495640_0093106
1736 Ga0495587_0026356
1737 Ga0495598_0014273
1738 Ga0495645_0001763
1739 Ga0495645_0004378
1740 Ga0495667_0000256
1741 Ga0495667_0092950
1742 Ga0495634_0003473
1743 Ga0495634_0044121
1744 Ga0495634_0098678
1745 Ga0495635_0001674
1746 Ga0495635_0003010
1747 Ga0495635_0019505
1748 Ga0495635_0389808
1749 Ga0495588_0052958
1750 Ga0495657_0002838
1751 Ga0495599_0002175
1752 Ga0495623_0008613
1753 Ga0495646_0001535
1754 Ga0495647_0010400
1755 Ga0495647_0059631
1756 Ga0495658_0040583
1757 Ga0495613_0095948
1758 Ga0495624_0002424
1759 Ga0495624_0040939
1760 Ga0495600_0008376
1761 Ga0495581_0008086
1762 Ga0495604_0012925
1763 Ga0495604_0175636
1764 Ga0495674_0001984
1765 Ga0495674_0004803
1766 Ga0495674_0345711
1767 Ga0495674_0379723
1768 Ga0495676_0299706
1769 Ga0495680_0005564
1770 Ga0495680_0008253
1771 Ga0495675_0000532
1772 Ga0495685_004853
1773 Ga0495684_0000987
1774 Ga0495684_0009836
1775 Ga0495593_0082439
1776 Ga0495602_0005750
1777 Ga0495615_0009209
1778 Ga0495615_0012574
1779 Ga0496100_0000842
1780 Ga0496100_0073931
1781 Ga0496101_0007404
1782 Ga0496101_0017864
1783 Ga0496101_0077127
1784 Ga0496101_0135469
1785 Ga0496101_0160773
1786 Ga0496102_0001935
1787 Ga0496102_0011713
1788 Ga0496102_0051622
1789 Ga0496103_0004653
1790 Ga0496103_0010777
1791 Ga0496104_0011266
1792 Ga0496104_0084266
1793 Ga0496104_0172235
1794 Ga0496104_0230375
1795 Ga0496104_0642583
1796 Ga0496105_0041290
1797 Ga0496105_0186660
1798 Ga0496106_0000405
1799 Ga0496106_0055867
1800 Ga0496107_0004066
1801 Ga0496107_0005799
1802 Ga0496107_0034287
1803 Ga0496107_0050462
1804 Ga0496108_0001198
1805 Ga0496108_0025837
1806 Ga0496108_0032267
1807 Ga0496108_0034437
1808 Ga0496108_0049561
1809 Ga0496108_0141846
1810 Ga0496109_0151200
1811 Ga0496110_0010646
1812 Ga0496110_0041865
1813 Ga0496110_0070107
1814 Ga0496110_0494729
1815 Ga0496111_0004338
1816 Ga0496111_0009762
1817 Ga0496111_0069131
1818 Ga0496111_0194583
1819 Ga0496112_0047842
1820 Ga0496112_0143557
1821 Ga0496113_0002604
1822 Ga0496113_0079720
1823 Ga0496113_0150213
1824 Ga0496113_0170106
1825 Ga0496114_0005575
1826 Ga0496114_0016691
1827 Ga0496114_0018204
1828 Ga0496114_0071524
1829 Ga0496114_0147538
1830 Ga0496115_0053006
1831 Ga0496115_0067368
1832 Ga0496115_0191993
1833 Ga0496115_0211939
1834 Ga0496115_0478452
1835 Ga0496119_0000893
1836 Ga0496122_0002944
1837 Ga0496123_0001139
1838 Ga0501031_0228033
1839 Ga0501032_0005175
1840 Ga0501033_0029607
1841 Ga0501033_0083303
1842 Ga0501033_0129315
1843 Ga0501034_0164419
1844 Ga0501034_0184946
1845 Ga0501034_0257328
1846 Ga0501036_0009276
1847 Ga0501036_0327333
1848 Ga0501037_0001340
1849 Ga0501038_0001023
1850 Ga0501039_0015388
1851 Ga0501039_0529808
1852 Ga0501042_0299785
1853 Ga0501043_0025349
1854 Ga0501043_0192196
1855 Ga0501046_0000060
1856 Ga0501046_0008699
1857 Ga0501046_0038257
1858 Ga0501047_0055872
1859 Ga0501047_0061462
1860 Ga0501047_0195600
1861 Ga0501047_0419955
1862 Ga0501048_0002666
1863 Ga0501048_0087158
1864 Ga0501048_0335918
1865 Ga0501067_0005961
1866 Ga0501067_0083621
1867 Ga0501069_0005453
1868 Ga0501070_0025730
1869 Ga0501070_0043988
1870 Ga0501070_0063526
1871 Ga0501071_0021832
1872 Ga0501072_0313549
1873 Ga0501072_0374429
1874 Ga0501072_0396274
1875 Ga0501073_0017253
1876 Ga0501073_0142636
1877 Ga0501074_0008132
1878 Ga0501074_0060646
1879 Ga0501074_0212813
1880 Ga0501075_0274824
1881 Ga0501076_0106477
1882 Ga0501077_0046198
1883 Ga0501079_0006545
1884 Ga0501079_0086067
1885 Ga0501079_0426513
1886 Ga0501080_0099237
1887 Ga0501080_0254987
1888 Ga0501083_0007790
1889 Ga0501083_0012367
1890 Ga0501083_0089078
1891 Ga0501083_0149372
1892 Ga0501035_0206329
1893 Ga0501035_0294822
1894 Ga0501035_0352720
1895 Ga0501044_0000260
1896 Ga0501044_0008573
1897 Ga0501044_0010896
1898 Ga0501044_0322843
1899 Ga0501044_0487609
1900 Ga0501045_0490490
1901 nmdc:mga03683_41279_c1
1902 nmdc:mga03n38_79548_c1
1903 nmdc:mga00v17_19362_c1
1904 nmdc:mga0yw44_383517_c1
1905 nmdc:mga0yw44_63367_c1
1906 nmdc:mga0yw44_75835_c1
1907 nmdc:mga0k408_55917_c1
1908 nmdc:mga06z11_113993_c1
1909 nmdc:mga06z11_53313_c1
1910 nmdc:mga04h51_29994_c1
1911 nmdc:mga07m45_147397_c1
1912 nmdc:mga07m45_15773_c1
1913 nmdc:mga07m45_26560_c1
1914 nmdc:mga07m45_27289_c1
1915 nmdc:mga05p37_153275_c1
1916 nmdc:mga05p37_163552_c1
1917 nmdc:mga05p37_290189_c1
1918 nmdc:mga05p37_354142_c1
1919 nmdc:mga05p37_5377_c1
1920 nmdc:mga09592_170167_c1
1921 nmdc:mga09592_21364_c1
1922 nmdc:mga09592_29378_c1
1923 nmdc:mga0qj67_151963_c1
1924 nmdc:mga0qj67_28_c1
1925 nmdc:mga0qj67_341240_c1
1926 nmdc:mga0qj67_82924_c1
1927 nmdc:mga0qj67_97253_c1
1928 nmdc:mga06r32_270079_c1
1929 nmdc:mga06r32_322976_c1
1930 nmdc:mga06r32_383161_c1
1931 nmdc:mga06r32_507731_c1
1932 nmdc:mga06r32_752703_c1
1933 nmdc:mga08y16_22572_c1
1934 nmdc:mga08y16_409669_c1
1935 nmdc:mga08y16_590_c1
1936 nmdc:mga0n895_33397_c1
1937 nmdc:mga0n895_425283_c1
1938 nmdc:mga0n895_4459_c1
1939 nmdc:mga0n895_947751_c1
1940 nmdc:mga0rr50_39320_c1
1941 nmdc:mga0rr50_8026_c1
1942 nmdc:mga0rr50_85462_c1
1943 nmdc:mga0a205_3619_c1
1944 nmdc:mga0a205_733_c2
1945 nmdc:mga0sz30_4070_c1
1946 Ga0495601_0000418
1947 Ga0495601_0010781
1948 Ga0495601_0012231
1949 Ga0495601_0039644
1950 Ga0495612_0000251
1951 Ga0495612_0003654
1952 Ga0495612_0138888
1953 Ga0495595_0002778
1954 Ga0495619_0002566
1955 Ga0495619_0037784
1956 Ga0495619_0090917
1957 Ga0495619_0165320
1958 Ga0500556_0000363
1959 Ga0500652_003832
1960 Ga0500568_0016297
1961 Ga0500568_0052466
1962 Ga0500645_024021
1963 Ga0501084_0049531
1964 Ga0501084_0208885
1965 Ga0501084_0275634
1966 Ga0501084_0292547
1967 Ga0501084_0317794
1968 Ga0587073_0039083
1969 Ga0587073_0044354
1970 Ga0587073_0054520
1971 Ga0587083_0049489
1972 Ga0587075_017536
1973 Ga0501082_0007563
1974 Ga0501082_0231755
1975 Ga0501082_0259670
1976 Ga0501082_0317955
1977 Ga0530510_0164077
1978 2842695434

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22029

PhyR_sigma2

Sigma2 domain of PhyR

31

85

0.98

PF22233

PhyR_sigma-like

Response regulator PhyR, sigma-like domain

107

156

0.95

PF00072

Response_reg

Response regulator receiver domain

161

270

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9718 93 130
7bhy-assembly1.cif.gz_A dna-binding domain of deor in complex with the dna operator 0.9706 93 131
4g97-assembly1.cif.gz_A crystal structure of the response regulator phyr from brucella abortus 0.9697 1 266
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9675 93 130
4g97-assembly1.cif.gz_A crystal structure of the response regulator phyr from brucella abortus 0.9658 1 266
ID Description Score Start End Superfamily
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9718 93 130 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9675 93 130 1.10.10.10
3t0yA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9564 91 135 1.10.10.10
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9538 90 130 1.10.10.10
3n0rA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9511 135 254 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A530R2W7-F1-model_v4 Response regulator 0.9856 157 260 GO:0000160
AF-X2FNI5-F1-model_v4 Two-component response regulator 0.9833 111 247 GO:0000160
AF-Q98FM8-F1-model_v4 Sensory transduction regulatory protein 0.9735 136 260 GO:0000160
AF-A0A6B2NSG7-F1-model_v4 Response regulator 0.9716 141 259 GO:0000160
AF-A0A257G5H4-F1-model_v4 Response regulator 0.9703 1 262 GO:0000160

Map