F487650
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 991 | 484 | 1983 | 287 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2547132424|2548692431 |
| Length | 299 |
| Sequence | ILAGGTGSRLHPITRGVSKQLVPVYDKPMVYYPLSTLMLAGVRDVLVITTPEDAESFRRLLGDGTQFGMSIDYVVQPEPDGLARAFVLGADHIGTDCAALVLGDNIFHGPGLGTRLRRFDGLDGGTVFAYRVSDPSAYGVIEFVGGKAVSIEEKPKLPRSSYAVPGLYFYDNDVVEIARGLRPSARGEYEITDINRTYLEQGRLRVETLARGTAWLDTGTFDSLLDAANYVRTIEERQGLKIGVPEEVAWRMGFIDDEQLSRLAEPLVRSGYGTYLMDLLTRGKNDGTTADEYRDEQDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 203 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 204 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 205 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 209 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 210 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 214 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 235 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 240 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 241 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 246 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 247 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 250 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 251 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 252 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 253 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 254 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 255 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 256 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 257 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 258 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 259 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 266 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 267 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 272 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 315 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 316 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 317 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 318 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 319 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 320 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 321 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 322 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 348 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 349 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 350 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 351 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 352 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 365 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 374 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 375 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 376 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 377 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 378 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 379 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 380 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 381 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 382 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 383 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 384 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 385 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 386 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 390 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 391 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 392 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 394 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 395 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 397 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 400 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 401 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 402 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 403 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 404 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 405 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 406 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 407 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 408 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 409 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 410 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 411 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 412 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 413 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 414 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 415 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 416 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 417 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 418 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 419 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 420 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 421 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 422 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 423 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 424 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 425 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 426 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 427 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 428 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 429 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 430 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 431 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 432 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 433 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 434 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 435 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 436 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 437 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 438 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 439 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 440 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 441 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 442 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 443 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 444 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 445 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 446 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 447 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 448 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 449 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 450 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 451 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 452 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 453 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 454 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 455 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 456 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 457 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 458 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 459 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 460 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 461 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 462 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 463 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 464 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 465 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 466 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 467 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 468 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 469 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 470 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 471 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 472 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 473 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 474 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 475 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 476 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 477 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 478 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 479 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 480 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 481 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 482 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 483 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 484 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.62 |
| Metatranscriptomes | 0.4 |
| Isolates | 8.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 18.06 |
| Nodule | 0.1 |
| Rhizoplane | 7.06 |
| Rhizosphere | 59.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_300488 | 2162886007 | Bacteria | 4246 |
| 2 | JGI24746J21847_1001168 | 3300001977 | Bacteria | 4151 |
| 3 | JGI24740J21852_10001780 | 3300001979 | Bacteria | 9878 |
| 4 | JGI24739J22299_10002055 | 3300001989 | Bacteria | 7703 |
| 5 | JGI24744J21845_10001990 | 3300002077 | Bacteria | 4135 |
| 6 | JGI24744J21845_10006209 | 3300002077 | Bacteria | 2480 |
| 7 | JGI25154J39366_1000002 | 3300002738 | Bacteria | 466942 |
| 8 | JGI25154J39366_1001681 | 3300002738 | Bacteria | 7309 |
| 9 | JGI25153J46596_10008393 | 3300003215 | Bacteria | 4941 |
| 10 | rootL2_10022523 | 3300003322 | Bacteria | 1966 |
| 11 | rootL2_10081697 | 3300003322 | Bacteria | 3459 |
| 12 | rootH1_10000619 | 3300003316 | Bacteria | 3651 |
| 13 | rootH1_10000619 | 3300003323 | Bacteria | 100005 |
| 14 | rootH1_10000732 | 3300003323 | Bacteria | 17056 |
| 15 | rootH1_10040576 | 3300003323 | Bacteria | 6667 |
| 16 | rootH1_10137115 | 3300003323 | Bacteria | 4229 |
| 17 | JGI25160J50197_1001555 | 3300003354 | Bacteria | 11368 |
| 18 | JGI25160J50197_1008496 | 3300003354 | Bacteria | 3907 |
| 19 | Ga0006562J51391_1044531 | 3300003578 | Bacteria | 3718 |
| 20 | Ga0006562J51391_1044534 | 3300003578 | Bacteria | 1780 |
| 21 | Ga0055528_1000422 | 3300003790 | Bacteria | 34012 |
| 22 | Ga0055530_10000475 | 3300003791 | Bacteria | 34908 |
| 23 | Ga0055540_1007250 | 3300003792 | Bacteria | 4230 |
| 24 | Ga0055540_1007673 | 3300003792 | Bacteria | 4023 |
| 25 | Ga0055540_1022563 | 3300003792 | Bacteria | 1607 |
| 26 | Ga0055540_1031088 | 3300003792 | Bacteria | 1230 |
| 27 | Ga0055531_10000014 | 3300003794 | Bacteria | 184532 |
| 28 | Ga0065165_1000258 | 3300005262 | Bacteria | 91861 |
| 29 | Ga0065165_1002847 | 3300005262 | Bacteria | 13435 |
| 30 | Ga0065165_1024739 | 3300005262 | Bacteria | 2011 |
| 31 | Ga0065704_10073688 | 3300005289 | Bacteria | 6887 |
| 32 | Ga0070658_10000839 | 3300005327 | Bacteria | 26240 |
| 33 | Ga0070658_10040088 | 3300005327 | Bacteria | 3779 |
| 34 | Ga0070676_10089790 | 3300005328 | Bacteria | 1880 |
| 35 | Ga0070676_10114154 | 3300005328 | Bacteria | 1686 |
| 36 | Ga0070683_100024499 | 3300005329 | Bacteria | 5407 |
| 37 | Ga0070683_100112109 | 3300005329 | Bacteria | 2574 |
| 38 | Ga0070683_100562634 | 3300005329 | Bacteria | 1090 |
| 39 | Ga0070690_100002005 | 3300005330 | Bacteria | 10847 |
| 40 | Ga0068869_100046160 | 3300005334 | Bacteria | 3141 |
| 41 | Ga0070666_10060925 | 3300005335 | Bacteria | 2554 |
| 42 | Ga0070680_100023828 | 3300005336 | Bacteria | 4885 |
| 43 | Ga0070680_100177905 | 3300005336 | Bacteria | 1791 |
| 44 | Ga0070682_100003922 | 3300005337 | Bacteria | 8255 |
| 45 | Ga0068868_100000721 | 3300005338 | Bacteria | 22318 |
| 46 | Ga0068868_100083622 | 3300005338 | Bacteria | 2563 |
| 47 | Ga0070660_100000275 | 3300005339 | Bacteria | 34274 |
| 48 | Ga0070660_100010827 | 3300005339 | Bacteria | 6456 |
| 49 | Ga0070689_100058091 | 3300005340 | Bacteria | 3004 |
| 50 | Ga0070691_10010747 | 3300005341 | Bacteria | 4179 |
| 51 | Ga0070692_10030196 | 3300005345 | Bacteria | 2708 |
| 52 | Ga0070668_100001176 | 3300005347 | Bacteria | 18508 |
| 53 | Ga0070668_100051114 | 3300005347 | Bacteria | 3184 |
| 54 | Ga0070668_100104218 | 3300005347 | Bacteria | 2251 |
| 55 | Ga0070669_100044641 | 3300005353 | Bacteria | 3229 |
| 56 | Ga0070671_100045381 | 3300005355 | Bacteria | 3653 |
| 57 | Ga0070674_100024056 | 3300005356 | Bacteria | 3951 |
| 58 | Ga0070673_100559931 | 3300005364 | Bacteria | 1039 |
| 59 | Ga0070659_100001086 | 3300005366 | Bacteria | 19840 |
| 60 | Ga0070659_100055713 | 3300005366 | Bacteria | 3117 |
| 61 | Ga0070667_100001332 | 3300005367 | Bacteria | 22171 |
| 62 | Ga0070667_100011524 | 3300005367 | Bacteria | 7311 |
| 63 | Ga0070709_10093423 | 3300005434 | Bacteria | 1988 |
| 64 | Ga0070714_100059440 | 3300005435 | Bacteria | 3277 |
| 65 | Ga0070714_100103843 | 3300005435 | Bacteria | 2507 |
| 66 | Ga0070710_10003466 | 3300005437 | Bacteria | 7477 |
| 67 | Ga0070701_10001177 | 3300005438 | Bacteria | 9599 |
| 68 | Ga0070701_10093432 | 3300005438 | Bacteria | 1653 |
| 69 | Ga0070711_100001348 | 3300005439 | Bacteria | 13404 |
| 70 | Ga0070711_100013605 | 3300005439 | Bacteria | 5112 |
| 71 | Ga0070705_100006092 | 3300005440 | Bacteria | 5901 |
| 72 | Ga0070705_100104729 | 3300005440 | Bacteria | 1794 |
| 73 | Ga0070700_100002213 | 3300005441 | Bacteria | 9895 |
| 74 | Ga0070694_100009996 | 3300005444 | Bacteria | 5833 |
| 75 | Ga0070663_100005044 | 3300005455 | Bacteria | 7801 |
| 76 | Ga0070663_100024173 | 3300005455 | Bacteria | 4085 |
| 77 | Ga0070663_100211764 | 3300005455 | Bacteria | 1518 |
| 78 | Ga0070678_100000690 | 3300005456 | Bacteria | 16671 |
| 79 | Ga0070662_100020728 | 3300005457 | Bacteria | 4482 |
| 80 | Ga0070662_100031415 | 3300005457 | Bacteria | 3726 |
| 81 | Ga0070681_10050063 | 3300005458 | Bacteria | 4169 |
| 82 | Ga0068867_100002146 | 3300005459 | Bacteria | 13834 |
| 83 | Ga0068867_100029761 | 3300005459 | Bacteria | 3936 |
| 84 | Ga0070685_10050961 | 3300005466 | Bacteria | 2393 |
| 85 | Ga0070685_10094756 | 3300005466 | Bacteria | 1814 |
| 86 | Ga0070699_100252882 | 3300005518 | Bacteria | 1575 |
| 87 | Ga0070679_100009071 | 3300005530 | Bacteria | 9383 |
| 88 | Ga0070679_100009808 | 3300005530 | Bacteria | 9059 |
| 89 | Ga0070684_100132720 | 3300005535 | Bacteria | 2247 |
| 90 | Ga0070684_100531578 | 3300005535 | Bacteria | 1090 |
| 91 | Ga0070697_100161948 | 3300005536 | Bacteria | 1890 |
| 92 | Ga0068853_100002060 | 3300005539 | Bacteria | 14892 |
| 93 | Ga0068853_100020442 | 3300005539 | Bacteria | 5506 |
| 94 | Ga0068853_100192290 | 3300005539 | Bacteria | 1854 |
| 95 | Ga0068853_100535977 | 3300005539 | Bacteria | 1108 |
| 96 | Ga0070672_100025016 | 3300005543 | Bacteria | 4421 |
| 97 | Ga0070696_100001539 | 3300005546 | Bacteria | 15125 |
| 98 | Ga0070665_100008709 | 3300005548 | Bacteria | 10266 |
| 99 | Ga0070665_100133519 | 3300005548 | Bacteria | 2484 |
| 100 | Ga0070704_100000342 | 3300005549 | Bacteria | 21195 |
| 101 | Ga0068855_100081453 | 3300005563 | Bacteria | 3752 |
| 102 | Ga0070664_100052079 | 3300005564 | Bacteria | 3467 |
| 103 | Ga0068857_100112040 | 3300005577 | Bacteria | 2453 |
| 104 | Ga0068854_100005978 | 3300005578 | Bacteria | 7710 |
| 105 | Ga0068856_100000060 | 3300005614 | Bacteria | 101415 |
| 106 | Ga0070702_100002910 | 3300005615 | Bacteria | 7539 |
| 107 | Ga0070702_100071989 | 3300005615 | Bacteria | 2045 |
| 108 | Ga0068852_100000088 | 3300005616 | Bacteria | 64778 |
| 109 | Ga0068852_100155424 | 3300005616 | Bacteria | 2130 |
| 110 | Ga0068852_100411137 | 3300005616 | Bacteria | 1333 |
| 111 | Ga0068859_100002678 | 3300005617 | Bacteria | 18089 |
| 112 | Ga0068859_100008165 | 3300005617 | Bacteria | 10620 |
| 113 | Ga0068859_100275432 | 3300005617 | Bacteria | 1775 |
| 114 | Ga0068864_100268459 | 3300005618 | Bacteria | 1589 |
| 115 | Ga0068864_100622843 | 3300005618 | Bacteria | 1049 |
| 116 | Ga0068866_10003250 | 3300005718 | Bacteria | 6693 |
| 117 | Ga0068866_10030623 | 3300005718 | Bacteria | 2584 |
| 118 | Ga0068866_10079925 | 3300005718 | Bacteria | 1753 |
| 119 | Ga0068861_100024884 | 3300005719 | Bacteria | 4335 |
| 120 | Ga0068861_100380020 | 3300005719 | Bacteria | 1248 |
| 121 | Ga0068863_100000205 | 3300005841 | Bacteria | 63387 |
| 122 | Ga0068863_100303094 | 3300005841 | Bacteria | 1550 |
| 123 | Ga0068858_100000569 | 3300005842 | Bacteria | 38556 |
| 124 | Ga0068858_100021662 | 3300005842 | Bacteria | 6007 |
| 125 | Ga0068858_100069863 | 3300005842 | Bacteria | 3255 |
| 126 | Ga0068858_100247683 | 3300005842 | Bacteria | 1692 |
| 127 | Ga0068860_100000472 | 3300005843 | Bacteria | 50060 |
| 128 | Ga0068860_100018155 | 3300005843 | Bacteria | 6847 |
| 129 | Ga0068862_100000030 | 3300005844 | Bacteria | 182487 |
| 130 | Ga0068862_100001196 | 3300005844 | Bacteria | 24474 |
| 131 | Ga0068862_100161763 | 3300005844 | Bacteria | 1999 |
| 132 | Ga0081455_10021717 | 3300005937 | Bacteria | 6012 |
| 133 | Ga0081455_10048739 | 3300005937 | Bacteria | 3657 |
| 134 | Ga0081455_10090423 | 3300005937 | Bacteria | 2482 |
| 135 | Ga0081455_10116704 | 3300005937 | Bacteria | 2111 |
| 136 | Ga0081455_10130098 | 3300005937 | Bacteria | 1970 |
| 137 | Ga0081455_10231688 | 3300005937 | Bacteria | 1363 |
| 138 | Ga0081539_10002644 | 3300005985 | Bacteria | 24458 |
| 139 | Ga0075365_10003949 | 3300006038 | Bacteria | 7767 |
| 140 | Ga0075365_10005987 | 3300006038 | Bacteria | 6637 |
| 141 | Ga0075365_10020421 | 3300006038 | Bacteria | 4106 |
| 142 | Ga0075365_10031290 | 3300006038 | Bacteria | 3413 |
| 143 | Ga0075365_10092721 | 3300006038 | Bacteria | 2059 |
| 144 | Ga0075365_10103317 | 3300006038 | Bacteria | 1953 |
| 145 | Ga0075365_10140446 | 3300006038 | Bacteria | 1677 |
| 146 | Ga0075365_10155329 | 3300006038 | Bacteria | 1592 |
| 147 | Ga0075365_10198509 | 3300006038 | Bacteria | 1405 |
| 148 | Ga0075368_10030850 | 3300006042 | Bacteria | 2077 |
| 149 | Ga0075363_100000097 | 3300006048 | Bacteria | 19438 |
| 150 | Ga0075363_100002740 | 3300006048 | Bacteria | 7294 |
| 151 | Ga0075363_100003750 | 3300006048 | Bacteria | 6541 |
| 152 | Ga0075363_100006637 | 3300006048 | Bacteria | 5273 |
| 153 | Ga0075363_100016375 | 3300006048 | Bacteria | 3662 |
| 154 | Ga0075363_100019871 | 3300006048 | Bacteria | 3362 |
| 155 | Ga0075363_100019973 | 3300006048 | Bacteria | 3355 |
| 156 | Ga0075363_100026690 | 3300006048 | Bacteria | 2956 |
| 157 | Ga0075363_100135286 | 3300006048 | Bacteria | 1385 |
| 158 | Ga0075363_100193264 | 3300006048 | Bacteria | 1161 |
| 159 | Ga0075364_10008403 | 3300006051 | Bacteria | 6170 |
| 160 | Ga0075364_10009086 | 3300006051 | Bacteria | 5952 |
| 161 | Ga0075364_10011846 | 3300006051 | Bacteria | 5310 |
| 162 | Ga0075364_10016734 | 3300006051 | Bacteria | 4567 |
| 163 | Ga0075364_10028145 | 3300006051 | Bacteria | 3596 |
| 164 | Ga0075364_10044912 | 3300006051 | Bacteria | 2875 |
| 165 | Ga0075364_10061062 | 3300006051 | Bacteria | 2471 |
| 166 | Ga0075364_10076481 | 3300006051 | Bacteria | 2209 |
| 167 | Ga0075364_10083783 | 3300006051 | Bacteria | 2111 |
| 168 | Ga0075364_10117162 | 3300006051 | Bacteria | 1781 |
| 169 | Ga0075364_10135515 | 3300006051 | Bacteria | 1654 |
| 170 | Ga0070715_10000745 | 3300006163 | Bacteria | 8784 |
| 171 | Ga0070716_100002545 | 3300006173 | Bacteria | 8435 |
| 172 | Ga0070716_100052081 | 3300006173 | Bacteria | 2330 |
| 173 | Ga0070712_100001630 | 3300006175 | Bacteria | 13741 |
| 174 | Ga0070712_100008920 | 3300006175 | Bacteria | 6315 |
| 175 | Ga0070712_100163325 | 3300006175 | Bacteria | 1722 |
| 176 | Ga0075362_10068099 | 3300006177 | Bacteria | 1621 |
| 177 | Ga0075367_10058747 | 3300006178 | Bacteria | 2289 |
| 178 | Ga0075367_10121915 | 3300006178 | Bacteria | 1607 |
| 179 | Ga0075367_10182849 | 3300006178 | Bacteria | 1307 |
| 180 | Ga0075369_10003213 | 3300006186 | Bacteria | 5931 |
| 181 | Ga0075369_10017544 | 3300006186 | Bacteria | 2903 |
| 182 | Ga0075369_10023785 | 3300006186 | Bacteria | 2535 |
| 183 | Ga0075369_10034608 | 3300006186 | Bacteria | 2144 |
| 184 | Ga0075369_10042008 | 3300006186 | Bacteria | 1959 |
| 185 | Ga0075369_10044597 | 3300006186 | Bacteria | 1905 |
| 186 | Ga0075369_10079851 | 3300006186 | Bacteria | 1450 |
| 187 | Ga0075369_10133245 | 3300006186 | Bacteria | 1130 |
| 188 | Ga0075366_10004918 | 3300006195 | Bacteria | 7207 |
| 189 | Ga0075366_10023876 | 3300006195 | Bacteria | 3563 |
| 190 | Ga0075366_10166895 | 3300006195 | Bacteria | 1335 |
| 191 | Ga0097621_100009990 | 3300006237 | Bacteria | 6917 |
| 192 | Ga0075370_10020303 | 3300006353 | Bacteria | 3629 |
| 193 | Ga0075370_10067844 | 3300006353 | Bacteria | 2036 |
| 194 | Ga0075370_10232545 | 3300006353 | Bacteria | 1091 |
| 195 | Ga0068871_100039173 | 3300006358 | Bacteria | 3791 |
| 196 | Ga0068871_100083216 | 3300006358 | Bacteria | 2654 |
| 197 | Ga0075428_100023471 | 3300006844 | Bacteria | 6827 |
| 198 | Ga0075428_100431309 | 3300006844 | Bacteria | 1412 |
| 199 | Ga0075431_100385090 | 3300006847 | Bacteria | 1406 |
| 200 | Ga0068865_100000869 | 3300006881 | Bacteria | 17113 |
| 201 | Ga0097620_100002678 | 3300006931 | Bacteria | 18089 |
| 202 | Ga0097620_100008165 | 3300006931 | Bacteria | 10620 |
| 203 | Ga0097620_100275455 | 3300006931 | Bacteria | 1775 |
| 204 | Ga0105244_10013007 | 3300009036 | Bacteria | 4888 |
| 205 | Ga0105250_10062958 | 3300009092 | Bacteria | 1493 |
| 206 | Ga0105240_10000030 | 3300009093 | Bacteria | 321312 |
| 207 | Ga0111539_10040373 | 3300009094 | Bacteria | 5618 |
| 208 | Ga0111539_10421043 | 3300009094 | Bacteria | 1555 |
| 209 | Ga0111539_10535286 | 3300009094 | Bacteria | 1365 |
| 210 | Ga0105245_10001960 | 3300009098 | Bacteria | 18684 |
| 211 | Ga0105247_10000008 | 3300009101 | Bacteria | 391450 |
| 212 | Ga0105247_10000731 | 3300009101 | Bacteria | 25571 |
| 213 | Ga0105247_10024985 | 3300009101 | Bacteria | 3603 |
| 214 | Ga0105247_10046848 | 3300009101 | Bacteria | 2654 |
| 215 | Ga0114129_10234720 | 3300009147 | Bacteria | 2469 |
| 216 | Ga0105243_10003737 | 3300009148 | Bacteria | 12202 |
| 217 | Ga0105243_10004909 | 3300009148 | Bacteria | 10484 |
| 218 | Ga0105243_10484947 | 3300009148 | Bacteria | 1168 |
| 219 | Ga0105241_10005394 | 3300009174 | Bacteria | 9454 |
| 220 | Ga0105242_10001062 | 3300009176 | Bacteria | 21595 |
| 221 | Ga0105248_10000257 | 3300009177 | Bacteria | 62094 |
| 222 | Ga0105248_10011362 | 3300009177 | Bacteria | 9814 |
| 223 | Ga0105248_10092787 | 3300009177 | Bacteria | 3400 |
| 224 | Ga0105248_10136665 | 3300009177 | Bacteria | 2765 |
| 225 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 226 | Ga0105237_10001184 | 3300009545 | Bacteria | 34869 |
| 227 | Ga0105237_10064418 | 3300009545 | Bacteria | 3662 |
| 228 | Ga0105238_10132643 | 3300009551 | Bacteria | 2469 |
| 229 | Ga0105238_10509971 | 3300009551 | Bacteria | 1204 |
| 230 | Ga0105249_10000036 | 3300009553 | Bacteria | 198578 |
| 231 | Ga0105249_10002637 | 3300009553 | Bacteria | 15512 |
| 232 | Ga0105249_10062183 | 3300009553 | Bacteria | 3428 |
| 233 | Ga0105239_10003290 | 3300010375 | Bacteria | 19920 |
| 234 | Ga0105239_10021671 | 3300010375 | Bacteria | 7083 |
| 235 | Ga0105239_10059620 | 3300010375 | Bacteria | 4189 |
| 236 | Ga0105239_10281419 | 3300010375 | Bacteria | 1872 |
| 237 | Ga0105246_10000069 | 3300011119 | Bacteria | 42493 |
| 238 | Ga0105246_10013466 | 3300011119 | Bacteria | 5129 |
| 239 | Ga0157373_10001378 | 3300013100 | Bacteria | 18643 |
| 240 | Ga0157371_10005033 | 3300013102 | Bacteria | 11313 |
| 241 | Ga0157371_10027957 | 3300013102 | Bacteria | 4086 |
| 242 | Ga0157370_10000812 | 3300013104 | Bacteria | 39488 |
| 243 | Ga0157370_10000984 | 3300013104 | Bacteria | 36041 |
| 244 | Ga0157370_10048608 | 3300013104 | Bacteria | 4063 |
| 245 | Ga0157369_10000026 | 3300013105 | Bacteria | 216023 |
| 246 | Ga0157369_10000851 | 3300013105 | Bacteria | 38900 |
| 247 | Ga0157369_10008059 | 3300013105 | Bacteria | 12081 |
| 248 | Ga0157374_10019012 | 3300013296 | Bacteria | 6076 |
| 249 | Ga0157378_10003646 | 3300013297 | Bacteria | 13637 |
| 250 | Ga0157378_10114883 | 3300013297 | Bacteria | 2473 |
| 251 | Ga0157378_10319677 | 3300013297 | Bacteria | 1507 |
| 252 | Ga0163162_10015231 | 3300013306 | Bacteria | 7511 |
| 253 | Ga0163162_10104859 | 3300013306 | Bacteria | 2922 |
| 254 | Ga0157372_10000007 | 3300013307 | Bacteria | 340690 |
| 255 | Ga0157372_10000027 | 3300013307 | Bacteria | 186906 |
| 256 | Ga0157372_10006391 | 3300013307 | Bacteria | 12536 |
| 257 | Ga0157372_10085822 | 3300013307 | Bacteria | 3571 |
| 258 | Ga0157372_10213109 | 3300013307 | Bacteria | 2238 |
| 259 | Ga0157375_10002986 | 3300013308 | Bacteria | 14691 |
| 260 | Ga0157375_10177231 | 3300013308 | Bacteria | 2282 |
| 261 | Ga0157375_10238090 | 3300013308 | Bacteria | 1979 |
| 262 | Ga0157375_10260849 | 3300013308 | Bacteria | 1894 |
| 263 | Ga0157380_10000595 | 3300014326 | Bacteria | 22279 |
| 264 | Ga0157380_10004722 | 3300014326 | Bacteria | 9482 |
| 265 | Ga0157380_10069047 | 3300014326 | Bacteria | 2850 |
| 266 | Ga0157380_10144834 | 3300014326 | Bacteria | 2046 |
| 267 | Ga0157377_10023666 | 3300014745 | Bacteria | 3259 |
| 268 | Ga0157377_10035244 | 3300014745 | Bacteria | 2744 |
| 269 | Ga0157379_10040132 | 3300014968 | Bacteria | 4177 |
| 270 | Ga0157376_10433754 | 3300014969 | Bacteria | 1278 |
| 271 | Ga0157376_10721345 | 3300014969 | Bacteria | 1004 |
| 272 | Ga0163161_10001886 | 3300017792 | Bacteria | 15293 |
| 273 | Ga0163161_10066742 | 3300017792 | Bacteria | 2627 |
| 274 | Ga0163161_10210792 | 3300017792 | Bacteria | 1501 |
| 275 | Ga0163161_10310074 | 3300017792 | Bacteria | 1245 |
| 276 | Ga0206351_10585983 | 3300020077 | Bacteria | 1404 |
| 277 | Ga0213876_10232144 | 3300021384 | Bacteria | 981 |
| 278 | Ga0213875_10032182 | 3300021388 | Bacteria | 2479 |
| 279 | Ga0224712_10004555 | 3300022467 | Bacteria | 3752 |
| 280 | Ga0209436_100440 | 3300025208 | Bacteria | 18624 |
| 281 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 282 | Ga0209646_1000005 | 3300025246 | Bacteria | 717627 |
| 283 | Ga0209646_1000041 | 3300025246 | Bacteria | 346024 |
| 284 | Ga0209026_1000169 | 3300025250 | Bacteria | 100088 |
| 285 | Ga0209148_1000089 | 3300025254 | Bacteria | 253548 |
| 286 | Ga0209673_1000049 | 3300025273 | Bacteria | 286207 |
| 287 | Ga0209130_1001814 | 3300025284 | Bacteria | 12415 |
| 288 | Ga0209564_1011681 | 3300025295 | Bacteria | 3908 |
| 289 | Ga0209758_1000346 | 3300025297 | Bacteria | 84821 |
| 290 | Ga0209758_1023829 | 3300025297 | Bacteria | 2751 |
| 291 | Ga0209758_1029351 | 3300025297 | Bacteria | 2302 |
| 292 | Ga0209050_1000272 | 3300025298 | Bacteria | 110636 |
| 293 | Ga0207426_1000233 | 3300025302 | Bacteria | 127848 |
| 294 | Ga0207426_1000381 | 3300025302 | Bacteria | 76038 |
| 295 | Ga0207426_1001311 | 3300025302 | Bacteria | 21230 |
| 296 | Ga0209051_1000807 | 3300025303 | Bacteria | 32813 |
| 297 | Ga0209051_1000884 | 3300025303 | Bacteria | 30128 |
| 298 | Ga0209051_1001910 | 3300025303 | Bacteria | 16205 |
| 299 | Ga0209051_1013992 | 3300025303 | Bacteria | 3775 |
| 300 | Ga0209051_1024837 | 3300025303 | Bacteria | 2455 |
| 301 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 302 | Ga0209257_1001525 | 3300025304 | Bacteria | 27049 |
| 303 | Ga0207653_10026046 | 3300025885 | Bacteria | 1873 |
| 304 | Ga0207692_10002339 | 3300025898 | Bacteria | 7275 |
| 305 | Ga0207692_10025260 | 3300025898 | Bacteria | 2772 |
| 306 | Ga0207642_10004559 | 3300025899 | Bacteria | 4474 |
| 307 | Ga0207710_10000006 | 3300025900 | Bacteria | 538831 |
| 308 | Ga0207710_10020197 | 3300025900 | Bacteria | 2847 |
| 309 | Ga0207710_10035899 | 3300025900 | Bacteria | 2183 |
| 310 | Ga0207710_10053271 | 3300025900 | Bacteria | 1820 |
| 311 | Ga0207710_10095729 | 3300025900 | Bacteria | 1395 |
| 312 | Ga0207688_10000313 | 3300025901 | Bacteria | 22327 |
| 313 | Ga0207688_10002177 | 3300025901 | Bacteria | 10553 |
| 314 | Ga0207680_10032508 | 3300025903 | Bacteria | 2966 |
| 315 | Ga0207647_10024977 | 3300025904 | Bacteria | 3934 |
| 316 | Ga0207685_10008972 | 3300025905 | Bacteria | 2882 |
| 317 | Ga0207699_10002972 | 3300025906 | Bacteria | 8061 |
| 318 | Ga0207699_10180791 | 3300025906 | Bacteria | 1418 |
| 319 | Ga0207645_10036984 | 3300025907 | Bacteria | 3134 |
| 320 | Ga0207705_10000934 | 3300025909 | Bacteria | 23858 |
| 321 | Ga0207705_10009390 | 3300025909 | Bacteria | 7111 |
| 322 | Ga0207654_10037773 | 3300025911 | Bacteria | 2705 |
| 323 | Ga0207695_10000009 | 3300025913 | Bacteria | 1034276 |
| 324 | Ga0207671_10000003 | 3300025914 | Bacteria | 1065461 |
| 325 | Ga0207671_10016681 | 3300025914 | Bacteria | 5700 |
| 326 | Ga0207671_10038019 | 3300025914 | Bacteria | 3568 |
| 327 | Ga0207671_10127161 | 3300025914 | Bacteria | 1953 |
| 328 | Ga0207693_10001545 | 3300025915 | Bacteria | 20341 |
| 329 | Ga0207693_10005615 | 3300025915 | Bacteria | 10430 |
| 330 | Ga0207693_10278334 | 3300025915 | Bacteria | 1311 |
| 331 | Ga0207663_10005432 | 3300025916 | Bacteria | 6419 |
| 332 | Ga0207663_10020877 | 3300025916 | Bacteria | 3717 |
| 333 | Ga0207660_10062382 | 3300025917 | Bacteria | 2685 |
| 334 | Ga0207660_10133331 | 3300025917 | Bacteria | 1893 |
| 335 | Ga0207660_10140232 | 3300025917 | Bacteria | 1848 |
| 336 | Ga0207657_10000296 | 3300025919 | Bacteria | 53043 |
| 337 | Ga0207657_10006095 | 3300025919 | Bacteria | 12537 |
| 338 | Ga0207657_10135891 | 3300025919 | Bacteria | 2012 |
| 339 | Ga0207657_10175395 | 3300025919 | Bacteria | 1735 |
| 340 | Ga0207652_10283537 | 3300025921 | Bacteria | 1494 |
| 341 | Ga0207681_10006042 | 3300025923 | Bacteria | 7427 |
| 342 | Ga0207681_10018534 | 3300025923 | Bacteria | 4386 |
| 343 | Ga0207681_10178094 | 3300025923 | Bacteria | 1617 |
| 344 | Ga0207694_10110938 | 3300025924 | Bacteria | 2182 |
| 345 | Ga0207659_10156875 | 3300025926 | Bacteria | 1783 |
| 346 | Ga0207687_10001949 | 3300025927 | Bacteria | 14199 |
| 347 | Ga0207664_10232658 | 3300025929 | Bacteria | 1602 |
| 348 | Ga0207644_10276552 | 3300025931 | Bacteria | 1347 |
| 349 | Ga0207690_10007615 | 3300025932 | Bacteria | 6423 |
| 350 | Ga0207690_10019135 | 3300025932 | Bacteria | 4209 |
| 351 | Ga0207690_10376038 | 3300025932 | Bacteria | 1128 |
| 352 | Ga0207706_10034196 | 3300025933 | Bacteria | 4522 |
| 353 | Ga0207706_10154063 | 3300025933 | Bacteria | 2022 |
| 354 | Ga0207686_10005130 | 3300025934 | Bacteria | 7039 |
| 355 | Ga0207709_10001364 | 3300025935 | Bacteria | 17148 |
| 356 | Ga0207709_10001848 | 3300025935 | Bacteria | 14102 |
| 357 | Ga0207709_10127649 | 3300025935 | Bacteria | 1728 |
| 358 | Ga0207709_10502277 | 3300025935 | Bacteria | 946 |
| 359 | Ga0207670_10018652 | 3300025936 | Bacteria | 4224 |
| 360 | Ga0207669_10004474 | 3300025937 | Bacteria | 6159 |
| 361 | Ga0207669_10054775 | 3300025937 | Bacteria | 2411 |
| 362 | Ga0207704_10000673 | 3300025938 | Bacteria | 15118 |
| 363 | Ga0207704_10395969 | 3300025938 | Bacteria | 1088 |
| 364 | Ga0207665_10000142 | 3300025939 | Bacteria | 48305 |
| 365 | Ga0207665_10001800 | 3300025939 | Bacteria | 14438 |
| 366 | Ga0207691_10012555 | 3300025940 | Bacteria | 8120 |
| 367 | Ga0207711_10000269 | 3300025941 | Bacteria | 56180 |
| 368 | Ga0207711_10083596 | 3300025941 | Bacteria | 2793 |
| 369 | Ga0207711_10202498 | 3300025941 | Bacteria | 1812 |
| 370 | Ga0207711_10466800 | 3300025941 | Bacteria | 1175 |
| 371 | Ga0207689_10019613 | 3300025942 | Bacteria | 5699 |
| 372 | Ga0207689_10021202 | 3300025942 | Bacteria | 5462 |
| 373 | Ga0207689_10039105 | 3300025942 | Bacteria | 3928 |
| 374 | Ga0207661_10015302 | 3300025944 | Bacteria | 5642 |
| 375 | Ga0207661_10016982 | 3300025944 | Bacteria | 5376 |
| 376 | Ga0207661_10469370 | 3300025944 | Bacteria | 1148 |
| 377 | Ga0207661_10480087 | 3300025944 | Bacteria | 1135 |
| 378 | Ga0207679_10061833 | 3300025945 | Bacteria | 2789 |
| 379 | Ga0207679_10233631 | 3300025945 | Bacteria | 1554 |
| 380 | Ga0207712_10000036 | 3300025961 | Bacteria | 198586 |
| 381 | Ga0207712_10006069 | 3300025961 | Bacteria | 7625 |
| 382 | Ga0207712_10139732 | 3300025961 | Bacteria | 1857 |
| 383 | Ga0207668_10001315 | 3300025972 | Bacteria | 14758 |
| 384 | Ga0207668_10020654 | 3300025972 | Bacteria | 4189 |
| 385 | Ga0207668_10072425 | 3300025972 | Bacteria | 2465 |
| 386 | Ga0207640_10219956 | 3300025981 | Bacteria | 1453 |
| 387 | Ga0207658_10000060 | 3300025986 | Bacteria | 119956 |
| 388 | Ga0207658_10010136 | 3300025986 | Bacteria | 6403 |
| 389 | Ga0207658_10299112 | 3300025986 | Bacteria | 1386 |
| 390 | Ga0207677_10003046 | 3300026023 | Bacteria | 8863 |
| 391 | Ga0207703_10016131 | 3300026035 | Bacteria | 5824 |
| 392 | Ga0207703_10161908 | 3300026035 | Bacteria | 1960 |
| 393 | Ga0207703_10269055 | 3300026035 | Bacteria | 1543 |
| 394 | Ga0207703_10374281 | 3300026035 | Bacteria | 1316 |
| 395 | Ga0207639_10189777 | 3300026041 | Bacteria | 1754 |
| 396 | Ga0207678_10019583 | 3300026067 | Bacteria | 5948 |
| 397 | Ga0207678_10021554 | 3300026067 | Bacteria | 5651 |
| 398 | Ga0207678_10054346 | 3300026067 | Bacteria | 3449 |
| 399 | Ga0207678_10071723 | 3300026067 | Bacteria | 2969 |
| 400 | Ga0207708_10011837 | 3300026075 | Bacteria | 6496 |
| 401 | Ga0207708_10025429 | 3300026075 | Bacteria | 4478 |
| 402 | Ga0207708_10040442 | 3300026075 | Bacteria | 3555 |
| 403 | Ga0207702_10000097 | 3300026078 | Bacteria | 101497 |
| 404 | Ga0207641_10000302 | 3300026088 | Bacteria | 61385 |
| 405 | Ga0207641_10034256 | 3300026088 | Bacteria | 4223 |
| 406 | Ga0207648_10000979 | 3300026089 | Bacteria | 32219 |
| 407 | Ga0207648_10011185 | 3300026089 | Bacteria | 8463 |
| 408 | Ga0207648_10088431 | 3300026089 | Bacteria | 2705 |
| 409 | Ga0207648_10169180 | 3300026089 | Bacteria | 1931 |
| 410 | Ga0207676_10265474 | 3300026095 | Bacteria | 1552 |
| 411 | Ga0207674_10127799 | 3300026116 | Bacteria | 2506 |
| 412 | Ga0207675_100001993 | 3300026118 | Bacteria | 20366 |
| 413 | Ga0207675_100007416 | 3300026118 | Bacteria | 10364 |
| 414 | Ga0207675_100196209 | 3300026118 | Bacteria | 1938 |
| 415 | Ga0207675_100224355 | 3300026118 | Bacteria | 1811 |
| 416 | Ga0207683_10000334 | 3300026121 | Bacteria | 42872 |
| 417 | Ga0207683_10024839 | 3300026121 | Bacteria | 5163 |
| 418 | Ga0207698_10000072 | 3300026142 | Bacteria | 67649 |
| 419 | Ga0207698_10070853 | 3300026142 | Bacteria | 2764 |
| 420 | Ga0207698_10136079 | 3300026142 | Bacteria | 2108 |
| 421 | Ga0207698_10297577 | 3300026142 | Bacteria | 1501 |
| 422 | Ga0268266_10009911 | 3300028379 | Bacteria | 8370 |
| 423 | Ga0268266_10055011 | 3300028379 | Bacteria | 3420 |
| 424 | Ga0268266_10486737 | 3300028379 | Bacteria | 1177 |
| 425 | Ga0268265_10000038 | 3300028380 | Bacteria | 198640 |
| 426 | Ga0268265_10025828 | 3300028380 | Bacteria | 4174 |
| 427 | Ga0268265_10232811 | 3300028380 | Bacteria | 1620 |
| 428 | Ga0268264_10000056 | 3300028381 | Bacteria | 310339 |
| 429 | Ga0268264_10000280 | 3300028381 | Bacteria | 86361 |
| 430 | Ga0268264_10012887 | 3300028381 | Bacteria | 6877 |
| 431 | Ga0268264_10145565 | 3300028381 | Bacteria | 2118 |
| 432 | Ga0265334_10042138 | 3300028573 | Bacteria | 1781 |
| 433 | Ga0314311_1127295 | 3300030733 | Bacteria | 1086 |
| 434 | Ga0316183_1077323 | 3300030742 | Bacteria | 10817 |
| 435 | Ga0316182_1395692 | 3300030745 | Bacteria | 2333 |
| 436 | Ga0265325_10032299 | 3300031241 | Bacteria | 2795 |
| 437 | Ga0265327_10000358 | 3300031251 | Bacteria | 86964 |
| 438 | Ga0307509_10041006 | 3300031507 | Bacteria | 5030 |
| 439 | Ga0316575_10000545 | 3300031665 | Bacteria | 11057 |
| 440 | Ga0316576_10010593 | 3300031727 | Bacteria | 6000 |
| 441 | Ga0316578_10065381 | 3300031728 | Bacteria | 2147 |
| 442 | Ga0316578_10080776 | 3300031728 | Bacteria | 1934 |
| 443 | Ga0307516_10048220 | 3300031730 | Unclassified | 4192 |
| 444 | Ga0307413_10188979 | 3300031824 | Bacteria | 1477 |
| 445 | Ga0307410_10168074 | 3300031852 | Bacteria | 1650 |
| 446 | Ga0307406_10092427 | 3300031901 | Bacteria | 2040 |
| 447 | Ga0307406_10371703 | 3300031901 | Bacteria | 1124 |
| 448 | Ga0307412_10216045 | 3300031911 | Bacteria | 1467 |
| 449 | Ga0307409_100070227 | 3300031995 | Bacteria | 2779 |
| 450 | Ga0307409_100086893 | 3300031995 | Bacteria | 2547 |
| 451 | Ga0307409_100315286 | 3300031995 | Bacteria | 1461 |
| 452 | Ga0307409_100378253 | 3300031995 | Bacteria | 1345 |
| 453 | Ga0307409_100530650 | 3300031995 | Bacteria | 1152 |
| 454 | Ga0307416_100284935 | 3300032002 | Bacteria | 1632 |
| 455 | Ga0307414_10397765 | 3300032004 | Bacteria | 1196 |
| 456 | Ga0307414_10646801 | 3300032004 | Bacteria | 953 |
| 457 | Ga0373959_0000224 | 3300034820 | Bacteria | 12394 |
| 458 | Ga0373928_0008874 | 3300035084 | Bacteria | 1960 |
| 459 | Ga0373939_0009652 | 3300035114 | Bacteria | 2398 |
| 460 | Ga0373941_0016813 | 3300035115 | Bacteria | 1995 |
| 461 | Ga0373960_0040098 | 3300035121 | Bacteria | 1350 |
| 462 | Ga0373943_0180749 | 3300035170 | Bacteria | 1159 |
| 463 | Ga0316574_0019163 | 3300035398 | Bacteria | 4034 |
| 464 | Ga0316574_0180511 | 3300035398 | Bacteria | 1358 |
| 465 | Ga0373931_0112383 | 3300035691 | Bacteria | 1547 |
| 466 | Ga0373931_0146781 | 3300035691 | Bacteria | 1372 |
| 467 | Ga0373933_0062717 | 3300035724 | Bacteria | 2246 |
| 468 | Ga0316584_0008378 | 3300036712 | Bacteria | 7122 |
| 469 | Ga0316584_0043583 | 3300036712 | Bacteria | 3346 |
| 470 | Ga0373925_0318038 | 3300037068 | Bacteria | 1259 |
| 471 | Ga0373925_0359321 | 3300037068 | Bacteria | 1184 |
| 472 | Ga0395899_0251107 | 3300037312 | Bacteria | 1214 |
| 473 | Ga0395898_0059405 | 3300037466 | Bacteria | 3720 |
| 474 | Ga0395898_0474252 | 3300037466 | Bacteria | 1191 |
| 475 | Ga0436364_0095068 | 3300037853 | Bacteria | 2355 |
| 476 | Ga0436364_0151759 | 3300037853 | Bacteria | 4832 |
| 477 | Ga0436364_0727309 | 3300037853 | Bacteria | 1640 |
| 478 | Ga0395901_0488453 | 3300038443 | Bacteria | 1255 |
| 479 | Ga0400485_08773 | 3300038735 | Bacteria | 119523 |
| 480 | Ga0400486_28732 | 3300038742 | Bacteria | 31623 |
| 481 | Ga0436365_0943842 | 3300039437 | Bacteria | 40181 |
| 482 | Ga0436365_1146896 | 3300039437 | Bacteria | 7362 |
| 483 | Ga0436365_1195958 | 3300039437 | Bacteria | 52983 |
| 484 | Ga0436360_0313352 | 3300039438 | Bacteria | 1875 |
| 485 | Ga0436363_0708325 | 3300039450 | Bacteria | 1520 |
| 486 | Ga0439436_0028907 | 3300041404 | Bacteria | 1616 |
| 487 | Ga0439461_0009888 | 3300041410 | Bacteria | 1739 |
| 488 | Ga0439466_0003018 | 3300041411 | Bacteria | 6563 |
| 489 | Ga0439466_0029723 | 3300041411 | Bacteria | 1878 |
| 490 | Ga0439466_0067199 | 3300041411 | Bacteria | 1147 |
| 491 | Ga0439465_0012327 | 3300041413 | Bacteria | 2675 |
| 492 | Ga0439465_0024211 | 3300041413 | Bacteria | 1913 |
| 493 | Ga0451793_0173016 | 3300041452 | Bacteria | 2098 |
| 494 | Ga0451793_1579998 | 3300041452 | Bacteria | 2119 |
| 495 | Ga0451795_0931545 | 3300041456 | Bacteria | 1055 |
| 496 | Ga0451795_1444608 | 3300041456 | Bacteria | 1443 |
| 497 | Ga0451833_0141528 | 3300041491 | Bacteria | 9582 |
| 498 | Ga0451837_1576909 | 3300041494 | Bacteria | 9671 |
| 499 | Ga0451839_0447997 | 3300041496 | Bacteria | 2628 |
| 500 | Ga0451853_0331732 | 3300041512 | Bacteria | 1075 |
| 501 | Ga0439431_0004979 | 3300041997 | Bacteria | 2928 |
| 502 | Ga0439431_0005227 | 3300041997 | Bacteria | 2861 |
| 503 | Ga0439445_0022142 | 3300042004 | Bacteria | 1601 |
| 504 | Ga0439445_0040731 | 3300042004 | Bacteria | 1233 |
| 505 | Ga0439445_0048936 | 3300042004 | Bacteria | 1138 |
| 506 | Ga0439432_016023 | 3300042006 | Bacteria | 2526 |
| 507 | Ga0439449_0051482 | 3300042007 | Bacteria | 1523 |
| 508 | Ga0439462_0002959 | 3300042015 | Bacteria | 4025 |
| 509 | Ga0439434_0006786 | 3300042435 | Bacteria | 3346 |
| 510 | Ga0439435_0020244 | 3300042436 | Bacteria | 1714 |
| 511 | Ga0439459_0004714 | 3300042438 | Bacteria | 2207 |
| 512 | Ga0439464_0015223 | 3300042439 | Bacteria | 2074 |
| 513 | Ga0466969_0047400 | 3300044656 | Bacteria | 2127 |
| 514 | Ga0466972_0010647 | 3300044658 | Bacteria | 4614 |
| 515 | Ga0466965_0004966 | 3300044683 | Bacteria | 5955 |
| 516 | Ga0466965_0028692 | 3300044683 | Bacteria | 2704 |
| 517 | Ga0466966_0003202 | 3300044684 | Bacteria | 10782 |
| 518 | Ga0466966_0008774 | 3300044684 | Bacteria | 6693 |
| 519 | Ga0466966_0210798 | 3300044684 | Bacteria | 1174 |
| 520 | Ga0466961_0011812 | 3300044693 | Bacteria | 5582 |
| 521 | Ga0466961_0118588 | 3300044693 | Bacteria | 1662 |
| 522 | Ga0466963_0023012 | 3300044694 | Bacteria | 3952 |
| 523 | Ga0466963_0029095 | 3300044694 | Bacteria | 3553 |
| 524 | Ga0466963_0063926 | 3300044694 | Bacteria | 2464 |
| 525 | Ga0466963_0145423 | 3300044694 | Bacteria | 1644 |
| 526 | Ga0466964_0101930 | 3300044706 | Bacteria | 1267 |
| 527 | Ga0466964_0201484 | 3300044706 | Bacteria | 956 |
| 528 | Ga0466971_0012179 | 3300044719 | Bacteria | 3769 |
| 529 | Ga0466971_0035503 | 3300044719 | Bacteria | 2235 |
| 530 | Ga0466971_0212633 | 3300044719 | Bacteria | 915 |
| 531 | Ga0466968_0019675 | 3300044735 | Bacteria | 2719 |
| 532 | Ga0466970_0003938 | 3300044765 | Bacteria | 7278 |
| 533 | Ga0466970_0035340 | 3300044765 | Bacteria | 2647 |
| 534 | Ga0466970_0256475 | 3300044765 | Bacteria | 980 |
| 535 | Ga0466957_0000745 | 3300044842 | Bacteria | 16607 |
| 536 | Ga0466957_0031958 | 3300044842 | Bacteria | 3149 |
| 537 | Ga0466957_0094215 | 3300044842 | Bacteria | 1880 |
| 538 | Ga0466957_0104329 | 3300044842 | Bacteria | 1791 |
| 539 | Ga0466957_0107062 | 3300044842 | Bacteria | 1769 |
| 540 | Ga0466960_0000676 | 3300044901 | Bacteria | 11820 |
| 541 | Ga0466960_0001163 | 3300044901 | Bacteria | 9454 |
| 542 | Ga0466960_0008943 | 3300044901 | Bacteria | 4116 |
| 543 | Ga0466960_0032258 | 3300044901 | Bacteria | 2424 |
| 544 | Ga0466960_0107507 | 3300044901 | Bacteria | 1445 |
| 545 | Ga0466959_0004991 | 3300045049 | Bacteria | 9002 |
| 546 | Ga0466959_0007534 | 3300045049 | Bacteria | 7646 |
| 547 | Ga0466959_0085638 | 3300045049 | Bacteria | 2267 |
| 548 | Ga0451576_0002303 | 3300045051 | Bacteria | 28951 |
| 549 | Ga0466958_0025398 | 3300045836 | Bacteria | 3493 |
| 550 | Ga0466958_0025883 | 3300045836 | Bacteria | 3463 |
| 551 | Ga0466958_0065693 | 3300045836 | Bacteria | 2214 |
| 552 | Ga0466958_0151001 | 3300045836 | Bacteria | 1465 |
| 553 | Ga0466958_0218448 | 3300045836 | Bacteria | 1216 |
| 554 | Ga0466967_0004929 | 3300045976 | Bacteria | 9126 |
| 555 | Ga0466967_0005712 | 3300045976 | Bacteria | 8676 |
| 556 | Ga0466967_0025571 | 3300045976 | Bacteria | 4871 |
| 557 | Ga0466967_0096497 | 3300045976 | Bacteria | 2697 |
| 558 | Ga0466967_0109818 | 3300045976 | Bacteria | 2532 |
| 559 | Ga0466967_0113905 | 3300045976 | Bacteria | 2489 |
| 560 | Ga0466967_0119347 | 3300045976 | Bacteria | 2434 |
| 561 | Ga0466967_0364234 | 3300045976 | Bacteria | 1401 |
| 562 | Ga0466967_0800520 | 3300045976 | Bacteria | 936 |
| 563 | Ga0495627_030337 | 3300046453 | Bacteria | 1714 |
| 564 | Ga0495629_0013527 | 3300046459 | Bacteria | 5887 |
| 565 | Ga0495629_0035066 | 3300046459 | Bacteria | 3547 |
| 566 | Ga0495638_0000247 | 3300046460 | Bacteria | 73629 |
| 567 | Ga0495638_0032134 | 3300046460 | Bacteria | 3367 |
| 568 | Ga0495582_0070277 | 3300046473 | Bacteria | 1936 |
| 569 | Ga0495639_0135663 | 3300046475 | Bacteria | 1181 |
| 570 | Ga0495639_0221976 | 3300046475 | Bacteria | 929 |
| 571 | Ga0495662_0002485 | 3300046476 | Bacteria | 9287 |
| 572 | Ga0495664_0026240 | 3300046477 | Bacteria | 3394 |
| 573 | Ga0495594_0041725 | 3300046499 | Bacteria | 2512 |
| 574 | Ga0495606_0013640 | 3300046507 | Bacteria | 6406 |
| 575 | Ga0495648_0014127 | 3300046524 | Bacteria | 5863 |
| 576 | Ga0495648_0166034 | 3300046524 | Bacteria | 1136 |
| 577 | Ga0495652_0124456 | 3300046529 | Bacteria | 2051 |
| 578 | Ga0495645_0034496 | 3300046543 | Bacteria | 3691 |
| 579 | Ga0495633_0000025 | 3300046558 | Bacteria | 218627 |
| 580 | Ga0495668_0000167 | 3300046616 | Bacteria | 97427 |
| 581 | Ga0495634_0150728 | 3300046642 | Bacteria | 1471 |
| 582 | Ga0495625_0211361 | 3300046660 | Bacteria | 1275 |
| 583 | Ga0495658_0320962 | 3300046683 | Bacteria | 982 |
| 584 | Ga0495649_0180330 | 3300046694 | Bacteria | 1102 |
| 585 | Ga0495581_0186004 | 3300047315 | Bacteria | 1215 |
| 586 | Ga0495674_0069030 | 3300047319 | Bacteria | 3057 |
| 587 | Ga0495672_0003415 | 3300047320 | Bacteria | 13616 |
| 588 | Ga0495672_0005726 | 3300047320 | Bacteria | 9783 |
| 589 | Ga0495672_0026705 | 3300047320 | Bacteria | 3680 |
| 590 | Ga0495673_0003856 | 3300047469 | Bacteria | 9670 |
| 591 | Ga0495686_0003681 | 3300047472 | Bacteria | 13101 |
| 592 | Ga0495593_0008905 | 3300047673 | Bacteria | 5825 |
| 593 | Ga0495593_0048945 | 3300047673 | Bacteria | 2245 |
| 594 | Ga0496100_0000527 | 3300048903 | Bacteria | 18269 |
| 595 | Ga0496100_0004078 | 3300048903 | Bacteria | 7704 |
| 596 | Ga0496100_0006138 | 3300048903 | Bacteria | 6537 |
| 597 | Ga0496100_0044083 | 3300048903 | Bacteria | 2855 |
| 598 | Ga0496100_0158209 | 3300048903 | Bacteria | 1622 |
| 599 | Ga0496101_0000002 | 3300048904 | Bacteria | 410971 |
| 600 | Ga0496101_0000619 | 3300048904 | Bacteria | 21671 |
| 601 | Ga0496101_0000765 | 3300048904 | Bacteria | 19052 |
| 602 | Ga0496101_0010167 | 3300048904 | Bacteria | 6209 |
| 603 | Ga0496101_0013978 | 3300048904 | Bacteria | 5391 |
| 604 | Ga0496101_0097595 | 3300048904 | Bacteria | 2195 |
| 605 | Ga0496102_0000009 | 3300048905 | Bacteria | 344149 |
| 606 | Ga0496102_0000973 | 3300048905 | Bacteria | 26960 |
| 607 | Ga0496102_0001870 | 3300048905 | Bacteria | 18137 |
| 608 | Ga0496102_0056618 | 3300048905 | Bacteria | 3577 |
| 609 | Ga0496102_0076687 | 3300048905 | Bacteria | 3075 |
| 610 | Ga0496102_0287897 | 3300048905 | Bacteria | 1548 |
| 611 | Ga0496103_0000005 | 3300048906 | Bacteria | 505416 |
| 612 | Ga0496103_0000902 | 3300048906 | Bacteria | 21303 |
| 613 | Ga0496103_0004390 | 3300048906 | Bacteria | 8556 |
| 614 | Ga0496104_0055723 | 3300048907 | Bacteria | 3738 |
| 615 | Ga0496104_0162034 | 3300048907 | Bacteria | 2145 |
| 616 | Ga0496104_0656832 | 3300048907 | Bacteria | 957 |
| 617 | Ga0496105_0003833 | 3300048908 | Bacteria | 11219 |
| 618 | Ga0496105_0090349 | 3300048908 | Bacteria | 2530 |
| 619 | Ga0496105_0156982 | 3300048908 | Bacteria | 1868 |
| 620 | Ga0496106_0010701 | 3300048909 | Bacteria | 6780 |
| 621 | Ga0496106_0036460 | 3300048909 | Bacteria | 3679 |
| 622 | Ga0496106_0093974 | 3300048909 | Bacteria | 2318 |
| 623 | Ga0496106_0338540 | 3300048909 | Bacteria | 1208 |
| 624 | Ga0496107_0010484 | 3300048910 | Bacteria | 6442 |
| 625 | Ga0496107_0110606 | 3300048910 | Bacteria | 2019 |
| 626 | Ga0496108_0004412 | 3300048911 | Bacteria | 11322 |
| 627 | Ga0496108_0005920 | 3300048911 | Bacteria | 9908 |
| 628 | Ga0496108_0169501 | 3300048911 | Bacteria | 1889 |
| 629 | Ga0496108_0285505 | 3300048911 | Bacteria | 1437 |
| 630 | Ga0496108_0791721 | 3300048911 | Bacteria | 818 |
| 631 | Ga0496109_0000747 | 3300048912 | Bacteria | 27044 |
| 632 | Ga0496109_0041880 | 3300048912 | Bacteria | 4148 |
| 633 | Ga0496109_0098003 | 3300048912 | Bacteria | 2718 |
| 634 | Ga0496109_0140259 | 3300048912 | Bacteria | 2260 |
| 635 | Ga0496109_0266160 | 3300048912 | Bacteria | 1615 |
| 636 | Ga0496109_0533224 | 3300048912 | Bacteria | 1108 |
| 637 | Ga0496110_0498686 | 3300048913 | Bacteria | 1109 |
| 638 | Ga0496111_0010684 | 3300048914 | Bacteria | 6175 |
| 639 | Ga0496111_0015233 | 3300048914 | Bacteria | 5272 |
| 640 | Ga0496111_0168775 | 3300048914 | Bacteria | 1626 |
| 641 | Ga0496112_0001525 | 3300048915 | Bacteria | 17850 |
| 642 | Ga0496112_0009325 | 3300048915 | Bacteria | 8832 |
| 643 | Ga0496112_0095459 | 3300048915 | Bacteria | 2944 |
| 644 | Ga0496112_0712779 | 3300048915 | Bacteria | 931 |
| 645 | Ga0496113_0068329 | 3300048916 | Bacteria | 2696 |
| 646 | Ga0496114_0000681 | 3300048917 | Bacteria | 25219 |
| 647 | Ga0496114_0004256 | 3300048917 | Bacteria | 11087 |
| 648 | Ga0496114_0014448 | 3300048917 | Bacteria | 6341 |
| 649 | Ga0496114_0022813 | 3300048917 | Bacteria | 5101 |
| 650 | Ga0496114_0091880 | 3300048917 | Bacteria | 2578 |
| 651 | Ga0496114_0100517 | 3300048917 | Bacteria | 2468 |
| 652 | Ga0496114_0124023 | 3300048917 | Bacteria | 2224 |
| 653 | Ga0496114_0213249 | 3300048917 | Bacteria | 1694 |
| 654 | Ga0496114_0244900 | 3300048917 | Bacteria | 1577 |
| 655 | Ga0496114_0268628 | 3300048917 | Bacteria | 1503 |
| 656 | Ga0496114_0313434 | 3300048917 | Bacteria | 1386 |
| 657 | Ga0496114_0574702 | 3300048917 | Bacteria | 995 |
| 658 | Ga0496115_0009071 | 3300048918 | Bacteria | 7379 |
| 659 | Ga0496115_0020330 | 3300048918 | Bacteria | 5121 |
| 660 | Ga0496116_0000104 | 3300048919 | Bacteria | 193416 |
| 661 | Ga0496116_0016923 | 3300048919 | Bacteria | 5684 |
| 662 | Ga0496117_0000019 | 3300048920 | Bacteria | 469256 |
| 663 | Ga0496117_0000028 | 3300048920 | Bacteria | 407392 |
| 664 | Ga0496117_0000497 | 3300048920 | Bacteria | 64914 |
| 665 | Ga0496117_0002095 | 3300048920 | Bacteria | 26250 |
| 666 | Ga0496117_0031541 | 3300048920 | Bacteria | 4042 |
| 667 | Ga0496118_0000020 | 3300048921 | Bacteria | 470521 |
| 668 | Ga0496118_0000255 | 3300048921 | Bacteria | 94123 |
| 669 | Ga0496118_0002066 | 3300048921 | Bacteria | 28281 |
| 670 | Ga0496118_0037919 | 3300048921 | Bacteria | 3870 |
| 671 | Ga0496118_0040589 | 3300048921 | Bacteria | 3698 |
| 672 | Ga0496118_0131553 | 3300048921 | Bacteria | 1606 |
| 673 | Ga0496119_0001830 | 3300048922 | Bacteria | 24637 |
| 674 | Ga0496119_0004258 | 3300048922 | Bacteria | 14344 |
| 675 | Ga0496119_0018843 | 3300048922 | Bacteria | 5114 |
| 676 | Ga0496119_0028338 | 3300048922 | Bacteria | 3823 |
| 677 | Ga0496120_0001838 | 3300048923 | Bacteria | 23651 |
| 678 | Ga0496120_0029385 | 3300048923 | Bacteria | 3356 |
| 679 | Ga0496120_0046233 | 3300048923 | Bacteria | 2516 |
| 680 | Ga0496120_0081021 | 3300048923 | Bacteria | 1757 |
| 681 | Ga0496121_0001252 | 3300048924 | Bacteria | 44016 |
| 682 | Ga0496121_0007909 | 3300048924 | Bacteria | 12719 |
| 683 | Ga0496122_0000522 | 3300048925 | Bacteria | 79377 |
| 684 | Ga0496122_0000534 | 3300048925 | Bacteria | 78704 |
| 685 | Ga0496122_0000877 | 3300048925 | Bacteria | 56353 |
| 686 | Ga0496122_0001012 | 3300048925 | Bacteria | 49765 |
| 687 | Ga0496122_0003004 | 3300048925 | Bacteria | 22932 |
| 688 | Ga0496122_0020806 | 3300048925 | Bacteria | 5905 |
| 689 | Ga0496122_0048687 | 3300048925 | Bacteria | 3255 |
| 690 | Ga0496123_0000142 | 3300048926 | Bacteria | 146932 |
| 691 | Ga0496123_0000251 | 3300048926 | Bacteria | 108664 |
| 692 | Ga0496123_0001800 | 3300048926 | Bacteria | 28215 |
| 693 | Ga0496123_0009604 | 3300048926 | Bacteria | 8686 |
| 694 | Ga0496124_0000420 | 3300048927 | Bacteria | 75761 |
| 695 | Ga0496124_0001505 | 3300048927 | Bacteria | 34041 |
| 696 | Ga0496124_0002708 | 3300048927 | Bacteria | 22632 |
| 697 | Ga0496124_0095728 | 3300048927 | Bacteria | 2413 |
| 698 | Ga0496125_0000085 | 3300048928 | Bacteria | 218570 |
| 699 | Ga0496125_0000214 | 3300048928 | Bacteria | 118625 |
| 700 | Ga0496125_0000857 | 3300048928 | Bacteria | 48805 |
| 701 | Ga0496125_0002891 | 3300048928 | Bacteria | 21636 |
| 702 | Ga0496125_0004133 | 3300048928 | Bacteria | 16948 |
| 703 | Ga0496125_0006476 | 3300048928 | Bacteria | 12648 |
| 704 | Ga0496125_0011614 | 3300048928 | Bacteria | 8797 |
| 705 | Ga0496125_0245183 | 3300048928 | Bacteria | 1134 |
| 706 | Ga0496126_0000931 | 3300048929 | Bacteria | 50490 |
| 707 | Ga0496126_0002688 | 3300048929 | Bacteria | 23495 |
| 708 | Ga0496126_0008151 | 3300048929 | Bacteria | 11340 |
| 709 | Ga0496126_0010295 | 3300048929 | Bacteria | 9820 |
| 710 | Ga0496126_0012396 | 3300048929 | Bacteria | 8739 |
| 711 | Ga0496126_0014320 | 3300048929 | Bacteria | 8019 |
| 712 | Ga0496126_0023340 | 3300048929 | Bacteria | 5995 |
| 713 | Ga0496126_0023445 | 3300048929 | Bacteria | 5981 |
| 714 | Ga0496126_0029198 | 3300048929 | Bacteria | 5241 |
| 715 | Ga0496126_0047354 | 3300048929 | Bacteria | 3936 |
| 716 | Ga0496126_0052596 | 3300048929 | Bacteria | 3700 |
| 717 | Ga0496126_0062705 | 3300048929 | Bacteria | 3335 |
| 718 | Ga0496126_0068632 | 3300048929 | Bacteria | 3164 |
| 719 | Ga0501031_0010829 | 3300049568 | Bacteria | 5937 |
| 720 | Ga0501031_0029921 | 3300049568 | Bacteria | 3552 |
| 721 | Ga0501032_0007655 | 3300049569 | Bacteria | 7876 |
| 722 | Ga0501032_0042793 | 3300049569 | Bacteria | 3071 |
| 723 | Ga0501033_0055147 | 3300049570 | Bacteria | 2939 |
| 724 | Ga0501033_0062546 | 3300049570 | Bacteria | 2741 |
| 725 | Ga0501033_0140939 | 3300049570 | Bacteria | 1743 |
| 726 | Ga0501034_0002933 | 3300049571 | Bacteria | 19772 |
| 727 | Ga0501034_0007765 | 3300049571 | Bacteria | 11410 |
| 728 | Ga0501034_0018608 | 3300049571 | Bacteria | 7121 |
| 729 | Ga0501034_0028244 | 3300049571 | Bacteria | 5707 |
| 730 | Ga0501034_0052682 | 3300049571 | Bacteria | 4099 |
| 731 | Ga0501034_0131828 | 3300049571 | Bacteria | 2482 |
| 732 | Ga0501034_0307530 | 3300049571 | Bacteria | 1521 |
| 733 | Ga0501034_0430569 | 3300049571 | Bacteria | 1239 |
| 734 | Ga0501036_0018267 | 3300049572 | Bacteria | 5872 |
| 735 | Ga0501036_0029322 | 3300049572 | Bacteria | 4651 |
| 736 | Ga0501036_0125563 | 3300049572 | Bacteria | 2167 |
| 737 | Ga0501037_0036272 | 3300049573 | Bacteria | 3634 |
| 738 | Ga0501038_0021716 | 3300049574 | Bacteria | 5759 |
| 739 | Ga0501038_0371429 | 3300049574 | Bacteria | 1111 |
| 740 | Ga0501039_0450145 | 3300049575 | Bacteria | 1011 |
| 741 | Ga0501040_0005707 | 3300049576 | Bacteria | 8050 |
| 742 | Ga0501042_0019926 | 3300049578 | Bacteria | 4664 |
| 743 | Ga0501043_0070417 | 3300049579 | Bacteria | 2747 |
| 744 | Ga0501043_0220194 | 3300049579 | Bacteria | 1469 |
| 745 | Ga0501046_0003054 | 3300049580 | Bacteria | 15460 |
| 746 | Ga0501046_0083613 | 3300049580 | Bacteria | 2463 |
| 747 | Ga0501046_0278524 | 3300049580 | Bacteria | 1226 |
| 748 | Ga0501047_0004113 | 3300049581 | Bacteria | 13690 |
| 749 | Ga0501047_0010633 | 3300049581 | Bacteria | 8700 |
| 750 | Ga0501047_0013607 | 3300049581 | Bacteria | 7718 |
| 751 | Ga0501047_0024057 | 3300049581 | Bacteria | 5850 |
| 752 | Ga0501047_0046100 | 3300049581 | Bacteria | 4214 |
| 753 | Ga0501047_0152736 | 3300049581 | Bacteria | 2184 |
| 754 | Ga0501048_0042785 | 3300049582 | Bacteria | 3242 |
| 755 | Ga0501048_0050206 | 3300049582 | Bacteria | 2971 |
| 756 | Ga0501048_0073862 | 3300049582 | Bacteria | 2406 |
| 757 | Ga0501067_0131736 | 3300049583 | Bacteria | 1392 |
| 758 | Ga0501068_0096961 | 3300049584 | Bacteria | 1824 |
| 759 | Ga0501068_0166478 | 3300049584 | Bacteria | 1390 |
| 760 | Ga0501069_0037454 | 3300049585 | Bacteria | 2677 |
| 761 | Ga0501070_0022067 | 3300049586 | Bacteria | 5332 |
| 762 | Ga0501070_0088591 | 3300049586 | Bacteria | 2561 |
| 763 | Ga0501070_0149810 | 3300049586 | Bacteria | 1925 |
| 764 | Ga0501072_0020049 | 3300049588 | Bacteria | 5177 |
| 765 | Ga0501072_0252526 | 3300049588 | Bacteria | 1404 |
| 766 | Ga0501074_0081345 | 3300049590 | Bacteria | 2323 |
| 767 | Ga0501075_0102029 | 3300049591 | Bacteria | 2179 |
| 768 | Ga0501076_0059207 | 3300049592 | Bacteria | 3046 |
| 769 | Ga0501222_004336 | 3300049662 | Bacteria | 1926 |
| 770 | Ga0501238_004383 | 3300049671 | Bacteria | 1765 |
| 771 | Ga0501238_016412 | 3300049671 | Bacteria | 1027 |
| 772 | Ga0501242_000231 | 3300049674 | Bacteria | 4402 |
| 773 | Ga0501257_001564 | 3300049686 | Bacteria | 4774 |
| 774 | Ga0501259_006624 | 3300049688 | Bacteria | 1844 |
| 775 | Ga0501079_0155365 | 3300049741 | Bacteria | 1783 |
| 776 | Ga0501080_0046200 | 3300049742 | Bacteria | 4056 |
| 777 | Ga0501080_0326391 | 3300049742 | Bacteria | 1389 |
| 778 | Ga0501081_0101574 | 3300049743 | Bacteria | 2034 |
| 779 | Ga0501083_0004945 | 3300049744 | Bacteria | 9438 |
| 780 | Ga0501083_0035867 | 3300049744 | Bacteria | 3387 |
| 781 | Ga0501083_0036714 | 3300049744 | Bacteria | 3341 |
| 782 | Ga0501241_000961 | 3300049758 | Bacteria | 6100 |
| 783 | Ga0501241_002804 | 3300049758 | Bacteria | 3348 |
| 784 | Ga0501035_0000121 | 3300049822 | Bacteria | 94497 |
| 785 | Ga0501035_0005068 | 3300049822 | Bacteria | 12485 |
| 786 | Ga0501035_0006303 | 3300049822 | Bacteria | 11149 |
| 787 | Ga0501035_0083466 | 3300049822 | Bacteria | 2819 |
| 788 | Ga0501035_0105087 | 3300049822 | Bacteria | 2476 |
| 789 | Ga0501035_0492572 | 3300049822 | Bacteria | 1010 |
| 790 | Ga0501044_0001588 | 3300049823 | Bacteria | 26614 |
| 791 | Ga0501044_0007597 | 3300049823 | Bacteria | 11918 |
| 792 | Ga0501044_0042467 | 3300049823 | Bacteria | 4729 |
| 793 | Ga0501044_0254659 | 3300049823 | Bacteria | 1695 |
| 794 | Ga0501045_0031658 | 3300049824 | Bacteria | 3830 |
| 795 | nmdc:mga03683_104824_c1 | 3300050489 | Bacteria | 1245 |
| 796 | nmdc:mga03683_10497_c2 | 3300050489 | Bacteria | 2471 |
| 797 | nmdc:mga03683_105877_c1 | 3300050489 | Bacteria | 1239 |
| 798 | nmdc:mga03683_18147_c1 | 3300050489 | Bacteria | 2671 |
| 799 | nmdc:mga03683_19145_c1 | 3300050489 | Bacteria | 2610 |
| 800 | nmdc:mga03683_68955_c1 | 3300050489 | Bacteria | 1508 |
| 801 | nmdc:mga03n38_12463_c1 | 3300050490 | Bacteria | 3200 |
| 802 | nmdc:mga03n38_133606_c1 | 3300050490 | Bacteria | 1232 |
| 803 | nmdc:mga03n38_150962_c1 | 3300050490 | Bacteria | 1169 |
| 804 | nmdc:mga03n38_268483_c1 | 3300050490 | Bacteria | 907 |
| 805 | nmdc:mga03n38_3173_c1 | 3300050490 | Bacteria | 5241 |
| 806 | nmdc:mga03n38_3177_c1 | 3300050490 | Bacteria | 5235 |
| 807 | nmdc:mga03n38_345_c1 | 3300050490 | Bacteria | 11261 |
| 808 | nmdc:mga03n38_4741_c1 | 3300050490 | Bacteria | 4543 |
| 809 | nmdc:mga03n38_61508_c1 | 3300050490 | Bacteria | 1710 |
| 810 | nmdc:mga03n38_97935_c1 | 3300050490 | Bacteria | 1409 |
| 811 | nmdc:mga00v17_16536_c1 | 3300050491 | Bacteria | 4157 |
| 812 | nmdc:mga00v17_188252_c1 | 3300050491 | Bacteria | 1332 |
| 813 | nmdc:mga00v17_393798_c1 | 3300050491 | Bacteria | 900 |
| 814 | nmdc:mga00v17_42601_c1 | 3300050491 | Bacteria | 2731 |
| 815 | nmdc:mga00v17_45625_c1 | 3300050491 | Bacteria | 2649 |
| 816 | nmdc:mga00v17_6119_c1 | 3300050491 | Bacteria | 6372 |
| 817 | nmdc:mga00v17_81554_c1 | 3300050491 | Bacteria | 1667 |
| 818 | nmdc:mga00v17_96202_c1 | 3300050491 | Bacteria | 1865 |
| 819 | nmdc:mga0yw44_13779_c1 | 3300050492 | Bacteria | 4271 |
| 820 | nmdc:mga0yw44_157666_c1 | 3300050492 | Bacteria | 1484 |
| 821 | nmdc:mga0yw44_161384_c1 | 3300050492 | Bacteria | 1467 |
| 822 | nmdc:mga0yw44_17240_c1 | 3300050492 | Bacteria | 3925 |
| 823 | nmdc:mga0yw44_18395_c1 | 3300050492 | Bacteria | 3826 |
| 824 | nmdc:mga0yw44_24584_c1 | 3300050492 | Bacteria | 3411 |
| 825 | nmdc:mga0yw44_4417_c1 | 3300050492 | Bacteria | 6444 |
| 826 | nmdc:mga0yw44_455781_c1 | 3300050492 | Bacteria | 867 |
| 827 | nmdc:mga0yw44_51367_c1 | 3300050492 | Bacteria | 2496 |
| 828 | nmdc:mga0yw44_58089_c1 | 3300050492 | Bacteria | 2362 |
| 829 | nmdc:mga0yw44_5_c1 | 3300050492 | Bacteria | 313167 |
| 830 | nmdc:mga0k408_105717_c1 | 3300050493 | Bacteria | 1662 |
| 831 | nmdc:mga0k408_111139_c1 | 3300050493 | Bacteria | 1620 |
| 832 | nmdc:mga0k408_298318_c1 | 3300050493 | Bacteria | 962 |
| 833 | nmdc:mga06z11_175467_c1 | 3300050494 | Bacteria | 1233 |
| 834 | nmdc:mga06z11_226238_c1 | 3300050494 | Bacteria | 1095 |
| 835 | nmdc:mga06z11_52945_c1 | 3300050494 | Bacteria | 2085 |
| 836 | nmdc:mga04h51_4947_c1 | 3300050495 | Bacteria | 3358 |
| 837 | nmdc:mga04h51_67847_c1 | 3300050495 | Bacteria | 1238 |
| 838 | nmdc:mga07m45_116966_c1 | 3300050496 | Bacteria | 1538 |
| 839 | nmdc:mga07m45_168_c1 | 3300050496 | Bacteria | 26249 |
| 840 | nmdc:mga07m45_27678_c2 | 3300050496 | Bacteria | 2265 |
| 841 | nmdc:mga07m45_45088_c1 | 3300050496 | Bacteria | 2475 |
| 842 | nmdc:mga07m45_848_c1 | 3300050496 | Bacteria | 13274 |
| 843 | nmdc:mga06r32_304478_c1 | 3300050510 | Bacteria | 1579 |
| 844 | nmdc:mga08y16_162499_c1 | 3300050511 | Bacteria | 2320 |
| 845 | nmdc:mga08y16_37703_c1 | 3300050511 | Bacteria | 5074 |
| 846 | nmdc:mga08y16_494241_c1 | 3300050511 | Bacteria | 1244 |
| 847 | nmdc:mga08y16_625945_c1 | 3300050511 | Bacteria | 1083 |
| 848 | nmdc:mga0sz30_10947_c1 | 3300050516 | Bacteria | 2757 |
| 849 | nmdc:mga0sz30_134848_c1 | 3300050516 | Bacteria | 1089 |
| 850 | nmdc:mga0sz30_138812_c1 | 3300050516 | Bacteria | 1073 |
| 851 | nmdc:mga0sz30_153935_c1 | 3300050516 | Bacteria | 1018 |
| 852 | nmdc:mga0sz30_20167_c1 | 3300050516 | Bacteria | 2687 |
| 853 | nmdc:mga0sz30_22654_c1 | 3300050516 | Bacteria | 2551 |
| 854 | nmdc:mga0sz30_26935_c1 | 3300050516 | Bacteria | 2359 |
| 855 | nmdc:mga0sz30_31676_c1 | 3300050516 | Bacteria | 2189 |
| 856 | nmdc:mga0sz30_56_c1 | 3300050516 | Bacteria | 42210 |
| 857 | nmdc:mga0sz30_6507_c2 | 3300050516 | Bacteria | 1479 |
| 858 | nmdc:mga0sz30_99890_c1 | 3300050516 | Bacteria | 1267 |
| 859 | Ga0495601_0140327 | 3300053077 | Bacteria | 1576 |
| 860 | Ga0500610_0009933 | 3300053079 | Bacteria | 4254 |
| 861 | Ga0500635_0011660 | 3300053080 | Bacteria | 2506 |
| 862 | Ga0500643_001252 | 3300053087 | Bacteria | 15050 |
| 863 | Ga0500643_001788 | 3300053087 | Bacteria | 11785 |
| 864 | Ga0500643_002468 | 3300053087 | Bacteria | 9524 |
| 865 | Ga0500643_009677 | 3300053087 | Bacteria | 3660 |
| 866 | Ga0500646_0005272 | 3300053090 | Bacteria | 3268 |
| 867 | Ga0500583_0000111 | 3300053092 | Bacteria | 40256 |
| 868 | Ga0500651_0002354 | 3300053093 | Bacteria | 9943 |
| 869 | Ga0500641_0005068 | 3300053096 | Bacteria | 4671 |
| 870 | Ga0500641_0042974 | 3300053096 | Bacteria | 1833 |
| 871 | Ga0500555_000023 | 3300053103 | Bacteria | 150521 |
| 872 | Ga0500556_0067442 | 3300053104 | Bacteria | 1330 |
| 873 | Ga0500562_007680 | 3300053108 | Bacteria | 2720 |
| 874 | Ga0500569_000008 | 3300053109 | Bacteria | 73629 |
| 875 | Ga0500569_024101 | 3300053109 | Bacteria | 1643 |
| 876 | Ga0500608_103572 | 3300053122 | Bacteria | 1315 |
| 877 | Ga0500652_000058 | 3300053131 | Bacteria | 50084 |
| 878 | Ga0500652_000912 | 3300053131 | Bacteria | 9745 |
| 879 | Ga0500655_002822 | 3300053133 | Bacteria | 3157 |
| 880 | Ga0500658_0019173 | 3300053134 | Bacteria | 2572 |
| 881 | Ga0500658_0113266 | 3300053134 | Bacteria | 1196 |
| 882 | Ga0500559_0052503 | 3300053136 | Bacteria | 1802 |
| 883 | Ga0500568_0009913 | 3300053139 | Bacteria | 4497 |
| 884 | Ga0500568_0030043 | 3300053139 | Bacteria | 2251 |
| 885 | Ga0500568_0087860 | 3300053139 | Bacteria | 1175 |
| 886 | Ga0500573_0000080 | 3300053140 | Bacteria | 46390 |
| 887 | Ga0500573_0002557 | 3300053140 | Bacteria | 9138 |
| 888 | Ga0500573_0004692 | 3300053140 | Bacteria | 7234 |
| 889 | Ga0500577_0000422 | 3300053142 | Bacteria | 10871 |
| 890 | Ga0500588_0000023 | 3300053146 | Bacteria | 37338 |
| 891 | Ga0500616_0001675 | 3300053153 | Bacteria | 20419 |
| 892 | Ga0500616_0055766 | 3300053153 | Bacteria | 2065 |
| 893 | Ga0500622_0000151 | 3300053156 | Bacteria | 73392 |
| 894 | Ga0500633_0007500 | 3300053160 | Bacteria | 2752 |
| 895 | Ga0500645_000108 | 3300053730 | Bacteria | 66421 |
| 896 | Ga0500645_019002 | 3300053730 | Bacteria | 2141 |
| 897 | Ga0500552_011595 | 3300053733 | Bacteria | 1110 |
| 898 | Ga0501084_0022823 | 3300054114 | Bacteria | 5221 |
| 899 | Ga0501084_0109917 | 3300054114 | Bacteria | 2316 |
| 900 | Ga0501084_0452771 | 3300054114 | Bacteria | 1085 |
| 901 | Ga0501082_0002655 | 3300060353 | Bacteria | 15637 |
| 902 | Ga0501082_0237262 | 3300060353 | Bacteria | 1587 |
| 903 | Ga0466962_0046998 | 3300061719 | Bacteria | 2062 |
| 904 | 2548692431 | 2547132424 | Bacteria | 8348532 |
| 905 | 2552104972 | 2551306166 | Bacteria | 9731570 |
| 906 | 2552112726 | 2551306166 | Bacteria | 9731570 |
| 907 | 2643753076 | 2643221546 | Bacteria | 2910897 |
| 908 | 2643824472 | 2643221561 | Bacteria | 4984412 |
| 909 | 2644083629 | 2643221613 | Bacteria | 4622396 |
| 910 | 2644444390 | 2643221679 | Bacteria | 3839507 |
| 911 | 2644487542 | 2643221687 | Bacteria | 6500351 |
| 912 | 2644503208 | 2643221690 | Bacteria | 4654705 |
| 913 | 2644517325 | 2643221692 | Bacteria | 7282860 |
| 914 | 2644525518 | 2643221694 | Bacteria | 4392972 |
| 915 | 2644535731 | 2643221696 | Bacteria | 5431823 |
| 916 | 2644539284 | 2643221697 | Bacteria | 3575694 |
| 917 | 2644639107 | 2643221715 | Bacteria | 6671032 |
| 918 | 2644664174 | 2643221721 | Bacteria | 4486924 |
| 919 | 2644669602 | 2643221722 | Bacteria | 4247614 |
| 920 | 2729908320 | 2728369276 | Bacteria | 5610032 |
| 921 | 2738693132 | 2738541272 | Bacteria | 6848551 |
| 922 | 2738706650 | 2738541274 | Bacteria | 6909446 |
| 923 | 2739206427 | 2738543005 | Bacteria | 5278128 |
| 924 | 2739239235 | 2738543011 | Bacteria | 5731169 |
| 925 | 2739323294 | 2738543027 | Bacteria | 6409078 |
| 926 | 2739329825 | 2738543028 | Bacteria | 6917070 |
| 927 | 2739333268 | 2738543028 | Bacteria | 6917070 |
| 928 | 2739607900 | 2739367654 | Bacteria | 6049412 |
| 929 | 2744956108 | 2744054611 | Bacteria | 5611514 |
| 930 | 2747954531 | 2747842429 | Bacteria | 3914386 |
| 931 | 2753037297 | 2751185725 | Bacteria | 5740550 |
| 932 | 2753325166 | 2751185792 | Bacteria | 5739090 |
| 933 | 2758224495 | 2757320536 | Bacteria | 3629334 |
| 934 | 2760304089 | 2758568522 | Bacteria | 5953541 |
| 935 | 2760621959 | 2758568621 | Bacteria | 5967089 |
| 936 | 2774400308 | 2773857763 | Bacteria | 4180068 |
| 937 | 2795796733 | 2795385472 | Bacteria | 6627535 |
| 938 | 2809026796 | 2808606394 | Bacteria | 6248540 |
| 939 | 2809226790 | 2808606447 | Bacteria | 3572005 |
| 940 | 2812322393 | 2811994872 | Bacteria | 4121241 |
| 941 | 2812364680 | 2811994880 | Bacteria | 4147780 |
| 942 | 2816422681 | 2816332119 | Bacteria | 8120218 |
| 943 | 2819677426 | 2818991460 | Bacteria | 7595395 |
| 944 | 2821269312 | 2821268502 | Bacteria | 3750023 |
| 945 | 2835191215 | 2835188231 | Bacteria | 3476928 |
| 946 | 2839989572 | 2839986021 | Bacteria | 3685650 |
| 947 | 2840679241 | 2840677318 | Bacteria | 2664183 |
| 948 | 2842135319 | 2842134933 | Bacteria | 5847019 |
| 949 | 2842889849 | 2842888712 | Bacteria | 4279094 |
| 950 | 2857633039 | 2857632687 | Bacteria | 2448521 |
| 951 | 2857720978 | 2857720070 | Bacteria | 3189373 |
| 952 | 2870629669 | 2870628048 | Bacteria | 3696012 |
| 953 | 2870805214 | 2870804320 | Bacteria | 2552467 |
| 954 | 2884996107 | 2884994152 | Bacteria | 4492978 |
| 955 | 2889304189 | 2889300758 | Bacteria | 5690814 |
| 956 | 2895502688 | 2895498888 | Bacteria | 5283788 |
| 957 | 2896087052 | 2896085136 | Bacteria | 6129793 |
| 958 | 2896114337 | 2896109856 | Bacteria | 7140722 |
| 959 | 2902794162 | 2902792274 | Bacteria | 7270173 |
| 960 | 2902802910 | 2902799365 | Bacteria | 5419524 |
| 961 | 2902802927 | 2902799365 | Bacteria | 5419524 |
| 962 | 2902816006 | 2902810491 | Bacteria | 6794147 |
| 963 | 2902839628 | 2902837492 | Bacteria | 6697721 |
| 964 | 2904768367 | 2904765812 | Bacteria | 5369154 |
| 965 | 2904773969 | 2904770941 | Bacteria | 5580202 |
| 966 | 2904775766 | 2904770941 | Bacteria | 5580202 |
| 967 | 2906801150 | 2906799679 | Bacteria | 4031749 |
| 968 | 2908811725 | 2908811453 | Bacteria | 5478616 |
| 969 | 2919421738 | 2919420072 | Bacteria | 5390363 |
| 970 | 2919434704 | 2919432681 | Bacteria | 5390474 |
| 971 | 2919714777 | 2919713450 | Bacteria | 7431245 |
| 972 | 2922558077 | 2922554459 | Bacteria | 6683962 |
| 973 | 2928147071 | 2928142448 | Bacteria | 5288925 |
| 974 | 2929177185 | 2929177148 | Bacteria | 7883697 |
| 975 | 2929239608 | 2929239360 | Bacteria | 7745570 |
| 976 | 2929921238 | 2929921140 | Bacteria | 8649150 |
| 977 | 2932401281 | 2932398195 | Bacteria | 3847976 |
| 978 | 2932433180 | 2932431166 | Bacteria | 4215299 |
| 979 | 2935891556 | 2935890801 | Bacteria | 4593001 |
| 980 | 2939586058 | 2939582691 | Bacteria | 7088898 |
| 981 | 2939745417 | 2939743619 | Bacteria | 5762299 |
| 982 | 2945979552 | 2945977869 | Bacteria | 7777518 |
| 983 | 2946014580 | 2946013367 | Bacteria | 7766675 |
| 984 | 2946082443 | 2946080515 | Bacteria | 4310960 |
| 985 | 2974298098 | 2974294766 | Bacteria | 3767688 |
| 986 | 2974319682 | 2974315732 | Bacteria | 4602776 |
| 987 | 2974325666 | 2974324384 | Bacteria | 3750535 |
| 988 | 2977252102 | 2977251589 | Bacteria | 2952848 |
| 989 | 2977265853 | 2977264416 | Bacteria | 3750737 |
| 990 | 2984523550 | 2984523437 | Bacteria | 4508481 |
| 991 | 8003152528 | 8003151029 | Bacteria | 8187759 |
| 992 | 8056580823 | 8056579771 | Bacteria | 5840325 |
| 993 | SwRhRL2b_contig_300488 | |||
| 994 | JGI24746J21847_1001168 | |||
| 995 | JGI24740J21852_10001780 | |||
| 996 | JGI24739J22299_10002055 | |||
| 997 | JGI24744J21845_10001990 | |||
| 998 | JGI24744J21845_10006209 | |||
| 999 | JGI25154J39366_1000002 | |||
| 1000 | JGI25154J39366_1001681 | |||
| 1001 | JGI25153J46596_10008393 | |||
| 1002 | rootL2_10022523 | |||
| 1003 | rootL2_10081697 | |||
| 1004 | rootH1_10000619 | |||
| 1005 | rootH1_10000732 | |||
| 1006 | rootH1_10040576 | |||
| 1007 | rootH1_10137115 | |||
| 1008 | JGI25160J50197_1001555 | |||
| 1009 | JGI25160J50197_1008496 | |||
| 1010 | Ga0006562J51391_1044531 | |||
| 1011 | Ga0006562J51391_1044534 | |||
| 1012 | Ga0055528_1000422 | |||
| 1013 | Ga0055530_10000475 | |||
| 1014 | Ga0055540_1007250 | |||
| 1015 | Ga0055540_1007673 | |||
| 1016 | Ga0055540_1022563 | |||
| 1017 | Ga0055540_1031088 | |||
| 1018 | Ga0055531_10000014 | |||
| 1019 | Ga0065165_1000258 | |||
| 1020 | Ga0065165_1002847 | |||
| 1021 | Ga0065165_1024739 | |||
| 1022 | Ga0065704_10073688 | |||
| 1023 | Ga0070658_10000839 | |||
| 1024 | Ga0070658_10040088 | |||
| 1025 | Ga0070676_10089790 | |||
| 1026 | Ga0070676_10114154 | |||
| 1027 | Ga0070683_100024499 | |||
| 1028 | Ga0070683_100112109 | |||
| 1029 | Ga0070683_100562634 | |||
| 1030 | Ga0070690_100002005 | |||
| 1031 | Ga0068869_100046160 | |||
| 1032 | Ga0070666_10060925 | |||
| 1033 | Ga0070680_100023828 | |||
| 1034 | Ga0070680_100177905 | |||
| 1035 | Ga0070682_100003922 | |||
| 1036 | Ga0068868_100000721 | |||
| 1037 | Ga0068868_100083622 | |||
| 1038 | Ga0070660_100000275 | |||
| 1039 | Ga0070660_100010827 | |||
| 1040 | Ga0070689_100058091 | |||
| 1041 | Ga0070691_10010747 | |||
| 1042 | Ga0070692_10030196 | |||
| 1043 | Ga0070668_100001176 | |||
| 1044 | Ga0070668_100051114 | |||
| 1045 | Ga0070668_100104218 | |||
| 1046 | Ga0070669_100044641 | |||
| 1047 | Ga0070671_100045381 | |||
| 1048 | Ga0070674_100024056 | |||
| 1049 | Ga0070673_100559931 | |||
| 1050 | Ga0070659_100001086 | |||
| 1051 | Ga0070659_100055713 | |||
| 1052 | Ga0070667_100001332 | |||
| 1053 | Ga0070667_100011524 | |||
| 1054 | Ga0070709_10093423 | |||
| 1055 | Ga0070714_100059440 | |||
| 1056 | Ga0070714_100103843 | |||
| 1057 | Ga0070710_10003466 | |||
| 1058 | Ga0070701_10001177 | |||
| 1059 | Ga0070701_10093432 | |||
| 1060 | Ga0070711_100001348 | |||
| 1061 | Ga0070711_100013605 | |||
| 1062 | Ga0070705_100006092 | |||
| 1063 | Ga0070705_100104729 | |||
| 1064 | Ga0070700_100002213 | |||
| 1065 | Ga0070694_100009996 | |||
| 1066 | Ga0070663_100005044 | |||
| 1067 | Ga0070663_100024173 | |||
| 1068 | Ga0070663_100211764 | |||
| 1069 | Ga0070678_100000690 | |||
| 1070 | Ga0070662_100020728 | |||
| 1071 | Ga0070662_100031415 | |||
| 1072 | Ga0070681_10050063 | |||
| 1073 | Ga0068867_100002146 | |||
| 1074 | Ga0068867_100029761 | |||
| 1075 | Ga0070685_10050961 | |||
| 1076 | Ga0070685_10094756 | |||
| 1077 | Ga0070699_100252882 | |||
| 1078 | Ga0070679_100009071 | |||
| 1079 | Ga0070679_100009808 | |||
| 1080 | Ga0070684_100132720 | |||
| 1081 | Ga0070684_100531578 | |||
| 1082 | Ga0070697_100161948 | |||
| 1083 | Ga0068853_100002060 | |||
| 1084 | Ga0068853_100020442 | |||
| 1085 | Ga0068853_100192290 | |||
| 1086 | Ga0068853_100535977 | |||
| 1087 | Ga0070672_100025016 | |||
| 1088 | Ga0070696_100001539 | |||
| 1089 | Ga0070665_100008709 | |||
| 1090 | Ga0070665_100133519 | |||
| 1091 | Ga0070704_100000342 | |||
| 1092 | Ga0068855_100081453 | |||
| 1093 | Ga0070664_100052079 | |||
| 1094 | Ga0068857_100112040 | |||
| 1095 | Ga0068854_100005978 | |||
| 1096 | Ga0068856_100000060 | |||
| 1097 | Ga0070702_100002910 | |||
| 1098 | Ga0070702_100071989 | |||
| 1099 | Ga0068852_100000088 | |||
| 1100 | Ga0068852_100155424 | |||
| 1101 | Ga0068852_100411137 | |||
| 1102 | Ga0068859_100002678 | |||
| 1103 | Ga0068859_100008165 | |||
| 1104 | Ga0068859_100275432 | |||
| 1105 | Ga0068864_100268459 | |||
| 1106 | Ga0068864_100622843 | |||
| 1107 | Ga0068866_10003250 | |||
| 1108 | Ga0068866_10030623 | |||
| 1109 | Ga0068866_10079925 | |||
| 1110 | Ga0068861_100024884 | |||
| 1111 | Ga0068861_100380020 | |||
| 1112 | Ga0068863_100000205 | |||
| 1113 | Ga0068863_100303094 | |||
| 1114 | Ga0068858_100000569 | |||
| 1115 | Ga0068858_100021662 | |||
| 1116 | Ga0068858_100069863 | |||
| 1117 | Ga0068858_100247683 | |||
| 1118 | Ga0068860_100000472 | |||
| 1119 | Ga0068860_100018155 | |||
| 1120 | Ga0068862_100000030 | |||
| 1121 | Ga0068862_100001196 | |||
| 1122 | Ga0068862_100161763 | |||
| 1123 | Ga0081455_10021717 | |||
| 1124 | Ga0081455_10048739 | |||
| 1125 | Ga0081455_10090423 | |||
| 1126 | Ga0081455_10116704 | |||
| 1127 | Ga0081455_10130098 | |||
| 1128 | Ga0081455_10231688 | |||
| 1129 | Ga0081539_10002644 | |||
| 1130 | Ga0075365_10003949 | |||
| 1131 | Ga0075365_10005987 | |||
| 1132 | Ga0075365_10020421 | |||
| 1133 | Ga0075365_10031290 | |||
| 1134 | Ga0075365_10092721 | |||
| 1135 | Ga0075365_10103317 | |||
| 1136 | Ga0075365_10140446 | |||
| 1137 | Ga0075365_10155329 | |||
| 1138 | Ga0075365_10198509 | |||
| 1139 | Ga0075368_10030850 | |||
| 1140 | Ga0075363_100000097 | |||
| 1141 | Ga0075363_100002740 | |||
| 1142 | Ga0075363_100003750 | |||
| 1143 | Ga0075363_100006637 | |||
| 1144 | Ga0075363_100016375 | |||
| 1145 | Ga0075363_100019871 | |||
| 1146 | Ga0075363_100019973 | |||
| 1147 | Ga0075363_100026690 | |||
| 1148 | Ga0075363_100135286 | |||
| 1149 | Ga0075363_100193264 | |||
| 1150 | Ga0075364_10008403 | |||
| 1151 | Ga0075364_10009086 | |||
| 1152 | Ga0075364_10011846 | |||
| 1153 | Ga0075364_10016734 | |||
| 1154 | Ga0075364_10028145 | |||
| 1155 | Ga0075364_10044912 | |||
| 1156 | Ga0075364_10061062 | |||
| 1157 | Ga0075364_10076481 | |||
| 1158 | Ga0075364_10083783 | |||
| 1159 | Ga0075364_10117162 | |||
| 1160 | Ga0075364_10135515 | |||
| 1161 | Ga0070715_10000745 | |||
| 1162 | Ga0070716_100002545 | |||
| 1163 | Ga0070716_100052081 | |||
| 1164 | Ga0070712_100001630 | |||
| 1165 | Ga0070712_100008920 | |||
| 1166 | Ga0070712_100163325 | |||
| 1167 | Ga0075362_10068099 | |||
| 1168 | Ga0075367_10058747 | |||
| 1169 | Ga0075367_10121915 | |||
| 1170 | Ga0075367_10182849 | |||
| 1171 | Ga0075369_10003213 | |||
| 1172 | Ga0075369_10017544 | |||
| 1173 | Ga0075369_10023785 | |||
| 1174 | Ga0075369_10034608 | |||
| 1175 | Ga0075369_10042008 | |||
| 1176 | Ga0075369_10044597 | |||
| 1177 | Ga0075369_10079851 | |||
| 1178 | Ga0075369_10133245 | |||
| 1179 | Ga0075366_10004918 | |||
| 1180 | Ga0075366_10023876 | |||
| 1181 | Ga0075366_10166895 | |||
| 1182 | Ga0097621_100009990 | |||
| 1183 | Ga0075370_10020303 | |||
| 1184 | Ga0075370_10067844 | |||
| 1185 | Ga0075370_10232545 | |||
| 1186 | Ga0068871_100039173 | |||
| 1187 | Ga0068871_100083216 | |||
| 1188 | Ga0075428_100023471 | |||
| 1189 | Ga0075428_100431309 | |||
| 1190 | Ga0075431_100385090 | |||
| 1191 | Ga0068865_100000869 | |||
| 1192 | Ga0097620_100002678 | |||
| 1193 | Ga0097620_100008165 | |||
| 1194 | Ga0097620_100275455 | |||
| 1195 | Ga0105244_10013007 | |||
| 1196 | Ga0105250_10062958 | |||
| 1197 | Ga0105240_10000030 | |||
| 1198 | Ga0111539_10040373 | |||
| 1199 | Ga0111539_10421043 | |||
| 1200 | Ga0111539_10535286 | |||
| 1201 | Ga0105245_10001960 | |||
| 1202 | Ga0105247_10000008 | |||
| 1203 | Ga0105247_10000731 | |||
| 1204 | Ga0105247_10024985 | |||
| 1205 | Ga0105247_10046848 | |||
| 1206 | Ga0114129_10234720 | |||
| 1207 | Ga0105243_10003737 | |||
| 1208 | Ga0105243_10004909 | |||
| 1209 | Ga0105243_10484947 | |||
| 1210 | Ga0105241_10005394 | |||
| 1211 | Ga0105242_10001062 | |||
| 1212 | Ga0105248_10000257 | |||
| 1213 | Ga0105248_10011362 | |||
| 1214 | Ga0105248_10092787 | |||
| 1215 | Ga0105248_10136665 | |||
| 1216 | Ga0105237_10000001 | |||
| 1217 | Ga0105237_10001184 | |||
| 1218 | Ga0105237_10064418 | |||
| 1219 | Ga0105238_10132643 | |||
| 1220 | Ga0105238_10509971 | |||
| 1221 | Ga0105249_10000036 | |||
| 1222 | Ga0105249_10002637 | |||
| 1223 | Ga0105249_10062183 | |||
| 1224 | Ga0105239_10003290 | |||
| 1225 | Ga0105239_10021671 | |||
| 1226 | Ga0105239_10059620 | |||
| 1227 | Ga0105239_10281419 | |||
| 1228 | Ga0105246_10000069 | |||
| 1229 | Ga0105246_10013466 | |||
| 1230 | Ga0157373_10001378 | |||
| 1231 | Ga0157371_10005033 | |||
| 1232 | Ga0157371_10027957 | |||
| 1233 | Ga0157370_10000812 | |||
| 1234 | Ga0157370_10000984 | |||
| 1235 | Ga0157370_10048608 | |||
| 1236 | Ga0157369_10000026 | |||
| 1237 | Ga0157369_10000851 | |||
| 1238 | Ga0157369_10008059 | |||
| 1239 | Ga0157374_10019012 | |||
| 1240 | Ga0157378_10003646 | |||
| 1241 | Ga0157378_10114883 | |||
| 1242 | Ga0157378_10319677 | |||
| 1243 | Ga0163162_10015231 | |||
| 1244 | Ga0163162_10104859 | |||
| 1245 | Ga0157372_10000007 | |||
| 1246 | Ga0157372_10000027 | |||
| 1247 | Ga0157372_10006391 | |||
| 1248 | Ga0157372_10085822 | |||
| 1249 | Ga0157372_10213109 | |||
| 1250 | Ga0157375_10002986 | |||
| 1251 | Ga0157375_10177231 | |||
| 1252 | Ga0157375_10238090 | |||
| 1253 | Ga0157375_10260849 | |||
| 1254 | Ga0157380_10000595 | |||
| 1255 | Ga0157380_10004722 | |||
| 1256 | Ga0157380_10069047 | |||
| 1257 | Ga0157380_10144834 | |||
| 1258 | Ga0157377_10023666 | |||
| 1259 | Ga0157377_10035244 | |||
| 1260 | Ga0157379_10040132 | |||
| 1261 | Ga0157376_10433754 | |||
| 1262 | Ga0157376_10721345 | |||
| 1263 | Ga0163161_10001886 | |||
| 1264 | Ga0163161_10066742 | |||
| 1265 | Ga0163161_10210792 | |||
| 1266 | Ga0163161_10310074 | |||
| 1267 | Ga0206351_10585983 | |||
| 1268 | Ga0213876_10232144 | |||
| 1269 | Ga0213875_10032182 | |||
| 1270 | Ga0224712_10004555 | |||
| 1271 | Ga0209436_100440 | |||
| 1272 | Ga0209258_100029 | |||
| 1273 | Ga0209646_1000005 | |||
| 1274 | Ga0209646_1000041 | |||
| 1275 | Ga0209026_1000169 | |||
| 1276 | Ga0209148_1000089 | |||
| 1277 | Ga0209673_1000049 | |||
| 1278 | Ga0209130_1001814 | |||
| 1279 | Ga0209564_1011681 | |||
| 1280 | Ga0209758_1000346 | |||
| 1281 | Ga0209758_1023829 | |||
| 1282 | Ga0209758_1029351 | |||
| 1283 | Ga0209050_1000272 | |||
| 1284 | Ga0207426_1000233 | |||
| 1285 | Ga0207426_1000381 | |||
| 1286 | Ga0207426_1001311 | |||
| 1287 | Ga0209051_1000807 | |||
| 1288 | Ga0209051_1000884 | |||
| 1289 | Ga0209051_1001910 | |||
| 1290 | Ga0209051_1013992 | |||
| 1291 | Ga0209051_1024837 | |||
| 1292 | Ga0209257_1000004 | |||
| 1293 | Ga0209257_1001525 | |||
| 1294 | Ga0207653_10026046 | |||
| 1295 | Ga0207692_10002339 | |||
| 1296 | Ga0207692_10025260 | |||
| 1297 | Ga0207642_10004559 | |||
| 1298 | Ga0207710_10000006 | |||
| 1299 | Ga0207710_10020197 | |||
| 1300 | Ga0207710_10035899 | |||
| 1301 | Ga0207710_10053271 | |||
| 1302 | Ga0207710_10095729 | |||
| 1303 | Ga0207688_10000313 | |||
| 1304 | Ga0207688_10002177 | |||
| 1305 | Ga0207680_10032508 | |||
| 1306 | Ga0207647_10024977 | |||
| 1307 | Ga0207685_10008972 | |||
| 1308 | Ga0207699_10002972 | |||
| 1309 | Ga0207699_10180791 | |||
| 1310 | Ga0207645_10036984 | |||
| 1311 | Ga0207705_10000934 | |||
| 1312 | Ga0207705_10009390 | |||
| 1313 | Ga0207654_10037773 | |||
| 1314 | Ga0207695_10000009 | |||
| 1315 | Ga0207671_10000003 | |||
| 1316 | Ga0207671_10016681 | |||
| 1317 | Ga0207671_10038019 | |||
| 1318 | Ga0207671_10127161 | |||
| 1319 | Ga0207693_10001545 | |||
| 1320 | Ga0207693_10005615 | |||
| 1321 | Ga0207693_10278334 | |||
| 1322 | Ga0207663_10005432 | |||
| 1323 | Ga0207663_10020877 | |||
| 1324 | Ga0207660_10062382 | |||
| 1325 | Ga0207660_10133331 | |||
| 1326 | Ga0207660_10140232 | |||
| 1327 | Ga0207657_10000296 | |||
| 1328 | Ga0207657_10006095 | |||
| 1329 | Ga0207657_10135891 | |||
| 1330 | Ga0207657_10175395 | |||
| 1331 | Ga0207652_10283537 | |||
| 1332 | Ga0207681_10006042 | |||
| 1333 | Ga0207681_10018534 | |||
| 1334 | Ga0207681_10178094 | |||
| 1335 | Ga0207694_10110938 | |||
| 1336 | Ga0207659_10156875 | |||
| 1337 | Ga0207687_10001949 | |||
| 1338 | Ga0207664_10232658 | |||
| 1339 | Ga0207644_10276552 | |||
| 1340 | Ga0207690_10007615 | |||
| 1341 | Ga0207690_10019135 | |||
| 1342 | Ga0207690_10376038 | |||
| 1343 | Ga0207706_10034196 | |||
| 1344 | Ga0207706_10154063 | |||
| 1345 | Ga0207686_10005130 | |||
| 1346 | Ga0207709_10001364 | |||
| 1347 | Ga0207709_10001848 | |||
| 1348 | Ga0207709_10127649 | |||
| 1349 | Ga0207709_10502277 | |||
| 1350 | Ga0207670_10018652 | |||
| 1351 | Ga0207669_10004474 | |||
| 1352 | Ga0207669_10054775 | |||
| 1353 | Ga0207704_10000673 | |||
| 1354 | Ga0207704_10395969 | |||
| 1355 | Ga0207665_10000142 | |||
| 1356 | Ga0207665_10001800 | |||
| 1357 | Ga0207691_10012555 | |||
| 1358 | Ga0207711_10000269 | |||
| 1359 | Ga0207711_10083596 | |||
| 1360 | Ga0207711_10202498 | |||
| 1361 | Ga0207711_10466800 | |||
| 1362 | Ga0207689_10019613 | |||
| 1363 | Ga0207689_10021202 | |||
| 1364 | Ga0207689_10039105 | |||
| 1365 | Ga0207661_10015302 | |||
| 1366 | Ga0207661_10016982 | |||
| 1367 | Ga0207661_10469370 | |||
| 1368 | Ga0207661_10480087 | |||
| 1369 | Ga0207679_10061833 | |||
| 1370 | Ga0207679_10233631 | |||
| 1371 | Ga0207712_10000036 | |||
| 1372 | Ga0207712_10006069 | |||
| 1373 | Ga0207712_10139732 | |||
| 1374 | Ga0207668_10001315 | |||
| 1375 | Ga0207668_10020654 | |||
| 1376 | Ga0207668_10072425 | |||
| 1377 | Ga0207640_10219956 | |||
| 1378 | Ga0207658_10000060 | |||
| 1379 | Ga0207658_10010136 | |||
| 1380 | Ga0207658_10299112 | |||
| 1381 | Ga0207677_10003046 | |||
| 1382 | Ga0207703_10016131 | |||
| 1383 | Ga0207703_10161908 | |||
| 1384 | Ga0207703_10269055 | |||
| 1385 | Ga0207703_10374281 | |||
| 1386 | Ga0207639_10189777 | |||
| 1387 | Ga0207678_10019583 | |||
| 1388 | Ga0207678_10021554 | |||
| 1389 | Ga0207678_10054346 | |||
| 1390 | Ga0207678_10071723 | |||
| 1391 | Ga0207708_10011837 | |||
| 1392 | Ga0207708_10025429 | |||
| 1393 | Ga0207708_10040442 | |||
| 1394 | Ga0207702_10000097 | |||
| 1395 | Ga0207641_10000302 | |||
| 1396 | Ga0207641_10034256 | |||
| 1397 | Ga0207648_10000979 | |||
| 1398 | Ga0207648_10011185 | |||
| 1399 | Ga0207648_10088431 | |||
| 1400 | Ga0207648_10169180 | |||
| 1401 | Ga0207676_10265474 | |||
| 1402 | Ga0207674_10127799 | |||
| 1403 | Ga0207675_100001993 | |||
| 1404 | Ga0207675_100007416 | |||
| 1405 | Ga0207675_100196209 | |||
| 1406 | Ga0207675_100224355 | |||
| 1407 | Ga0207683_10000334 | |||
| 1408 | Ga0207683_10024839 | |||
| 1409 | Ga0207698_10000072 | |||
| 1410 | Ga0207698_10070853 | |||
| 1411 | Ga0207698_10136079 | |||
| 1412 | Ga0207698_10297577 | |||
| 1413 | Ga0268266_10009911 | |||
| 1414 | Ga0268266_10055011 | |||
| 1415 | Ga0268266_10486737 | |||
| 1416 | Ga0268265_10000038 | |||
| 1417 | Ga0268265_10025828 | |||
| 1418 | Ga0268265_10232811 | |||
| 1419 | Ga0268264_10000056 | |||
| 1420 | Ga0268264_10000280 | |||
| 1421 | Ga0268264_10012887 | |||
| 1422 | Ga0268264_10145565 | |||
| 1423 | Ga0265334_10042138 | |||
| 1424 | Ga0314311_1127295 | |||
| 1425 | Ga0316183_1077323 | |||
| 1426 | Ga0316182_1395692 | |||
| 1427 | Ga0265325_10032299 | |||
| 1428 | Ga0265327_10000358 | |||
| 1429 | Ga0307509_10041006 | |||
| 1430 | Ga0316575_10000545 | |||
| 1431 | Ga0316576_10010593 | |||
| 1432 | Ga0316578_10065381 | |||
| 1433 | Ga0316578_10080776 | |||
| 1434 | Ga0307516_10048220 | |||
| 1435 | Ga0307413_10188979 | |||
| 1436 | Ga0307410_10168074 | |||
| 1437 | Ga0307406_10092427 | |||
| 1438 | Ga0307406_10371703 | |||
| 1439 | Ga0307412_10216045 | |||
| 1440 | Ga0307409_100070227 | |||
| 1441 | Ga0307409_100086893 | |||
| 1442 | Ga0307409_100315286 | |||
| 1443 | Ga0307409_100378253 | |||
| 1444 | Ga0307409_100530650 | |||
| 1445 | Ga0307416_100284935 | |||
| 1446 | Ga0307414_10397765 | |||
| 1447 | Ga0307414_10646801 | |||
| 1448 | Ga0373959_0000224 | |||
| 1449 | Ga0373928_0008874 | |||
| 1450 | Ga0373939_0009652 | |||
| 1451 | Ga0373941_0016813 | |||
| 1452 | Ga0373960_0040098 | |||
| 1453 | Ga0373943_0180749 | |||
| 1454 | Ga0316574_0019163 | |||
| 1455 | Ga0316574_0180511 | |||
| 1456 | Ga0373931_0112383 | |||
| 1457 | Ga0373931_0146781 | |||
| 1458 | Ga0373933_0062717 | |||
| 1459 | Ga0316584_0008378 | |||
| 1460 | Ga0316584_0043583 | |||
| 1461 | Ga0373925_0318038 | |||
| 1462 | Ga0373925_0359321 | |||
| 1463 | Ga0395899_0251107 | |||
| 1464 | Ga0395898_0059405 | |||
| 1465 | Ga0395898_0474252 | |||
| 1466 | Ga0436364_0095068 | |||
| 1467 | Ga0436364_0151759 | |||
| 1468 | Ga0436364_0727309 | |||
| 1469 | Ga0395901_0488453 | |||
| 1470 | Ga0400485_08773 | |||
| 1471 | Ga0400486_28732 | |||
| 1472 | Ga0436365_0943842 | |||
| 1473 | Ga0436365_1146896 | |||
| 1474 | Ga0436365_1195958 | |||
| 1475 | Ga0436360_0313352 | |||
| 1476 | Ga0436363_0708325 | |||
| 1477 | Ga0439436_0028907 | |||
| 1478 | Ga0439461_0009888 | |||
| 1479 | Ga0439466_0003018 | |||
| 1480 | Ga0439466_0029723 | |||
| 1481 | Ga0439466_0067199 | |||
| 1482 | Ga0439465_0012327 | |||
| 1483 | Ga0439465_0024211 | |||
| 1484 | Ga0451793_0173016 | |||
| 1485 | Ga0451793_1579998 | |||
| 1486 | Ga0451795_0931545 | |||
| 1487 | Ga0451795_1444608 | |||
| 1488 | Ga0451833_0141528 | |||
| 1489 | Ga0451837_1576909 | |||
| 1490 | Ga0451839_0447997 | |||
| 1491 | Ga0451853_0331732 | |||
| 1492 | Ga0439431_0004979 | |||
| 1493 | Ga0439431_0005227 | |||
| 1494 | Ga0439445_0022142 | |||
| 1495 | Ga0439445_0040731 | |||
| 1496 | Ga0439445_0048936 | |||
| 1497 | Ga0439432_016023 | |||
| 1498 | Ga0439449_0051482 | |||
| 1499 | Ga0439462_0002959 | |||
| 1500 | Ga0439434_0006786 | |||
| 1501 | Ga0439435_0020244 | |||
| 1502 | Ga0439459_0004714 | |||
| 1503 | Ga0439464_0015223 | |||
| 1504 | Ga0466969_0047400 | |||
| 1505 | Ga0466972_0010647 | |||
| 1506 | Ga0466965_0004966 | |||
| 1507 | Ga0466965_0028692 | |||
| 1508 | Ga0466966_0003202 | |||
| 1509 | Ga0466966_0008774 | |||
| 1510 | Ga0466966_0210798 | |||
| 1511 | Ga0466961_0011812 | |||
| 1512 | Ga0466961_0118588 | |||
| 1513 | Ga0466963_0023012 | |||
| 1514 | Ga0466963_0029095 | |||
| 1515 | Ga0466963_0063926 | |||
| 1516 | Ga0466963_0145423 | |||
| 1517 | Ga0466964_0101930 | |||
| 1518 | Ga0466964_0201484 | |||
| 1519 | Ga0466971_0012179 | |||
| 1520 | Ga0466971_0035503 | |||
| 1521 | Ga0466971_0212633 | |||
| 1522 | Ga0466968_0019675 | |||
| 1523 | Ga0466970_0003938 | |||
| 1524 | Ga0466970_0035340 | |||
| 1525 | Ga0466970_0256475 | |||
| 1526 | Ga0466957_0000745 | |||
| 1527 | Ga0466957_0031958 | |||
| 1528 | Ga0466957_0094215 | |||
| 1529 | Ga0466957_0104329 | |||
| 1530 | Ga0466957_0107062 | |||
| 1531 | Ga0466960_0000676 | |||
| 1532 | Ga0466960_0001163 | |||
| 1533 | Ga0466960_0008943 | |||
| 1534 | Ga0466960_0032258 | |||
| 1535 | Ga0466960_0107507 | |||
| 1536 | Ga0466959_0004991 | |||
| 1537 | Ga0466959_0007534 | |||
| 1538 | Ga0466959_0085638 | |||
| 1539 | Ga0451576_0002303 | |||
| 1540 | Ga0466958_0025398 | |||
| 1541 | Ga0466958_0025883 | |||
| 1542 | Ga0466958_0065693 | |||
| 1543 | Ga0466958_0151001 | |||
| 1544 | Ga0466958_0218448 | |||
| 1545 | Ga0466967_0004929 | |||
| 1546 | Ga0466967_0005712 | |||
| 1547 | Ga0466967_0025571 | |||
| 1548 | Ga0466967_0096497 | |||
| 1549 | Ga0466967_0109818 | |||
| 1550 | Ga0466967_0113905 | |||
| 1551 | Ga0466967_0119347 | |||
| 1552 | Ga0466967_0364234 | |||
| 1553 | Ga0466967_0800520 | |||
| 1554 | Ga0495627_030337 | |||
| 1555 | Ga0495629_0013527 | |||
| 1556 | Ga0495629_0035066 | |||
| 1557 | Ga0495638_0000247 | |||
| 1558 | Ga0495638_0032134 | |||
| 1559 | Ga0495582_0070277 | |||
| 1560 | Ga0495639_0135663 | |||
| 1561 | Ga0495639_0221976 | |||
| 1562 | Ga0495662_0002485 | |||
| 1563 | Ga0495664_0026240 | |||
| 1564 | Ga0495594_0041725 | |||
| 1565 | Ga0495606_0013640 | |||
| 1566 | Ga0495648_0014127 | |||
| 1567 | Ga0495648_0166034 | |||
| 1568 | Ga0495652_0124456 | |||
| 1569 | Ga0495645_0034496 | |||
| 1570 | Ga0495633_0000025 | |||
| 1571 | Ga0495668_0000167 | |||
| 1572 | Ga0495634_0150728 | |||
| 1573 | Ga0495625_0211361 | |||
| 1574 | Ga0495658_0320962 | |||
| 1575 | Ga0495649_0180330 | |||
| 1576 | Ga0495581_0186004 | |||
| 1577 | Ga0495674_0069030 | |||
| 1578 | Ga0495672_0003415 | |||
| 1579 | Ga0495672_0005726 | |||
| 1580 | Ga0495672_0026705 | |||
| 1581 | Ga0495673_0003856 | |||
| 1582 | Ga0495686_0003681 | |||
| 1583 | Ga0495593_0008905 | |||
| 1584 | Ga0495593_0048945 | |||
| 1585 | Ga0496100_0000527 | |||
| 1586 | Ga0496100_0004078 | |||
| 1587 | Ga0496100_0006138 | |||
| 1588 | Ga0496100_0044083 | |||
| 1589 | Ga0496100_0158209 | |||
| 1590 | Ga0496101_0000002 | |||
| 1591 | Ga0496101_0000619 | |||
| 1592 | Ga0496101_0000765 | |||
| 1593 | Ga0496101_0010167 | |||
| 1594 | Ga0496101_0013978 | |||
| 1595 | Ga0496101_0097595 | |||
| 1596 | Ga0496102_0000009 | |||
| 1597 | Ga0496102_0000973 | |||
| 1598 | Ga0496102_0001870 | |||
| 1599 | Ga0496102_0056618 | |||
| 1600 | Ga0496102_0076687 | |||
| 1601 | Ga0496102_0287897 | |||
| 1602 | Ga0496103_0000005 | |||
| 1603 | Ga0496103_0000902 | |||
| 1604 | Ga0496103_0004390 | |||
| 1605 | Ga0496104_0055723 | |||
| 1606 | Ga0496104_0162034 | |||
| 1607 | Ga0496104_0656832 | |||
| 1608 | Ga0496105_0003833 | |||
| 1609 | Ga0496105_0090349 | |||
| 1610 | Ga0496105_0156982 | |||
| 1611 | Ga0496106_0010701 | |||
| 1612 | Ga0496106_0036460 | |||
| 1613 | Ga0496106_0093974 | |||
| 1614 | Ga0496106_0338540 | |||
| 1615 | Ga0496107_0010484 | |||
| 1616 | Ga0496107_0110606 | |||
| 1617 | Ga0496108_0004412 | |||
| 1618 | Ga0496108_0005920 | |||
| 1619 | Ga0496108_0169501 | |||
| 1620 | Ga0496108_0285505 | |||
| 1621 | Ga0496108_0791721 | |||
| 1622 | Ga0496109_0000747 | |||
| 1623 | Ga0496109_0041880 | |||
| 1624 | Ga0496109_0098003 | |||
| 1625 | Ga0496109_0140259 | |||
| 1626 | Ga0496109_0266160 | |||
| 1627 | Ga0496109_0533224 | |||
| 1628 | Ga0496110_0498686 | |||
| 1629 | Ga0496111_0010684 | |||
| 1630 | Ga0496111_0015233 | |||
| 1631 | Ga0496111_0168775 | |||
| 1632 | Ga0496112_0001525 | |||
| 1633 | Ga0496112_0009325 | |||
| 1634 | Ga0496112_0095459 | |||
| 1635 | Ga0496112_0712779 | |||
| 1636 | Ga0496113_0068329 | |||
| 1637 | Ga0496114_0000681 | |||
| 1638 | Ga0496114_0004256 | |||
| 1639 | Ga0496114_0014448 | |||
| 1640 | Ga0496114_0022813 | |||
| 1641 | Ga0496114_0091880 | |||
| 1642 | Ga0496114_0100517 | |||
| 1643 | Ga0496114_0124023 | |||
| 1644 | Ga0496114_0213249 | |||
| 1645 | Ga0496114_0244900 | |||
| 1646 | Ga0496114_0268628 | |||
| 1647 | Ga0496114_0313434 | |||
| 1648 | Ga0496114_0574702 | |||
| 1649 | Ga0496115_0009071 | |||
| 1650 | Ga0496115_0020330 | |||
| 1651 | Ga0496116_0000104 | |||
| 1652 | Ga0496116_0016923 | |||
| 1653 | Ga0496117_0000019 | |||
| 1654 | Ga0496117_0000028 | |||
| 1655 | Ga0496117_0000497 | |||
| 1656 | Ga0496117_0002095 | |||
| 1657 | Ga0496117_0031541 | |||
| 1658 | Ga0496118_0000020 | |||
| 1659 | Ga0496118_0000255 | |||
| 1660 | Ga0496118_0002066 | |||
| 1661 | Ga0496118_0037919 | |||
| 1662 | Ga0496118_0040589 | |||
| 1663 | Ga0496118_0131553 | |||
| 1664 | Ga0496119_0001830 | |||
| 1665 | Ga0496119_0004258 | |||
| 1666 | Ga0496119_0018843 | |||
| 1667 | Ga0496119_0028338 | |||
| 1668 | Ga0496120_0001838 | |||
| 1669 | Ga0496120_0029385 | |||
| 1670 | Ga0496120_0046233 | |||
| 1671 | Ga0496120_0081021 | |||
| 1672 | Ga0496121_0001252 | |||
| 1673 | Ga0496121_0007909 | |||
| 1674 | Ga0496122_0000522 | |||
| 1675 | Ga0496122_0000534 | |||
| 1676 | Ga0496122_0000877 | |||
| 1677 | Ga0496122_0001012 | |||
| 1678 | Ga0496122_0003004 | |||
| 1679 | Ga0496122_0020806 | |||
| 1680 | Ga0496122_0048687 | |||
| 1681 | Ga0496123_0000142 | |||
| 1682 | Ga0496123_0000251 | |||
| 1683 | Ga0496123_0001800 | |||
| 1684 | Ga0496123_0009604 | |||
| 1685 | Ga0496124_0000420 | |||
| 1686 | Ga0496124_0001505 | |||
| 1687 | Ga0496124_0002708 | |||
| 1688 | Ga0496124_0095728 | |||
| 1689 | Ga0496125_0000085 | |||
| 1690 | Ga0496125_0000214 | |||
| 1691 | Ga0496125_0000857 | |||
| 1692 | Ga0496125_0002891 | |||
| 1693 | Ga0496125_0004133 | |||
| 1694 | Ga0496125_0006476 | |||
| 1695 | Ga0496125_0011614 | |||
| 1696 | Ga0496125_0245183 | |||
| 1697 | Ga0496126_0000931 | |||
| 1698 | Ga0496126_0002688 | |||
| 1699 | Ga0496126_0008151 | |||
| 1700 | Ga0496126_0010295 | |||
| 1701 | Ga0496126_0012396 | |||
| 1702 | Ga0496126_0014320 | |||
| 1703 | Ga0496126_0023340 | |||
| 1704 | Ga0496126_0023445 | |||
| 1705 | Ga0496126_0029198 | |||
| 1706 | Ga0496126_0047354 | |||
| 1707 | Ga0496126_0052596 | |||
| 1708 | Ga0496126_0062705 | |||
| 1709 | Ga0496126_0068632 | |||
| 1710 | Ga0501031_0010829 | |||
| 1711 | Ga0501031_0029921 | |||
| 1712 | Ga0501032_0007655 | |||
| 1713 | Ga0501032_0042793 | |||
| 1714 | Ga0501033_0055147 | |||
| 1715 | Ga0501033_0062546 | |||
| 1716 | Ga0501033_0140939 | |||
| 1717 | Ga0501034_0002933 | |||
| 1718 | Ga0501034_0007765 | |||
| 1719 | Ga0501034_0018608 | |||
| 1720 | Ga0501034_0028244 | |||
| 1721 | Ga0501034_0052682 | |||
| 1722 | Ga0501034_0131828 | |||
| 1723 | Ga0501034_0307530 | |||
| 1724 | Ga0501034_0430569 | |||
| 1725 | Ga0501036_0018267 | |||
| 1726 | Ga0501036_0029322 | |||
| 1727 | Ga0501036_0125563 | |||
| 1728 | Ga0501037_0036272 | |||
| 1729 | Ga0501038_0021716 | |||
| 1730 | Ga0501038_0371429 | |||
| 1731 | Ga0501039_0450145 | |||
| 1732 | Ga0501040_0005707 | |||
| 1733 | Ga0501042_0019926 | |||
| 1734 | Ga0501043_0070417 | |||
| 1735 | Ga0501043_0220194 | |||
| 1736 | Ga0501046_0003054 | |||
| 1737 | Ga0501046_0083613 | |||
| 1738 | Ga0501046_0278524 | |||
| 1739 | Ga0501047_0004113 | |||
| 1740 | Ga0501047_0010633 | |||
| 1741 | Ga0501047_0013607 | |||
| 1742 | Ga0501047_0024057 | |||
| 1743 | Ga0501047_0046100 | |||
| 1744 | Ga0501047_0152736 | |||
| 1745 | Ga0501048_0042785 | |||
| 1746 | Ga0501048_0050206 | |||
| 1747 | Ga0501048_0073862 | |||
| 1748 | Ga0501067_0131736 | |||
| 1749 | Ga0501068_0096961 | |||
| 1750 | Ga0501068_0166478 | |||
| 1751 | Ga0501069_0037454 | |||
| 1752 | Ga0501070_0022067 | |||
| 1753 | Ga0501070_0088591 | |||
| 1754 | Ga0501070_0149810 | |||
| 1755 | Ga0501072_0020049 | |||
| 1756 | Ga0501072_0252526 | |||
| 1757 | Ga0501074_0081345 | |||
| 1758 | Ga0501075_0102029 | |||
| 1759 | Ga0501076_0059207 | |||
| 1760 | Ga0501222_004336 | |||
| 1761 | Ga0501238_004383 | |||
| 1762 | Ga0501238_016412 | |||
| 1763 | Ga0501242_000231 | |||
| 1764 | Ga0501257_001564 | |||
| 1765 | Ga0501259_006624 | |||
| 1766 | Ga0501079_0155365 | |||
| 1767 | Ga0501080_0046200 | |||
| 1768 | Ga0501080_0326391 | |||
| 1769 | Ga0501081_0101574 | |||
| 1770 | Ga0501083_0004945 | |||
| 1771 | Ga0501083_0035867 | |||
| 1772 | Ga0501083_0036714 | |||
| 1773 | Ga0501241_000961 | |||
| 1774 | Ga0501241_002804 | |||
| 1775 | Ga0501035_0000121 | |||
| 1776 | Ga0501035_0005068 | |||
| 1777 | Ga0501035_0006303 | |||
| 1778 | Ga0501035_0083466 | |||
| 1779 | Ga0501035_0105087 | |||
| 1780 | Ga0501035_0492572 | |||
| 1781 | Ga0501044_0001588 | |||
| 1782 | Ga0501044_0007597 | |||
| 1783 | Ga0501044_0042467 | |||
| 1784 | Ga0501044_0254659 | |||
| 1785 | Ga0501045_0031658 | |||
| 1786 | nmdc:mga03683_104824_c1 | |||
| 1787 | nmdc:mga03683_10497_c2 | |||
| 1788 | nmdc:mga03683_105877_c1 | |||
| 1789 | nmdc:mga03683_18147_c1 | |||
| 1790 | nmdc:mga03683_19145_c1 | |||
| 1791 | nmdc:mga03683_68955_c1 | |||
| 1792 | nmdc:mga03n38_12463_c1 | |||
| 1793 | nmdc:mga03n38_133606_c1 | |||
| 1794 | nmdc:mga03n38_150962_c1 | |||
| 1795 | nmdc:mga03n38_268483_c1 | |||
| 1796 | nmdc:mga03n38_3173_c1 | |||
| 1797 | nmdc:mga03n38_3177_c1 | |||
| 1798 | nmdc:mga03n38_345_c1 | |||
| 1799 | nmdc:mga03n38_4741_c1 | |||
| 1800 | nmdc:mga03n38_61508_c1 | |||
| 1801 | nmdc:mga03n38_97935_c1 | |||
| 1802 | nmdc:mga00v17_16536_c1 | |||
| 1803 | nmdc:mga00v17_188252_c1 | |||
| 1804 | nmdc:mga00v17_393798_c1 | |||
| 1805 | nmdc:mga00v17_42601_c1 | |||
| 1806 | nmdc:mga00v17_45625_c1 | |||
| 1807 | nmdc:mga00v17_6119_c1 | |||
| 1808 | nmdc:mga00v17_81554_c1 | |||
| 1809 | nmdc:mga00v17_96202_c1 | |||
| 1810 | nmdc:mga0yw44_13779_c1 | |||
| 1811 | nmdc:mga0yw44_157666_c1 | |||
| 1812 | nmdc:mga0yw44_161384_c1 | |||
| 1813 | nmdc:mga0yw44_17240_c1 | |||
| 1814 | nmdc:mga0yw44_18395_c1 | |||
| 1815 | nmdc:mga0yw44_24584_c1 | |||
| 1816 | nmdc:mga0yw44_4417_c1 | |||
| 1817 | nmdc:mga0yw44_455781_c1 | |||
| 1818 | nmdc:mga0yw44_51367_c1 | |||
| 1819 | nmdc:mga0yw44_58089_c1 | |||
| 1820 | nmdc:mga0yw44_5_c1 | |||
| 1821 | nmdc:mga0k408_105717_c1 | |||
| 1822 | nmdc:mga0k408_111139_c1 | |||
| 1823 | nmdc:mga0k408_298318_c1 | |||
| 1824 | nmdc:mga06z11_175467_c1 | |||
| 1825 | nmdc:mga06z11_226238_c1 | |||
| 1826 | nmdc:mga06z11_52945_c1 | |||
| 1827 | nmdc:mga04h51_4947_c1 | |||
| 1828 | nmdc:mga04h51_67847_c1 | |||
| 1829 | nmdc:mga07m45_116966_c1 | |||
| 1830 | nmdc:mga07m45_168_c1 | |||
| 1831 | nmdc:mga07m45_27678_c2 | |||
| 1832 | nmdc:mga07m45_45088_c1 | |||
| 1833 | nmdc:mga07m45_848_c1 | |||
| 1834 | nmdc:mga06r32_304478_c1 | |||
| 1835 | nmdc:mga08y16_162499_c1 | |||
| 1836 | nmdc:mga08y16_37703_c1 | |||
| 1837 | nmdc:mga08y16_494241_c1 | |||
| 1838 | nmdc:mga08y16_625945_c1 | |||
| 1839 | nmdc:mga0sz30_10947_c1 | |||
| 1840 | nmdc:mga0sz30_134848_c1 | |||
| 1841 | nmdc:mga0sz30_138812_c1 | |||
| 1842 | nmdc:mga0sz30_153935_c1 | |||
| 1843 | nmdc:mga0sz30_20167_c1 | |||
| 1844 | nmdc:mga0sz30_22654_c1 | |||
| 1845 | nmdc:mga0sz30_26935_c1 | |||
| 1846 | nmdc:mga0sz30_31676_c1 | |||
| 1847 | nmdc:mga0sz30_56_c1 | |||
| 1848 | nmdc:mga0sz30_6507_c2 | |||
| 1849 | nmdc:mga0sz30_99890_c1 | |||
| 1850 | Ga0495601_0140327 | |||
| 1851 | Ga0500610_0009933 | |||
| 1852 | Ga0500635_0011660 | |||
| 1853 | Ga0500643_001252 | |||
| 1854 | Ga0500643_001788 | |||
| 1855 | Ga0500643_002468 | |||
| 1856 | Ga0500643_009677 | |||
| 1857 | Ga0500646_0005272 | |||
| 1858 | Ga0500583_0000111 | |||
| 1859 | Ga0500651_0002354 | |||
| 1860 | Ga0500641_0005068 | |||
| 1861 | Ga0500641_0042974 | |||
| 1862 | Ga0500555_000023 | |||
| 1863 | Ga0500556_0067442 | |||
| 1864 | Ga0500562_007680 | |||
| 1865 | Ga0500569_000008 | |||
| 1866 | Ga0500569_024101 | |||
| 1867 | Ga0500608_103572 | |||
| 1868 | Ga0500652_000058 | |||
| 1869 | Ga0500652_000912 | |||
| 1870 | Ga0500655_002822 | |||
| 1871 | Ga0500658_0019173 | |||
| 1872 | Ga0500658_0113266 | |||
| 1873 | Ga0500559_0052503 | |||
| 1874 | Ga0500568_0009913 | |||
| 1875 | Ga0500568_0030043 | |||
| 1876 | Ga0500568_0087860 | |||
| 1877 | Ga0500573_0000080 | |||
| 1878 | Ga0500573_0002557 | |||
| 1879 | Ga0500573_0004692 | |||
| 1880 | Ga0500577_0000422 | |||
| 1881 | Ga0500588_0000023 | |||
| 1882 | Ga0500616_0001675 | |||
| 1883 | Ga0500616_0055766 | |||
| 1884 | Ga0500622_0000151 | |||
| 1885 | Ga0500633_0007500 | |||
| 1886 | Ga0500645_000108 | |||
| 1887 | Ga0500645_019002 | |||
| 1888 | Ga0500552_011595 | |||
| 1889 | Ga0501084_0022823 | |||
| 1890 | Ga0501084_0109917 | |||
| 1891 | Ga0501084_0452771 | |||
| 1892 | Ga0501082_0002655 | |||
| 1893 | Ga0501082_0237262 | |||
| 1894 | Ga0466962_0046998 | |||
| 1895 | 2548692431 | |||
| 1896 | 2552104972 | |||
| 1897 | 2552112726 | |||
| 1898 | 2643753076 | |||
| 1899 | 2643824472 | |||
| 1900 | 2644083629 | |||
| 1901 | 2644444390 | |||
| 1902 | 2644487542 | |||
| 1903 | 2644503208 | |||
| 1904 | 2644517325 | |||
| 1905 | 2644525518 | |||
| 1906 | 2644535731 | |||
| 1907 | 2644539284 | |||
| 1908 | 2644639107 | |||
| 1909 | 2644664174 | |||
| 1910 | 2644669602 | |||
| 1911 | 2729908320 | |||
| 1912 | 2738693132 | |||
| 1913 | 2738706650 | |||
| 1914 | 2739206427 | |||
| 1915 | 2739239235 | |||
| 1916 | 2739323294 | |||
| 1917 | 2739329825 | |||
| 1918 | 2739333268 | |||
| 1919 | 2739607900 | |||
| 1920 | 2744956108 | |||
| 1921 | 2747954531 | |||
| 1922 | 2753037297 | |||
| 1923 | 2753325166 | |||
| 1924 | 2758224495 | |||
| 1925 | 2760304089 | |||
| 1926 | 2760621959 | |||
| 1927 | 2774400308 | |||
| 1928 | 2795796733 | |||
| 1929 | 2809026796 | |||
| 1930 | 2809226790 | |||
| 1931 | 2812322393 | |||
| 1932 | 2812364680 | |||
| 1933 | 2816422681 | |||
| 1934 | 2819677426 | |||
| 1935 | 2821269312 | |||
| 1936 | 2835191215 | |||
| 1937 | 2839989572 | |||
| 1938 | 2840679241 | |||
| 1939 | 2842135319 | |||
| 1940 | 2842889849 | |||
| 1941 | 2857633039 | |||
| 1942 | 2857720978 | |||
| 1943 | 2870629669 | |||
| 1944 | 2870805214 | |||
| 1945 | 2884996107 | |||
| 1946 | 2889304189 | |||
| 1947 | 2895502688 | |||
| 1948 | 2896087052 | |||
| 1949 | 2896114337 | |||
| 1950 | 2902794162 | |||
| 1951 | 2902802910 | |||
| 1952 | 2902802927 | |||
| 1953 | 2902816006 | |||
| 1954 | 2902839628 | |||
| 1955 | 2904768367 | |||
| 1956 | 2904773969 | |||
| 1957 | 2904775766 | |||
| 1958 | 2906801150 | |||
| 1959 | 2908811725 | |||
| 1960 | 2919421738 | |||
| 1961 | 2919434704 | |||
| 1962 | 2919714777 | |||
| 1963 | 2922558077 | |||
| 1964 | 2928147071 | |||
| 1965 | 2929177185 | |||
| 1966 | 2929239608 | |||
| 1967 | 2929921238 | |||
| 1968 | 2932401281 | |||
| 1969 | 2932433180 | |||
| 1970 | 2935891556 | |||
| 1971 | 2939586058 | |||
| 1972 | 2939745417 | |||
| 1973 | 2945979552 | |||
| 1974 | 2946014580 | |||
| 1975 | 2946082443 | |||
| 1976 | 2974298098 | |||
| 1977 | 2974319682 | |||
| 1978 | 2974325666 | |||
| 1979 | 2977252102 | |||
| 1980 | 2977265853 | |||
| 1981 | 2984523550 | |||
| 1982 | 8003152528 | |||
| 1983 | 8056580823 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ftv-assembly2.cif.gz_C | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.9889 | 2 | 286 |
| 5fuh-assembly2.cif.gz_C | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.9871 | 2 | 286 |
| 4b2x-assembly2.cif.gz_B | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.9867 | 2 | 286 |
| 1mp4-assembly1.cif.gz_A | w224h variant of s. enterica rmla | 0.9858 | 2 | 284 |
| 4hoc-assembly2.cif.gz_B | crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n-acetylglucosamine | 0.9849 | 1 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b2xA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9843 | 2 | 285 | 3.90.550.10 |
| 4b2xA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9741 | 2 | 285 | 3.90.550.10 |
| 4ecmA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9454 | 1 | 237 | 3.90.550.10 |
| 5z0aE01 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9143 | 1 | 222 | 3.90.550.10 |
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9034 | 1 | 222 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351VA12-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9994 | 1 | 112 |
GO:0008879
GO:0045226 |
| AF-A0A561DDF8-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9988 | 1 | 122 |
GO:0008879
GO:0045226 |
| AF-A0A5K1ISM2-F1-model_v4 | Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) | 0.9988 | 1 | 80 |
GO:0008879
GO:0045226 |
| AF-A0A2G6VR69-F1-model_v4 | Multifunctional fusion protein [Includes: Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24); dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)] | 0.998 | 1 | 285 |
GO:0008460
GO:0008879 GO:0009225 GO:0045226 GO:0046872 |
| AF-A0A6I0DZI6-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9975 | 1 | 106 |
GO:0008879
GO:0045226 |