F487650

General Info

Members Datasets Scaffolds Average Seq Length
991 484 1983 287

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2547132424|2548692431
Length 299
Sequence ILAGGTGSRLHPITRGVSKQLVPVYDKPMVYYPLSTLMLAGVRDVLVITTPEDAESFRRLLGDGTQFGMSIDYVVQPEPDGLARAFVLGADHIGTDCAALVLGDNIFHGPGLGTRLRRFDGLDGGTVFAYRVSDPSAYGVIEFVGGKAVSIEEKPKLPRSSYAVPGLYFYDNDVVEIARGLRPSARGEYEITDINRTYLEQGRLRVETLARGTAWLDTGTFDSLLDAANYVRTIEERQGLKIGVPEEVAWRMGFIDDEQLSRLAEPLVRSGYGTYLMDLLTRGKNDGTTADEYRDEQDD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
202 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
203 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
204 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
209 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
210 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
220 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
235 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
241 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
242 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
243 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
244 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
245 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
246 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
247 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
250 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
251 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
252 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
253 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
254 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
255 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
256 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
257 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
260 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
266 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
348 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
349 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
350 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
351 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
352 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
355 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
356 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
361 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
362 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
363 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
364 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
365 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
366 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
373 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
374 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
375 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
376 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
379 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
380 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
381 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
382 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
383 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
384 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
385 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
386 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
387 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
388 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
389 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
390 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
391 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
394 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
395 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
396 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
397 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
398 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
399 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
400 2547132424 Nocardia nova SH22a Isolate Unclassified
401 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
402 2643221546 Microbacterium sp. Root53 Isolate Unclassified
403 2643221561 Nocardioides sp. Root151 Isolate Unclassified
404 2643221613 Oerskovia sp. Root22 Isolate Unclassified
405 2643221679 Angustibacter sp. Root456 Isolate Unclassified
406 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
407 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
408 2643221692 Nocardia sp. Root136 Isolate Unclassified
409 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
410 2643221696 Nocardioides sp. Root140 Isolate Unclassified
411 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
412 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
413 2643221721 Oerskovia sp. Root918 Isolate Unclassified
414 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
415 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
416 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
417 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
418 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
419 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
420 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
421 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
422 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
423 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
424 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
425 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
426 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
427 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
428 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
429 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
430 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
431 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
432 2808606394 Promicromonospora sp. C35 Isolate Unclassified
433 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
434 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
435 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
436 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
437 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
438 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
439 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
440 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
441 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
442 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
443 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
444 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
445 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
446 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
447 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
448 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
449 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
450 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
451 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
452 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
453 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
454 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
455 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
456 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
457 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
458 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
459 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
460 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
461 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
462 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
463 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
464 2922554459 Rhodococcus sp. 66b Isolate Unclassified
465 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
466 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
467 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
468 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
469 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
470 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
471 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
472 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
473 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
474 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
475 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
476 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
477 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
478 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
479 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
480 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
481 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
482 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
483 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
484 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.62
Metatranscriptomes 0.4
Isolates 8.98

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 18.06
Nodule 0.1
Rhizoplane 7.06
Rhizosphere 59.54
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_300488 2162886007 Bacteria 4246
2 JGI24746J21847_1001168 3300001977 Bacteria 4151
3 JGI24740J21852_10001780 3300001979 Bacteria 9878
4 JGI24739J22299_10002055 3300001989 Bacteria 7703
5 JGI24744J21845_10001990 3300002077 Bacteria 4135
6 JGI24744J21845_10006209 3300002077 Bacteria 2480
7 JGI25154J39366_1000002 3300002738 Bacteria 466942
8 JGI25154J39366_1001681 3300002738 Bacteria 7309
9 JGI25153J46596_10008393 3300003215 Bacteria 4941
10 rootL2_10022523 3300003322 Bacteria 1966
11 rootL2_10081697 3300003322 Bacteria 3459
12 rootH1_10000619 3300003316 Bacteria 3651
13 rootH1_10000619 3300003323 Bacteria 100005
14 rootH1_10000732 3300003323 Bacteria 17056
15 rootH1_10040576 3300003323 Bacteria 6667
16 rootH1_10137115 3300003323 Bacteria 4229
17 JGI25160J50197_1001555 3300003354 Bacteria 11368
18 JGI25160J50197_1008496 3300003354 Bacteria 3907
19 Ga0006562J51391_1044531 3300003578 Bacteria 3718
20 Ga0006562J51391_1044534 3300003578 Bacteria 1780
21 Ga0055528_1000422 3300003790 Bacteria 34012
22 Ga0055530_10000475 3300003791 Bacteria 34908
23 Ga0055540_1007250 3300003792 Bacteria 4230
24 Ga0055540_1007673 3300003792 Bacteria 4023
25 Ga0055540_1022563 3300003792 Bacteria 1607
26 Ga0055540_1031088 3300003792 Bacteria 1230
27 Ga0055531_10000014 3300003794 Bacteria 184532
28 Ga0065165_1000258 3300005262 Bacteria 91861
29 Ga0065165_1002847 3300005262 Bacteria 13435
30 Ga0065165_1024739 3300005262 Bacteria 2011
31 Ga0065704_10073688 3300005289 Bacteria 6887
32 Ga0070658_10000839 3300005327 Bacteria 26240
33 Ga0070658_10040088 3300005327 Bacteria 3779
34 Ga0070676_10089790 3300005328 Bacteria 1880
35 Ga0070676_10114154 3300005328 Bacteria 1686
36 Ga0070683_100024499 3300005329 Bacteria 5407
37 Ga0070683_100112109 3300005329 Bacteria 2574
38 Ga0070683_100562634 3300005329 Bacteria 1090
39 Ga0070690_100002005 3300005330 Bacteria 10847
40 Ga0068869_100046160 3300005334 Bacteria 3141
41 Ga0070666_10060925 3300005335 Bacteria 2554
42 Ga0070680_100023828 3300005336 Bacteria 4885
43 Ga0070680_100177905 3300005336 Bacteria 1791
44 Ga0070682_100003922 3300005337 Bacteria 8255
45 Ga0068868_100000721 3300005338 Bacteria 22318
46 Ga0068868_100083622 3300005338 Bacteria 2563
47 Ga0070660_100000275 3300005339 Bacteria 34274
48 Ga0070660_100010827 3300005339 Bacteria 6456
49 Ga0070689_100058091 3300005340 Bacteria 3004
50 Ga0070691_10010747 3300005341 Bacteria 4179
51 Ga0070692_10030196 3300005345 Bacteria 2708
52 Ga0070668_100001176 3300005347 Bacteria 18508
53 Ga0070668_100051114 3300005347 Bacteria 3184
54 Ga0070668_100104218 3300005347 Bacteria 2251
55 Ga0070669_100044641 3300005353 Bacteria 3229
56 Ga0070671_100045381 3300005355 Bacteria 3653
57 Ga0070674_100024056 3300005356 Bacteria 3951
58 Ga0070673_100559931 3300005364 Bacteria 1039
59 Ga0070659_100001086 3300005366 Bacteria 19840
60 Ga0070659_100055713 3300005366 Bacteria 3117
61 Ga0070667_100001332 3300005367 Bacteria 22171
62 Ga0070667_100011524 3300005367 Bacteria 7311
63 Ga0070709_10093423 3300005434 Bacteria 1988
64 Ga0070714_100059440 3300005435 Bacteria 3277
65 Ga0070714_100103843 3300005435 Bacteria 2507
66 Ga0070710_10003466 3300005437 Bacteria 7477
67 Ga0070701_10001177 3300005438 Bacteria 9599
68 Ga0070701_10093432 3300005438 Bacteria 1653
69 Ga0070711_100001348 3300005439 Bacteria 13404
70 Ga0070711_100013605 3300005439 Bacteria 5112
71 Ga0070705_100006092 3300005440 Bacteria 5901
72 Ga0070705_100104729 3300005440 Bacteria 1794
73 Ga0070700_100002213 3300005441 Bacteria 9895
74 Ga0070694_100009996 3300005444 Bacteria 5833
75 Ga0070663_100005044 3300005455 Bacteria 7801
76 Ga0070663_100024173 3300005455 Bacteria 4085
77 Ga0070663_100211764 3300005455 Bacteria 1518
78 Ga0070678_100000690 3300005456 Bacteria 16671
79 Ga0070662_100020728 3300005457 Bacteria 4482
80 Ga0070662_100031415 3300005457 Bacteria 3726
81 Ga0070681_10050063 3300005458 Bacteria 4169
82 Ga0068867_100002146 3300005459 Bacteria 13834
83 Ga0068867_100029761 3300005459 Bacteria 3936
84 Ga0070685_10050961 3300005466 Bacteria 2393
85 Ga0070685_10094756 3300005466 Bacteria 1814
86 Ga0070699_100252882 3300005518 Bacteria 1575
87 Ga0070679_100009071 3300005530 Bacteria 9383
88 Ga0070679_100009808 3300005530 Bacteria 9059
89 Ga0070684_100132720 3300005535 Bacteria 2247
90 Ga0070684_100531578 3300005535 Bacteria 1090
91 Ga0070697_100161948 3300005536 Bacteria 1890
92 Ga0068853_100002060 3300005539 Bacteria 14892
93 Ga0068853_100020442 3300005539 Bacteria 5506
94 Ga0068853_100192290 3300005539 Bacteria 1854
95 Ga0068853_100535977 3300005539 Bacteria 1108
96 Ga0070672_100025016 3300005543 Bacteria 4421
97 Ga0070696_100001539 3300005546 Bacteria 15125
98 Ga0070665_100008709 3300005548 Bacteria 10266
99 Ga0070665_100133519 3300005548 Bacteria 2484
100 Ga0070704_100000342 3300005549 Bacteria 21195
101 Ga0068855_100081453 3300005563 Bacteria 3752
102 Ga0070664_100052079 3300005564 Bacteria 3467
103 Ga0068857_100112040 3300005577 Bacteria 2453
104 Ga0068854_100005978 3300005578 Bacteria 7710
105 Ga0068856_100000060 3300005614 Bacteria 101415
106 Ga0070702_100002910 3300005615 Bacteria 7539
107 Ga0070702_100071989 3300005615 Bacteria 2045
108 Ga0068852_100000088 3300005616 Bacteria 64778
109 Ga0068852_100155424 3300005616 Bacteria 2130
110 Ga0068852_100411137 3300005616 Bacteria 1333
111 Ga0068859_100002678 3300005617 Bacteria 18089
112 Ga0068859_100008165 3300005617 Bacteria 10620
113 Ga0068859_100275432 3300005617 Bacteria 1775
114 Ga0068864_100268459 3300005618 Bacteria 1589
115 Ga0068864_100622843 3300005618 Bacteria 1049
116 Ga0068866_10003250 3300005718 Bacteria 6693
117 Ga0068866_10030623 3300005718 Bacteria 2584
118 Ga0068866_10079925 3300005718 Bacteria 1753
119 Ga0068861_100024884 3300005719 Bacteria 4335
120 Ga0068861_100380020 3300005719 Bacteria 1248
121 Ga0068863_100000205 3300005841 Bacteria 63387
122 Ga0068863_100303094 3300005841 Bacteria 1550
123 Ga0068858_100000569 3300005842 Bacteria 38556
124 Ga0068858_100021662 3300005842 Bacteria 6007
125 Ga0068858_100069863 3300005842 Bacteria 3255
126 Ga0068858_100247683 3300005842 Bacteria 1692
127 Ga0068860_100000472 3300005843 Bacteria 50060
128 Ga0068860_100018155 3300005843 Bacteria 6847
129 Ga0068862_100000030 3300005844 Bacteria 182487
130 Ga0068862_100001196 3300005844 Bacteria 24474
131 Ga0068862_100161763 3300005844 Bacteria 1999
132 Ga0081455_10021717 3300005937 Bacteria 6012
133 Ga0081455_10048739 3300005937 Bacteria 3657
134 Ga0081455_10090423 3300005937 Bacteria 2482
135 Ga0081455_10116704 3300005937 Bacteria 2111
136 Ga0081455_10130098 3300005937 Bacteria 1970
137 Ga0081455_10231688 3300005937 Bacteria 1363
138 Ga0081539_10002644 3300005985 Bacteria 24458
139 Ga0075365_10003949 3300006038 Bacteria 7767
140 Ga0075365_10005987 3300006038 Bacteria 6637
141 Ga0075365_10020421 3300006038 Bacteria 4106
142 Ga0075365_10031290 3300006038 Bacteria 3413
143 Ga0075365_10092721 3300006038 Bacteria 2059
144 Ga0075365_10103317 3300006038 Bacteria 1953
145 Ga0075365_10140446 3300006038 Bacteria 1677
146 Ga0075365_10155329 3300006038 Bacteria 1592
147 Ga0075365_10198509 3300006038 Bacteria 1405
148 Ga0075368_10030850 3300006042 Bacteria 2077
149 Ga0075363_100000097 3300006048 Bacteria 19438
150 Ga0075363_100002740 3300006048 Bacteria 7294
151 Ga0075363_100003750 3300006048 Bacteria 6541
152 Ga0075363_100006637 3300006048 Bacteria 5273
153 Ga0075363_100016375 3300006048 Bacteria 3662
154 Ga0075363_100019871 3300006048 Bacteria 3362
155 Ga0075363_100019973 3300006048 Bacteria 3355
156 Ga0075363_100026690 3300006048 Bacteria 2956
157 Ga0075363_100135286 3300006048 Bacteria 1385
158 Ga0075363_100193264 3300006048 Bacteria 1161
159 Ga0075364_10008403 3300006051 Bacteria 6170
160 Ga0075364_10009086 3300006051 Bacteria 5952
161 Ga0075364_10011846 3300006051 Bacteria 5310
162 Ga0075364_10016734 3300006051 Bacteria 4567
163 Ga0075364_10028145 3300006051 Bacteria 3596
164 Ga0075364_10044912 3300006051 Bacteria 2875
165 Ga0075364_10061062 3300006051 Bacteria 2471
166 Ga0075364_10076481 3300006051 Bacteria 2209
167 Ga0075364_10083783 3300006051 Bacteria 2111
168 Ga0075364_10117162 3300006051 Bacteria 1781
169 Ga0075364_10135515 3300006051 Bacteria 1654
170 Ga0070715_10000745 3300006163 Bacteria 8784
171 Ga0070716_100002545 3300006173 Bacteria 8435
172 Ga0070716_100052081 3300006173 Bacteria 2330
173 Ga0070712_100001630 3300006175 Bacteria 13741
174 Ga0070712_100008920 3300006175 Bacteria 6315
175 Ga0070712_100163325 3300006175 Bacteria 1722
176 Ga0075362_10068099 3300006177 Bacteria 1621
177 Ga0075367_10058747 3300006178 Bacteria 2289
178 Ga0075367_10121915 3300006178 Bacteria 1607
179 Ga0075367_10182849 3300006178 Bacteria 1307
180 Ga0075369_10003213 3300006186 Bacteria 5931
181 Ga0075369_10017544 3300006186 Bacteria 2903
182 Ga0075369_10023785 3300006186 Bacteria 2535
183 Ga0075369_10034608 3300006186 Bacteria 2144
184 Ga0075369_10042008 3300006186 Bacteria 1959
185 Ga0075369_10044597 3300006186 Bacteria 1905
186 Ga0075369_10079851 3300006186 Bacteria 1450
187 Ga0075369_10133245 3300006186 Bacteria 1130
188 Ga0075366_10004918 3300006195 Bacteria 7207
189 Ga0075366_10023876 3300006195 Bacteria 3563
190 Ga0075366_10166895 3300006195 Bacteria 1335
191 Ga0097621_100009990 3300006237 Bacteria 6917
192 Ga0075370_10020303 3300006353 Bacteria 3629
193 Ga0075370_10067844 3300006353 Bacteria 2036
194 Ga0075370_10232545 3300006353 Bacteria 1091
195 Ga0068871_100039173 3300006358 Bacteria 3791
196 Ga0068871_100083216 3300006358 Bacteria 2654
197 Ga0075428_100023471 3300006844 Bacteria 6827
198 Ga0075428_100431309 3300006844 Bacteria 1412
199 Ga0075431_100385090 3300006847 Bacteria 1406
200 Ga0068865_100000869 3300006881 Bacteria 17113
201 Ga0097620_100002678 3300006931 Bacteria 18089
202 Ga0097620_100008165 3300006931 Bacteria 10620
203 Ga0097620_100275455 3300006931 Bacteria 1775
204 Ga0105244_10013007 3300009036 Bacteria 4888
205 Ga0105250_10062958 3300009092 Bacteria 1493
206 Ga0105240_10000030 3300009093 Bacteria 321312
207 Ga0111539_10040373 3300009094 Bacteria 5618
208 Ga0111539_10421043 3300009094 Bacteria 1555
209 Ga0111539_10535286 3300009094 Bacteria 1365
210 Ga0105245_10001960 3300009098 Bacteria 18684
211 Ga0105247_10000008 3300009101 Bacteria 391450
212 Ga0105247_10000731 3300009101 Bacteria 25571
213 Ga0105247_10024985 3300009101 Bacteria 3603
214 Ga0105247_10046848 3300009101 Bacteria 2654
215 Ga0114129_10234720 3300009147 Bacteria 2469
216 Ga0105243_10003737 3300009148 Bacteria 12202
217 Ga0105243_10004909 3300009148 Bacteria 10484
218 Ga0105243_10484947 3300009148 Bacteria 1168
219 Ga0105241_10005394 3300009174 Bacteria 9454
220 Ga0105242_10001062 3300009176 Bacteria 21595
221 Ga0105248_10000257 3300009177 Bacteria 62094
222 Ga0105248_10011362 3300009177 Bacteria 9814
223 Ga0105248_10092787 3300009177 Bacteria 3400
224 Ga0105248_10136665 3300009177 Bacteria 2765
225 Ga0105237_10000001 3300009545 Bacteria 1009213
226 Ga0105237_10001184 3300009545 Bacteria 34869
227 Ga0105237_10064418 3300009545 Bacteria 3662
228 Ga0105238_10132643 3300009551 Bacteria 2469
229 Ga0105238_10509971 3300009551 Bacteria 1204
230 Ga0105249_10000036 3300009553 Bacteria 198578
231 Ga0105249_10002637 3300009553 Bacteria 15512
232 Ga0105249_10062183 3300009553 Bacteria 3428
233 Ga0105239_10003290 3300010375 Bacteria 19920
234 Ga0105239_10021671 3300010375 Bacteria 7083
235 Ga0105239_10059620 3300010375 Bacteria 4189
236 Ga0105239_10281419 3300010375 Bacteria 1872
237 Ga0105246_10000069 3300011119 Bacteria 42493
238 Ga0105246_10013466 3300011119 Bacteria 5129
239 Ga0157373_10001378 3300013100 Bacteria 18643
240 Ga0157371_10005033 3300013102 Bacteria 11313
241 Ga0157371_10027957 3300013102 Bacteria 4086
242 Ga0157370_10000812 3300013104 Bacteria 39488
243 Ga0157370_10000984 3300013104 Bacteria 36041
244 Ga0157370_10048608 3300013104 Bacteria 4063
245 Ga0157369_10000026 3300013105 Bacteria 216023
246 Ga0157369_10000851 3300013105 Bacteria 38900
247 Ga0157369_10008059 3300013105 Bacteria 12081
248 Ga0157374_10019012 3300013296 Bacteria 6076
249 Ga0157378_10003646 3300013297 Bacteria 13637
250 Ga0157378_10114883 3300013297 Bacteria 2473
251 Ga0157378_10319677 3300013297 Bacteria 1507
252 Ga0163162_10015231 3300013306 Bacteria 7511
253 Ga0163162_10104859 3300013306 Bacteria 2922
254 Ga0157372_10000007 3300013307 Bacteria 340690
255 Ga0157372_10000027 3300013307 Bacteria 186906
256 Ga0157372_10006391 3300013307 Bacteria 12536
257 Ga0157372_10085822 3300013307 Bacteria 3571
258 Ga0157372_10213109 3300013307 Bacteria 2238
259 Ga0157375_10002986 3300013308 Bacteria 14691
260 Ga0157375_10177231 3300013308 Bacteria 2282
261 Ga0157375_10238090 3300013308 Bacteria 1979
262 Ga0157375_10260849 3300013308 Bacteria 1894
263 Ga0157380_10000595 3300014326 Bacteria 22279
264 Ga0157380_10004722 3300014326 Bacteria 9482
265 Ga0157380_10069047 3300014326 Bacteria 2850
266 Ga0157380_10144834 3300014326 Bacteria 2046
267 Ga0157377_10023666 3300014745 Bacteria 3259
268 Ga0157377_10035244 3300014745 Bacteria 2744
269 Ga0157379_10040132 3300014968 Bacteria 4177
270 Ga0157376_10433754 3300014969 Bacteria 1278
271 Ga0157376_10721345 3300014969 Bacteria 1004
272 Ga0163161_10001886 3300017792 Bacteria 15293
273 Ga0163161_10066742 3300017792 Bacteria 2627
274 Ga0163161_10210792 3300017792 Bacteria 1501
275 Ga0163161_10310074 3300017792 Bacteria 1245
276 Ga0206351_10585983 3300020077 Bacteria 1404
277 Ga0213876_10232144 3300021384 Bacteria 981
278 Ga0213875_10032182 3300021388 Bacteria 2479
279 Ga0224712_10004555 3300022467 Bacteria 3752
280 Ga0209436_100440 3300025208 Bacteria 18624
281 Ga0209258_100029 3300025242 Bacteria 490648
282 Ga0209646_1000005 3300025246 Bacteria 717627
283 Ga0209646_1000041 3300025246 Bacteria 346024
284 Ga0209026_1000169 3300025250 Bacteria 100088
285 Ga0209148_1000089 3300025254 Bacteria 253548
286 Ga0209673_1000049 3300025273 Bacteria 286207
287 Ga0209130_1001814 3300025284 Bacteria 12415
288 Ga0209564_1011681 3300025295 Bacteria 3908
289 Ga0209758_1000346 3300025297 Bacteria 84821
290 Ga0209758_1023829 3300025297 Bacteria 2751
291 Ga0209758_1029351 3300025297 Bacteria 2302
292 Ga0209050_1000272 3300025298 Bacteria 110636
293 Ga0207426_1000233 3300025302 Bacteria 127848
294 Ga0207426_1000381 3300025302 Bacteria 76038
295 Ga0207426_1001311 3300025302 Bacteria 21230
296 Ga0209051_1000807 3300025303 Bacteria 32813
297 Ga0209051_1000884 3300025303 Bacteria 30128
298 Ga0209051_1001910 3300025303 Bacteria 16205
299 Ga0209051_1013992 3300025303 Bacteria 3775
300 Ga0209051_1024837 3300025303 Bacteria 2455
301 Ga0209257_1000004 3300025304 Bacteria 1678347
302 Ga0209257_1001525 3300025304 Bacteria 27049
303 Ga0207653_10026046 3300025885 Bacteria 1873
304 Ga0207692_10002339 3300025898 Bacteria 7275
305 Ga0207692_10025260 3300025898 Bacteria 2772
306 Ga0207642_10004559 3300025899 Bacteria 4474
307 Ga0207710_10000006 3300025900 Bacteria 538831
308 Ga0207710_10020197 3300025900 Bacteria 2847
309 Ga0207710_10035899 3300025900 Bacteria 2183
310 Ga0207710_10053271 3300025900 Bacteria 1820
311 Ga0207710_10095729 3300025900 Bacteria 1395
312 Ga0207688_10000313 3300025901 Bacteria 22327
313 Ga0207688_10002177 3300025901 Bacteria 10553
314 Ga0207680_10032508 3300025903 Bacteria 2966
315 Ga0207647_10024977 3300025904 Bacteria 3934
316 Ga0207685_10008972 3300025905 Bacteria 2882
317 Ga0207699_10002972 3300025906 Bacteria 8061
318 Ga0207699_10180791 3300025906 Bacteria 1418
319 Ga0207645_10036984 3300025907 Bacteria 3134
320 Ga0207705_10000934 3300025909 Bacteria 23858
321 Ga0207705_10009390 3300025909 Bacteria 7111
322 Ga0207654_10037773 3300025911 Bacteria 2705
323 Ga0207695_10000009 3300025913 Bacteria 1034276
324 Ga0207671_10000003 3300025914 Bacteria 1065461
325 Ga0207671_10016681 3300025914 Bacteria 5700
326 Ga0207671_10038019 3300025914 Bacteria 3568
327 Ga0207671_10127161 3300025914 Bacteria 1953
328 Ga0207693_10001545 3300025915 Bacteria 20341
329 Ga0207693_10005615 3300025915 Bacteria 10430
330 Ga0207693_10278334 3300025915 Bacteria 1311
331 Ga0207663_10005432 3300025916 Bacteria 6419
332 Ga0207663_10020877 3300025916 Bacteria 3717
333 Ga0207660_10062382 3300025917 Bacteria 2685
334 Ga0207660_10133331 3300025917 Bacteria 1893
335 Ga0207660_10140232 3300025917 Bacteria 1848
336 Ga0207657_10000296 3300025919 Bacteria 53043
337 Ga0207657_10006095 3300025919 Bacteria 12537
338 Ga0207657_10135891 3300025919 Bacteria 2012
339 Ga0207657_10175395 3300025919 Bacteria 1735
340 Ga0207652_10283537 3300025921 Bacteria 1494
341 Ga0207681_10006042 3300025923 Bacteria 7427
342 Ga0207681_10018534 3300025923 Bacteria 4386
343 Ga0207681_10178094 3300025923 Bacteria 1617
344 Ga0207694_10110938 3300025924 Bacteria 2182
345 Ga0207659_10156875 3300025926 Bacteria 1783
346 Ga0207687_10001949 3300025927 Bacteria 14199
347 Ga0207664_10232658 3300025929 Bacteria 1602
348 Ga0207644_10276552 3300025931 Bacteria 1347
349 Ga0207690_10007615 3300025932 Bacteria 6423
350 Ga0207690_10019135 3300025932 Bacteria 4209
351 Ga0207690_10376038 3300025932 Bacteria 1128
352 Ga0207706_10034196 3300025933 Bacteria 4522
353 Ga0207706_10154063 3300025933 Bacteria 2022
354 Ga0207686_10005130 3300025934 Bacteria 7039
355 Ga0207709_10001364 3300025935 Bacteria 17148
356 Ga0207709_10001848 3300025935 Bacteria 14102
357 Ga0207709_10127649 3300025935 Bacteria 1728
358 Ga0207709_10502277 3300025935 Bacteria 946
359 Ga0207670_10018652 3300025936 Bacteria 4224
360 Ga0207669_10004474 3300025937 Bacteria 6159
361 Ga0207669_10054775 3300025937 Bacteria 2411
362 Ga0207704_10000673 3300025938 Bacteria 15118
363 Ga0207704_10395969 3300025938 Bacteria 1088
364 Ga0207665_10000142 3300025939 Bacteria 48305
365 Ga0207665_10001800 3300025939 Bacteria 14438
366 Ga0207691_10012555 3300025940 Bacteria 8120
367 Ga0207711_10000269 3300025941 Bacteria 56180
368 Ga0207711_10083596 3300025941 Bacteria 2793
369 Ga0207711_10202498 3300025941 Bacteria 1812
370 Ga0207711_10466800 3300025941 Bacteria 1175
371 Ga0207689_10019613 3300025942 Bacteria 5699
372 Ga0207689_10021202 3300025942 Bacteria 5462
373 Ga0207689_10039105 3300025942 Bacteria 3928
374 Ga0207661_10015302 3300025944 Bacteria 5642
375 Ga0207661_10016982 3300025944 Bacteria 5376
376 Ga0207661_10469370 3300025944 Bacteria 1148
377 Ga0207661_10480087 3300025944 Bacteria 1135
378 Ga0207679_10061833 3300025945 Bacteria 2789
379 Ga0207679_10233631 3300025945 Bacteria 1554
380 Ga0207712_10000036 3300025961 Bacteria 198586
381 Ga0207712_10006069 3300025961 Bacteria 7625
382 Ga0207712_10139732 3300025961 Bacteria 1857
383 Ga0207668_10001315 3300025972 Bacteria 14758
384 Ga0207668_10020654 3300025972 Bacteria 4189
385 Ga0207668_10072425 3300025972 Bacteria 2465
386 Ga0207640_10219956 3300025981 Bacteria 1453
387 Ga0207658_10000060 3300025986 Bacteria 119956
388 Ga0207658_10010136 3300025986 Bacteria 6403
389 Ga0207658_10299112 3300025986 Bacteria 1386
390 Ga0207677_10003046 3300026023 Bacteria 8863
391 Ga0207703_10016131 3300026035 Bacteria 5824
392 Ga0207703_10161908 3300026035 Bacteria 1960
393 Ga0207703_10269055 3300026035 Bacteria 1543
394 Ga0207703_10374281 3300026035 Bacteria 1316
395 Ga0207639_10189777 3300026041 Bacteria 1754
396 Ga0207678_10019583 3300026067 Bacteria 5948
397 Ga0207678_10021554 3300026067 Bacteria 5651
398 Ga0207678_10054346 3300026067 Bacteria 3449
399 Ga0207678_10071723 3300026067 Bacteria 2969
400 Ga0207708_10011837 3300026075 Bacteria 6496
401 Ga0207708_10025429 3300026075 Bacteria 4478
402 Ga0207708_10040442 3300026075 Bacteria 3555
403 Ga0207702_10000097 3300026078 Bacteria 101497
404 Ga0207641_10000302 3300026088 Bacteria 61385
405 Ga0207641_10034256 3300026088 Bacteria 4223
406 Ga0207648_10000979 3300026089 Bacteria 32219
407 Ga0207648_10011185 3300026089 Bacteria 8463
408 Ga0207648_10088431 3300026089 Bacteria 2705
409 Ga0207648_10169180 3300026089 Bacteria 1931
410 Ga0207676_10265474 3300026095 Bacteria 1552
411 Ga0207674_10127799 3300026116 Bacteria 2506
412 Ga0207675_100001993 3300026118 Bacteria 20366
413 Ga0207675_100007416 3300026118 Bacteria 10364
414 Ga0207675_100196209 3300026118 Bacteria 1938
415 Ga0207675_100224355 3300026118 Bacteria 1811
416 Ga0207683_10000334 3300026121 Bacteria 42872
417 Ga0207683_10024839 3300026121 Bacteria 5163
418 Ga0207698_10000072 3300026142 Bacteria 67649
419 Ga0207698_10070853 3300026142 Bacteria 2764
420 Ga0207698_10136079 3300026142 Bacteria 2108
421 Ga0207698_10297577 3300026142 Bacteria 1501
422 Ga0268266_10009911 3300028379 Bacteria 8370
423 Ga0268266_10055011 3300028379 Bacteria 3420
424 Ga0268266_10486737 3300028379 Bacteria 1177
425 Ga0268265_10000038 3300028380 Bacteria 198640
426 Ga0268265_10025828 3300028380 Bacteria 4174
427 Ga0268265_10232811 3300028380 Bacteria 1620
428 Ga0268264_10000056 3300028381 Bacteria 310339
429 Ga0268264_10000280 3300028381 Bacteria 86361
430 Ga0268264_10012887 3300028381 Bacteria 6877
431 Ga0268264_10145565 3300028381 Bacteria 2118
432 Ga0265334_10042138 3300028573 Bacteria 1781
433 Ga0314311_1127295 3300030733 Bacteria 1086
434 Ga0316183_1077323 3300030742 Bacteria 10817
435 Ga0316182_1395692 3300030745 Bacteria 2333
436 Ga0265325_10032299 3300031241 Bacteria 2795
437 Ga0265327_10000358 3300031251 Bacteria 86964
438 Ga0307509_10041006 3300031507 Bacteria 5030
439 Ga0316575_10000545 3300031665 Bacteria 11057
440 Ga0316576_10010593 3300031727 Bacteria 6000
441 Ga0316578_10065381 3300031728 Bacteria 2147
442 Ga0316578_10080776 3300031728 Bacteria 1934
443 Ga0307516_10048220 3300031730 Unclassified 4192
444 Ga0307413_10188979 3300031824 Bacteria 1477
445 Ga0307410_10168074 3300031852 Bacteria 1650
446 Ga0307406_10092427 3300031901 Bacteria 2040
447 Ga0307406_10371703 3300031901 Bacteria 1124
448 Ga0307412_10216045 3300031911 Bacteria 1467
449 Ga0307409_100070227 3300031995 Bacteria 2779
450 Ga0307409_100086893 3300031995 Bacteria 2547
451 Ga0307409_100315286 3300031995 Bacteria 1461
452 Ga0307409_100378253 3300031995 Bacteria 1345
453 Ga0307409_100530650 3300031995 Bacteria 1152
454 Ga0307416_100284935 3300032002 Bacteria 1632
455 Ga0307414_10397765 3300032004 Bacteria 1196
456 Ga0307414_10646801 3300032004 Bacteria 953
457 Ga0373959_0000224 3300034820 Bacteria 12394
458 Ga0373928_0008874 3300035084 Bacteria 1960
459 Ga0373939_0009652 3300035114 Bacteria 2398
460 Ga0373941_0016813 3300035115 Bacteria 1995
461 Ga0373960_0040098 3300035121 Bacteria 1350
462 Ga0373943_0180749 3300035170 Bacteria 1159
463 Ga0316574_0019163 3300035398 Bacteria 4034
464 Ga0316574_0180511 3300035398 Bacteria 1358
465 Ga0373931_0112383 3300035691 Bacteria 1547
466 Ga0373931_0146781 3300035691 Bacteria 1372
467 Ga0373933_0062717 3300035724 Bacteria 2246
468 Ga0316584_0008378 3300036712 Bacteria 7122
469 Ga0316584_0043583 3300036712 Bacteria 3346
470 Ga0373925_0318038 3300037068 Bacteria 1259
471 Ga0373925_0359321 3300037068 Bacteria 1184
472 Ga0395899_0251107 3300037312 Bacteria 1214
473 Ga0395898_0059405 3300037466 Bacteria 3720
474 Ga0395898_0474252 3300037466 Bacteria 1191
475 Ga0436364_0095068 3300037853 Bacteria 2355
476 Ga0436364_0151759 3300037853 Bacteria 4832
477 Ga0436364_0727309 3300037853 Bacteria 1640
478 Ga0395901_0488453 3300038443 Bacteria 1255
479 Ga0400485_08773 3300038735 Bacteria 119523
480 Ga0400486_28732 3300038742 Bacteria 31623
481 Ga0436365_0943842 3300039437 Bacteria 40181
482 Ga0436365_1146896 3300039437 Bacteria 7362
483 Ga0436365_1195958 3300039437 Bacteria 52983
484 Ga0436360_0313352 3300039438 Bacteria 1875
485 Ga0436363_0708325 3300039450 Bacteria 1520
486 Ga0439436_0028907 3300041404 Bacteria 1616
487 Ga0439461_0009888 3300041410 Bacteria 1739
488 Ga0439466_0003018 3300041411 Bacteria 6563
489 Ga0439466_0029723 3300041411 Bacteria 1878
490 Ga0439466_0067199 3300041411 Bacteria 1147
491 Ga0439465_0012327 3300041413 Bacteria 2675
492 Ga0439465_0024211 3300041413 Bacteria 1913
493 Ga0451793_0173016 3300041452 Bacteria 2098
494 Ga0451793_1579998 3300041452 Bacteria 2119
495 Ga0451795_0931545 3300041456 Bacteria 1055
496 Ga0451795_1444608 3300041456 Bacteria 1443
497 Ga0451833_0141528 3300041491 Bacteria 9582
498 Ga0451837_1576909 3300041494 Bacteria 9671
499 Ga0451839_0447997 3300041496 Bacteria 2628
500 Ga0451853_0331732 3300041512 Bacteria 1075
501 Ga0439431_0004979 3300041997 Bacteria 2928
502 Ga0439431_0005227 3300041997 Bacteria 2861
503 Ga0439445_0022142 3300042004 Bacteria 1601
504 Ga0439445_0040731 3300042004 Bacteria 1233
505 Ga0439445_0048936 3300042004 Bacteria 1138
506 Ga0439432_016023 3300042006 Bacteria 2526
507 Ga0439449_0051482 3300042007 Bacteria 1523
508 Ga0439462_0002959 3300042015 Bacteria 4025
509 Ga0439434_0006786 3300042435 Bacteria 3346
510 Ga0439435_0020244 3300042436 Bacteria 1714
511 Ga0439459_0004714 3300042438 Bacteria 2207
512 Ga0439464_0015223 3300042439 Bacteria 2074
513 Ga0466969_0047400 3300044656 Bacteria 2127
514 Ga0466972_0010647 3300044658 Bacteria 4614
515 Ga0466965_0004966 3300044683 Bacteria 5955
516 Ga0466965_0028692 3300044683 Bacteria 2704
517 Ga0466966_0003202 3300044684 Bacteria 10782
518 Ga0466966_0008774 3300044684 Bacteria 6693
519 Ga0466966_0210798 3300044684 Bacteria 1174
520 Ga0466961_0011812 3300044693 Bacteria 5582
521 Ga0466961_0118588 3300044693 Bacteria 1662
522 Ga0466963_0023012 3300044694 Bacteria 3952
523 Ga0466963_0029095 3300044694 Bacteria 3553
524 Ga0466963_0063926 3300044694 Bacteria 2464
525 Ga0466963_0145423 3300044694 Bacteria 1644
526 Ga0466964_0101930 3300044706 Bacteria 1267
527 Ga0466964_0201484 3300044706 Bacteria 956
528 Ga0466971_0012179 3300044719 Bacteria 3769
529 Ga0466971_0035503 3300044719 Bacteria 2235
530 Ga0466971_0212633 3300044719 Bacteria 915
531 Ga0466968_0019675 3300044735 Bacteria 2719
532 Ga0466970_0003938 3300044765 Bacteria 7278
533 Ga0466970_0035340 3300044765 Bacteria 2647
534 Ga0466970_0256475 3300044765 Bacteria 980
535 Ga0466957_0000745 3300044842 Bacteria 16607
536 Ga0466957_0031958 3300044842 Bacteria 3149
537 Ga0466957_0094215 3300044842 Bacteria 1880
538 Ga0466957_0104329 3300044842 Bacteria 1791
539 Ga0466957_0107062 3300044842 Bacteria 1769
540 Ga0466960_0000676 3300044901 Bacteria 11820
541 Ga0466960_0001163 3300044901 Bacteria 9454
542 Ga0466960_0008943 3300044901 Bacteria 4116
543 Ga0466960_0032258 3300044901 Bacteria 2424
544 Ga0466960_0107507 3300044901 Bacteria 1445
545 Ga0466959_0004991 3300045049 Bacteria 9002
546 Ga0466959_0007534 3300045049 Bacteria 7646
547 Ga0466959_0085638 3300045049 Bacteria 2267
548 Ga0451576_0002303 3300045051 Bacteria 28951
549 Ga0466958_0025398 3300045836 Bacteria 3493
550 Ga0466958_0025883 3300045836 Bacteria 3463
551 Ga0466958_0065693 3300045836 Bacteria 2214
552 Ga0466958_0151001 3300045836 Bacteria 1465
553 Ga0466958_0218448 3300045836 Bacteria 1216
554 Ga0466967_0004929 3300045976 Bacteria 9126
555 Ga0466967_0005712 3300045976 Bacteria 8676
556 Ga0466967_0025571 3300045976 Bacteria 4871
557 Ga0466967_0096497 3300045976 Bacteria 2697
558 Ga0466967_0109818 3300045976 Bacteria 2532
559 Ga0466967_0113905 3300045976 Bacteria 2489
560 Ga0466967_0119347 3300045976 Bacteria 2434
561 Ga0466967_0364234 3300045976 Bacteria 1401
562 Ga0466967_0800520 3300045976 Bacteria 936
563 Ga0495627_030337 3300046453 Bacteria 1714
564 Ga0495629_0013527 3300046459 Bacteria 5887
565 Ga0495629_0035066 3300046459 Bacteria 3547
566 Ga0495638_0000247 3300046460 Bacteria 73629
567 Ga0495638_0032134 3300046460 Bacteria 3367
568 Ga0495582_0070277 3300046473 Bacteria 1936
569 Ga0495639_0135663 3300046475 Bacteria 1181
570 Ga0495639_0221976 3300046475 Bacteria 929
571 Ga0495662_0002485 3300046476 Bacteria 9287
572 Ga0495664_0026240 3300046477 Bacteria 3394
573 Ga0495594_0041725 3300046499 Bacteria 2512
574 Ga0495606_0013640 3300046507 Bacteria 6406
575 Ga0495648_0014127 3300046524 Bacteria 5863
576 Ga0495648_0166034 3300046524 Bacteria 1136
577 Ga0495652_0124456 3300046529 Bacteria 2051
578 Ga0495645_0034496 3300046543 Bacteria 3691
579 Ga0495633_0000025 3300046558 Bacteria 218627
580 Ga0495668_0000167 3300046616 Bacteria 97427
581 Ga0495634_0150728 3300046642 Bacteria 1471
582 Ga0495625_0211361 3300046660 Bacteria 1275
583 Ga0495658_0320962 3300046683 Bacteria 982
584 Ga0495649_0180330 3300046694 Bacteria 1102
585 Ga0495581_0186004 3300047315 Bacteria 1215
586 Ga0495674_0069030 3300047319 Bacteria 3057
587 Ga0495672_0003415 3300047320 Bacteria 13616
588 Ga0495672_0005726 3300047320 Bacteria 9783
589 Ga0495672_0026705 3300047320 Bacteria 3680
590 Ga0495673_0003856 3300047469 Bacteria 9670
591 Ga0495686_0003681 3300047472 Bacteria 13101
592 Ga0495593_0008905 3300047673 Bacteria 5825
593 Ga0495593_0048945 3300047673 Bacteria 2245
594 Ga0496100_0000527 3300048903 Bacteria 18269
595 Ga0496100_0004078 3300048903 Bacteria 7704
596 Ga0496100_0006138 3300048903 Bacteria 6537
597 Ga0496100_0044083 3300048903 Bacteria 2855
598 Ga0496100_0158209 3300048903 Bacteria 1622
599 Ga0496101_0000002 3300048904 Bacteria 410971
600 Ga0496101_0000619 3300048904 Bacteria 21671
601 Ga0496101_0000765 3300048904 Bacteria 19052
602 Ga0496101_0010167 3300048904 Bacteria 6209
603 Ga0496101_0013978 3300048904 Bacteria 5391
604 Ga0496101_0097595 3300048904 Bacteria 2195
605 Ga0496102_0000009 3300048905 Bacteria 344149
606 Ga0496102_0000973 3300048905 Bacteria 26960
607 Ga0496102_0001870 3300048905 Bacteria 18137
608 Ga0496102_0056618 3300048905 Bacteria 3577
609 Ga0496102_0076687 3300048905 Bacteria 3075
610 Ga0496102_0287897 3300048905 Bacteria 1548
611 Ga0496103_0000005 3300048906 Bacteria 505416
612 Ga0496103_0000902 3300048906 Bacteria 21303
613 Ga0496103_0004390 3300048906 Bacteria 8556
614 Ga0496104_0055723 3300048907 Bacteria 3738
615 Ga0496104_0162034 3300048907 Bacteria 2145
616 Ga0496104_0656832 3300048907 Bacteria 957
617 Ga0496105_0003833 3300048908 Bacteria 11219
618 Ga0496105_0090349 3300048908 Bacteria 2530
619 Ga0496105_0156982 3300048908 Bacteria 1868
620 Ga0496106_0010701 3300048909 Bacteria 6780
621 Ga0496106_0036460 3300048909 Bacteria 3679
622 Ga0496106_0093974 3300048909 Bacteria 2318
623 Ga0496106_0338540 3300048909 Bacteria 1208
624 Ga0496107_0010484 3300048910 Bacteria 6442
625 Ga0496107_0110606 3300048910 Bacteria 2019
626 Ga0496108_0004412 3300048911 Bacteria 11322
627 Ga0496108_0005920 3300048911 Bacteria 9908
628 Ga0496108_0169501 3300048911 Bacteria 1889
629 Ga0496108_0285505 3300048911 Bacteria 1437
630 Ga0496108_0791721 3300048911 Bacteria 818
631 Ga0496109_0000747 3300048912 Bacteria 27044
632 Ga0496109_0041880 3300048912 Bacteria 4148
633 Ga0496109_0098003 3300048912 Bacteria 2718
634 Ga0496109_0140259 3300048912 Bacteria 2260
635 Ga0496109_0266160 3300048912 Bacteria 1615
636 Ga0496109_0533224 3300048912 Bacteria 1108
637 Ga0496110_0498686 3300048913 Bacteria 1109
638 Ga0496111_0010684 3300048914 Bacteria 6175
639 Ga0496111_0015233 3300048914 Bacteria 5272
640 Ga0496111_0168775 3300048914 Bacteria 1626
641 Ga0496112_0001525 3300048915 Bacteria 17850
642 Ga0496112_0009325 3300048915 Bacteria 8832
643 Ga0496112_0095459 3300048915 Bacteria 2944
644 Ga0496112_0712779 3300048915 Bacteria 931
645 Ga0496113_0068329 3300048916 Bacteria 2696
646 Ga0496114_0000681 3300048917 Bacteria 25219
647 Ga0496114_0004256 3300048917 Bacteria 11087
648 Ga0496114_0014448 3300048917 Bacteria 6341
649 Ga0496114_0022813 3300048917 Bacteria 5101
650 Ga0496114_0091880 3300048917 Bacteria 2578
651 Ga0496114_0100517 3300048917 Bacteria 2468
652 Ga0496114_0124023 3300048917 Bacteria 2224
653 Ga0496114_0213249 3300048917 Bacteria 1694
654 Ga0496114_0244900 3300048917 Bacteria 1577
655 Ga0496114_0268628 3300048917 Bacteria 1503
656 Ga0496114_0313434 3300048917 Bacteria 1386
657 Ga0496114_0574702 3300048917 Bacteria 995
658 Ga0496115_0009071 3300048918 Bacteria 7379
659 Ga0496115_0020330 3300048918 Bacteria 5121
660 Ga0496116_0000104 3300048919 Bacteria 193416
661 Ga0496116_0016923 3300048919 Bacteria 5684
662 Ga0496117_0000019 3300048920 Bacteria 469256
663 Ga0496117_0000028 3300048920 Bacteria 407392
664 Ga0496117_0000497 3300048920 Bacteria 64914
665 Ga0496117_0002095 3300048920 Bacteria 26250
666 Ga0496117_0031541 3300048920 Bacteria 4042
667 Ga0496118_0000020 3300048921 Bacteria 470521
668 Ga0496118_0000255 3300048921 Bacteria 94123
669 Ga0496118_0002066 3300048921 Bacteria 28281
670 Ga0496118_0037919 3300048921 Bacteria 3870
671 Ga0496118_0040589 3300048921 Bacteria 3698
672 Ga0496118_0131553 3300048921 Bacteria 1606
673 Ga0496119_0001830 3300048922 Bacteria 24637
674 Ga0496119_0004258 3300048922 Bacteria 14344
675 Ga0496119_0018843 3300048922 Bacteria 5114
676 Ga0496119_0028338 3300048922 Bacteria 3823
677 Ga0496120_0001838 3300048923 Bacteria 23651
678 Ga0496120_0029385 3300048923 Bacteria 3356
679 Ga0496120_0046233 3300048923 Bacteria 2516
680 Ga0496120_0081021 3300048923 Bacteria 1757
681 Ga0496121_0001252 3300048924 Bacteria 44016
682 Ga0496121_0007909 3300048924 Bacteria 12719
683 Ga0496122_0000522 3300048925 Bacteria 79377
684 Ga0496122_0000534 3300048925 Bacteria 78704
685 Ga0496122_0000877 3300048925 Bacteria 56353
686 Ga0496122_0001012 3300048925 Bacteria 49765
687 Ga0496122_0003004 3300048925 Bacteria 22932
688 Ga0496122_0020806 3300048925 Bacteria 5905
689 Ga0496122_0048687 3300048925 Bacteria 3255
690 Ga0496123_0000142 3300048926 Bacteria 146932
691 Ga0496123_0000251 3300048926 Bacteria 108664
692 Ga0496123_0001800 3300048926 Bacteria 28215
693 Ga0496123_0009604 3300048926 Bacteria 8686
694 Ga0496124_0000420 3300048927 Bacteria 75761
695 Ga0496124_0001505 3300048927 Bacteria 34041
696 Ga0496124_0002708 3300048927 Bacteria 22632
697 Ga0496124_0095728 3300048927 Bacteria 2413
698 Ga0496125_0000085 3300048928 Bacteria 218570
699 Ga0496125_0000214 3300048928 Bacteria 118625
700 Ga0496125_0000857 3300048928 Bacteria 48805
701 Ga0496125_0002891 3300048928 Bacteria 21636
702 Ga0496125_0004133 3300048928 Bacteria 16948
703 Ga0496125_0006476 3300048928 Bacteria 12648
704 Ga0496125_0011614 3300048928 Bacteria 8797
705 Ga0496125_0245183 3300048928 Bacteria 1134
706 Ga0496126_0000931 3300048929 Bacteria 50490
707 Ga0496126_0002688 3300048929 Bacteria 23495
708 Ga0496126_0008151 3300048929 Bacteria 11340
709 Ga0496126_0010295 3300048929 Bacteria 9820
710 Ga0496126_0012396 3300048929 Bacteria 8739
711 Ga0496126_0014320 3300048929 Bacteria 8019
712 Ga0496126_0023340 3300048929 Bacteria 5995
713 Ga0496126_0023445 3300048929 Bacteria 5981
714 Ga0496126_0029198 3300048929 Bacteria 5241
715 Ga0496126_0047354 3300048929 Bacteria 3936
716 Ga0496126_0052596 3300048929 Bacteria 3700
717 Ga0496126_0062705 3300048929 Bacteria 3335
718 Ga0496126_0068632 3300048929 Bacteria 3164
719 Ga0501031_0010829 3300049568 Bacteria 5937
720 Ga0501031_0029921 3300049568 Bacteria 3552
721 Ga0501032_0007655 3300049569 Bacteria 7876
722 Ga0501032_0042793 3300049569 Bacteria 3071
723 Ga0501033_0055147 3300049570 Bacteria 2939
724 Ga0501033_0062546 3300049570 Bacteria 2741
725 Ga0501033_0140939 3300049570 Bacteria 1743
726 Ga0501034_0002933 3300049571 Bacteria 19772
727 Ga0501034_0007765 3300049571 Bacteria 11410
728 Ga0501034_0018608 3300049571 Bacteria 7121
729 Ga0501034_0028244 3300049571 Bacteria 5707
730 Ga0501034_0052682 3300049571 Bacteria 4099
731 Ga0501034_0131828 3300049571 Bacteria 2482
732 Ga0501034_0307530 3300049571 Bacteria 1521
733 Ga0501034_0430569 3300049571 Bacteria 1239
734 Ga0501036_0018267 3300049572 Bacteria 5872
735 Ga0501036_0029322 3300049572 Bacteria 4651
736 Ga0501036_0125563 3300049572 Bacteria 2167
737 Ga0501037_0036272 3300049573 Bacteria 3634
738 Ga0501038_0021716 3300049574 Bacteria 5759
739 Ga0501038_0371429 3300049574 Bacteria 1111
740 Ga0501039_0450145 3300049575 Bacteria 1011
741 Ga0501040_0005707 3300049576 Bacteria 8050
742 Ga0501042_0019926 3300049578 Bacteria 4664
743 Ga0501043_0070417 3300049579 Bacteria 2747
744 Ga0501043_0220194 3300049579 Bacteria 1469
745 Ga0501046_0003054 3300049580 Bacteria 15460
746 Ga0501046_0083613 3300049580 Bacteria 2463
747 Ga0501046_0278524 3300049580 Bacteria 1226
748 Ga0501047_0004113 3300049581 Bacteria 13690
749 Ga0501047_0010633 3300049581 Bacteria 8700
750 Ga0501047_0013607 3300049581 Bacteria 7718
751 Ga0501047_0024057 3300049581 Bacteria 5850
752 Ga0501047_0046100 3300049581 Bacteria 4214
753 Ga0501047_0152736 3300049581 Bacteria 2184
754 Ga0501048_0042785 3300049582 Bacteria 3242
755 Ga0501048_0050206 3300049582 Bacteria 2971
756 Ga0501048_0073862 3300049582 Bacteria 2406
757 Ga0501067_0131736 3300049583 Bacteria 1392
758 Ga0501068_0096961 3300049584 Bacteria 1824
759 Ga0501068_0166478 3300049584 Bacteria 1390
760 Ga0501069_0037454 3300049585 Bacteria 2677
761 Ga0501070_0022067 3300049586 Bacteria 5332
762 Ga0501070_0088591 3300049586 Bacteria 2561
763 Ga0501070_0149810 3300049586 Bacteria 1925
764 Ga0501072_0020049 3300049588 Bacteria 5177
765 Ga0501072_0252526 3300049588 Bacteria 1404
766 Ga0501074_0081345 3300049590 Bacteria 2323
767 Ga0501075_0102029 3300049591 Bacteria 2179
768 Ga0501076_0059207 3300049592 Bacteria 3046
769 Ga0501222_004336 3300049662 Bacteria 1926
770 Ga0501238_004383 3300049671 Bacteria 1765
771 Ga0501238_016412 3300049671 Bacteria 1027
772 Ga0501242_000231 3300049674 Bacteria 4402
773 Ga0501257_001564 3300049686 Bacteria 4774
774 Ga0501259_006624 3300049688 Bacteria 1844
775 Ga0501079_0155365 3300049741 Bacteria 1783
776 Ga0501080_0046200 3300049742 Bacteria 4056
777 Ga0501080_0326391 3300049742 Bacteria 1389
778 Ga0501081_0101574 3300049743 Bacteria 2034
779 Ga0501083_0004945 3300049744 Bacteria 9438
780 Ga0501083_0035867 3300049744 Bacteria 3387
781 Ga0501083_0036714 3300049744 Bacteria 3341
782 Ga0501241_000961 3300049758 Bacteria 6100
783 Ga0501241_002804 3300049758 Bacteria 3348
784 Ga0501035_0000121 3300049822 Bacteria 94497
785 Ga0501035_0005068 3300049822 Bacteria 12485
786 Ga0501035_0006303 3300049822 Bacteria 11149
787 Ga0501035_0083466 3300049822 Bacteria 2819
788 Ga0501035_0105087 3300049822 Bacteria 2476
789 Ga0501035_0492572 3300049822 Bacteria 1010
790 Ga0501044_0001588 3300049823 Bacteria 26614
791 Ga0501044_0007597 3300049823 Bacteria 11918
792 Ga0501044_0042467 3300049823 Bacteria 4729
793 Ga0501044_0254659 3300049823 Bacteria 1695
794 Ga0501045_0031658 3300049824 Bacteria 3830
795 nmdc:mga03683_104824_c1 3300050489 Bacteria 1245
796 nmdc:mga03683_10497_c2 3300050489 Bacteria 2471
797 nmdc:mga03683_105877_c1 3300050489 Bacteria 1239
798 nmdc:mga03683_18147_c1 3300050489 Bacteria 2671
799 nmdc:mga03683_19145_c1 3300050489 Bacteria 2610
800 nmdc:mga03683_68955_c1 3300050489 Bacteria 1508
801 nmdc:mga03n38_12463_c1 3300050490 Bacteria 3200
802 nmdc:mga03n38_133606_c1 3300050490 Bacteria 1232
803 nmdc:mga03n38_150962_c1 3300050490 Bacteria 1169
804 nmdc:mga03n38_268483_c1 3300050490 Bacteria 907
805 nmdc:mga03n38_3173_c1 3300050490 Bacteria 5241
806 nmdc:mga03n38_3177_c1 3300050490 Bacteria 5235
807 nmdc:mga03n38_345_c1 3300050490 Bacteria 11261
808 nmdc:mga03n38_4741_c1 3300050490 Bacteria 4543
809 nmdc:mga03n38_61508_c1 3300050490 Bacteria 1710
810 nmdc:mga03n38_97935_c1 3300050490 Bacteria 1409
811 nmdc:mga00v17_16536_c1 3300050491 Bacteria 4157
812 nmdc:mga00v17_188252_c1 3300050491 Bacteria 1332
813 nmdc:mga00v17_393798_c1 3300050491 Bacteria 900
814 nmdc:mga00v17_42601_c1 3300050491 Bacteria 2731
815 nmdc:mga00v17_45625_c1 3300050491 Bacteria 2649
816 nmdc:mga00v17_6119_c1 3300050491 Bacteria 6372
817 nmdc:mga00v17_81554_c1 3300050491 Bacteria 1667
818 nmdc:mga00v17_96202_c1 3300050491 Bacteria 1865
819 nmdc:mga0yw44_13779_c1 3300050492 Bacteria 4271
820 nmdc:mga0yw44_157666_c1 3300050492 Bacteria 1484
821 nmdc:mga0yw44_161384_c1 3300050492 Bacteria 1467
822 nmdc:mga0yw44_17240_c1 3300050492 Bacteria 3925
823 nmdc:mga0yw44_18395_c1 3300050492 Bacteria 3826
824 nmdc:mga0yw44_24584_c1 3300050492 Bacteria 3411
825 nmdc:mga0yw44_4417_c1 3300050492 Bacteria 6444
826 nmdc:mga0yw44_455781_c1 3300050492 Bacteria 867
827 nmdc:mga0yw44_51367_c1 3300050492 Bacteria 2496
828 nmdc:mga0yw44_58089_c1 3300050492 Bacteria 2362
829 nmdc:mga0yw44_5_c1 3300050492 Bacteria 313167
830 nmdc:mga0k408_105717_c1 3300050493 Bacteria 1662
831 nmdc:mga0k408_111139_c1 3300050493 Bacteria 1620
832 nmdc:mga0k408_298318_c1 3300050493 Bacteria 962
833 nmdc:mga06z11_175467_c1 3300050494 Bacteria 1233
834 nmdc:mga06z11_226238_c1 3300050494 Bacteria 1095
835 nmdc:mga06z11_52945_c1 3300050494 Bacteria 2085
836 nmdc:mga04h51_4947_c1 3300050495 Bacteria 3358
837 nmdc:mga04h51_67847_c1 3300050495 Bacteria 1238
838 nmdc:mga07m45_116966_c1 3300050496 Bacteria 1538
839 nmdc:mga07m45_168_c1 3300050496 Bacteria 26249
840 nmdc:mga07m45_27678_c2 3300050496 Bacteria 2265
841 nmdc:mga07m45_45088_c1 3300050496 Bacteria 2475
842 nmdc:mga07m45_848_c1 3300050496 Bacteria 13274
843 nmdc:mga06r32_304478_c1 3300050510 Bacteria 1579
844 nmdc:mga08y16_162499_c1 3300050511 Bacteria 2320
845 nmdc:mga08y16_37703_c1 3300050511 Bacteria 5074
846 nmdc:mga08y16_494241_c1 3300050511 Bacteria 1244
847 nmdc:mga08y16_625945_c1 3300050511 Bacteria 1083
848 nmdc:mga0sz30_10947_c1 3300050516 Bacteria 2757
849 nmdc:mga0sz30_134848_c1 3300050516 Bacteria 1089
850 nmdc:mga0sz30_138812_c1 3300050516 Bacteria 1073
851 nmdc:mga0sz30_153935_c1 3300050516 Bacteria 1018
852 nmdc:mga0sz30_20167_c1 3300050516 Bacteria 2687
853 nmdc:mga0sz30_22654_c1 3300050516 Bacteria 2551
854 nmdc:mga0sz30_26935_c1 3300050516 Bacteria 2359
855 nmdc:mga0sz30_31676_c1 3300050516 Bacteria 2189
856 nmdc:mga0sz30_56_c1 3300050516 Bacteria 42210
857 nmdc:mga0sz30_6507_c2 3300050516 Bacteria 1479
858 nmdc:mga0sz30_99890_c1 3300050516 Bacteria 1267
859 Ga0495601_0140327 3300053077 Bacteria 1576
860 Ga0500610_0009933 3300053079 Bacteria 4254
861 Ga0500635_0011660 3300053080 Bacteria 2506
862 Ga0500643_001252 3300053087 Bacteria 15050
863 Ga0500643_001788 3300053087 Bacteria 11785
864 Ga0500643_002468 3300053087 Bacteria 9524
865 Ga0500643_009677 3300053087 Bacteria 3660
866 Ga0500646_0005272 3300053090 Bacteria 3268
867 Ga0500583_0000111 3300053092 Bacteria 40256
868 Ga0500651_0002354 3300053093 Bacteria 9943
869 Ga0500641_0005068 3300053096 Bacteria 4671
870 Ga0500641_0042974 3300053096 Bacteria 1833
871 Ga0500555_000023 3300053103 Bacteria 150521
872 Ga0500556_0067442 3300053104 Bacteria 1330
873 Ga0500562_007680 3300053108 Bacteria 2720
874 Ga0500569_000008 3300053109 Bacteria 73629
875 Ga0500569_024101 3300053109 Bacteria 1643
876 Ga0500608_103572 3300053122 Bacteria 1315
877 Ga0500652_000058 3300053131 Bacteria 50084
878 Ga0500652_000912 3300053131 Bacteria 9745
879 Ga0500655_002822 3300053133 Bacteria 3157
880 Ga0500658_0019173 3300053134 Bacteria 2572
881 Ga0500658_0113266 3300053134 Bacteria 1196
882 Ga0500559_0052503 3300053136 Bacteria 1802
883 Ga0500568_0009913 3300053139 Bacteria 4497
884 Ga0500568_0030043 3300053139 Bacteria 2251
885 Ga0500568_0087860 3300053139 Bacteria 1175
886 Ga0500573_0000080 3300053140 Bacteria 46390
887 Ga0500573_0002557 3300053140 Bacteria 9138
888 Ga0500573_0004692 3300053140 Bacteria 7234
889 Ga0500577_0000422 3300053142 Bacteria 10871
890 Ga0500588_0000023 3300053146 Bacteria 37338
891 Ga0500616_0001675 3300053153 Bacteria 20419
892 Ga0500616_0055766 3300053153 Bacteria 2065
893 Ga0500622_0000151 3300053156 Bacteria 73392
894 Ga0500633_0007500 3300053160 Bacteria 2752
895 Ga0500645_000108 3300053730 Bacteria 66421
896 Ga0500645_019002 3300053730 Bacteria 2141
897 Ga0500552_011595 3300053733 Bacteria 1110
898 Ga0501084_0022823 3300054114 Bacteria 5221
899 Ga0501084_0109917 3300054114 Bacteria 2316
900 Ga0501084_0452771 3300054114 Bacteria 1085
901 Ga0501082_0002655 3300060353 Bacteria 15637
902 Ga0501082_0237262 3300060353 Bacteria 1587
903 Ga0466962_0046998 3300061719 Bacteria 2062
904 2548692431 2547132424 Bacteria 8348532
905 2552104972 2551306166 Bacteria 9731570
906 2552112726 2551306166 Bacteria 9731570
907 2643753076 2643221546 Bacteria 2910897
908 2643824472 2643221561 Bacteria 4984412
909 2644083629 2643221613 Bacteria 4622396
910 2644444390 2643221679 Bacteria 3839507
911 2644487542 2643221687 Bacteria 6500351
912 2644503208 2643221690 Bacteria 4654705
913 2644517325 2643221692 Bacteria 7282860
914 2644525518 2643221694 Bacteria 4392972
915 2644535731 2643221696 Bacteria 5431823
916 2644539284 2643221697 Bacteria 3575694
917 2644639107 2643221715 Bacteria 6671032
918 2644664174 2643221721 Bacteria 4486924
919 2644669602 2643221722 Bacteria 4247614
920 2729908320 2728369276 Bacteria 5610032
921 2738693132 2738541272 Bacteria 6848551
922 2738706650 2738541274 Bacteria 6909446
923 2739206427 2738543005 Bacteria 5278128
924 2739239235 2738543011 Bacteria 5731169
925 2739323294 2738543027 Bacteria 6409078
926 2739329825 2738543028 Bacteria 6917070
927 2739333268 2738543028 Bacteria 6917070
928 2739607900 2739367654 Bacteria 6049412
929 2744956108 2744054611 Bacteria 5611514
930 2747954531 2747842429 Bacteria 3914386
931 2753037297 2751185725 Bacteria 5740550
932 2753325166 2751185792 Bacteria 5739090
933 2758224495 2757320536 Bacteria 3629334
934 2760304089 2758568522 Bacteria 5953541
935 2760621959 2758568621 Bacteria 5967089
936 2774400308 2773857763 Bacteria 4180068
937 2795796733 2795385472 Bacteria 6627535
938 2809026796 2808606394 Bacteria 6248540
939 2809226790 2808606447 Bacteria 3572005
940 2812322393 2811994872 Bacteria 4121241
941 2812364680 2811994880 Bacteria 4147780
942 2816422681 2816332119 Bacteria 8120218
943 2819677426 2818991460 Bacteria 7595395
944 2821269312 2821268502 Bacteria 3750023
945 2835191215 2835188231 Bacteria 3476928
946 2839989572 2839986021 Bacteria 3685650
947 2840679241 2840677318 Bacteria 2664183
948 2842135319 2842134933 Bacteria 5847019
949 2842889849 2842888712 Bacteria 4279094
950 2857633039 2857632687 Bacteria 2448521
951 2857720978 2857720070 Bacteria 3189373
952 2870629669 2870628048 Bacteria 3696012
953 2870805214 2870804320 Bacteria 2552467
954 2884996107 2884994152 Bacteria 4492978
955 2889304189 2889300758 Bacteria 5690814
956 2895502688 2895498888 Bacteria 5283788
957 2896087052 2896085136 Bacteria 6129793
958 2896114337 2896109856 Bacteria 7140722
959 2902794162 2902792274 Bacteria 7270173
960 2902802910 2902799365 Bacteria 5419524
961 2902802927 2902799365 Bacteria 5419524
962 2902816006 2902810491 Bacteria 6794147
963 2902839628 2902837492 Bacteria 6697721
964 2904768367 2904765812 Bacteria 5369154
965 2904773969 2904770941 Bacteria 5580202
966 2904775766 2904770941 Bacteria 5580202
967 2906801150 2906799679 Bacteria 4031749
968 2908811725 2908811453 Bacteria 5478616
969 2919421738 2919420072 Bacteria 5390363
970 2919434704 2919432681 Bacteria 5390474
971 2919714777 2919713450 Bacteria 7431245
972 2922558077 2922554459 Bacteria 6683962
973 2928147071 2928142448 Bacteria 5288925
974 2929177185 2929177148 Bacteria 7883697
975 2929239608 2929239360 Bacteria 7745570
976 2929921238 2929921140 Bacteria 8649150
977 2932401281 2932398195 Bacteria 3847976
978 2932433180 2932431166 Bacteria 4215299
979 2935891556 2935890801 Bacteria 4593001
980 2939586058 2939582691 Bacteria 7088898
981 2939745417 2939743619 Bacteria 5762299
982 2945979552 2945977869 Bacteria 7777518
983 2946014580 2946013367 Bacteria 7766675
984 2946082443 2946080515 Bacteria 4310960
985 2974298098 2974294766 Bacteria 3767688
986 2974319682 2974315732 Bacteria 4602776
987 2974325666 2974324384 Bacteria 3750535
988 2977252102 2977251589 Bacteria 2952848
989 2977265853 2977264416 Bacteria 3750737
990 2984523550 2984523437 Bacteria 4508481
991 8003152528 8003151029 Bacteria 8187759
992 8056580823 8056579771 Bacteria 5840325
993 SwRhRL2b_contig_300488
994 JGI24746J21847_1001168
995 JGI24740J21852_10001780
996 JGI24739J22299_10002055
997 JGI24744J21845_10001990
998 JGI24744J21845_10006209
999 JGI25154J39366_1000002
1000 JGI25154J39366_1001681
1001 JGI25153J46596_10008393
1002 rootL2_10022523
1003 rootL2_10081697
1004 rootH1_10000619
1005 rootH1_10000732
1006 rootH1_10040576
1007 rootH1_10137115
1008 JGI25160J50197_1001555
1009 JGI25160J50197_1008496
1010 Ga0006562J51391_1044531
1011 Ga0006562J51391_1044534
1012 Ga0055528_1000422
1013 Ga0055530_10000475
1014 Ga0055540_1007250
1015 Ga0055540_1007673
1016 Ga0055540_1022563
1017 Ga0055540_1031088
1018 Ga0055531_10000014
1019 Ga0065165_1000258
1020 Ga0065165_1002847
1021 Ga0065165_1024739
1022 Ga0065704_10073688
1023 Ga0070658_10000839
1024 Ga0070658_10040088
1025 Ga0070676_10089790
1026 Ga0070676_10114154
1027 Ga0070683_100024499
1028 Ga0070683_100112109
1029 Ga0070683_100562634
1030 Ga0070690_100002005
1031 Ga0068869_100046160
1032 Ga0070666_10060925
1033 Ga0070680_100023828
1034 Ga0070680_100177905
1035 Ga0070682_100003922
1036 Ga0068868_100000721
1037 Ga0068868_100083622
1038 Ga0070660_100000275
1039 Ga0070660_100010827
1040 Ga0070689_100058091
1041 Ga0070691_10010747
1042 Ga0070692_10030196
1043 Ga0070668_100001176
1044 Ga0070668_100051114
1045 Ga0070668_100104218
1046 Ga0070669_100044641
1047 Ga0070671_100045381
1048 Ga0070674_100024056
1049 Ga0070673_100559931
1050 Ga0070659_100001086
1051 Ga0070659_100055713
1052 Ga0070667_100001332
1053 Ga0070667_100011524
1054 Ga0070709_10093423
1055 Ga0070714_100059440
1056 Ga0070714_100103843
1057 Ga0070710_10003466
1058 Ga0070701_10001177
1059 Ga0070701_10093432
1060 Ga0070711_100001348
1061 Ga0070711_100013605
1062 Ga0070705_100006092
1063 Ga0070705_100104729
1064 Ga0070700_100002213
1065 Ga0070694_100009996
1066 Ga0070663_100005044
1067 Ga0070663_100024173
1068 Ga0070663_100211764
1069 Ga0070678_100000690
1070 Ga0070662_100020728
1071 Ga0070662_100031415
1072 Ga0070681_10050063
1073 Ga0068867_100002146
1074 Ga0068867_100029761
1075 Ga0070685_10050961
1076 Ga0070685_10094756
1077 Ga0070699_100252882
1078 Ga0070679_100009071
1079 Ga0070679_100009808
1080 Ga0070684_100132720
1081 Ga0070684_100531578
1082 Ga0070697_100161948
1083 Ga0068853_100002060
1084 Ga0068853_100020442
1085 Ga0068853_100192290
1086 Ga0068853_100535977
1087 Ga0070672_100025016
1088 Ga0070696_100001539
1089 Ga0070665_100008709
1090 Ga0070665_100133519
1091 Ga0070704_100000342
1092 Ga0068855_100081453
1093 Ga0070664_100052079
1094 Ga0068857_100112040
1095 Ga0068854_100005978
1096 Ga0068856_100000060
1097 Ga0070702_100002910
1098 Ga0070702_100071989
1099 Ga0068852_100000088
1100 Ga0068852_100155424
1101 Ga0068852_100411137
1102 Ga0068859_100002678
1103 Ga0068859_100008165
1104 Ga0068859_100275432
1105 Ga0068864_100268459
1106 Ga0068864_100622843
1107 Ga0068866_10003250
1108 Ga0068866_10030623
1109 Ga0068866_10079925
1110 Ga0068861_100024884
1111 Ga0068861_100380020
1112 Ga0068863_100000205
1113 Ga0068863_100303094
1114 Ga0068858_100000569
1115 Ga0068858_100021662
1116 Ga0068858_100069863
1117 Ga0068858_100247683
1118 Ga0068860_100000472
1119 Ga0068860_100018155
1120 Ga0068862_100000030
1121 Ga0068862_100001196
1122 Ga0068862_100161763
1123 Ga0081455_10021717
1124 Ga0081455_10048739
1125 Ga0081455_10090423
1126 Ga0081455_10116704
1127 Ga0081455_10130098
1128 Ga0081455_10231688
1129 Ga0081539_10002644
1130 Ga0075365_10003949
1131 Ga0075365_10005987
1132 Ga0075365_10020421
1133 Ga0075365_10031290
1134 Ga0075365_10092721
1135 Ga0075365_10103317
1136 Ga0075365_10140446
1137 Ga0075365_10155329
1138 Ga0075365_10198509
1139 Ga0075368_10030850
1140 Ga0075363_100000097
1141 Ga0075363_100002740
1142 Ga0075363_100003750
1143 Ga0075363_100006637
1144 Ga0075363_100016375
1145 Ga0075363_100019871
1146 Ga0075363_100019973
1147 Ga0075363_100026690
1148 Ga0075363_100135286
1149 Ga0075363_100193264
1150 Ga0075364_10008403
1151 Ga0075364_10009086
1152 Ga0075364_10011846
1153 Ga0075364_10016734
1154 Ga0075364_10028145
1155 Ga0075364_10044912
1156 Ga0075364_10061062
1157 Ga0075364_10076481
1158 Ga0075364_10083783
1159 Ga0075364_10117162
1160 Ga0075364_10135515
1161 Ga0070715_10000745
1162 Ga0070716_100002545
1163 Ga0070716_100052081
1164 Ga0070712_100001630
1165 Ga0070712_100008920
1166 Ga0070712_100163325
1167 Ga0075362_10068099
1168 Ga0075367_10058747
1169 Ga0075367_10121915
1170 Ga0075367_10182849
1171 Ga0075369_10003213
1172 Ga0075369_10017544
1173 Ga0075369_10023785
1174 Ga0075369_10034608
1175 Ga0075369_10042008
1176 Ga0075369_10044597
1177 Ga0075369_10079851
1178 Ga0075369_10133245
1179 Ga0075366_10004918
1180 Ga0075366_10023876
1181 Ga0075366_10166895
1182 Ga0097621_100009990
1183 Ga0075370_10020303
1184 Ga0075370_10067844
1185 Ga0075370_10232545
1186 Ga0068871_100039173
1187 Ga0068871_100083216
1188 Ga0075428_100023471
1189 Ga0075428_100431309
1190 Ga0075431_100385090
1191 Ga0068865_100000869
1192 Ga0097620_100002678
1193 Ga0097620_100008165
1194 Ga0097620_100275455
1195 Ga0105244_10013007
1196 Ga0105250_10062958
1197 Ga0105240_10000030
1198 Ga0111539_10040373
1199 Ga0111539_10421043
1200 Ga0111539_10535286
1201 Ga0105245_10001960
1202 Ga0105247_10000008
1203 Ga0105247_10000731
1204 Ga0105247_10024985
1205 Ga0105247_10046848
1206 Ga0114129_10234720
1207 Ga0105243_10003737
1208 Ga0105243_10004909
1209 Ga0105243_10484947
1210 Ga0105241_10005394
1211 Ga0105242_10001062
1212 Ga0105248_10000257
1213 Ga0105248_10011362
1214 Ga0105248_10092787
1215 Ga0105248_10136665
1216 Ga0105237_10000001
1217 Ga0105237_10001184
1218 Ga0105237_10064418
1219 Ga0105238_10132643
1220 Ga0105238_10509971
1221 Ga0105249_10000036
1222 Ga0105249_10002637
1223 Ga0105249_10062183
1224 Ga0105239_10003290
1225 Ga0105239_10021671
1226 Ga0105239_10059620
1227 Ga0105239_10281419
1228 Ga0105246_10000069
1229 Ga0105246_10013466
1230 Ga0157373_10001378
1231 Ga0157371_10005033
1232 Ga0157371_10027957
1233 Ga0157370_10000812
1234 Ga0157370_10000984
1235 Ga0157370_10048608
1236 Ga0157369_10000026
1237 Ga0157369_10000851
1238 Ga0157369_10008059
1239 Ga0157374_10019012
1240 Ga0157378_10003646
1241 Ga0157378_10114883
1242 Ga0157378_10319677
1243 Ga0163162_10015231
1244 Ga0163162_10104859
1245 Ga0157372_10000007
1246 Ga0157372_10000027
1247 Ga0157372_10006391
1248 Ga0157372_10085822
1249 Ga0157372_10213109
1250 Ga0157375_10002986
1251 Ga0157375_10177231
1252 Ga0157375_10238090
1253 Ga0157375_10260849
1254 Ga0157380_10000595
1255 Ga0157380_10004722
1256 Ga0157380_10069047
1257 Ga0157380_10144834
1258 Ga0157377_10023666
1259 Ga0157377_10035244
1260 Ga0157379_10040132
1261 Ga0157376_10433754
1262 Ga0157376_10721345
1263 Ga0163161_10001886
1264 Ga0163161_10066742
1265 Ga0163161_10210792
1266 Ga0163161_10310074
1267 Ga0206351_10585983
1268 Ga0213876_10232144
1269 Ga0213875_10032182
1270 Ga0224712_10004555
1271 Ga0209436_100440
1272 Ga0209258_100029
1273 Ga0209646_1000005
1274 Ga0209646_1000041
1275 Ga0209026_1000169
1276 Ga0209148_1000089
1277 Ga0209673_1000049
1278 Ga0209130_1001814
1279 Ga0209564_1011681
1280 Ga0209758_1000346
1281 Ga0209758_1023829
1282 Ga0209758_1029351
1283 Ga0209050_1000272
1284 Ga0207426_1000233
1285 Ga0207426_1000381
1286 Ga0207426_1001311
1287 Ga0209051_1000807
1288 Ga0209051_1000884
1289 Ga0209051_1001910
1290 Ga0209051_1013992
1291 Ga0209051_1024837
1292 Ga0209257_1000004
1293 Ga0209257_1001525
1294 Ga0207653_10026046
1295 Ga0207692_10002339
1296 Ga0207692_10025260
1297 Ga0207642_10004559
1298 Ga0207710_10000006
1299 Ga0207710_10020197
1300 Ga0207710_10035899
1301 Ga0207710_10053271
1302 Ga0207710_10095729
1303 Ga0207688_10000313
1304 Ga0207688_10002177
1305 Ga0207680_10032508
1306 Ga0207647_10024977
1307 Ga0207685_10008972
1308 Ga0207699_10002972
1309 Ga0207699_10180791
1310 Ga0207645_10036984
1311 Ga0207705_10000934
1312 Ga0207705_10009390
1313 Ga0207654_10037773
1314 Ga0207695_10000009
1315 Ga0207671_10000003
1316 Ga0207671_10016681
1317 Ga0207671_10038019
1318 Ga0207671_10127161
1319 Ga0207693_10001545
1320 Ga0207693_10005615
1321 Ga0207693_10278334
1322 Ga0207663_10005432
1323 Ga0207663_10020877
1324 Ga0207660_10062382
1325 Ga0207660_10133331
1326 Ga0207660_10140232
1327 Ga0207657_10000296
1328 Ga0207657_10006095
1329 Ga0207657_10135891
1330 Ga0207657_10175395
1331 Ga0207652_10283537
1332 Ga0207681_10006042
1333 Ga0207681_10018534
1334 Ga0207681_10178094
1335 Ga0207694_10110938
1336 Ga0207659_10156875
1337 Ga0207687_10001949
1338 Ga0207664_10232658
1339 Ga0207644_10276552
1340 Ga0207690_10007615
1341 Ga0207690_10019135
1342 Ga0207690_10376038
1343 Ga0207706_10034196
1344 Ga0207706_10154063
1345 Ga0207686_10005130
1346 Ga0207709_10001364
1347 Ga0207709_10001848
1348 Ga0207709_10127649
1349 Ga0207709_10502277
1350 Ga0207670_10018652
1351 Ga0207669_10004474
1352 Ga0207669_10054775
1353 Ga0207704_10000673
1354 Ga0207704_10395969
1355 Ga0207665_10000142
1356 Ga0207665_10001800
1357 Ga0207691_10012555
1358 Ga0207711_10000269
1359 Ga0207711_10083596
1360 Ga0207711_10202498
1361 Ga0207711_10466800
1362 Ga0207689_10019613
1363 Ga0207689_10021202
1364 Ga0207689_10039105
1365 Ga0207661_10015302
1366 Ga0207661_10016982
1367 Ga0207661_10469370
1368 Ga0207661_10480087
1369 Ga0207679_10061833
1370 Ga0207679_10233631
1371 Ga0207712_10000036
1372 Ga0207712_10006069
1373 Ga0207712_10139732
1374 Ga0207668_10001315
1375 Ga0207668_10020654
1376 Ga0207668_10072425
1377 Ga0207640_10219956
1378 Ga0207658_10000060
1379 Ga0207658_10010136
1380 Ga0207658_10299112
1381 Ga0207677_10003046
1382 Ga0207703_10016131
1383 Ga0207703_10161908
1384 Ga0207703_10269055
1385 Ga0207703_10374281
1386 Ga0207639_10189777
1387 Ga0207678_10019583
1388 Ga0207678_10021554
1389 Ga0207678_10054346
1390 Ga0207678_10071723
1391 Ga0207708_10011837
1392 Ga0207708_10025429
1393 Ga0207708_10040442
1394 Ga0207702_10000097
1395 Ga0207641_10000302
1396 Ga0207641_10034256
1397 Ga0207648_10000979
1398 Ga0207648_10011185
1399 Ga0207648_10088431
1400 Ga0207648_10169180
1401 Ga0207676_10265474
1402 Ga0207674_10127799
1403 Ga0207675_100001993
1404 Ga0207675_100007416
1405 Ga0207675_100196209
1406 Ga0207675_100224355
1407 Ga0207683_10000334
1408 Ga0207683_10024839
1409 Ga0207698_10000072
1410 Ga0207698_10070853
1411 Ga0207698_10136079
1412 Ga0207698_10297577
1413 Ga0268266_10009911
1414 Ga0268266_10055011
1415 Ga0268266_10486737
1416 Ga0268265_10000038
1417 Ga0268265_10025828
1418 Ga0268265_10232811
1419 Ga0268264_10000056
1420 Ga0268264_10000280
1421 Ga0268264_10012887
1422 Ga0268264_10145565
1423 Ga0265334_10042138
1424 Ga0314311_1127295
1425 Ga0316183_1077323
1426 Ga0316182_1395692
1427 Ga0265325_10032299
1428 Ga0265327_10000358
1429 Ga0307509_10041006
1430 Ga0316575_10000545
1431 Ga0316576_10010593
1432 Ga0316578_10065381
1433 Ga0316578_10080776
1434 Ga0307516_10048220
1435 Ga0307413_10188979
1436 Ga0307410_10168074
1437 Ga0307406_10092427
1438 Ga0307406_10371703
1439 Ga0307412_10216045
1440 Ga0307409_100070227
1441 Ga0307409_100086893
1442 Ga0307409_100315286
1443 Ga0307409_100378253
1444 Ga0307409_100530650
1445 Ga0307416_100284935
1446 Ga0307414_10397765
1447 Ga0307414_10646801
1448 Ga0373959_0000224
1449 Ga0373928_0008874
1450 Ga0373939_0009652
1451 Ga0373941_0016813
1452 Ga0373960_0040098
1453 Ga0373943_0180749
1454 Ga0316574_0019163
1455 Ga0316574_0180511
1456 Ga0373931_0112383
1457 Ga0373931_0146781
1458 Ga0373933_0062717
1459 Ga0316584_0008378
1460 Ga0316584_0043583
1461 Ga0373925_0318038
1462 Ga0373925_0359321
1463 Ga0395899_0251107
1464 Ga0395898_0059405
1465 Ga0395898_0474252
1466 Ga0436364_0095068
1467 Ga0436364_0151759
1468 Ga0436364_0727309
1469 Ga0395901_0488453
1470 Ga0400485_08773
1471 Ga0400486_28732
1472 Ga0436365_0943842
1473 Ga0436365_1146896
1474 Ga0436365_1195958
1475 Ga0436360_0313352
1476 Ga0436363_0708325
1477 Ga0439436_0028907
1478 Ga0439461_0009888
1479 Ga0439466_0003018
1480 Ga0439466_0029723
1481 Ga0439466_0067199
1482 Ga0439465_0012327
1483 Ga0439465_0024211
1484 Ga0451793_0173016
1485 Ga0451793_1579998
1486 Ga0451795_0931545
1487 Ga0451795_1444608
1488 Ga0451833_0141528
1489 Ga0451837_1576909
1490 Ga0451839_0447997
1491 Ga0451853_0331732
1492 Ga0439431_0004979
1493 Ga0439431_0005227
1494 Ga0439445_0022142
1495 Ga0439445_0040731
1496 Ga0439445_0048936
1497 Ga0439432_016023
1498 Ga0439449_0051482
1499 Ga0439462_0002959
1500 Ga0439434_0006786
1501 Ga0439435_0020244
1502 Ga0439459_0004714
1503 Ga0439464_0015223
1504 Ga0466969_0047400
1505 Ga0466972_0010647
1506 Ga0466965_0004966
1507 Ga0466965_0028692
1508 Ga0466966_0003202
1509 Ga0466966_0008774
1510 Ga0466966_0210798
1511 Ga0466961_0011812
1512 Ga0466961_0118588
1513 Ga0466963_0023012
1514 Ga0466963_0029095
1515 Ga0466963_0063926
1516 Ga0466963_0145423
1517 Ga0466964_0101930
1518 Ga0466964_0201484
1519 Ga0466971_0012179
1520 Ga0466971_0035503
1521 Ga0466971_0212633
1522 Ga0466968_0019675
1523 Ga0466970_0003938
1524 Ga0466970_0035340
1525 Ga0466970_0256475
1526 Ga0466957_0000745
1527 Ga0466957_0031958
1528 Ga0466957_0094215
1529 Ga0466957_0104329
1530 Ga0466957_0107062
1531 Ga0466960_0000676
1532 Ga0466960_0001163
1533 Ga0466960_0008943
1534 Ga0466960_0032258
1535 Ga0466960_0107507
1536 Ga0466959_0004991
1537 Ga0466959_0007534
1538 Ga0466959_0085638
1539 Ga0451576_0002303
1540 Ga0466958_0025398
1541 Ga0466958_0025883
1542 Ga0466958_0065693
1543 Ga0466958_0151001
1544 Ga0466958_0218448
1545 Ga0466967_0004929
1546 Ga0466967_0005712
1547 Ga0466967_0025571
1548 Ga0466967_0096497
1549 Ga0466967_0109818
1550 Ga0466967_0113905
1551 Ga0466967_0119347
1552 Ga0466967_0364234
1553 Ga0466967_0800520
1554 Ga0495627_030337
1555 Ga0495629_0013527
1556 Ga0495629_0035066
1557 Ga0495638_0000247
1558 Ga0495638_0032134
1559 Ga0495582_0070277
1560 Ga0495639_0135663
1561 Ga0495639_0221976
1562 Ga0495662_0002485
1563 Ga0495664_0026240
1564 Ga0495594_0041725
1565 Ga0495606_0013640
1566 Ga0495648_0014127
1567 Ga0495648_0166034
1568 Ga0495652_0124456
1569 Ga0495645_0034496
1570 Ga0495633_0000025
1571 Ga0495668_0000167
1572 Ga0495634_0150728
1573 Ga0495625_0211361
1574 Ga0495658_0320962
1575 Ga0495649_0180330
1576 Ga0495581_0186004
1577 Ga0495674_0069030
1578 Ga0495672_0003415
1579 Ga0495672_0005726
1580 Ga0495672_0026705
1581 Ga0495673_0003856
1582 Ga0495686_0003681
1583 Ga0495593_0008905
1584 Ga0495593_0048945
1585 Ga0496100_0000527
1586 Ga0496100_0004078
1587 Ga0496100_0006138
1588 Ga0496100_0044083
1589 Ga0496100_0158209
1590 Ga0496101_0000002
1591 Ga0496101_0000619
1592 Ga0496101_0000765
1593 Ga0496101_0010167
1594 Ga0496101_0013978
1595 Ga0496101_0097595
1596 Ga0496102_0000009
1597 Ga0496102_0000973
1598 Ga0496102_0001870
1599 Ga0496102_0056618
1600 Ga0496102_0076687
1601 Ga0496102_0287897
1602 Ga0496103_0000005
1603 Ga0496103_0000902
1604 Ga0496103_0004390
1605 Ga0496104_0055723
1606 Ga0496104_0162034
1607 Ga0496104_0656832
1608 Ga0496105_0003833
1609 Ga0496105_0090349
1610 Ga0496105_0156982
1611 Ga0496106_0010701
1612 Ga0496106_0036460
1613 Ga0496106_0093974
1614 Ga0496106_0338540
1615 Ga0496107_0010484
1616 Ga0496107_0110606
1617 Ga0496108_0004412
1618 Ga0496108_0005920
1619 Ga0496108_0169501
1620 Ga0496108_0285505
1621 Ga0496108_0791721
1622 Ga0496109_0000747
1623 Ga0496109_0041880
1624 Ga0496109_0098003
1625 Ga0496109_0140259
1626 Ga0496109_0266160
1627 Ga0496109_0533224
1628 Ga0496110_0498686
1629 Ga0496111_0010684
1630 Ga0496111_0015233
1631 Ga0496111_0168775
1632 Ga0496112_0001525
1633 Ga0496112_0009325
1634 Ga0496112_0095459
1635 Ga0496112_0712779
1636 Ga0496113_0068329
1637 Ga0496114_0000681
1638 Ga0496114_0004256
1639 Ga0496114_0014448
1640 Ga0496114_0022813
1641 Ga0496114_0091880
1642 Ga0496114_0100517
1643 Ga0496114_0124023
1644 Ga0496114_0213249
1645 Ga0496114_0244900
1646 Ga0496114_0268628
1647 Ga0496114_0313434
1648 Ga0496114_0574702
1649 Ga0496115_0009071
1650 Ga0496115_0020330
1651 Ga0496116_0000104
1652 Ga0496116_0016923
1653 Ga0496117_0000019
1654 Ga0496117_0000028
1655 Ga0496117_0000497
1656 Ga0496117_0002095
1657 Ga0496117_0031541
1658 Ga0496118_0000020
1659 Ga0496118_0000255
1660 Ga0496118_0002066
1661 Ga0496118_0037919
1662 Ga0496118_0040589
1663 Ga0496118_0131553
1664 Ga0496119_0001830
1665 Ga0496119_0004258
1666 Ga0496119_0018843
1667 Ga0496119_0028338
1668 Ga0496120_0001838
1669 Ga0496120_0029385
1670 Ga0496120_0046233
1671 Ga0496120_0081021
1672 Ga0496121_0001252
1673 Ga0496121_0007909
1674 Ga0496122_0000522
1675 Ga0496122_0000534
1676 Ga0496122_0000877
1677 Ga0496122_0001012
1678 Ga0496122_0003004
1679 Ga0496122_0020806
1680 Ga0496122_0048687
1681 Ga0496123_0000142
1682 Ga0496123_0000251
1683 Ga0496123_0001800
1684 Ga0496123_0009604
1685 Ga0496124_0000420
1686 Ga0496124_0001505
1687 Ga0496124_0002708
1688 Ga0496124_0095728
1689 Ga0496125_0000085
1690 Ga0496125_0000214
1691 Ga0496125_0000857
1692 Ga0496125_0002891
1693 Ga0496125_0004133
1694 Ga0496125_0006476
1695 Ga0496125_0011614
1696 Ga0496125_0245183
1697 Ga0496126_0000931
1698 Ga0496126_0002688
1699 Ga0496126_0008151
1700 Ga0496126_0010295
1701 Ga0496126_0012396
1702 Ga0496126_0014320
1703 Ga0496126_0023340
1704 Ga0496126_0023445
1705 Ga0496126_0029198
1706 Ga0496126_0047354
1707 Ga0496126_0052596
1708 Ga0496126_0062705
1709 Ga0496126_0068632
1710 Ga0501031_0010829
1711 Ga0501031_0029921
1712 Ga0501032_0007655
1713 Ga0501032_0042793
1714 Ga0501033_0055147
1715 Ga0501033_0062546
1716 Ga0501033_0140939
1717 Ga0501034_0002933
1718 Ga0501034_0007765
1719 Ga0501034_0018608
1720 Ga0501034_0028244
1721 Ga0501034_0052682
1722 Ga0501034_0131828
1723 Ga0501034_0307530
1724 Ga0501034_0430569
1725 Ga0501036_0018267
1726 Ga0501036_0029322
1727 Ga0501036_0125563
1728 Ga0501037_0036272
1729 Ga0501038_0021716
1730 Ga0501038_0371429
1731 Ga0501039_0450145
1732 Ga0501040_0005707
1733 Ga0501042_0019926
1734 Ga0501043_0070417
1735 Ga0501043_0220194
1736 Ga0501046_0003054
1737 Ga0501046_0083613
1738 Ga0501046_0278524
1739 Ga0501047_0004113
1740 Ga0501047_0010633
1741 Ga0501047_0013607
1742 Ga0501047_0024057
1743 Ga0501047_0046100
1744 Ga0501047_0152736
1745 Ga0501048_0042785
1746 Ga0501048_0050206
1747 Ga0501048_0073862
1748 Ga0501067_0131736
1749 Ga0501068_0096961
1750 Ga0501068_0166478
1751 Ga0501069_0037454
1752 Ga0501070_0022067
1753 Ga0501070_0088591
1754 Ga0501070_0149810
1755 Ga0501072_0020049
1756 Ga0501072_0252526
1757 Ga0501074_0081345
1758 Ga0501075_0102029
1759 Ga0501076_0059207
1760 Ga0501222_004336
1761 Ga0501238_004383
1762 Ga0501238_016412
1763 Ga0501242_000231
1764 Ga0501257_001564
1765 Ga0501259_006624
1766 Ga0501079_0155365
1767 Ga0501080_0046200
1768 Ga0501080_0326391
1769 Ga0501081_0101574
1770 Ga0501083_0004945
1771 Ga0501083_0035867
1772 Ga0501083_0036714
1773 Ga0501241_000961
1774 Ga0501241_002804
1775 Ga0501035_0000121
1776 Ga0501035_0005068
1777 Ga0501035_0006303
1778 Ga0501035_0083466
1779 Ga0501035_0105087
1780 Ga0501035_0492572
1781 Ga0501044_0001588
1782 Ga0501044_0007597
1783 Ga0501044_0042467
1784 Ga0501044_0254659
1785 Ga0501045_0031658
1786 nmdc:mga03683_104824_c1
1787 nmdc:mga03683_10497_c2
1788 nmdc:mga03683_105877_c1
1789 nmdc:mga03683_18147_c1
1790 nmdc:mga03683_19145_c1
1791 nmdc:mga03683_68955_c1
1792 nmdc:mga03n38_12463_c1
1793 nmdc:mga03n38_133606_c1
1794 nmdc:mga03n38_150962_c1
1795 nmdc:mga03n38_268483_c1
1796 nmdc:mga03n38_3173_c1
1797 nmdc:mga03n38_3177_c1
1798 nmdc:mga03n38_345_c1
1799 nmdc:mga03n38_4741_c1
1800 nmdc:mga03n38_61508_c1
1801 nmdc:mga03n38_97935_c1
1802 nmdc:mga00v17_16536_c1
1803 nmdc:mga00v17_188252_c1
1804 nmdc:mga00v17_393798_c1
1805 nmdc:mga00v17_42601_c1
1806 nmdc:mga00v17_45625_c1
1807 nmdc:mga00v17_6119_c1
1808 nmdc:mga00v17_81554_c1
1809 nmdc:mga00v17_96202_c1
1810 nmdc:mga0yw44_13779_c1
1811 nmdc:mga0yw44_157666_c1
1812 nmdc:mga0yw44_161384_c1
1813 nmdc:mga0yw44_17240_c1
1814 nmdc:mga0yw44_18395_c1
1815 nmdc:mga0yw44_24584_c1
1816 nmdc:mga0yw44_4417_c1
1817 nmdc:mga0yw44_455781_c1
1818 nmdc:mga0yw44_51367_c1
1819 nmdc:mga0yw44_58089_c1
1820 nmdc:mga0yw44_5_c1
1821 nmdc:mga0k408_105717_c1
1822 nmdc:mga0k408_111139_c1
1823 nmdc:mga0k408_298318_c1
1824 nmdc:mga06z11_175467_c1
1825 nmdc:mga06z11_226238_c1
1826 nmdc:mga06z11_52945_c1
1827 nmdc:mga04h51_4947_c1
1828 nmdc:mga04h51_67847_c1
1829 nmdc:mga07m45_116966_c1
1830 nmdc:mga07m45_168_c1
1831 nmdc:mga07m45_27678_c2
1832 nmdc:mga07m45_45088_c1
1833 nmdc:mga07m45_848_c1
1834 nmdc:mga06r32_304478_c1
1835 nmdc:mga08y16_162499_c1
1836 nmdc:mga08y16_37703_c1
1837 nmdc:mga08y16_494241_c1
1838 nmdc:mga08y16_625945_c1
1839 nmdc:mga0sz30_10947_c1
1840 nmdc:mga0sz30_134848_c1
1841 nmdc:mga0sz30_138812_c1
1842 nmdc:mga0sz30_153935_c1
1843 nmdc:mga0sz30_20167_c1
1844 nmdc:mga0sz30_22654_c1
1845 nmdc:mga0sz30_26935_c1
1846 nmdc:mga0sz30_31676_c1
1847 nmdc:mga0sz30_56_c1
1848 nmdc:mga0sz30_6507_c2
1849 nmdc:mga0sz30_99890_c1
1850 Ga0495601_0140327
1851 Ga0500610_0009933
1852 Ga0500635_0011660
1853 Ga0500643_001252
1854 Ga0500643_001788
1855 Ga0500643_002468
1856 Ga0500643_009677
1857 Ga0500646_0005272
1858 Ga0500583_0000111
1859 Ga0500651_0002354
1860 Ga0500641_0005068
1861 Ga0500641_0042974
1862 Ga0500555_000023
1863 Ga0500556_0067442
1864 Ga0500562_007680
1865 Ga0500569_000008
1866 Ga0500569_024101
1867 Ga0500608_103572
1868 Ga0500652_000058
1869 Ga0500652_000912
1870 Ga0500655_002822
1871 Ga0500658_0019173
1872 Ga0500658_0113266
1873 Ga0500559_0052503
1874 Ga0500568_0009913
1875 Ga0500568_0030043
1876 Ga0500568_0087860
1877 Ga0500573_0000080
1878 Ga0500573_0002557
1879 Ga0500573_0004692
1880 Ga0500577_0000422
1881 Ga0500588_0000023
1882 Ga0500616_0001675
1883 Ga0500616_0055766
1884 Ga0500622_0000151
1885 Ga0500633_0007500
1886 Ga0500645_000108
1887 Ga0500645_019002
1888 Ga0500552_011595
1889 Ga0501084_0022823
1890 Ga0501084_0109917
1891 Ga0501084_0452771
1892 Ga0501082_0002655
1893 Ga0501082_0237262
1894 Ga0466962_0046998
1895 2548692431
1896 2552104972
1897 2552112726
1898 2643753076
1899 2643824472
1900 2644083629
1901 2644444390
1902 2644487542
1903 2644503208
1904 2644517325
1905 2644525518
1906 2644535731
1907 2644539284
1908 2644639107
1909 2644664174
1910 2644669602
1911 2729908320
1912 2738693132
1913 2738706650
1914 2739206427
1915 2739239235
1916 2739323294
1917 2739329825
1918 2739333268
1919 2739607900
1920 2744956108
1921 2747954531
1922 2753037297
1923 2753325166
1924 2758224495
1925 2760304089
1926 2760621959
1927 2774400308
1928 2795796733
1929 2809026796
1930 2809226790
1931 2812322393
1932 2812364680
1933 2816422681
1934 2819677426
1935 2821269312
1936 2835191215
1937 2839989572
1938 2840679241
1939 2842135319
1940 2842889849
1941 2857633039
1942 2857720978
1943 2870629669
1944 2870805214
1945 2884996107
1946 2889304189
1947 2895502688
1948 2896087052
1949 2896114337
1950 2902794162
1951 2902802910
1952 2902802927
1953 2902816006
1954 2902839628
1955 2904768367
1956 2904773969
1957 2904775766
1958 2906801150
1959 2908811725
1960 2919421738
1961 2919434704
1962 2919714777
1963 2922558077
1964 2928147071
1965 2929177185
1966 2929239608
1967 2929921238
1968 2932401281
1969 2932433180
1970 2935891556
1971 2939586058
1972 2939745417
1973 2945979552
1974 2946014580
1975 2946082443
1976 2974298098
1977 2974319682
1978 2974325666
1979 2977252102
1980 2977265853
1981 2984523550
1982 8003152528
1983 8056580823

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

1

234

0.98

PF12804

NTP_transf_3

MobA-like NTP transferase domain

1

138

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ftv-assembly2.cif.gz_C pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9889 2 286
5fuh-assembly2.cif.gz_C pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9871 2 286
4b2x-assembly2.cif.gz_B pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9867 2 286
1mp4-assembly1.cif.gz_A w224h variant of s. enterica rmla 0.9858 2 284
4hoc-assembly2.cif.gz_B crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n-acetylglucosamine 0.9849 1 285
ID Description Score Start End Superfamily
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9843 2 285 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9741 2 285 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9454 1 237 3.90.550.10
5z0aE01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9143 1 222 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9034 1 222 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A351VA12-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9994 1 112 GO:0008879
GO:0045226
AF-A0A561DDF8-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9988 1 122 GO:0008879
GO:0045226
AF-A0A5K1ISM2-F1-model_v4 Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) 0.9988 1 80 GO:0008879
GO:0045226
AF-A0A2G6VR69-F1-model_v4 Multifunctional fusion protein [Includes: Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24); dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)] 0.998 1 285 GO:0008460
GO:0008879
GO:0009225
GO:0045226
GO:0046872
AF-A0A6I0DZI6-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9975 1 106 GO:0008879
GO:0045226

Map