F487654
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 992 | 592 | 1984 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10080003|Ga0070658_100800033 |
| Length | 283 |
| Sequence | MRHLVILATVMTCAFAPPLLAETTASSSPEKDFAAFRHYFTSKFPKVELNDFVNGPYSMDEGLRKQWVEKEVFPPYDFALDHGKELFEKPFKNGKTFADCFDNKGIGVRQNYPYFDEKTNEVVTLELAVNQCLEKNGEKPYNYMKDDMAAVTAYMAFTSRGKPFDIKIPKDNPKALEAYEKGKQYFYQRRGQFNFSCASCHVQAPGERIRAEVLAPALGILNAMPIYRSEWGGMGTISRRFTSCNSQVRGVPLKPQDPEYRNVEYYLSYMANGLPISGPGARP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 72 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 101 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 102 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 103 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 104 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 107 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 162 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 190 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 193 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 220 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 222 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 309 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 310 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 311 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 312 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 313 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 314 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 315 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 316 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 358 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 367 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 369 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 370 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 371 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 374 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 375 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 378 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 379 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 381 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 383 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 384 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 386 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 387 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 390 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 391 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 392 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 393 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 394 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 395 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 396 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 397 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 398 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 399 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 400 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 401 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 402 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 403 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 404 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 405 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 406 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 407 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 408 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 409 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 410 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 411 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 412 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 413 | 2791355199 | |||
| 414 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 415 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 416 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 417 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 418 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 419 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 420 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 421 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 422 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 423 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 424 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 425 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 426 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 427 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 428 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 429 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 430 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 431 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 432 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 433 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 434 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 435 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 436 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 437 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 438 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 439 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 440 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 441 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 442 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 443 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 444 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 445 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 446 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 447 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 448 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 449 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 450 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 451 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 452 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 453 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 454 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 455 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 456 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 457 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 458 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 459 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 460 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 461 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 462 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 463 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 464 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 465 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 466 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 467 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 468 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 469 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 470 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 471 | 2904699407 | |||
| 472 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 473 | 2906610324 | |||
| 474 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 475 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 476 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 477 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 478 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 479 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 480 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 481 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 482 | 2922368715 | |||
| 483 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 484 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 485 | 2922425934 | |||
| 486 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 487 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 488 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 489 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 490 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 491 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 492 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 493 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 494 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 495 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 496 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 497 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 498 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 499 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 500 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 501 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 502 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 503 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 504 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 505 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 506 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 507 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 508 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 509 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 510 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 511 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 512 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 513 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 514 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 515 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 516 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 517 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 518 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 519 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 520 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 521 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 522 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 523 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 524 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 525 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 526 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 527 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 528 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 529 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 530 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 531 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 532 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 533 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 534 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 535 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 536 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 537 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 538 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 539 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 540 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 541 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 542 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 543 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 544 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 545 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 546 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 547 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 548 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 549 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 550 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 551 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 552 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 553 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 554 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 555 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 556 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 557 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 558 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 559 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 560 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 561 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 562 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 563 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 564 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 565 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 566 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 567 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 568 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 569 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 570 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 571 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 572 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 573 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 574 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 575 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 576 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 577 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 578 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 579 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 580 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 581 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 582 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 583 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 584 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 585 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 586 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 587 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 588 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 589 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 590 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 591 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 592 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.84 |
| Metatranscriptomes | 0 |
| Isolates | 20.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.38 |
| Nodule | 16.73 |
| Rhizoplane | 5.44 |
| Rhizosphere | 57.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10080003 | 3300005327 | Bacteria | 2684 |
| 2 | JGI25406J46586_10000009 | 3300003203 | Bacteria | 109818 |
| 3 | rootH1_10072573 | 3300003323 | Bacteria | 2017 |
| 4 | JGI25160J50197_1002555 | 3300003354 | Bacteria | 8422 |
| 5 | JGI25160J50197_1009959 | 3300003354 | Bacteria | 3479 |
| 6 | JGI25404J52841_10027858 | 3300003659 | Bacteria | 1214 |
| 7 | JGI25404J52841_10038208 | 3300003659 | Bacteria | 1019 |
| 8 | Ga0055542_1006464 | 3300003762 | Bacteria | 2502 |
| 9 | Ga0065165_1002687 | 3300005262 | Bacteria | 14319 |
| 10 | Ga0065165_1026814 | 3300005262 | Bacteria | 1889 |
| 11 | Ga0070658_10113862 | 3300005327 | Bacteria | 2243 |
| 12 | Ga0070676_10105727 | 3300005328 | Bacteria | 1745 |
| 13 | Ga0070683_100171046 | 3300005329 | Bacteria | 2062 |
| 14 | Ga0070683_100286016 | 3300005329 | Bacteria | 1568 |
| 15 | Ga0070690_100336687 | 3300005330 | Bacteria | 1092 |
| 16 | Ga0070670_100097588 | 3300005331 | Bacteria | 2528 |
| 17 | Ga0070670_100210948 | 3300005331 | Bacteria | 1689 |
| 18 | Ga0068869_100333060 | 3300005334 | Bacteria | 1234 |
| 19 | Ga0070680_100014445 | 3300005336 | Bacteria | 6174 |
| 20 | Ga0070680_100023524 | 3300005336 | Bacteria | 4914 |
| 21 | Ga0068868_100146708 | 3300005338 | Bacteria | 1941 |
| 22 | Ga0070660_100009964 | 3300005339 | Bacteria | 6700 |
| 23 | Ga0070660_100011441 | 3300005339 | Bacteria | 6305 |
| 24 | Ga0070689_100363424 | 3300005340 | Bacteria | 1216 |
| 25 | Ga0070691_10125944 | 3300005341 | Bacteria | 1294 |
| 26 | Ga0070661_100050355 | 3300005344 | Bacteria | 3047 |
| 27 | Ga0070675_100128981 | 3300005354 | Bacteria | 2154 |
| 28 | Ga0070674_100460405 | 3300005356 | Bacteria | 1052 |
| 29 | Ga0070659_100014636 | 3300005366 | Bacteria | 5866 |
| 30 | Ga0070659_100044076 | 3300005366 | Bacteria | 3491 |
| 31 | Ga0070709_10000732 | 3300005434 | Bacteria | 18548 |
| 32 | Ga0070709_10050555 | 3300005434 | Bacteria | 2605 |
| 33 | Ga0070714_100007289 | 3300005435 | Bacteria | 8598 |
| 34 | Ga0070714_100017631 | 3300005435 | Bacteria | 5787 |
| 35 | Ga0070714_100034321 | 3300005435 | Bacteria | 4249 |
| 36 | Ga0070714_100056302 | 3300005435 | Bacteria | 3363 |
| 37 | Ga0070714_100267804 | 3300005435 | Bacteria | 1583 |
| 38 | Ga0070713_100014459 | 3300005436 | Bacteria | 5864 |
| 39 | Ga0070710_10000211 | 3300005437 | Bacteria | 27400 |
| 40 | Ga0070710_10012645 | 3300005437 | Bacteria | 4198 |
| 41 | Ga0070711_100001113 | 3300005439 | Bacteria | 14371 |
| 42 | Ga0070711_100367831 | 3300005439 | Bacteria | 1159 |
| 43 | Ga0070711_100416558 | 3300005439 | Bacteria | 1094 |
| 44 | Ga0070663_100005344 | 3300005455 | Bacteria | 7623 |
| 45 | Ga0070663_100029905 | 3300005455 | Bacteria | 3727 |
| 46 | Ga0070663_100171615 | 3300005455 | Bacteria | 1677 |
| 47 | Ga0070678_100060739 | 3300005456 | Bacteria | 2783 |
| 48 | Ga0070681_10017850 | 3300005458 | Bacteria | 7091 |
| 49 | Ga0070681_10193834 | 3300005458 | Bacteria | 1951 |
| 50 | Ga0068867_100229681 | 3300005459 | Bacteria | 1499 |
| 51 | Ga0070706_100484489 | 3300005467 | Bacteria | 1151 |
| 52 | Ga0070679_100016197 | 3300005530 | Bacteria | 7181 |
| 53 | Ga0070679_100316937 | 3300005530 | Bacteria | 1509 |
| 54 | Ga0070684_100008647 | 3300005535 | Bacteria | 7977 |
| 55 | Ga0070684_100206596 | 3300005535 | Bacteria | 1790 |
| 56 | Ga0070697_100135729 | 3300005536 | Bacteria | 2066 |
| 57 | Ga0068853_100008174 | 3300005539 | Bacteria | 8398 |
| 58 | Ga0068853_100161116 | 3300005539 | Bacteria | 2025 |
| 59 | Ga0068853_100418281 | 3300005539 | Bacteria | 1257 |
| 60 | Ga0070686_100264679 | 3300005544 | Bacteria | 1262 |
| 61 | Ga0070665_100073912 | 3300005548 | Bacteria | 3415 |
| 62 | Ga0070665_100119741 | 3300005548 | Bacteria | 2634 |
| 63 | Ga0070665_100163266 | 3300005548 | Bacteria | 2230 |
| 64 | Ga0070665_100179577 | 3300005548 | Bacteria | 2117 |
| 65 | Ga0070665_100395599 | 3300005548 | Bacteria | 1389 |
| 66 | Ga0068855_100024487 | 3300005563 | Bacteria | 7221 |
| 67 | Ga0068855_100056894 | 3300005563 | Bacteria | 4585 |
| 68 | Ga0068855_100280210 | 3300005563 | Bacteria | 1851 |
| 69 | Ga0070664_100211131 | 3300005564 | Bacteria | 1735 |
| 70 | Ga0068857_100397800 | 3300005577 | Bacteria | 1282 |
| 71 | Ga0068857_100613611 | 3300005577 | Bacteria | 1029 |
| 72 | Ga0068856_100002749 | 3300005614 | Bacteria | 18013 |
| 73 | Ga0068852_100089252 | 3300005616 | Bacteria | 2755 |
| 74 | Ga0068859_100047364 | 3300005617 | Bacteria | 4319 |
| 75 | Ga0068864_100083102 | 3300005618 | Bacteria | 2812 |
| 76 | Ga0068861_100182400 | 3300005719 | Bacteria | 1748 |
| 77 | Ga0068870_10024241 | 3300005840 | Bacteria | 3000 |
| 78 | Ga0068863_100203223 | 3300005841 | Bacteria | 1906 |
| 79 | Ga0068863_100494868 | 3300005841 | Bacteria | 1204 |
| 80 | Ga0068858_100213893 | 3300005842 | Bacteria | 1824 |
| 81 | Ga0068858_100532612 | 3300005842 | Bacteria | 1136 |
| 82 | Ga0068860_100000257 | 3300005843 | Bacteria | 78468 |
| 83 | Ga0068860_100048315 | 3300005843 | Bacteria | 4055 |
| 84 | Ga0068860_100192407 | 3300005843 | Bacteria | 1974 |
| 85 | Ga0068860_100502523 | 3300005843 | Bacteria | 1210 |
| 86 | Ga0081455_10006300 | 3300005937 | Bacteria | 12756 |
| 87 | Ga0081455_10006921 | 3300005937 | Bacteria | 12061 |
| 88 | Ga0081455_10031610 | 3300005937 | Bacteria | 4785 |
| 89 | Ga0081455_10065139 | 3300005937 | Bacteria | 3049 |
| 90 | Ga0081538_10032860 | 3300005981 | Bacteria | 3465 |
| 91 | Ga0081540_1002991 | 3300005983 | Bacteria | 13549 |
| 92 | Ga0081540_1003839 | 3300005983 | Bacteria | 11755 |
| 93 | Ga0081540_1005804 | 3300005983 | Bacteria | 9136 |
| 94 | Ga0081540_1016025 | 3300005983 | Bacteria | 4718 |
| 95 | Ga0081540_1035214 | 3300005983 | Bacteria | 2688 |
| 96 | Ga0081540_1134802 | 3300005983 | Bacteria | 1002 |
| 97 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 98 | Ga0081539_10000530 | 3300005985 | Bacteria | 79454 |
| 99 | Ga0081539_10050176 | 3300005985 | Bacteria | 2363 |
| 100 | Ga0081539_10164556 | 3300005985 | Bacteria | 1054 |
| 101 | Ga0070717_10029633 | 3300006028 | Bacteria | 4392 |
| 102 | Ga0070717_10355778 | 3300006028 | Bacteria | 1310 |
| 103 | Ga0075365_10015761 | 3300006038 | Bacteria | 4578 |
| 104 | Ga0075365_10095900 | 3300006038 | Bacteria | 2026 |
| 105 | Ga0075368_10007497 | 3300006042 | Bacteria | 3848 |
| 106 | Ga0075368_10100804 | 3300006042 | Bacteria | 1186 |
| 107 | Ga0075363_100042275 | 3300006048 | Bacteria | 2407 |
| 108 | Ga0075363_100218234 | 3300006048 | Bacteria | 1092 |
| 109 | Ga0075364_10124008 | 3300006051 | Bacteria | 1730 |
| 110 | Ga0070715_10184389 | 3300006163 | Bacteria | 1049 |
| 111 | Ga0070716_100001713 | 3300006173 | Bacteria | 9880 |
| 112 | Ga0070712_100020761 | 3300006175 | Bacteria | 4302 |
| 113 | Ga0070712_100035189 | 3300006175 | Bacteria | 3399 |
| 114 | Ga0070712_100050724 | 3300006175 | Bacteria | 2888 |
| 115 | Ga0075367_10087696 | 3300006178 | Bacteria | 1890 |
| 116 | Ga0075367_10124896 | 3300006178 | Bacteria | 1587 |
| 117 | Ga0075369_10018011 | 3300006186 | Bacteria | 2871 |
| 118 | Ga0075369_10023867 | 3300006186 | Bacteria | 2531 |
| 119 | Ga0075366_10046585 | 3300006195 | Bacteria | 2569 |
| 120 | Ga0097621_100083441 | 3300006237 | Bacteria | 2663 |
| 121 | Ga0075370_10112237 | 3300006353 | Bacteria | 1583 |
| 122 | Ga0075370_10126424 | 3300006353 | Bacteria | 1490 |
| 123 | Ga0068871_100054328 | 3300006358 | Bacteria | 3249 |
| 124 | Ga0068871_100167157 | 3300006358 | Bacteria | 1884 |
| 125 | Ga0075434_100138919 | 3300006871 | Bacteria | 2449 |
| 126 | Ga0068865_100231300 | 3300006881 | Bacteria | 1450 |
| 127 | Ga0068865_100251609 | 3300006881 | Bacteria | 1395 |
| 128 | Ga0097620_100047363 | 3300006931 | Bacteria | 4319 |
| 129 | Ga0099824_1007096 | 3300006942 | Bacteria | 15025 |
| 130 | Ga0099822_1000135 | 3300006943 | Bacteria | 49135 |
| 131 | Ga0099794_10066168 | 3300007265 | Bacteria | 1763 |
| 132 | Ga0105244_10112946 | 3300009036 | Bacteria | 1320 |
| 133 | Ga0105240_10029904 | 3300009093 | Bacteria | 7089 |
| 134 | Ga0105240_10129948 | 3300009093 | Bacteria | 3022 |
| 135 | Ga0105240_10131811 | 3300009093 | Bacteria | 2997 |
| 136 | Ga0105240_10146739 | 3300009093 | Bacteria | 2814 |
| 137 | Ga0105240_10180765 | 3300009093 | Bacteria | 2489 |
| 138 | Ga0111539_10152799 | 3300009094 | Bacteria | 2702 |
| 139 | Ga0111539_10177955 | 3300009094 | Bacteria | 2485 |
| 140 | Ga0105245_10373307 | 3300009098 | Bacteria | 1418 |
| 141 | Ga0105247_10031287 | 3300009101 | Bacteria | 3229 |
| 142 | Ga0105243_10047809 | 3300009148 | Bacteria | 3370 |
| 143 | Ga0105241_10422385 | 3300009174 | Bacteria | 1174 |
| 144 | Ga0105248_10018433 | 3300009177 | Bacteria | 7714 |
| 145 | Ga0105248_10175736 | 3300009177 | Bacteria | 2413 |
| 146 | Ga0105248_10454680 | 3300009177 | Bacteria | 1443 |
| 147 | Ga0105237_10028115 | 3300009545 | Bacteria | 5730 |
| 148 | Ga0105237_10039147 | 3300009545 | Bacteria | 4786 |
| 149 | Ga0105238_10008395 | 3300009551 | Bacteria | 10334 |
| 150 | Ga0105238_10021725 | 3300009551 | Bacteria | 6537 |
| 151 | Ga0105238_10084387 | 3300009551 | Bacteria | 3166 |
| 152 | Ga0105249_10038388 | 3300009553 | Bacteria | 4346 |
| 153 | Ga0105239_10059090 | 3300010375 | Bacteria | 4208 |
| 154 | Ga0105239_10064085 | 3300010375 | Bacteria | 4035 |
| 155 | Ga0105239_10064900 | 3300010375 | Bacteria | 4008 |
| 156 | Ga0105239_10130316 | 3300010375 | Bacteria | 2797 |
| 157 | Ga0105239_10568486 | 3300010375 | Bacteria | 1292 |
| 158 | Ga0105246_10030981 | 3300011119 | Bacteria | 3537 |
| 159 | Ga0157370_10035427 | 3300013104 | Bacteria | 4851 |
| 160 | Ga0157370_10056045 | 3300013104 | Bacteria | 3752 |
| 161 | Ga0157370_10066941 | 3300013104 | Bacteria | 3396 |
| 162 | Ga0157370_10085334 | 3300013104 | Bacteria | 2966 |
| 163 | Ga0157369_10075142 | 3300013105 | Bacteria | 3624 |
| 164 | Ga0157369_10105089 | 3300013105 | Bacteria | 3006 |
| 165 | Ga0157369_10158242 | 3300013105 | Bacteria | 2392 |
| 166 | Ga0157374_10182677 | 3300013296 | Bacteria | 2049 |
| 167 | Ga0157378_10012723 | 3300013297 | Bacteria | 7363 |
| 168 | Ga0157378_10314333 | 3300013297 | Bacteria | 1520 |
| 169 | Ga0163162_10082734 | 3300013306 | Bacteria | 3282 |
| 170 | Ga0163162_10324132 | 3300013306 | Bacteria | 1673 |
| 171 | Ga0157372_10665512 | 3300013307 | Bacteria | 1212 |
| 172 | Ga0157375_10074428 | 3300013308 | Bacteria | 3418 |
| 173 | Ga0163163_10531732 | 3300014325 | Bacteria | 1238 |
| 174 | Ga0157380_10305002 | 3300014326 | Bacteria | 1469 |
| 175 | Ga0157380_10394268 | 3300014326 | Bacteria | 1311 |
| 176 | Ga0157379_10054384 | 3300014968 | Bacteria | 3577 |
| 177 | Ga0157376_10300126 | 3300014969 | Bacteria | 1520 |
| 178 | Ga0182007_10064447 | 3300015262 | Bacteria | 1201 |
| 179 | Ga0163161_10078523 | 3300017792 | Bacteria | 2426 |
| 180 | Ga0214544_1000087 | 3300021320 | Bacteria | 119600 |
| 181 | Ga0214542_1000018 | 3300021321 | Bacteria | 202226 |
| 182 | Ga0214545_1000009 | 3300021324 | Bacteria | 202915 |
| 183 | Ga0214543_1000037 | 3300021327 | Bacteria | 182113 |
| 184 | Ga0213873_10003627 | 3300021358 | Bacteria | 2801 |
| 185 | Ga0213876_10009766 | 3300021384 | Bacteria | 5163 |
| 186 | Ga0213871_10010443 | 3300021441 | Bacteria | 2106 |
| 187 | Ga0209677_100351 | 3300025253 | Bacteria | 28656 |
| 188 | Ga0209677_105322 | 3300025253 | Bacteria | 3394 |
| 189 | Ga0209148_1000694 | 3300025254 | Bacteria | 27288 |
| 190 | Ga0209233_1001183 | 3300025261 | Bacteria | 10540 |
| 191 | Ga0209233_1001483 | 3300025261 | Bacteria | 9243 |
| 192 | Ga0209233_1004271 | 3300025261 | Bacteria | 4888 |
| 193 | Ga0209455_1010407 | 3300025272 | Bacteria | 2366 |
| 194 | Ga0209455_1016202 | 3300025272 | Bacteria | 1609 |
| 195 | Ga0209758_1010323 | 3300025297 | Bacteria | 5608 |
| 196 | Ga0209758_1012517 | 3300025297 | Bacteria | 4738 |
| 197 | Ga0209758_1018538 | 3300025297 | Bacteria | 3403 |
| 198 | Ga0209758_1036727 | 3300025297 | Bacteria | 1906 |
| 199 | Ga0207426_1000201 | 3300025302 | Bacteria | 143975 |
| 200 | Ga0207426_1007359 | 3300025302 | Bacteria | 4620 |
| 201 | Ga0207426_1009367 | 3300025302 | Bacteria | 3879 |
| 202 | Ga0207656_10159496 | 3300025321 | Bacteria | 1073 |
| 203 | Ga0207692_10000494 | 3300025898 | Bacteria | 13955 |
| 204 | Ga0207642_10107148 | 3300025899 | Bacteria | 1415 |
| 205 | Ga0207710_10023909 | 3300025900 | Bacteria | 2628 |
| 206 | Ga0207647_10132985 | 3300025904 | Bacteria | 1461 |
| 207 | Ga0207699_10000480 | 3300025906 | Bacteria | 20266 |
| 208 | Ga0207699_10032324 | 3300025906 | Bacteria | 2948 |
| 209 | Ga0207699_10092807 | 3300025906 | Bacteria | 1898 |
| 210 | Ga0207699_10240327 | 3300025906 | Bacteria | 1244 |
| 211 | Ga0207705_10046309 | 3300025909 | Bacteria | 3125 |
| 212 | Ga0207705_10110790 | 3300025909 | Bacteria | 2028 |
| 213 | Ga0207684_10096663 | 3300025910 | Bacteria | 2521 |
| 214 | Ga0207654_10181150 | 3300025911 | Bacteria | 1375 |
| 215 | Ga0207707_10007086 | 3300025912 | Bacteria | 9771 |
| 216 | Ga0207707_10020967 | 3300025912 | Bacteria | 5709 |
| 217 | Ga0207707_10037525 | 3300025912 | Bacteria | 4235 |
| 218 | Ga0207707_10154186 | 3300025912 | Bacteria | 2009 |
| 219 | Ga0207707_10379586 | 3300025912 | Bacteria | 1215 |
| 220 | Ga0207695_10042176 | 3300025913 | Bacteria | 4878 |
| 221 | Ga0207695_10141798 | 3300025913 | Bacteria | 2351 |
| 222 | Ga0207671_10023286 | 3300025914 | Bacteria | 4671 |
| 223 | Ga0207671_10065742 | 3300025914 | Bacteria | 2698 |
| 224 | Ga0207671_10081338 | 3300025914 | Bacteria | 2429 |
| 225 | Ga0207693_10001776 | 3300025915 | Bacteria | 18911 |
| 226 | Ga0207693_10010321 | 3300025915 | Bacteria | 7581 |
| 227 | Ga0207693_10021887 | 3300025915 | Bacteria | 5084 |
| 228 | Ga0207693_10027366 | 3300025915 | Bacteria | 4508 |
| 229 | Ga0207693_10043158 | 3300025915 | Bacteria | 3550 |
| 230 | Ga0207663_10000356 | 3300025916 | Bacteria | 19925 |
| 231 | Ga0207663_10018201 | 3300025916 | Bacteria | 3931 |
| 232 | Ga0207660_10002711 | 3300025917 | Bacteria | 11604 |
| 233 | Ga0207660_10077105 | 3300025917 | Bacteria | 2439 |
| 234 | Ga0207660_10117379 | 3300025917 | Bacteria | 2011 |
| 235 | Ga0207660_10181152 | 3300025917 | Bacteria | 1636 |
| 236 | Ga0207657_10011430 | 3300025919 | Bacteria | 8815 |
| 237 | Ga0207657_10012728 | 3300025919 | Bacteria | 8286 |
| 238 | Ga0207657_10026499 | 3300025919 | Bacteria | 5326 |
| 239 | Ga0207657_10120290 | 3300025919 | Bacteria | 2161 |
| 240 | Ga0207657_10177267 | 3300025919 | Bacteria | 1724 |
| 241 | Ga0207652_10004991 | 3300025921 | Bacteria | 10747 |
| 242 | Ga0207652_10025043 | 3300025921 | Bacteria | 4957 |
| 243 | Ga0207681_10112595 | 3300025923 | Bacteria | 1982 |
| 244 | Ga0207694_10007898 | 3300025924 | Bacteria | 8055 |
| 245 | Ga0207694_10097619 | 3300025924 | Bacteria | 2325 |
| 246 | Ga0207694_10184898 | 3300025924 | Bacteria | 1691 |
| 247 | Ga0207687_10184149 | 3300025927 | Bacteria | 1620 |
| 248 | Ga0207664_10020450 | 3300025929 | Bacteria | 4906 |
| 249 | Ga0207664_10055501 | 3300025929 | Bacteria | 3143 |
| 250 | Ga0207664_10061817 | 3300025929 | Bacteria | 2989 |
| 251 | Ga0207664_10127444 | 3300025929 | Bacteria | 2138 |
| 252 | Ga0207664_10369600 | 3300025929 | Bacteria | 1272 |
| 253 | Ga0207644_10168012 | 3300025931 | Bacteria | 1710 |
| 254 | Ga0207644_10243620 | 3300025931 | Bacteria | 1432 |
| 255 | Ga0207690_10307553 | 3300025932 | Bacteria | 1242 |
| 256 | Ga0207706_10061004 | 3300025933 | Bacteria | 3321 |
| 257 | Ga0207709_10007124 | 3300025935 | Bacteria | 6242 |
| 258 | Ga0207669_10004832 | 3300025937 | Bacteria | 5983 |
| 259 | Ga0207704_10059506 | 3300025938 | Bacteria | 2359 |
| 260 | Ga0207704_10335701 | 3300025938 | Bacteria | 1171 |
| 261 | Ga0207665_10001832 | 3300025939 | Bacteria | 14302 |
| 262 | Ga0207691_10035507 | 3300025940 | Bacteria | 4625 |
| 263 | Ga0207711_10025676 | 3300025941 | Bacteria | 4941 |
| 264 | Ga0207711_10158025 | 3300025941 | Bacteria | 2050 |
| 265 | Ga0207711_10257779 | 3300025941 | Bacteria | 1602 |
| 266 | Ga0207689_10071969 | 3300025942 | Bacteria | 2840 |
| 267 | Ga0207661_10031859 | 3300025944 | Bacteria | 4078 |
| 268 | Ga0207661_10129788 | 3300025944 | Bacteria | 2157 |
| 269 | Ga0207661_10281079 | 3300025944 | Bacteria | 1488 |
| 270 | Ga0207661_10544497 | 3300025944 | Bacteria | 1063 |
| 271 | Ga0207667_10010722 | 3300025949 | Bacteria | 10691 |
| 272 | Ga0207667_10022929 | 3300025949 | Bacteria | 6882 |
| 273 | Ga0207667_10243413 | 3300025949 | Bacteria | 1840 |
| 274 | Ga0207667_10349377 | 3300025949 | Bacteria | 1508 |
| 275 | Ga0207712_10031864 | 3300025961 | Bacteria | 3554 |
| 276 | Ga0207668_10010669 | 3300025972 | Bacteria | 5559 |
| 277 | Ga0207668_10015396 | 3300025972 | Bacteria | 4751 |
| 278 | Ga0207668_10031458 | 3300025972 | Bacteria | 3495 |
| 279 | Ga0207640_10266202 | 3300025981 | Bacteria | 1338 |
| 280 | Ga0207677_10036816 | 3300026023 | Bacteria | 3193 |
| 281 | Ga0207703_10149157 | 3300026035 | Bacteria | 2037 |
| 282 | Ga0207639_10043497 | 3300026041 | Bacteria | 3372 |
| 283 | Ga0207639_10183014 | 3300026041 | Bacteria | 1784 |
| 284 | Ga0207639_10221198 | 3300026041 | Bacteria | 1635 |
| 285 | Ga0207639_10393611 | 3300026041 | Bacteria | 1247 |
| 286 | Ga0207639_10418290 | 3300026041 | Bacteria | 1211 |
| 287 | Ga0207678_10011493 | 3300026067 | Bacteria | 7776 |
| 288 | Ga0207678_10023466 | 3300026067 | Bacteria | 5395 |
| 289 | Ga0207702_10000056 | 3300026078 | Bacteria | 131186 |
| 290 | Ga0207702_10063731 | 3300026078 | Bacteria | 3153 |
| 291 | Ga0207641_10072841 | 3300026088 | Bacteria | 2959 |
| 292 | Ga0207641_10318080 | 3300026088 | Bacteria | 1475 |
| 293 | Ga0207648_10069412 | 3300026089 | Bacteria | 3071 |
| 294 | Ga0207648_10169915 | 3300026089 | Bacteria | 1927 |
| 295 | Ga0207676_10024271 | 3300026095 | Bacteria | 4485 |
| 296 | Ga0207674_10098670 | 3300026116 | Bacteria | 2904 |
| 297 | Ga0207675_100029414 | 3300026118 | Bacteria | 5119 |
| 298 | Ga0207675_100176095 | 3300026118 | Bacteria | 2046 |
| 299 | Ga0207675_100290068 | 3300026118 | Bacteria | 1591 |
| 300 | Ga0207683_10074092 | 3300026121 | Bacteria | 3012 |
| 301 | Ga0207698_10069481 | 3300026142 | Bacteria | 2785 |
| 302 | Ga0207698_10304068 | 3300026142 | Bacteria | 1486 |
| 303 | Ga0207698_10699393 | 3300026142 | Bacteria | 1008 |
| 304 | Ga0209389_1000029 | 3300027296 | Bacteria | 140337 |
| 305 | Ga0209589_1000012 | 3300027357 | Bacteria | 229451 |
| 306 | Ga0209589_1000013 | 3300027357 | Bacteria | 229273 |
| 307 | Ga0209589_1000017 | 3300027357 | Bacteria | 215546 |
| 308 | Ga0209489_100013 | 3300027361 | Bacteria | 229831 |
| 309 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 310 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 311 | Ga0209588_1006331 | 3300027671 | Bacteria | 3436 |
| 312 | Ga0268266_10168478 | 3300028379 | Bacteria | 1986 |
| 313 | Ga0268266_10368279 | 3300028379 | Bacteria | 1353 |
| 314 | Ga0268265_10024844 | 3300028380 | Bacteria | 4245 |
| 315 | Ga0268264_10000049 | 3300028381 | Bacteria | 329992 |
| 316 | Ga0268264_10071969 | 3300028381 | Bacteria | 2931 |
| 317 | Ga0265337_1028504 | 3300028556 | Bacteria | 1675 |
| 318 | Ga0265334_10007076 | 3300028573 | Bacteria | 4814 |
| 319 | Ga0265318_10008750 | 3300028577 | Bacteria | 4486 |
| 320 | Ga0265323_10002966 | 3300028653 | Bacteria | 7579 |
| 321 | Ga0265322_10011412 | 3300028654 | Bacteria | 2577 |
| 322 | Ga0265336_10001946 | 3300028666 | Bacteria | 8880 |
| 323 | Ga0307517_10000766 | 3300028786 | Bacteria | 55210 |
| 324 | Ga0265338_10000024 | 3300028800 | Bacteria | 297778 |
| 325 | Ga0265324_10009302 | 3300029957 | Bacteria | 3844 |
| 326 | Ga0265330_10006264 | 3300031235 | Bacteria | 5883 |
| 327 | Ga0265330_10056632 | 3300031235 | Bacteria | 1711 |
| 328 | Ga0265332_10019884 | 3300031238 | Bacteria | 2964 |
| 329 | Ga0265328_10020866 | 3300031239 | Bacteria | 2505 |
| 330 | Ga0265339_10007291 | 3300031249 | Bacteria | 7166 |
| 331 | Ga0265316_10276893 | 3300031344 | Bacteria | 1227 |
| 332 | Ga0307513_10117890 | 3300031456 | Bacteria | 2631 |
| 333 | Ga0307509_10076249 | 3300031507 | Bacteria | 3479 |
| 334 | Ga0307508_10000005 | 3300031616 | Bacteria | 286511 |
| 335 | Ga0307508_10011825 | 3300031616 | Bacteria | 7979 |
| 336 | Ga0265342_10085381 | 3300031712 | Bacteria | 1817 |
| 337 | Ga0265342_10088710 | 3300031712 | Bacteria | 1776 |
| 338 | Ga0307516_10007966 | 3300031730 | Bacteria | 12059 |
| 339 | Ga0307516_10029291 | 3300031730 | Bacteria | 5567 |
| 340 | Ga0307516_10145252 | 3300031730 | Bacteria | 2138 |
| 341 | Ga0307516_10361380 | 3300031730 | Bacteria | 1116 |
| 342 | Ga0307410_10053396 | 3300031852 | Bacteria | 2735 |
| 343 | Ga0316583_10002620 | 3300032133 | Bacteria | 6277 |
| 344 | Ga0307507_10247874 | 3300033179 | Bacteria | 1155 |
| 345 | Ga0307510_10001273 | 3300033180 | Bacteria | 27490 |
| 346 | Ga0307510_10069809 | 3300033180 | Bacteria | 3515 |
| 347 | Ga0315911_1000033 | 3300033442 | Bacteria | 67159 |
| 348 | Ga0373923_0001018 | 3300035111 | Bacteria | 7611 |
| 349 | Ga0373923_0148961 | 3300035111 | Bacteria | 1062 |
| 350 | Ga0373936_0010157 | 3300035113 | Bacteria | 3555 |
| 351 | Ga0373936_0036067 | 3300035113 | Bacteria | 1970 |
| 352 | Ga0373945_0002016 | 3300035116 | Bacteria | 6311 |
| 353 | Ga0373953_0015608 | 3300035117 | Bacteria | 2757 |
| 354 | Ga0373954_0001240 | 3300035118 | Bacteria | 10277 |
| 355 | Ga0373954_0075033 | 3300035118 | Bacteria | 1610 |
| 356 | Ga0373956_0000296 | 3300035119 | Bacteria | 20068 |
| 357 | Ga0373957_0007838 | 3300035120 | Bacteria | 3432 |
| 358 | Ga0373943_0011050 | 3300035170 | Bacteria | 4055 |
| 359 | Ga0373946_0001135 | 3300035171 | Bacteria | 9211 |
| 360 | Ga0373955_0001544 | 3300035172 | Bacteria | 9844 |
| 361 | Ga0373955_0024853 | 3300035172 | Bacteria | 3068 |
| 362 | Ga0373924_0001120 | 3300035410 | Bacteria | 8595 |
| 363 | Ga0373931_0191358 | 3300035691 | Bacteria | 1217 |
| 364 | Ga0373935_0008536 | 3300035692 | Bacteria | 6133 |
| 365 | Ga0373935_0061563 | 3300035692 | Bacteria | 2403 |
| 366 | Ga0373927_0000071 | 3300035695 | Bacteria | 73794 |
| 367 | Ga0373927_0005319 | 3300035695 | Bacteria | 8895 |
| 368 | Ga0373927_0017743 | 3300035695 | Bacteria | 4682 |
| 369 | Ga0373927_0038587 | 3300035695 | Bacteria | 3101 |
| 370 | Ga0373933_0000114 | 3300035724 | Bacteria | 52016 |
| 371 | Ga0373933_0003475 | 3300035724 | Bacteria | 8766 |
| 372 | Ga0373933_0274493 | 3300035724 | Bacteria | 1088 |
| 373 | Ga0373947_0002914 | 3300035725 | Bacteria | 10210 |
| 374 | Ga0373947_0158528 | 3300035725 | Bacteria | 1462 |
| 375 | Ga0373937_0006682 | 3300036401 | Bacteria | 9959 |
| 376 | Ga0373937_0020664 | 3300036401 | Bacteria | 5904 |
| 377 | Ga0373925_0012108 | 3300037068 | Bacteria | 6243 |
| 378 | Ga0373925_0018670 | 3300037068 | Bacteria | 5041 |
| 379 | Ga0373925_0035939 | 3300037068 | Bacteria | 3657 |
| 380 | Ga0395900_0084990 | 3300037418 | Bacteria | 3252 |
| 381 | Ga0395900_0093104 | 3300037418 | Bacteria | 3096 |
| 382 | Ga0395900_0488283 | 3300037418 | Bacteria | 1183 |
| 383 | Ga0395898_0037127 | 3300037466 | Bacteria | 4835 |
| 384 | Ga0395898_0088910 | 3300037466 | Bacteria | 2973 |
| 385 | Ga0395898_0138371 | 3300037466 | Bacteria | 2331 |
| 386 | Ga0395905_0005511 | 3300037471 | Bacteria | 12915 |
| 387 | Ga0395905_0132044 | 3300037471 | Bacteria | 2349 |
| 388 | Ga0395905_0258463 | 3300037471 | Bacteria | 1626 |
| 389 | Ga0436364_1210928 | 3300037853 | Bacteria | 5255 |
| 390 | Ga0436364_1525576 | 3300037853 | Bacteria | 3914 |
| 391 | Ga0395901_0026879 | 3300038443 | Bacteria | 5908 |
| 392 | Ga0395901_0139896 | 3300038443 | Bacteria | 2544 |
| 393 | Ga0395901_0231511 | 3300038443 | Bacteria | 1929 |
| 394 | Ga0395901_0405726 | 3300038443 | Bacteria | 1400 |
| 395 | Ga0436365_0650112 | 3300039437 | Bacteria | 58550 |
| 396 | Ga0436365_0951406 | 3300039437 | Bacteria | 1489 |
| 397 | Ga0436365_1496296 | 3300039437 | Bacteria | 1761 |
| 398 | Ga0436360_0291987 | 3300039438 | Bacteria | 6332 |
| 399 | Ga0436363_0280053 | 3300039450 | Bacteria | 1814 |
| 400 | Ga0436363_0439777 | 3300039450 | Bacteria | 8998 |
| 401 | Ga0436362_0465319 | 3300039453 | Bacteria | 2858 |
| 402 | Ga0451795_0400584 | 3300041456 | Bacteria | 1128 |
| 403 | Ga0439431_0030779 | 3300041997 | Bacteria | 1331 |
| 404 | Ga0466972_0000103 | 3300044658 | Bacteria | 75095 |
| 405 | Ga0466972_0011618 | 3300044658 | Bacteria | 4421 |
| 406 | Ga0466963_0060863 | 3300044694 | Bacteria | 2522 |
| 407 | Ga0466968_0007308 | 3300044735 | Bacteria | 4196 |
| 408 | Ga0466970_0211251 | 3300044765 | Bacteria | 1081 |
| 409 | Ga0466957_0025520 | 3300044842 | Bacteria | 3503 |
| 410 | Ga0466960_0011025 | 3300044901 | Bacteria | 3766 |
| 411 | Ga0466967_0498331 | 3300045976 | Bacteria | 1195 |
| 412 | Ga0495592_0004585 | 3300046454 | Bacteria | 10117 |
| 413 | Ga0495592_0006419 | 3300046454 | Bacteria | 8753 |
| 414 | Ga0495592_0051631 | 3300046454 | Bacteria | 3054 |
| 415 | Ga0495603_0000035 | 3300046455 | Bacteria | 57510 |
| 416 | Ga0495603_0004004 | 3300046455 | Bacteria | 8770 |
| 417 | Ga0495603_0006336 | 3300046455 | Bacteria | 7080 |
| 418 | Ga0495629_0000081 | 3300046459 | Bacteria | 85305 |
| 419 | Ga0495629_0001069 | 3300046459 | Bacteria | 21887 |
| 420 | Ga0495629_0048237 | 3300046459 | Bacteria | 2986 |
| 421 | Ga0495629_0151152 | 3300046459 | Bacteria | 1613 |
| 422 | Ga0495638_0002281 | 3300046460 | Bacteria | 15850 |
| 423 | Ga0495638_0007023 | 3300046460 | Bacteria | 8121 |
| 424 | Ga0495641_0000707 | 3300046461 | Bacteria | 28228 |
| 425 | Ga0495651_0010124 | 3300046462 | Bacteria | 7242 |
| 426 | Ga0495651_0016379 | 3300046462 | Bacteria | 5740 |
| 427 | Ga0495651_0104835 | 3300046462 | Bacteria | 2098 |
| 428 | Ga0495653_0001526 | 3300046463 | Bacteria | 18106 |
| 429 | Ga0495653_0059435 | 3300046463 | Bacteria | 2901 |
| 430 | Ga0495653_0153088 | 3300046463 | Bacteria | 1609 |
| 431 | Ga0495580_0003091 | 3300046472 | Bacteria | 14262 |
| 432 | Ga0495580_0062442 | 3300046472 | Bacteria | 2614 |
| 433 | Ga0495582_0000235 | 3300046473 | Bacteria | 30725 |
| 434 | Ga0495639_0000010 | 3300046475 | Bacteria | 93685 |
| 435 | Ga0495639_0148297 | 3300046475 | Bacteria | 1131 |
| 436 | Ga0495662_0000034 | 3300046476 | Bacteria | 46636 |
| 437 | Ga0495662_0057056 | 3300046476 | Bacteria | 1886 |
| 438 | Ga0495662_0102808 | 3300046476 | Bacteria | 1398 |
| 439 | Ga0495664_0018913 | 3300046477 | Bacteria | 3954 |
| 440 | Ga0495664_0032881 | 3300046477 | Bacteria | 3046 |
| 441 | Ga0495664_0039454 | 3300046477 | Bacteria | 2790 |
| 442 | Ga0495664_0267415 | 3300046477 | Bacteria | 1033 |
| 443 | Ga0495585_0069042 | 3300046492 | Bacteria | 1929 |
| 444 | Ga0495594_0001375 | 3300046499 | Bacteria | 12621 |
| 445 | Ga0495607_0070719 | 3300046501 | Bacteria | 1949 |
| 446 | Ga0495606_0000265 | 3300046507 | Bacteria | 92526 |
| 447 | Ga0495608_0004335 | 3300046511 | Bacteria | 10162 |
| 448 | Ga0495616_0036522 | 3300046513 | Bacteria | 2535 |
| 449 | Ga0495618_0103673 | 3300046514 | Bacteria | 1821 |
| 450 | Ga0495618_0142938 | 3300046514 | Bacteria | 1530 |
| 451 | Ga0495628_0012927 | 3300046516 | Bacteria | 7028 |
| 452 | Ga0495628_0032331 | 3300046516 | Bacteria | 4224 |
| 453 | Ga0495628_0046957 | 3300046516 | Bacteria | 3428 |
| 454 | Ga0495628_0060094 | 3300046516 | Bacteria | 2983 |
| 455 | Ga0495630_0002040 | 3300046517 | Bacteria | 14046 |
| 456 | Ga0495630_0160306 | 3300046517 | Bacteria | 1713 |
| 457 | Ga0495632_0019670 | 3300046519 | Bacteria | 3673 |
| 458 | Ga0495632_0045655 | 3300046519 | Bacteria | 2181 |
| 459 | Ga0495632_0194754 | 3300046519 | Bacteria | 925 |
| 460 | Ga0495648_0003897 | 3300046524 | Bacteria | 12935 |
| 461 | Ga0495666_0008369 | 3300046526 | Bacteria | 5185 |
| 462 | Ga0495666_0022400 | 3300046526 | Bacteria | 3129 |
| 463 | Ga0495652_0006665 | 3300046529 | Bacteria | 10717 |
| 464 | Ga0495652_0011477 | 3300046529 | Bacteria | 8013 |
| 465 | Ga0495652_0054128 | 3300046529 | Bacteria | 3418 |
| 466 | Ga0495665_0000005 | 3300046531 | Bacteria | 86491 |
| 467 | Ga0495640_0001991 | 3300046533 | Bacteria | 16290 |
| 468 | Ga0495640_0038556 | 3300046533 | Bacteria | 3360 |
| 469 | Ga0495640_0038785 | 3300046533 | Bacteria | 3349 |
| 470 | Ga0495586_0055794 | 3300046535 | Bacteria | 2141 |
| 471 | Ga0495587_0045966 | 3300046536 | Bacteria | 2593 |
| 472 | Ga0495645_0018588 | 3300046543 | Bacteria | 4994 |
| 473 | Ga0495645_0028158 | 3300046543 | Bacteria | 4083 |
| 474 | Ga0495645_0059254 | 3300046543 | Bacteria | 2777 |
| 475 | Ga0495622_0001721 | 3300046557 | Bacteria | 10820 |
| 476 | Ga0495622_0070105 | 3300046557 | Bacteria | 1618 |
| 477 | Ga0495633_0103185 | 3300046558 | Bacteria | 1323 |
| 478 | Ga0495667_0009439 | 3300046559 | Bacteria | 6610 |
| 479 | Ga0495667_0077762 | 3300046559 | Bacteria | 2157 |
| 480 | Ga0495667_0093822 | 3300046559 | Bacteria | 1943 |
| 481 | Ga0495656_0025167 | 3300046615 | Bacteria | 2357 |
| 482 | Ga0495668_0074226 | 3300046616 | Bacteria | 1868 |
| 483 | Ga0495634_0000261 | 3300046642 | Bacteria | 49735 |
| 484 | Ga0495634_0022791 | 3300046642 | Bacteria | 4411 |
| 485 | Ga0495634_0157576 | 3300046642 | Bacteria | 1433 |
| 486 | Ga0495611_0068131 | 3300046648 | Bacteria | 1624 |
| 487 | Ga0495625_0314265 | 3300046660 | Bacteria | 999 |
| 488 | Ga0495635_0000281 | 3300046663 | Bacteria | 32699 |
| 489 | Ga0495635_0000963 | 3300046663 | Bacteria | 19001 |
| 490 | Ga0495635_0011833 | 3300046663 | Bacteria | 6116 |
| 491 | Ga0495635_0112373 | 3300046663 | Bacteria | 1860 |
| 492 | Ga0495588_0013335 | 3300046674 | Bacteria | 3914 |
| 493 | Ga0495588_0061742 | 3300046674 | Bacteria | 1942 |
| 494 | Ga0495588_0084210 | 3300046674 | Bacteria | 1661 |
| 495 | Ga0495657_0006559 | 3300046675 | Bacteria | 9094 |
| 496 | Ga0495657_0045052 | 3300046675 | Bacteria | 2995 |
| 497 | Ga0495599_0017554 | 3300046678 | Bacteria | 4448 |
| 498 | Ga0495599_0019957 | 3300046678 | Bacteria | 4174 |
| 499 | Ga0495623_0015660 | 3300046679 | Bacteria | 4901 |
| 500 | Ga0495646_0015043 | 3300046680 | Bacteria | 4915 |
| 501 | Ga0495646_0091348 | 3300046680 | Bacteria | 1757 |
| 502 | Ga0495646_0172008 | 3300046680 | Bacteria | 1193 |
| 503 | Ga0495647_0001017 | 3300046681 | Bacteria | 8545 |
| 504 | Ga0495658_0001011 | 3300046683 | Bacteria | 14844 |
| 505 | Ga0495613_0004043 | 3300046689 | Bacteria | 10970 |
| 506 | Ga0495613_0062002 | 3300046689 | Bacteria | 2737 |
| 507 | Ga0495613_0108256 | 3300046689 | Bacteria | 2004 |
| 508 | Ga0495613_0215885 | 3300046689 | Bacteria | 1348 |
| 509 | Ga0495624_0001342 | 3300046690 | Bacteria | 19226 |
| 510 | Ga0495624_0226069 | 3300046690 | Bacteria | 1134 |
| 511 | Ga0495624_0295560 | 3300046690 | Bacteria | 977 |
| 512 | Ga0495671_0032886 | 3300046692 | Bacteria | 2645 |
| 513 | Ga0495600_0000567 | 3300046809 | Bacteria | 19167 |
| 514 | Ga0495600_0042815 | 3300046809 | Bacteria | 2952 |
| 515 | Ga0495581_0000018 | 3300047315 | Bacteria | 58791 |
| 516 | Ga0495581_0096067 | 3300047315 | Bacteria | 1721 |
| 517 | Ga0495604_0005727 | 3300047317 | Bacteria | 9854 |
| 518 | Ga0495604_0008890 | 3300047317 | Bacteria | 7940 |
| 519 | Ga0495674_0000134 | 3300047319 | Bacteria | 56618 |
| 520 | Ga0495674_0030816 | 3300047319 | Bacteria | 4874 |
| 521 | Ga0495674_0118456 | 3300047319 | Bacteria | 2239 |
| 522 | Ga0495672_0042363 | 3300047320 | Bacteria | 2746 |
| 523 | Ga0495676_0030497 | 3300047321 | Bacteria | 4575 |
| 524 | Ga0495676_0068390 | 3300047321 | Bacteria | 2744 |
| 525 | Ga0495680_0006823 | 3300047322 | Bacteria | 10545 |
| 526 | Ga0495680_0007319 | 3300047322 | Bacteria | 10156 |
| 527 | Ga0495680_0121242 | 3300047322 | Bacteria | 1930 |
| 528 | Ga0495683_0070352 | 3300047323 | Bacteria | 1718 |
| 529 | Ga0495675_0021068 | 3300047444 | Bacteria | 4149 |
| 530 | Ga0495675_0022748 | 3300047444 | Bacteria | 3997 |
| 531 | Ga0495675_0061810 | 3300047444 | Bacteria | 2372 |
| 532 | Ga0495673_0021341 | 3300047469 | Bacteria | 3201 |
| 533 | Ga0495673_0048751 | 3300047469 | Bacteria | 1866 |
| 534 | Ga0495684_0000052 | 3300047471 | Bacteria | 85125 |
| 535 | Ga0495684_0032994 | 3300047471 | Bacteria | 3976 |
| 536 | Ga0495684_0140995 | 3300047471 | Bacteria | 1807 |
| 537 | Ga0495593_0000072 | 3300047673 | Bacteria | 43039 |
| 538 | Ga0495593_0000214 | 3300047673 | Bacteria | 30567 |
| 539 | Ga0495602_0062320 | 3300048088 | Bacteria | 3235 |
| 540 | Ga0495602_0220007 | 3300048088 | Bacteria | 1434 |
| 541 | Ga0495614_0046866 | 3300048089 | Bacteria | 1853 |
| 542 | Ga0495614_0083955 | 3300048089 | Bacteria | 1381 |
| 543 | Ga0496100_0036087 | 3300048903 | Bacteria | 3115 |
| 544 | Ga0496100_0097113 | 3300048903 | Bacteria | 2023 |
| 545 | Ga0496100_0277530 | 3300048903 | Bacteria | 1248 |
| 546 | Ga0496101_0119028 | 3300048904 | Bacteria | 1995 |
| 547 | Ga0496101_0152462 | 3300048904 | Bacteria | 1768 |
| 548 | Ga0496101_0197495 | 3300048904 | Bacteria | 1554 |
| 549 | Ga0496102_0020395 | 3300048905 | Bacteria | 5858 |
| 550 | Ga0496102_0042868 | 3300048905 | Bacteria | 4102 |
| 551 | Ga0496102_0151367 | 3300048905 | Bacteria | 2180 |
| 552 | Ga0496102_0159558 | 3300048905 | Bacteria | 2121 |
| 553 | Ga0496102_0166114 | 3300048905 | Bacteria | 2077 |
| 554 | Ga0496103_0012448 | 3300048906 | Bacteria | 5046 |
| 555 | Ga0496104_0005388 | 3300048907 | Bacteria | 11198 |
| 556 | Ga0496104_0032218 | 3300048907 | Bacteria | 4877 |
| 557 | Ga0496104_0036647 | 3300048907 | Bacteria | 4586 |
| 558 | Ga0496104_0129492 | 3300048907 | Bacteria | 2424 |
| 559 | Ga0496104_0160497 | 3300048907 | Bacteria | 2156 |
| 560 | Ga0496105_0001275 | 3300048908 | Bacteria | 17613 |
| 561 | Ga0496105_0037647 | 3300048908 | Bacteria | 3983 |
| 562 | Ga0496105_0122747 | 3300048908 | Bacteria | 2142 |
| 563 | Ga0496106_0003991 | 3300048909 | Bacteria | 11026 |
| 564 | Ga0496106_0042979 | 3300048909 | Bacteria | 3389 |
| 565 | Ga0496106_0121425 | 3300048909 | Bacteria | 2042 |
| 566 | Ga0496106_0241430 | 3300048909 | Bacteria | 1443 |
| 567 | Ga0496107_0003794 | 3300048910 | Bacteria | 10148 |
| 568 | Ga0496107_0005978 | 3300048910 | Bacteria | 8339 |
| 569 | Ga0496107_0040653 | 3300048910 | Bacteria | 3338 |
| 570 | Ga0496108_0000581 | 3300048911 | Bacteria | 28520 |
| 571 | Ga0496109_0000507 | 3300048912 | Bacteria | 33280 |
| 572 | Ga0496109_0159771 | 3300048912 | Bacteria | 2111 |
| 573 | Ga0496110_0008549 | 3300048913 | Bacteria | 8242 |
| 574 | Ga0496110_0011045 | 3300048913 | Bacteria | 7372 |
| 575 | Ga0496110_0166098 | 3300048913 | Bacteria | 2001 |
| 576 | Ga0496111_0050677 | 3300048914 | Bacteria | 2996 |
| 577 | Ga0496111_0370033 | 3300048914 | Bacteria | 1060 |
| 578 | Ga0496112_0004823 | 3300048915 | Bacteria | 11515 |
| 579 | Ga0496112_0032266 | 3300048915 | Bacteria | 5084 |
| 580 | Ga0496112_0161748 | 3300048915 | Bacteria | 2205 |
| 581 | Ga0496112_0190662 | 3300048915 | Bacteria | 2012 |
| 582 | Ga0496112_0553263 | 3300048915 | Bacteria | 1084 |
| 583 | Ga0496113_0010309 | 3300048916 | Bacteria | 6174 |
| 584 | Ga0496113_0029645 | 3300048916 | Bacteria | 3955 |
| 585 | Ga0496113_0411991 | 3300048916 | Bacteria | 1085 |
| 586 | Ga0496114_0045648 | 3300048917 | Bacteria | 3641 |
| 587 | Ga0496114_0100516 | 3300048917 | Bacteria | 2468 |
| 588 | Ga0496114_0127199 | 3300048917 | Bacteria | 2197 |
| 589 | Ga0496114_0357299 | 3300048917 | Bacteria | 1292 |
| 590 | Ga0496115_0022097 | 3300048918 | Bacteria | 4922 |
| 591 | Ga0496115_0082169 | 3300048918 | Bacteria | 2624 |
| 592 | Ga0496115_0083685 | 3300048918 | Bacteria | 2601 |
| 593 | Ga0496115_0095293 | 3300048918 | Bacteria | 2436 |
| 594 | Ga0496115_0286035 | 3300048918 | Bacteria | 1353 |
| 595 | Ga0496116_0088220 | 3300048919 | Bacteria | 1896 |
| 596 | Ga0496116_0113270 | 3300048919 | Bacteria | 1588 |
| 597 | Ga0496117_0004399 | 3300048920 | Bacteria | 15594 |
| 598 | Ga0496117_0135251 | 3300048920 | Bacteria | 1486 |
| 599 | Ga0496118_0005557 | 3300048921 | Bacteria | 14287 |
| 600 | Ga0496118_0035728 | 3300048921 | Bacteria | 4029 |
| 601 | Ga0496118_0063743 | 3300048921 | Bacteria | 2710 |
| 602 | Ga0496118_0215406 | 3300048921 | Bacteria | 1123 |
| 603 | Ga0496119_0038310 | 3300048922 | Bacteria | 3100 |
| 604 | Ga0496119_0041332 | 3300048922 | Bacteria | 2937 |
| 605 | Ga0496120_0023580 | 3300048923 | Bacteria | 3850 |
| 606 | Ga0496120_0046427 | 3300048923 | Bacteria | 2510 |
| 607 | Ga0496121_0000716 | 3300048924 | Bacteria | 61451 |
| 608 | Ga0496121_0004612 | 3300048924 | Bacteria | 18357 |
| 609 | Ga0496121_0039009 | 3300048924 | Bacteria | 4194 |
| 610 | Ga0496121_0040767 | 3300048924 | Bacteria | 4068 |
| 611 | Ga0496121_0053636 | 3300048924 | Bacteria | 3376 |
| 612 | Ga0496121_0054425 | 3300048924 | Bacteria | 3344 |
| 613 | Ga0496121_0064371 | 3300048924 | Bacteria | 2990 |
| 614 | Ga0496121_0124235 | 3300048924 | Bacteria | 1943 |
| 615 | Ga0496121_0130335 | 3300048924 | Bacteria | 1883 |
| 616 | Ga0496121_0230345 | 3300048924 | Bacteria | 1298 |
| 617 | Ga0496124_0001529 | 3300048927 | Bacteria | 33656 |
| 618 | Ga0496124_0052896 | 3300048927 | Bacteria | 3447 |
| 619 | Ga0496124_0092171 | 3300048927 | Bacteria | 2468 |
| 620 | Ga0496124_0165220 | 3300048927 | Bacteria | 1721 |
| 621 | Ga0496124_0278423 | 3300048927 | Bacteria | 1221 |
| 622 | Ga0496125_0092208 | 3300048928 | Bacteria | 2266 |
| 623 | Ga0496125_0116685 | 3300048928 | Bacteria | 1916 |
| 624 | Ga0496126_0032749 | 3300048929 | Bacteria | 4894 |
| 625 | Ga0496126_0041848 | 3300048929 | Bacteria | 4236 |
| 626 | Ga0496126_0077478 | 3300048929 | Bacteria | 2947 |
| 627 | Ga0496126_0143508 | 3300048929 | Bacteria | 2053 |
| 628 | Ga0496126_0294095 | 3300048929 | Bacteria | 1342 |
| 629 | Ga0501031_0001453 | 3300049568 | Bacteria | 14707 |
| 630 | Ga0501032_0000048 | 3300049569 | Bacteria | 106326 |
| 631 | Ga0501032_0014636 | 3300049569 | Bacteria | 5556 |
| 632 | Ga0501032_0023304 | 3300049569 | Bacteria | 4281 |
| 633 | Ga0501032_0090231 | 3300049569 | Bacteria | 2034 |
| 634 | Ga0501032_0239997 | 3300049569 | Bacteria | 1177 |
| 635 | Ga0501033_0000184 | 3300049570 | Bacteria | 59970 |
| 636 | Ga0501033_0003525 | 3300049570 | Bacteria | 12801 |
| 637 | Ga0501033_0063050 | 3300049570 | Bacteria | 2729 |
| 638 | Ga0501033_0107480 | 3300049570 | Bacteria | 2032 |
| 639 | Ga0501033_0243823 | 3300049570 | Bacteria | 1274 |
| 640 | Ga0501034_0000082 | 3300049571 | Bacteria | 170039 |
| 641 | Ga0501034_0011514 | 3300049571 | Bacteria | 9167 |
| 642 | Ga0501034_0026323 | 3300049571 | Bacteria | 5924 |
| 643 | Ga0501034_0100582 | 3300049571 | Bacteria | 2885 |
| 644 | Ga0501034_0194842 | 3300049571 | Bacteria | 1987 |
| 645 | Ga0501036_0000791 | 3300049572 | Bacteria | 23456 |
| 646 | Ga0501036_0172827 | 3300049572 | Bacteria | 1820 |
| 647 | Ga0501037_0000063 | 3300049573 | Bacteria | 97745 |
| 648 | Ga0501037_0014971 | 3300049573 | Bacteria | 5704 |
| 649 | Ga0501037_0168736 | 3300049573 | Bacteria | 1557 |
| 650 | Ga0501038_0000295 | 3300049574 | Bacteria | 42291 |
| 651 | Ga0501038_0006071 | 3300049574 | Bacteria | 11176 |
| 652 | Ga0501038_0010109 | 3300049574 | Bacteria | 8638 |
| 653 | Ga0501038_0032236 | 3300049574 | Bacteria | 4624 |
| 654 | Ga0501038_0061390 | 3300049574 | Bacteria | 3214 |
| 655 | Ga0501038_0127784 | 3300049574 | Bacteria | 2090 |
| 656 | Ga0501038_0235841 | 3300049574 | Bacteria | 1454 |
| 657 | Ga0501039_0000082 | 3300049575 | Bacteria | 72201 |
| 658 | Ga0501039_0155746 | 3300049575 | Bacteria | 1795 |
| 659 | Ga0501039_0482272 | 3300049575 | Bacteria | 974 |
| 660 | Ga0501040_0117720 | 3300049576 | Bacteria | 1862 |
| 661 | Ga0501042_0002545 | 3300049578 | Bacteria | 11215 |
| 662 | Ga0501043_0000148 | 3300049579 | Bacteria | 65190 |
| 663 | Ga0501043_0020509 | 3300049579 | Bacteria | 5185 |
| 664 | Ga0501043_0054115 | 3300049579 | Bacteria | 3151 |
| 665 | Ga0501043_0070406 | 3300049579 | Bacteria | 2747 |
| 666 | Ga0501046_0000101 | 3300049580 | Bacteria | 91179 |
| 667 | Ga0501046_0026634 | 3300049580 | Bacteria | 4722 |
| 668 | Ga0501046_0082467 | 3300049580 | Bacteria | 2483 |
| 669 | Ga0501046_0130541 | 3300049580 | Bacteria | 1906 |
| 670 | Ga0501047_0002965 | 3300049581 | Bacteria | 16090 |
| 671 | Ga0501047_0009908 | 3300049581 | Bacteria | 9009 |
| 672 | Ga0501047_0014737 | 3300049581 | Bacteria | 7440 |
| 673 | Ga0501047_0102168 | 3300049581 | Bacteria | 2746 |
| 674 | Ga0501047_0332635 | 3300049581 | Bacteria | 1357 |
| 675 | Ga0501047_0365629 | 3300049581 | Bacteria | 1278 |
| 676 | Ga0501048_0002363 | 3300049582 | Bacteria | 14407 |
| 677 | Ga0501048_0005496 | 3300049582 | Bacteria | 9642 |
| 678 | Ga0501048_0070461 | 3300049582 | Bacteria | 2469 |
| 679 | Ga0501067_0000056 | 3300049583 | Bacteria | 64757 |
| 680 | Ga0501067_0002825 | 3300049583 | Bacteria | 9556 |
| 681 | Ga0501067_0025603 | 3300049583 | Bacteria | 3270 |
| 682 | Ga0501068_0000070 | 3300049584 | Bacteria | 40553 |
| 683 | Ga0501068_0009793 | 3300049584 | Bacteria | 5369 |
| 684 | Ga0501068_0164793 | 3300049584 | Bacteria | 1398 |
| 685 | Ga0501069_0000352 | 3300049585 | Bacteria | 20643 |
| 686 | Ga0501069_0117920 | 3300049585 | Bacteria | 1514 |
| 687 | Ga0501070_0017489 | 3300049586 | Bacteria | 6019 |
| 688 | Ga0501070_0021108 | 3300049586 | Bacteria | 5465 |
| 689 | Ga0501070_0026055 | 3300049586 | Bacteria | 4905 |
| 690 | Ga0501070_0168234 | 3300049586 | Bacteria | 1806 |
| 691 | Ga0501070_0198841 | 3300049586 | Bacteria | 1646 |
| 692 | Ga0501070_0218245 | 3300049586 | Bacteria | 1564 |
| 693 | Ga0501071_0262511 | 3300049587 | Bacteria | 1305 |
| 694 | Ga0501072_0000871 | 3300049588 | Bacteria | 22090 |
| 695 | Ga0501073_0000053 | 3300049589 | Bacteria | 73023 |
| 696 | Ga0501073_0003590 | 3300049589 | Bacteria | 11666 |
| 697 | Ga0501073_0014548 | 3300049589 | Bacteria | 5716 |
| 698 | Ga0501073_0022587 | 3300049589 | Bacteria | 4528 |
| 699 | Ga0501074_0001132 | 3300049590 | Bacteria | 17452 |
| 700 | Ga0501074_0014062 | 3300049590 | Bacteria | 5819 |
| 701 | Ga0501074_0023865 | 3300049590 | Bacteria | 4445 |
| 702 | Ga0501076_0294057 | 3300049592 | Bacteria | 1331 |
| 703 | Ga0501079_0013401 | 3300049741 | Bacteria | 6253 |
| 704 | Ga0501080_0000826 | 3300049742 | Bacteria | 25330 |
| 705 | Ga0501080_0010573 | 3300049742 | Bacteria | 8448 |
| 706 | Ga0501080_0109870 | 3300049742 | Bacteria | 2555 |
| 707 | Ga0501080_0392357 | 3300049742 | Bacteria | 1249 |
| 708 | Ga0501083_0001586 | 3300049744 | Bacteria | 15524 |
| 709 | Ga0501083_0010499 | 3300049744 | Bacteria | 6517 |
| 710 | Ga0501035_0000474 | 3300049822 | Bacteria | 45071 |
| 711 | Ga0501035_0035212 | 3300049822 | Bacteria | 4544 |
| 712 | Ga0501035_0036749 | 3300049822 | Bacteria | 4438 |
| 713 | Ga0501035_0039873 | 3300049822 | Bacteria | 4247 |
| 714 | Ga0501035_0216406 | 3300049822 | Bacteria | 1637 |
| 715 | Ga0501044_0000408 | 3300049823 | Bacteria | 52994 |
| 716 | Ga0501044_0026586 | 3300049823 | Bacteria | 6125 |
| 717 | Ga0501044_0073368 | 3300049823 | Bacteria | 3478 |
| 718 | Ga0501044_0344200 | 3300049823 | Bacteria | 1411 |
| 719 | Ga0501045_0003604 | 3300049824 | Bacteria | 10638 |
| 720 | nmdc:mga03683_32770_c1 | 3300050489 | Bacteria | 2092 |
| 721 | nmdc:mga03n38_750_c1 | 3300050490 | Bacteria | 8581 |
| 722 | nmdc:mga00v17_44083_c1 | 3300050491 | Bacteria | 2688 |
| 723 | nmdc:mga00v17_89925_c1 | 3300050491 | Bacteria | 1927 |
| 724 | nmdc:mga0yw44_134708_c1 | 3300050492 | Bacteria | 1602 |
| 725 | nmdc:mga0yw44_71352_c1 | 3300050492 | Bacteria | 2156 |
| 726 | nmdc:mga0yw44_95063_c1 | 3300050492 | Bacteria | 1890 |
| 727 | nmdc:mga06z11_57843_c1 | 3300050494 | Bacteria | 2010 |
| 728 | nmdc:mga06z11_96061_c1 | 3300050494 | Bacteria | 1618 |
| 729 | nmdc:mga07m45_18580_c1 | 3300050496 | Bacteria | 3756 |
| 730 | nmdc:mga07m45_83827_c1 | 3300050496 | Bacteria | 1822 |
| 731 | nmdc:mga05p37_178885_c1 | 3300050507 | Bacteria | 2582 |
| 732 | nmdc:mga06r32_618063_c1 | 3300050510 | Bacteria | 1053 |
| 733 | nmdc:mga08y16_88998_c1 | 3300050511 | Bacteria | 3217 |
| 734 | nmdc:mga0sz30_114159_c1 | 3300050516 | Bacteria | 1185 |
| 735 | nmdc:mga0sz30_25537_c1 | 3300050516 | Bacteria | 2416 |
| 736 | Ga0495601_0046525 | 3300053077 | Bacteria | 2731 |
| 737 | Ga0495601_0057492 | 3300053077 | Bacteria | 2464 |
| 738 | Ga0500635_0003021 | 3300053080 | Bacteria | 4194 |
| 739 | Ga0495595_0001205 | 3300053084 | Bacteria | 10046 |
| 740 | Ga0495619_0003340 | 3300053085 | Bacteria | 10379 |
| 741 | Ga0495619_0131741 | 3300053085 | Bacteria | 1718 |
| 742 | Ga0500651_0073134 | 3300053093 | Bacteria | 2131 |
| 743 | Ga0500566_0000896 | 3300053094 | Bacteria | 17020 |
| 744 | Ga0500566_0002969 | 3300053094 | Bacteria | 10127 |
| 745 | Ga0500566_0009283 | 3300053094 | Bacteria | 5816 |
| 746 | Ga0500640_089234 | 3300053095 | Bacteria | 1294 |
| 747 | Ga0500640_107333 | 3300053095 | Bacteria | 1143 |
| 748 | Ga0500641_0001155 | 3300053096 | Bacteria | 9396 |
| 749 | Ga0500556_0053429 | 3300053104 | Bacteria | 1469 |
| 750 | Ga0500556_0062248 | 3300053104 | Bacteria | 1376 |
| 751 | Ga0500572_000633 | 3300053111 | Bacteria | 11659 |
| 752 | Ga0500572_008737 | 3300053111 | Bacteria | 2376 |
| 753 | Ga0500591_119045 | 3300053115 | Bacteria | 1089 |
| 754 | Ga0500595_000253 | 3300053119 | Bacteria | 35306 |
| 755 | Ga0500595_012401 | 3300053119 | Bacteria | 3298 |
| 756 | Ga0500607_048744 | 3300053121 | Bacteria | 2263 |
| 757 | Ga0500607_115020 | 3300053121 | Bacteria | 1312 |
| 758 | Ga0500614_020284 | 3300053123 | Bacteria | 1532 |
| 759 | Ga0500655_023414 | 3300053133 | Bacteria | 1166 |
| 760 | Ga0500658_0030957 | 3300053134 | Bacteria | 2091 |
| 761 | Ga0500559_0001232 | 3300053136 | Bacteria | 15083 |
| 762 | Ga0500559_0027725 | 3300053136 | Bacteria | 2417 |
| 763 | Ga0500559_0031651 | 3300053136 | Bacteria | 2269 |
| 764 | Ga0500559_0131436 | 3300053136 | Bacteria | 1169 |
| 765 | Ga0500573_0037537 | 3300053140 | Bacteria | 2799 |
| 766 | Ga0500577_0018436 | 3300053142 | Bacteria | 2244 |
| 767 | Ga0500603_000165 | 3300053150 | Bacteria | 16608 |
| 768 | Ga0500603_028425 | 3300053150 | Bacteria | 1426 |
| 769 | Ga0500604_0016811 | 3300053151 | Bacteria | 2018 |
| 770 | Ga0500619_071794 | 3300053154 | Bacteria | 1153 |
| 771 | Ga0500630_082708 | 3300053159 | Bacteria | 1499 |
| 772 | Ga0500638_026089 | 3300053162 | Bacteria | 2797 |
| 773 | Ga0500638_083307 | 3300053162 | Bacteria | 1516 |
| 774 | Ga0500639_004728 | 3300053163 | Bacteria | 6929 |
| 775 | Ga0500639_025802 | 3300053163 | Bacteria | 3106 |
| 776 | Ga0500636_0000075 | 3300053177 | Bacteria | 48415 |
| 777 | Ga0500636_0031111 | 3300053177 | Bacteria | 3157 |
| 778 | Ga0500636_0034808 | 3300053177 | Bacteria | 2981 |
| 779 | Ga0500637_0002240 | 3300053178 | Bacteria | 8531 |
| 780 | Ga0500637_0030717 | 3300053178 | Bacteria | 2991 |
| 781 | Ga0500637_0182301 | 3300053178 | Bacteria | 1203 |
| 782 | Ga0500637_0195048 | 3300053178 | Bacteria | 1155 |
| 783 | Ga0500609_003969 | 3300053731 | Bacteria | 2061 |
| 784 | Ga0500596_008366 | 3300053735 | Bacteria | 1652 |
| 785 | Ga0500599_001855 | 3300053736 | Bacteria | 2489 |
| 786 | Ga0500601_000821 | 3300053737 | Bacteria | 3863 |
| 787 | Ga0501084_0540782 | 3300054114 | Bacteria | 984 |
| 788 | Ga0501082_0014060 | 3300060353 | Bacteria | 6884 |
| 789 | 2507504843 | 2507262055 | Bacteria | 8048963 |
| 790 | 2508546198 | 2508501009 | Bacteria | 7784016 |
| 791 | 2508695130 | 2508501042 | Bacteria | 8719808 |
| 792 | 2511395456 | 2511231028 | Bacteria | 8046582 |
| 793 | 2513625425 | 2513237092 | Bacteria | 8341956 |
| 794 | 2513639554 | 2513237094 | Bacteria | 8789602 |
| 795 | 2513658232 | 2513237096 | Bacteria | 8722461 |
| 796 | 2513694928 | 2513237101 | Bacteria | 7952346 |
| 797 | 2513703352 | 2513237102 | Bacteria | 7703324 |
| 798 | 2513862938 | 2513237137 | Bacteria | 9558895 |
| 799 | 2513873913 | 2513237139 | Bacteria | 8737671 |
| 800 | 2513920276 | 2513237145 | Bacteria | 8979722 |
| 801 | 2514012886 | 2513237161 | Bacteria | 8871253 |
| 802 | 2515625864 | 2515154112 | Bacteria | 8294334 |
| 803 | 2517102386 | 2517093001 | Bacteria | 9002274 |
| 804 | 2517889304 | 2517572143 | Bacteria | 9484767 |
| 805 | 2528855138 | 2528768022 | Bacteria | 10457665 |
| 806 | 2617351701 | 2617270735 | Bacteria | 9163226 |
| 807 | 2617377249 | 2617270741 | Bacteria | 8201522 |
| 808 | 2671121416 | 2667528175 | Bacteria | 7532676 |
| 809 | 2723842025 | 2721755755 | Bacteria | 8322773 |
| 810 | 2728755360 | 2728368998 | Bacteria | 8720350 |
| 811 | 2793066048 | 2791355196 | Bacteria | 7323613 |
| 812 | 2793070961 | 2791355197 | Bacteria | 8420563 |
| 813 | 2793077426 | |||
| 814 | 2805915996 | 2802429603 | Bacteria | 8777136 |
| 815 | 2818237280 | 2816332527 | Bacteria | 8933356 |
| 816 | 2824621107 | 2824617872 | Bacteria | 8814715 |
| 817 | 2824630114 | 2824626560 | Bacteria | 8813858 |
| 818 | 2824640731 | 2824635225 | Bacteria | 8785348 |
| 819 | 2824649822 | 2824644064 | Bacteria | 8743947 |
| 820 | 2824664729 | 2824661429 | Bacteria | 9877870 |
| 821 | 2824674854 | 2824671348 | Bacteria | 8369588 |
| 822 | 2824683557 | 2824679649 | Bacteria | 8248951 |
| 823 | 2824691922 | 2824687955 | Bacteria | 8360029 |
| 824 | 2824697651 | 2824696289 | Bacteria | 8335049 |
| 825 | 2824709662 | 2824704595 | Bacteria | 9667483 |
| 826 | 2824719827 | 2824714736 | Bacteria | 8717648 |
| 827 | 2824727931 | 2824723954 | Bacteria | 8758240 |
| 828 | 2824736250 | 2824732956 | Bacteria | 7810675 |
| 829 | 2824750286 | 2824746037 | Bacteria | 7911610 |
| 830 | 2824757114 | 2824753945 | Bacteria | 9787441 |
| 831 | 2824768450 | 2824763712 | Bacteria | 9792355 |
| 832 | 2824774943 | 2824773399 | Bacteria | 8360218 |
| 833 | 2838131018 | 2838122688 | Bacteria | 8803140 |
| 834 | 2841944459 | 2841941048 | Bacteria | 8688029 |
| 835 | 2841951600 | 2841949485 | Bacteria | 8680857 |
| 836 | 2841964613 | 2841957949 | Bacteria | 8652217 |
| 837 | 2841969236 | 2841966195 | Bacteria | 8673214 |
| 838 | 2841982901 | 2841974524 | Bacteria | 8931498 |
| 839 | 2841991017 | 2841983080 | Bacteria | 8395090 |
| 840 | 2842043883 | 2842038055 | Bacteria | 8002051 |
| 841 | 2842052127 | 2842045827 | Bacteria | 8006841 |
| 842 | 2847931469 | 2847930680 | Bacteria | 9342022 |
| 843 | 2847941753 | 2847939898 | Bacteria | 8606328 |
| 844 | 2874596837 | 2874590934 | Bacteria | 8299676 |
| 845 | 2874610363 | 2874604998 | Bacteria | 7834745 |
| 846 | 2874617919 | 2874612657 | Bacteria | 8252029 |
| 847 | 2874624421 | 2874620515 | Bacteria | 8290088 |
| 848 | 2874648642 | 2874645413 | Bacteria | 8214782 |
| 849 | 2876766413 | 2876761206 | Bacteria | 10111113 |
| 850 | 2876777301 | 2876771140 | Bacteria | 8287509 |
| 851 | 2876812842 | 2876808645 | Bacteria | 8824342 |
| 852 | 2876825383 | 2876818435 | Bacteria | 8274608 |
| 853 | 2879077632 | 2879074833 | Bacteria | 8279565 |
| 854 | 2879087494 | 2879083081 | Bacteria | 8587928 |
| 855 | 2879107225 | 2879099564 | Bacteria | 10442239 |
| 856 | 2879111682 | 2879110137 | Bacteria | 8907982 |
| 857 | 2879127662 | 2879127579 | Bacteria | 8294491 |
| 858 | 2879146065 | 2879142872 | Bacteria | 8267021 |
| 859 | 2881371002 | 2881364244 | Bacteria | 7710352 |
| 860 | 2881665696 | 2881665667 | Bacteria | 8175609 |
| 861 | 2885371399 | 2885366525 | Bacteria | 8326213 |
| 862 | 2885377732 | 2885374607 | Bacteria | 8927485 |
| 863 | 2885411719 | 2885409591 | Bacteria | 9235467 |
| 864 | 2888379963 | 2888378607 | Bacteria | 9652610 |
| 865 | 2888391041 | 2888388044 | Bacteria | 7304136 |
| 866 | 2888420772 | 2888419890 | Bacteria | 7857137 |
| 867 | 2889035075 | 2889033259 | Bacteria | 9099371 |
| 868 | 2903749921 | 2903748898 | Bacteria | 9972761 |
| 869 | 2904672240 | 2904666416 | Bacteria | 8226587 |
| 870 | 2904692505 | 2904690495 | Bacteria | 9412302 |
| 871 | 2904709174 | |||
| 872 | 2904716183 | 2904711408 | Bacteria | 9771557 |
| 873 | 2906613220 | |||
| 874 | 2906633524 | 2906626472 | Bacteria | 8826946 |
| 875 | 2906635489 | 2906635258 | Bacteria | 8601019 |
| 876 | 2906647591 | 2906643746 | Bacteria | 8722424 |
| 877 | 2906668620 | 2906660503 | Bacteria | 8595048 |
| 878 | 2908747904 | 2908739725 | Bacteria | 8628932 |
| 879 | 2908756773 | 2908756301 | Bacteria | 8864324 |
| 880 | 2908775765 | 2908775508 | Bacteria | 8092255 |
| 881 | 2922363334 | 2922361189 | Bacteria | 7436256 |
| 882 | 2922378349 | |||
| 883 | 2922388613 | 2922386360 | Bacteria | 7017218 |
| 884 | 2922400797 | 2922393267 | Bacteria | 8285685 |
| 885 | 2922433717 | |||
| 886 | 2929622550 | 2929615660 | Bacteria | 9193770 |
| 887 | 2929631232 | 2929624759 | Bacteria | 9339455 |
| 888 | 2932786346 | 2932784394 | Bacteria | 9704911 |
| 889 | 2932794686 | 2932794094 | Bacteria | 7915132 |
| 890 | 2932805503 | 2932801729 | Bacteria | 7987968 |
| 891 | 2932812579 | 2932809354 | Bacteria | 9135765 |
| 892 | 2932822941 | 2932818245 | Bacteria | 9955613 |
| 893 | 2932829584 | 2932828146 | Bacteria | 9745859 |
| 894 | 2933584371 | 2933577622 | Bacteria | 9116884 |
| 895 | 2935614958 | 2935608549 | Bacteria | 8203142 |
| 896 | 2935618102 | 2935616580 | Bacteria | 9032984 |
| 897 | 2935634763 | 2935630451 | Bacteria | 8169952 |
| 898 | 2935641500 | 2935638405 | Bacteria | 10015038 |
| 899 | 2935652985 | 2935648319 | Bacteria | 8801166 |
| 900 | 2935661568 | 2935656913 | Bacteria | 8965014 |
| 901 | 2935669442 | 2935665750 | Bacteria | 9571747 |
| 902 | 2935677960 | 2935675223 | Bacteria | 9928132 |
| 903 | 2935689589 | 2935684952 | Bacteria | 9590419 |
| 904 | 2935701802 | 2935694250 | Bacteria | 9291695 |
| 905 | 2935707267 | 2935703347 | Bacteria | 10242284 |
| 906 | 2935717108 | 2935713505 | Bacteria | 9608509 |
| 907 | 2935730058 | 2935722832 | Bacteria | 9608746 |
| 908 | 2935738523 | 2935732158 | Bacteria | 9706831 |
| 909 | 2935749229 | 2935741537 | Bacteria | 9707219 |
| 910 | 2935756942 | 2935750917 | Bacteria | 9590372 |
| 911 | 2935764444 | 2935760218 | Bacteria | 9817913 |
| 912 | 2935772771 | 2935769743 | Bacteria | 7878163 |
| 913 | 2935778092 | 2935777560 | Bacteria | 8077691 |
| 914 | 2935787320 | 2935785616 | Bacteria | 7962367 |
| 915 | 2935795892 | 2935793552 | Bacteria | 8012592 |
| 916 | 2935804354 | 2935801545 | Bacteria | 9301974 |
| 917 | 2935817215 | 2935810662 | Bacteria | 9401221 |
| 918 | 2935826003 | 2935819856 | Bacteria | 8261050 |
| 919 | 2935831231 | 2935827899 | Bacteria | 10038562 |
| 920 | 2935841840 | 2935837841 | Bacteria | 9454360 |
| 921 | 2935851622 | 2935847175 | Bacteria | 8228321 |
| 922 | 2935856399 | 2935855204 | Bacteria | 9035059 |
| 923 | 2935871078 | 2935864058 | Bacteria | 9784707 |
| 924 | 2935874575 | 2935873716 | Bacteria | 9632195 |
| 925 | 2935888900 | 2935883170 | Bacteria | 7964738 |
| 926 | 2935910356 | 2935908558 | Bacteria | 8568796 |
| 927 | 2935918358 | 2935916978 | Bacteria | 9113783 |
| 928 | 2935927733 | 2935926038 | Bacteria | 8601059 |
| 929 | 2935936395 | 2935934488 | Bacteria | 8602579 |
| 930 | 2935944052 | 2935942939 | Bacteria | 8599779 |
| 931 | 2935952489 | 2935951376 | Bacteria | 8602333 |
| 932 | 2935964144 | 2935959822 | Bacteria | 7869783 |
| 933 | 2935969329 | 2935967501 | Bacteria | 8603075 |
| 934 | 2935977906 | 2935975950 | Bacteria | 8347125 |
| 935 | 2935984790 | 2935984226 | Bacteria | 8302647 |
| 936 | 2935994036 | 2935992306 | Bacteria | 9802711 |
| 937 | 2936004953 | 2936002035 | Bacteria | 9362176 |
| 938 | 2936015703 | 2936011229 | Bacteria | 8801034 |
| 939 | 2936024337 | 2936019824 | Bacteria | 8804134 |
| 940 | 2936031776 | 2936028420 | Bacteria | 8965941 |
| 941 | 2936044011 | 2936037263 | Bacteria | 9446081 |
| 942 | 2936051598 | 2936046547 | Bacteria | 8903709 |
| 943 | 2936055961 | 2936055302 | Bacteria | 8785755 |
| 944 | 2940562856 | 2940556831 | Bacteria | 9590747 |
| 945 | 2941511907 | 2941507105 | Bacteria | 8166816 |
| 946 | 2941519609 | 2941515067 | Bacteria | 8166720 |
| 947 | 2941527699 | 2941523033 | Bacteria | 8169134 |
| 948 | 2941532354 | 2941531003 | Bacteria | 7653939 |
| 949 | 2941543913 | 2941538514 | Bacteria | 9402094 |
| 950 | 3005475544 | 3005474847 | Bacteria | 9259049 |
| 951 | 3005486417 | 3005483717 | Bacteria | 7877331 |
| 952 | 3005509545 | 3005506211 | Bacteria | 6943378 |
| 953 | 3005589022 | 3005587118 | Bacteria | 7794411 |
| 954 | 3005717928 | 3005710791 | Bacteria | 7622528 |
| 955 | 8006929777 | 8006926726 | Bacteria | 6749210 |
| 956 | 8006935754 | 8006933436 | Bacteria | 10410654 |
| 957 | 8006968312 | 8006964411 | Bacteria | 8966052 |
| 958 | 8006975673 | 8006973647 | Bacteria | 10679141 |
| 959 | 8006985953 | 8006984368 | Bacteria | 9651211 |
| 960 | 8007000243 | 8006994254 | Bacteria | 8309700 |
| 961 | 8016518626 | 8016511872 | Bacteria | 9921665 |
| 962 | 8016526597 | 8016522445 | Bacteria | 8156687 |
| 963 | 8016531682 | 8016530956 | Bacteria | 8155261 |
| 964 | 8016544880 | 8016539877 | Bacteria | 8155419 |
| 965 | 8016557196 | 8016548790 | Bacteria | 8155074 |
| 966 | 8016569951 | 8016566248 | Bacteria | 8158151 |
| 967 | 8016582530 | 8016575299 | Bacteria | 8154085 |
| 968 | 8016586810 | 8016583857 | Bacteria | 10421953 |
| 969 | 8016603166 | 8016595262 | Bacteria | 8149947 |
| 970 | 8016617965 | 8016613128 | Bacteria | 8794220 |
| 971 | 8016623607 | 8016622563 | Bacteria | 7999408 |
| 972 | 8016636086 | 8016630954 | Bacteria | 9217207 |
| 973 | 8017058044 | 8017057580 | Bacteria | 10023680 |
| 974 | 8019531504 | 8019530166 | Bacteria | 8155624 |
| 975 | 8019540028 | 8019538911 | Bacteria | 7872763 |
| 976 | 8019550628 | 8019547302 | Bacteria | 7996444 |
| 977 | 8019563038 | 8019555841 | Bacteria | 9642137 |
| 978 | 8019573119 | 8019565922 | Bacteria | 9639779 |
| 979 | 8019577690 | 8019576017 | Bacteria | 10049540 |
| 980 | 8019595789 | 8019586578 | Bacteria | 10212056 |
| 981 | 8019612561 | 8019608314 | Bacteria | 10042931 |
| 982 | 8019622557 | 8019619141 | Bacteria | 9218857 |
| 983 | 8019630556 | 8019629233 | Bacteria | 8687553 |
| 984 | 8019652877 | 8019648815 | Bacteria | 10014479 |
| 985 | 8019667382 | 8019659431 | Bacteria | 8577854 |
| 986 | 8019677156 | 8019668869 | Bacteria | 8791617 |
| 987 | 8019678829 | 8019678201 | Bacteria | 8863603 |
| 988 | 8019696703 | 8019687851 | Bacteria | 8712826 |
| 989 | 8055751001 | 8055742211 | Bacteria | 9226248 |
| 990 | 8056677725 | 8056673599 | Bacteria | 7871253 |
| 991 | 8056694113 | 8056689827 | Bacteria | 6712655 |
| 992 | 8056970916 | 8056967851 | Bacteria | 9038162 |
| 993 | Ga0070658_10080003 | |||
| 994 | JGI25406J46586_10000009 | |||
| 995 | rootH1_10072573 | |||
| 996 | JGI25160J50197_1002555 | |||
| 997 | JGI25160J50197_1009959 | |||
| 998 | JGI25404J52841_10027858 | |||
| 999 | JGI25404J52841_10038208 | |||
| 1000 | Ga0055542_1006464 | |||
| 1001 | Ga0065165_1002687 | |||
| 1002 | Ga0065165_1026814 | |||
| 1003 | Ga0070658_10113862 | |||
| 1004 | Ga0070676_10105727 | |||
| 1005 | Ga0070683_100171046 | |||
| 1006 | Ga0070683_100286016 | |||
| 1007 | Ga0070690_100336687 | |||
| 1008 | Ga0070670_100097588 | |||
| 1009 | Ga0070670_100210948 | |||
| 1010 | Ga0068869_100333060 | |||
| 1011 | Ga0070680_100014445 | |||
| 1012 | Ga0070680_100023524 | |||
| 1013 | Ga0068868_100146708 | |||
| 1014 | Ga0070660_100009964 | |||
| 1015 | Ga0070660_100011441 | |||
| 1016 | Ga0070689_100363424 | |||
| 1017 | Ga0070691_10125944 | |||
| 1018 | Ga0070661_100050355 | |||
| 1019 | Ga0070675_100128981 | |||
| 1020 | Ga0070674_100460405 | |||
| 1021 | Ga0070659_100014636 | |||
| 1022 | Ga0070659_100044076 | |||
| 1023 | Ga0070709_10000732 | |||
| 1024 | Ga0070709_10050555 | |||
| 1025 | Ga0070714_100007289 | |||
| 1026 | Ga0070714_100017631 | |||
| 1027 | Ga0070714_100034321 | |||
| 1028 | Ga0070714_100056302 | |||
| 1029 | Ga0070714_100267804 | |||
| 1030 | Ga0070713_100014459 | |||
| 1031 | Ga0070710_10000211 | |||
| 1032 | Ga0070710_10012645 | |||
| 1033 | Ga0070711_100001113 | |||
| 1034 | Ga0070711_100367831 | |||
| 1035 | Ga0070711_100416558 | |||
| 1036 | Ga0070663_100005344 | |||
| 1037 | Ga0070663_100029905 | |||
| 1038 | Ga0070663_100171615 | |||
| 1039 | Ga0070678_100060739 | |||
| 1040 | Ga0070681_10017850 | |||
| 1041 | Ga0070681_10193834 | |||
| 1042 | Ga0068867_100229681 | |||
| 1043 | Ga0070706_100484489 | |||
| 1044 | Ga0070679_100016197 | |||
| 1045 | Ga0070679_100316937 | |||
| 1046 | Ga0070684_100008647 | |||
| 1047 | Ga0070684_100206596 | |||
| 1048 | Ga0070697_100135729 | |||
| 1049 | Ga0068853_100008174 | |||
| 1050 | Ga0068853_100161116 | |||
| 1051 | Ga0068853_100418281 | |||
| 1052 | Ga0070686_100264679 | |||
| 1053 | Ga0070665_100073912 | |||
| 1054 | Ga0070665_100119741 | |||
| 1055 | Ga0070665_100163266 | |||
| 1056 | Ga0070665_100179577 | |||
| 1057 | Ga0070665_100395599 | |||
| 1058 | Ga0068855_100024487 | |||
| 1059 | Ga0068855_100056894 | |||
| 1060 | Ga0068855_100280210 | |||
| 1061 | Ga0070664_100211131 | |||
| 1062 | Ga0068857_100397800 | |||
| 1063 | Ga0068857_100613611 | |||
| 1064 | Ga0068856_100002749 | |||
| 1065 | Ga0068852_100089252 | |||
| 1066 | Ga0068859_100047364 | |||
| 1067 | Ga0068864_100083102 | |||
| 1068 | Ga0068861_100182400 | |||
| 1069 | Ga0068870_10024241 | |||
| 1070 | Ga0068863_100203223 | |||
| 1071 | Ga0068863_100494868 | |||
| 1072 | Ga0068858_100213893 | |||
| 1073 | Ga0068858_100532612 | |||
| 1074 | Ga0068860_100000257 | |||
| 1075 | Ga0068860_100048315 | |||
| 1076 | Ga0068860_100192407 | |||
| 1077 | Ga0068860_100502523 | |||
| 1078 | Ga0081455_10006300 | |||
| 1079 | Ga0081455_10006921 | |||
| 1080 | Ga0081455_10031610 | |||
| 1081 | Ga0081455_10065139 | |||
| 1082 | Ga0081538_10032860 | |||
| 1083 | Ga0081540_1002991 | |||
| 1084 | Ga0081540_1003839 | |||
| 1085 | Ga0081540_1005804 | |||
| 1086 | Ga0081540_1016025 | |||
| 1087 | Ga0081540_1035214 | |||
| 1088 | Ga0081540_1134802 | |||
| 1089 | Ga0081539_10000048 | |||
| 1090 | Ga0081539_10000530 | |||
| 1091 | Ga0081539_10050176 | |||
| 1092 | Ga0081539_10164556 | |||
| 1093 | Ga0070717_10029633 | |||
| 1094 | Ga0070717_10355778 | |||
| 1095 | Ga0075365_10015761 | |||
| 1096 | Ga0075365_10095900 | |||
| 1097 | Ga0075368_10007497 | |||
| 1098 | Ga0075368_10100804 | |||
| 1099 | Ga0075363_100042275 | |||
| 1100 | Ga0075363_100218234 | |||
| 1101 | Ga0075364_10124008 | |||
| 1102 | Ga0070715_10184389 | |||
| 1103 | Ga0070716_100001713 | |||
| 1104 | Ga0070712_100020761 | |||
| 1105 | Ga0070712_100035189 | |||
| 1106 | Ga0070712_100050724 | |||
| 1107 | Ga0075367_10087696 | |||
| 1108 | Ga0075367_10124896 | |||
| 1109 | Ga0075369_10018011 | |||
| 1110 | Ga0075369_10023867 | |||
| 1111 | Ga0075366_10046585 | |||
| 1112 | Ga0097621_100083441 | |||
| 1113 | Ga0075370_10112237 | |||
| 1114 | Ga0075370_10126424 | |||
| 1115 | Ga0068871_100054328 | |||
| 1116 | Ga0068871_100167157 | |||
| 1117 | Ga0075434_100138919 | |||
| 1118 | Ga0068865_100231300 | |||
| 1119 | Ga0068865_100251609 | |||
| 1120 | Ga0097620_100047363 | |||
| 1121 | Ga0099824_1007096 | |||
| 1122 | Ga0099822_1000135 | |||
| 1123 | Ga0099794_10066168 | |||
| 1124 | Ga0105244_10112946 | |||
| 1125 | Ga0105240_10029904 | |||
| 1126 | Ga0105240_10129948 | |||
| 1127 | Ga0105240_10131811 | |||
| 1128 | Ga0105240_10146739 | |||
| 1129 | Ga0105240_10180765 | |||
| 1130 | Ga0111539_10152799 | |||
| 1131 | Ga0111539_10177955 | |||
| 1132 | Ga0105245_10373307 | |||
| 1133 | Ga0105247_10031287 | |||
| 1134 | Ga0105243_10047809 | |||
| 1135 | Ga0105241_10422385 | |||
| 1136 | Ga0105248_10018433 | |||
| 1137 | Ga0105248_10175736 | |||
| 1138 | Ga0105248_10454680 | |||
| 1139 | Ga0105237_10028115 | |||
| 1140 | Ga0105237_10039147 | |||
| 1141 | Ga0105238_10008395 | |||
| 1142 | Ga0105238_10021725 | |||
| 1143 | Ga0105238_10084387 | |||
| 1144 | Ga0105249_10038388 | |||
| 1145 | Ga0105239_10059090 | |||
| 1146 | Ga0105239_10064085 | |||
| 1147 | Ga0105239_10064900 | |||
| 1148 | Ga0105239_10130316 | |||
| 1149 | Ga0105239_10568486 | |||
| 1150 | Ga0105246_10030981 | |||
| 1151 | Ga0157370_10035427 | |||
| 1152 | Ga0157370_10056045 | |||
| 1153 | Ga0157370_10066941 | |||
| 1154 | Ga0157370_10085334 | |||
| 1155 | Ga0157369_10075142 | |||
| 1156 | Ga0157369_10105089 | |||
| 1157 | Ga0157369_10158242 | |||
| 1158 | Ga0157374_10182677 | |||
| 1159 | Ga0157378_10012723 | |||
| 1160 | Ga0157378_10314333 | |||
| 1161 | Ga0163162_10082734 | |||
| 1162 | Ga0163162_10324132 | |||
| 1163 | Ga0157372_10665512 | |||
| 1164 | Ga0157375_10074428 | |||
| 1165 | Ga0163163_10531732 | |||
| 1166 | Ga0157380_10305002 | |||
| 1167 | Ga0157380_10394268 | |||
| 1168 | Ga0157379_10054384 | |||
| 1169 | Ga0157376_10300126 | |||
| 1170 | Ga0182007_10064447 | |||
| 1171 | Ga0163161_10078523 | |||
| 1172 | Ga0214544_1000087 | |||
| 1173 | Ga0214542_1000018 | |||
| 1174 | Ga0214545_1000009 | |||
| 1175 | Ga0214543_1000037 | |||
| 1176 | Ga0213873_10003627 | |||
| 1177 | Ga0213876_10009766 | |||
| 1178 | Ga0213871_10010443 | |||
| 1179 | Ga0209677_100351 | |||
| 1180 | Ga0209677_105322 | |||
| 1181 | Ga0209148_1000694 | |||
| 1182 | Ga0209233_1001183 | |||
| 1183 | Ga0209233_1001483 | |||
| 1184 | Ga0209233_1004271 | |||
| 1185 | Ga0209455_1010407 | |||
| 1186 | Ga0209455_1016202 | |||
| 1187 | Ga0209758_1010323 | |||
| 1188 | Ga0209758_1012517 | |||
| 1189 | Ga0209758_1018538 | |||
| 1190 | Ga0209758_1036727 | |||
| 1191 | Ga0207426_1000201 | |||
| 1192 | Ga0207426_1007359 | |||
| 1193 | Ga0207426_1009367 | |||
| 1194 | Ga0207656_10159496 | |||
| 1195 | Ga0207692_10000494 | |||
| 1196 | Ga0207642_10107148 | |||
| 1197 | Ga0207710_10023909 | |||
| 1198 | Ga0207647_10132985 | |||
| 1199 | Ga0207699_10000480 | |||
| 1200 | Ga0207699_10032324 | |||
| 1201 | Ga0207699_10092807 | |||
| 1202 | Ga0207699_10240327 | |||
| 1203 | Ga0207705_10046309 | |||
| 1204 | Ga0207705_10110790 | |||
| 1205 | Ga0207684_10096663 | |||
| 1206 | Ga0207654_10181150 | |||
| 1207 | Ga0207707_10007086 | |||
| 1208 | Ga0207707_10020967 | |||
| 1209 | Ga0207707_10037525 | |||
| 1210 | Ga0207707_10154186 | |||
| 1211 | Ga0207707_10379586 | |||
| 1212 | Ga0207695_10042176 | |||
| 1213 | Ga0207695_10141798 | |||
| 1214 | Ga0207671_10023286 | |||
| 1215 | Ga0207671_10065742 | |||
| 1216 | Ga0207671_10081338 | |||
| 1217 | Ga0207693_10001776 | |||
| 1218 | Ga0207693_10010321 | |||
| 1219 | Ga0207693_10021887 | |||
| 1220 | Ga0207693_10027366 | |||
| 1221 | Ga0207693_10043158 | |||
| 1222 | Ga0207663_10000356 | |||
| 1223 | Ga0207663_10018201 | |||
| 1224 | Ga0207660_10002711 | |||
| 1225 | Ga0207660_10077105 | |||
| 1226 | Ga0207660_10117379 | |||
| 1227 | Ga0207660_10181152 | |||
| 1228 | Ga0207657_10011430 | |||
| 1229 | Ga0207657_10012728 | |||
| 1230 | Ga0207657_10026499 | |||
| 1231 | Ga0207657_10120290 | |||
| 1232 | Ga0207657_10177267 | |||
| 1233 | Ga0207652_10004991 | |||
| 1234 | Ga0207652_10025043 | |||
| 1235 | Ga0207681_10112595 | |||
| 1236 | Ga0207694_10007898 | |||
| 1237 | Ga0207694_10097619 | |||
| 1238 | Ga0207694_10184898 | |||
| 1239 | Ga0207687_10184149 | |||
| 1240 | Ga0207664_10020450 | |||
| 1241 | Ga0207664_10055501 | |||
| 1242 | Ga0207664_10061817 | |||
| 1243 | Ga0207664_10127444 | |||
| 1244 | Ga0207664_10369600 | |||
| 1245 | Ga0207644_10168012 | |||
| 1246 | Ga0207644_10243620 | |||
| 1247 | Ga0207690_10307553 | |||
| 1248 | Ga0207706_10061004 | |||
| 1249 | Ga0207709_10007124 | |||
| 1250 | Ga0207669_10004832 | |||
| 1251 | Ga0207704_10059506 | |||
| 1252 | Ga0207704_10335701 | |||
| 1253 | Ga0207665_10001832 | |||
| 1254 | Ga0207691_10035507 | |||
| 1255 | Ga0207711_10025676 | |||
| 1256 | Ga0207711_10158025 | |||
| 1257 | Ga0207711_10257779 | |||
| 1258 | Ga0207689_10071969 | |||
| 1259 | Ga0207661_10031859 | |||
| 1260 | Ga0207661_10129788 | |||
| 1261 | Ga0207661_10281079 | |||
| 1262 | Ga0207661_10544497 | |||
| 1263 | Ga0207667_10010722 | |||
| 1264 | Ga0207667_10022929 | |||
| 1265 | Ga0207667_10243413 | |||
| 1266 | Ga0207667_10349377 | |||
| 1267 | Ga0207712_10031864 | |||
| 1268 | Ga0207668_10010669 | |||
| 1269 | Ga0207668_10015396 | |||
| 1270 | Ga0207668_10031458 | |||
| 1271 | Ga0207640_10266202 | |||
| 1272 | Ga0207677_10036816 | |||
| 1273 | Ga0207703_10149157 | |||
| 1274 | Ga0207639_10043497 | |||
| 1275 | Ga0207639_10183014 | |||
| 1276 | Ga0207639_10221198 | |||
| 1277 | Ga0207639_10393611 | |||
| 1278 | Ga0207639_10418290 | |||
| 1279 | Ga0207678_10011493 | |||
| 1280 | Ga0207678_10023466 | |||
| 1281 | Ga0207702_10000056 | |||
| 1282 | Ga0207702_10063731 | |||
| 1283 | Ga0207641_10072841 | |||
| 1284 | Ga0207641_10318080 | |||
| 1285 | Ga0207648_10069412 | |||
| 1286 | Ga0207648_10169915 | |||
| 1287 | Ga0207676_10024271 | |||
| 1288 | Ga0207674_10098670 | |||
| 1289 | Ga0207675_100029414 | |||
| 1290 | Ga0207675_100176095 | |||
| 1291 | Ga0207675_100290068 | |||
| 1292 | Ga0207683_10074092 | |||
| 1293 | Ga0207698_10069481 | |||
| 1294 | Ga0207698_10304068 | |||
| 1295 | Ga0207698_10699393 | |||
| 1296 | Ga0209389_1000029 | |||
| 1297 | Ga0209589_1000012 | |||
| 1298 | Ga0209589_1000013 | |||
| 1299 | Ga0209589_1000017 | |||
| 1300 | Ga0209489_100013 | |||
| 1301 | Ga0209489_100018 | |||
| 1302 | Ga0209700_100028 | |||
| 1303 | Ga0209588_1006331 | |||
| 1304 | Ga0268266_10168478 | |||
| 1305 | Ga0268266_10368279 | |||
| 1306 | Ga0268265_10024844 | |||
| 1307 | Ga0268264_10000049 | |||
| 1308 | Ga0268264_10071969 | |||
| 1309 | Ga0265337_1028504 | |||
| 1310 | Ga0265334_10007076 | |||
| 1311 | Ga0265318_10008750 | |||
| 1312 | Ga0265323_10002966 | |||
| 1313 | Ga0265322_10011412 | |||
| 1314 | Ga0265336_10001946 | |||
| 1315 | Ga0307517_10000766 | |||
| 1316 | Ga0265338_10000024 | |||
| 1317 | Ga0265324_10009302 | |||
| 1318 | Ga0265330_10006264 | |||
| 1319 | Ga0265330_10056632 | |||
| 1320 | Ga0265332_10019884 | |||
| 1321 | Ga0265328_10020866 | |||
| 1322 | Ga0265339_10007291 | |||
| 1323 | Ga0265316_10276893 | |||
| 1324 | Ga0307513_10117890 | |||
| 1325 | Ga0307509_10076249 | |||
| 1326 | Ga0307508_10000005 | |||
| 1327 | Ga0307508_10011825 | |||
| 1328 | Ga0265342_10085381 | |||
| 1329 | Ga0265342_10088710 | |||
| 1330 | Ga0307516_10007966 | |||
| 1331 | Ga0307516_10029291 | |||
| 1332 | Ga0307516_10145252 | |||
| 1333 | Ga0307516_10361380 | |||
| 1334 | Ga0307410_10053396 | |||
| 1335 | Ga0316583_10002620 | |||
| 1336 | Ga0307507_10247874 | |||
| 1337 | Ga0307510_10001273 | |||
| 1338 | Ga0307510_10069809 | |||
| 1339 | Ga0315911_1000033 | |||
| 1340 | Ga0373923_0001018 | |||
| 1341 | Ga0373923_0148961 | |||
| 1342 | Ga0373936_0010157 | |||
| 1343 | Ga0373936_0036067 | |||
| 1344 | Ga0373945_0002016 | |||
| 1345 | Ga0373953_0015608 | |||
| 1346 | Ga0373954_0001240 | |||
| 1347 | Ga0373954_0075033 | |||
| 1348 | Ga0373956_0000296 | |||
| 1349 | Ga0373957_0007838 | |||
| 1350 | Ga0373943_0011050 | |||
| 1351 | Ga0373946_0001135 | |||
| 1352 | Ga0373955_0001544 | |||
| 1353 | Ga0373955_0024853 | |||
| 1354 | Ga0373924_0001120 | |||
| 1355 | Ga0373931_0191358 | |||
| 1356 | Ga0373935_0008536 | |||
| 1357 | Ga0373935_0061563 | |||
| 1358 | Ga0373927_0000071 | |||
| 1359 | Ga0373927_0005319 | |||
| 1360 | Ga0373927_0017743 | |||
| 1361 | Ga0373927_0038587 | |||
| 1362 | Ga0373933_0000114 | |||
| 1363 | Ga0373933_0003475 | |||
| 1364 | Ga0373933_0274493 | |||
| 1365 | Ga0373947_0002914 | |||
| 1366 | Ga0373947_0158528 | |||
| 1367 | Ga0373937_0006682 | |||
| 1368 | Ga0373937_0020664 | |||
| 1369 | Ga0373925_0012108 | |||
| 1370 | Ga0373925_0018670 | |||
| 1371 | Ga0373925_0035939 | |||
| 1372 | Ga0395900_0084990 | |||
| 1373 | Ga0395900_0093104 | |||
| 1374 | Ga0395900_0488283 | |||
| 1375 | Ga0395898_0037127 | |||
| 1376 | Ga0395898_0088910 | |||
| 1377 | Ga0395898_0138371 | |||
| 1378 | Ga0395905_0005511 | |||
| 1379 | Ga0395905_0132044 | |||
| 1380 | Ga0395905_0258463 | |||
| 1381 | Ga0436364_1210928 | |||
| 1382 | Ga0436364_1525576 | |||
| 1383 | Ga0395901_0026879 | |||
| 1384 | Ga0395901_0139896 | |||
| 1385 | Ga0395901_0231511 | |||
| 1386 | Ga0395901_0405726 | |||
| 1387 | Ga0436365_0650112 | |||
| 1388 | Ga0436365_0951406 | |||
| 1389 | Ga0436365_1496296 | |||
| 1390 | Ga0436360_0291987 | |||
| 1391 | Ga0436363_0280053 | |||
| 1392 | Ga0436363_0439777 | |||
| 1393 | Ga0436362_0465319 | |||
| 1394 | Ga0451795_0400584 | |||
| 1395 | Ga0439431_0030779 | |||
| 1396 | Ga0466972_0000103 | |||
| 1397 | Ga0466972_0011618 | |||
| 1398 | Ga0466963_0060863 | |||
| 1399 | Ga0466968_0007308 | |||
| 1400 | Ga0466970_0211251 | |||
| 1401 | Ga0466957_0025520 | |||
| 1402 | Ga0466960_0011025 | |||
| 1403 | Ga0466967_0498331 | |||
| 1404 | Ga0495592_0004585 | |||
| 1405 | Ga0495592_0006419 | |||
| 1406 | Ga0495592_0051631 | |||
| 1407 | Ga0495603_0000035 | |||
| 1408 | Ga0495603_0004004 | |||
| 1409 | Ga0495603_0006336 | |||
| 1410 | Ga0495629_0000081 | |||
| 1411 | Ga0495629_0001069 | |||
| 1412 | Ga0495629_0048237 | |||
| 1413 | Ga0495629_0151152 | |||
| 1414 | Ga0495638_0002281 | |||
| 1415 | Ga0495638_0007023 | |||
| 1416 | Ga0495641_0000707 | |||
| 1417 | Ga0495651_0010124 | |||
| 1418 | Ga0495651_0016379 | |||
| 1419 | Ga0495651_0104835 | |||
| 1420 | Ga0495653_0001526 | |||
| 1421 | Ga0495653_0059435 | |||
| 1422 | Ga0495653_0153088 | |||
| 1423 | Ga0495580_0003091 | |||
| 1424 | Ga0495580_0062442 | |||
| 1425 | Ga0495582_0000235 | |||
| 1426 | Ga0495639_0000010 | |||
| 1427 | Ga0495639_0148297 | |||
| 1428 | Ga0495662_0000034 | |||
| 1429 | Ga0495662_0057056 | |||
| 1430 | Ga0495662_0102808 | |||
| 1431 | Ga0495664_0018913 | |||
| 1432 | Ga0495664_0032881 | |||
| 1433 | Ga0495664_0039454 | |||
| 1434 | Ga0495664_0267415 | |||
| 1435 | Ga0495585_0069042 | |||
| 1436 | Ga0495594_0001375 | |||
| 1437 | Ga0495607_0070719 | |||
| 1438 | Ga0495606_0000265 | |||
| 1439 | Ga0495608_0004335 | |||
| 1440 | Ga0495616_0036522 | |||
| 1441 | Ga0495618_0103673 | |||
| 1442 | Ga0495618_0142938 | |||
| 1443 | Ga0495628_0012927 | |||
| 1444 | Ga0495628_0032331 | |||
| 1445 | Ga0495628_0046957 | |||
| 1446 | Ga0495628_0060094 | |||
| 1447 | Ga0495630_0002040 | |||
| 1448 | Ga0495630_0160306 | |||
| 1449 | Ga0495632_0019670 | |||
| 1450 | Ga0495632_0045655 | |||
| 1451 | Ga0495632_0194754 | |||
| 1452 | Ga0495648_0003897 | |||
| 1453 | Ga0495666_0008369 | |||
| 1454 | Ga0495666_0022400 | |||
| 1455 | Ga0495652_0006665 | |||
| 1456 | Ga0495652_0011477 | |||
| 1457 | Ga0495652_0054128 | |||
| 1458 | Ga0495665_0000005 | |||
| 1459 | Ga0495640_0001991 | |||
| 1460 | Ga0495640_0038556 | |||
| 1461 | Ga0495640_0038785 | |||
| 1462 | Ga0495586_0055794 | |||
| 1463 | Ga0495587_0045966 | |||
| 1464 | Ga0495645_0018588 | |||
| 1465 | Ga0495645_0028158 | |||
| 1466 | Ga0495645_0059254 | |||
| 1467 | Ga0495622_0001721 | |||
| 1468 | Ga0495622_0070105 | |||
| 1469 | Ga0495633_0103185 | |||
| 1470 | Ga0495667_0009439 | |||
| 1471 | Ga0495667_0077762 | |||
| 1472 | Ga0495667_0093822 | |||
| 1473 | Ga0495656_0025167 | |||
| 1474 | Ga0495668_0074226 | |||
| 1475 | Ga0495634_0000261 | |||
| 1476 | Ga0495634_0022791 | |||
| 1477 | Ga0495634_0157576 | |||
| 1478 | Ga0495611_0068131 | |||
| 1479 | Ga0495625_0314265 | |||
| 1480 | Ga0495635_0000281 | |||
| 1481 | Ga0495635_0000963 | |||
| 1482 | Ga0495635_0011833 | |||
| 1483 | Ga0495635_0112373 | |||
| 1484 | Ga0495588_0013335 | |||
| 1485 | Ga0495588_0061742 | |||
| 1486 | Ga0495588_0084210 | |||
| 1487 | Ga0495657_0006559 | |||
| 1488 | Ga0495657_0045052 | |||
| 1489 | Ga0495599_0017554 | |||
| 1490 | Ga0495599_0019957 | |||
| 1491 | Ga0495623_0015660 | |||
| 1492 | Ga0495646_0015043 | |||
| 1493 | Ga0495646_0091348 | |||
| 1494 | Ga0495646_0172008 | |||
| 1495 | Ga0495647_0001017 | |||
| 1496 | Ga0495658_0001011 | |||
| 1497 | Ga0495613_0004043 | |||
| 1498 | Ga0495613_0062002 | |||
| 1499 | Ga0495613_0108256 | |||
| 1500 | Ga0495613_0215885 | |||
| 1501 | Ga0495624_0001342 | |||
| 1502 | Ga0495624_0226069 | |||
| 1503 | Ga0495624_0295560 | |||
| 1504 | Ga0495671_0032886 | |||
| 1505 | Ga0495600_0000567 | |||
| 1506 | Ga0495600_0042815 | |||
| 1507 | Ga0495581_0000018 | |||
| 1508 | Ga0495581_0096067 | |||
| 1509 | Ga0495604_0005727 | |||
| 1510 | Ga0495604_0008890 | |||
| 1511 | Ga0495674_0000134 | |||
| 1512 | Ga0495674_0030816 | |||
| 1513 | Ga0495674_0118456 | |||
| 1514 | Ga0495672_0042363 | |||
| 1515 | Ga0495676_0030497 | |||
| 1516 | Ga0495676_0068390 | |||
| 1517 | Ga0495680_0006823 | |||
| 1518 | Ga0495680_0007319 | |||
| 1519 | Ga0495680_0121242 | |||
| 1520 | Ga0495683_0070352 | |||
| 1521 | Ga0495675_0021068 | |||
| 1522 | Ga0495675_0022748 | |||
| 1523 | Ga0495675_0061810 | |||
| 1524 | Ga0495673_0021341 | |||
| 1525 | Ga0495673_0048751 | |||
| 1526 | Ga0495684_0000052 | |||
| 1527 | Ga0495684_0032994 | |||
| 1528 | Ga0495684_0140995 | |||
| 1529 | Ga0495593_0000072 | |||
| 1530 | Ga0495593_0000214 | |||
| 1531 | Ga0495602_0062320 | |||
| 1532 | Ga0495602_0220007 | |||
| 1533 | Ga0495614_0046866 | |||
| 1534 | Ga0495614_0083955 | |||
| 1535 | Ga0496100_0036087 | |||
| 1536 | Ga0496100_0097113 | |||
| 1537 | Ga0496100_0277530 | |||
| 1538 | Ga0496101_0119028 | |||
| 1539 | Ga0496101_0152462 | |||
| 1540 | Ga0496101_0197495 | |||
| 1541 | Ga0496102_0020395 | |||
| 1542 | Ga0496102_0042868 | |||
| 1543 | Ga0496102_0151367 | |||
| 1544 | Ga0496102_0159558 | |||
| 1545 | Ga0496102_0166114 | |||
| 1546 | Ga0496103_0012448 | |||
| 1547 | Ga0496104_0005388 | |||
| 1548 | Ga0496104_0032218 | |||
| 1549 | Ga0496104_0036647 | |||
| 1550 | Ga0496104_0129492 | |||
| 1551 | Ga0496104_0160497 | |||
| 1552 | Ga0496105_0001275 | |||
| 1553 | Ga0496105_0037647 | |||
| 1554 | Ga0496105_0122747 | |||
| 1555 | Ga0496106_0003991 | |||
| 1556 | Ga0496106_0042979 | |||
| 1557 | Ga0496106_0121425 | |||
| 1558 | Ga0496106_0241430 | |||
| 1559 | Ga0496107_0003794 | |||
| 1560 | Ga0496107_0005978 | |||
| 1561 | Ga0496107_0040653 | |||
| 1562 | Ga0496108_0000581 | |||
| 1563 | Ga0496109_0000507 | |||
| 1564 | Ga0496109_0159771 | |||
| 1565 | Ga0496110_0008549 | |||
| 1566 | Ga0496110_0011045 | |||
| 1567 | Ga0496110_0166098 | |||
| 1568 | Ga0496111_0050677 | |||
| 1569 | Ga0496111_0370033 | |||
| 1570 | Ga0496112_0004823 | |||
| 1571 | Ga0496112_0032266 | |||
| 1572 | Ga0496112_0161748 | |||
| 1573 | Ga0496112_0190662 | |||
| 1574 | Ga0496112_0553263 | |||
| 1575 | Ga0496113_0010309 | |||
| 1576 | Ga0496113_0029645 | |||
| 1577 | Ga0496113_0411991 | |||
| 1578 | Ga0496114_0045648 | |||
| 1579 | Ga0496114_0100516 | |||
| 1580 | Ga0496114_0127199 | |||
| 1581 | Ga0496114_0357299 | |||
| 1582 | Ga0496115_0022097 | |||
| 1583 | Ga0496115_0082169 | |||
| 1584 | Ga0496115_0083685 | |||
| 1585 | Ga0496115_0095293 | |||
| 1586 | Ga0496115_0286035 | |||
| 1587 | Ga0496116_0088220 | |||
| 1588 | Ga0496116_0113270 | |||
| 1589 | Ga0496117_0004399 | |||
| 1590 | Ga0496117_0135251 | |||
| 1591 | Ga0496118_0005557 | |||
| 1592 | Ga0496118_0035728 | |||
| 1593 | Ga0496118_0063743 | |||
| 1594 | Ga0496118_0215406 | |||
| 1595 | Ga0496119_0038310 | |||
| 1596 | Ga0496119_0041332 | |||
| 1597 | Ga0496120_0023580 | |||
| 1598 | Ga0496120_0046427 | |||
| 1599 | Ga0496121_0000716 | |||
| 1600 | Ga0496121_0004612 | |||
| 1601 | Ga0496121_0039009 | |||
| 1602 | Ga0496121_0040767 | |||
| 1603 | Ga0496121_0053636 | |||
| 1604 | Ga0496121_0054425 | |||
| 1605 | Ga0496121_0064371 | |||
| 1606 | Ga0496121_0124235 | |||
| 1607 | Ga0496121_0130335 | |||
| 1608 | Ga0496121_0230345 | |||
| 1609 | Ga0496124_0001529 | |||
| 1610 | Ga0496124_0052896 | |||
| 1611 | Ga0496124_0092171 | |||
| 1612 | Ga0496124_0165220 | |||
| 1613 | Ga0496124_0278423 | |||
| 1614 | Ga0496125_0092208 | |||
| 1615 | Ga0496125_0116685 | |||
| 1616 | Ga0496126_0032749 | |||
| 1617 | Ga0496126_0041848 | |||
| 1618 | Ga0496126_0077478 | |||
| 1619 | Ga0496126_0143508 | |||
| 1620 | Ga0496126_0294095 | |||
| 1621 | Ga0501031_0001453 | |||
| 1622 | Ga0501032_0000048 | |||
| 1623 | Ga0501032_0014636 | |||
| 1624 | Ga0501032_0023304 | |||
| 1625 | Ga0501032_0090231 | |||
| 1626 | Ga0501032_0239997 | |||
| 1627 | Ga0501033_0000184 | |||
| 1628 | Ga0501033_0003525 | |||
| 1629 | Ga0501033_0063050 | |||
| 1630 | Ga0501033_0107480 | |||
| 1631 | Ga0501033_0243823 | |||
| 1632 | Ga0501034_0000082 | |||
| 1633 | Ga0501034_0011514 | |||
| 1634 | Ga0501034_0026323 | |||
| 1635 | Ga0501034_0100582 | |||
| 1636 | Ga0501034_0194842 | |||
| 1637 | Ga0501036_0000791 | |||
| 1638 | Ga0501036_0172827 | |||
| 1639 | Ga0501037_0000063 | |||
| 1640 | Ga0501037_0014971 | |||
| 1641 | Ga0501037_0168736 | |||
| 1642 | Ga0501038_0000295 | |||
| 1643 | Ga0501038_0006071 | |||
| 1644 | Ga0501038_0010109 | |||
| 1645 | Ga0501038_0032236 | |||
| 1646 | Ga0501038_0061390 | |||
| 1647 | Ga0501038_0127784 | |||
| 1648 | Ga0501038_0235841 | |||
| 1649 | Ga0501039_0000082 | |||
| 1650 | Ga0501039_0155746 | |||
| 1651 | Ga0501039_0482272 | |||
| 1652 | Ga0501040_0117720 | |||
| 1653 | Ga0501042_0002545 | |||
| 1654 | Ga0501043_0000148 | |||
| 1655 | Ga0501043_0020509 | |||
| 1656 | Ga0501043_0054115 | |||
| 1657 | Ga0501043_0070406 | |||
| 1658 | Ga0501046_0000101 | |||
| 1659 | Ga0501046_0026634 | |||
| 1660 | Ga0501046_0082467 | |||
| 1661 | Ga0501046_0130541 | |||
| 1662 | Ga0501047_0002965 | |||
| 1663 | Ga0501047_0009908 | |||
| 1664 | Ga0501047_0014737 | |||
| 1665 | Ga0501047_0102168 | |||
| 1666 | Ga0501047_0332635 | |||
| 1667 | Ga0501047_0365629 | |||
| 1668 | Ga0501048_0002363 | |||
| 1669 | Ga0501048_0005496 | |||
| 1670 | Ga0501048_0070461 | |||
| 1671 | Ga0501067_0000056 | |||
| 1672 | Ga0501067_0002825 | |||
| 1673 | Ga0501067_0025603 | |||
| 1674 | Ga0501068_0000070 | |||
| 1675 | Ga0501068_0009793 | |||
| 1676 | Ga0501068_0164793 | |||
| 1677 | Ga0501069_0000352 | |||
| 1678 | Ga0501069_0117920 | |||
| 1679 | Ga0501070_0017489 | |||
| 1680 | Ga0501070_0021108 | |||
| 1681 | Ga0501070_0026055 | |||
| 1682 | Ga0501070_0168234 | |||
| 1683 | Ga0501070_0198841 | |||
| 1684 | Ga0501070_0218245 | |||
| 1685 | Ga0501071_0262511 | |||
| 1686 | Ga0501072_0000871 | |||
| 1687 | Ga0501073_0000053 | |||
| 1688 | Ga0501073_0003590 | |||
| 1689 | Ga0501073_0014548 | |||
| 1690 | Ga0501073_0022587 | |||
| 1691 | Ga0501074_0001132 | |||
| 1692 | Ga0501074_0014062 | |||
| 1693 | Ga0501074_0023865 | |||
| 1694 | Ga0501076_0294057 | |||
| 1695 | Ga0501079_0013401 | |||
| 1696 | Ga0501080_0000826 | |||
| 1697 | Ga0501080_0010573 | |||
| 1698 | Ga0501080_0109870 | |||
| 1699 | Ga0501080_0392357 | |||
| 1700 | Ga0501083_0001586 | |||
| 1701 | Ga0501083_0010499 | |||
| 1702 | Ga0501035_0000474 | |||
| 1703 | Ga0501035_0035212 | |||
| 1704 | Ga0501035_0036749 | |||
| 1705 | Ga0501035_0039873 | |||
| 1706 | Ga0501035_0216406 | |||
| 1707 | Ga0501044_0000408 | |||
| 1708 | Ga0501044_0026586 | |||
| 1709 | Ga0501044_0073368 | |||
| 1710 | Ga0501044_0344200 | |||
| 1711 | Ga0501045_0003604 | |||
| 1712 | nmdc:mga03683_32770_c1 | |||
| 1713 | nmdc:mga03n38_750_c1 | |||
| 1714 | nmdc:mga00v17_44083_c1 | |||
| 1715 | nmdc:mga00v17_89925_c1 | |||
| 1716 | nmdc:mga0yw44_134708_c1 | |||
| 1717 | nmdc:mga0yw44_71352_c1 | |||
| 1718 | nmdc:mga0yw44_95063_c1 | |||
| 1719 | nmdc:mga06z11_57843_c1 | |||
| 1720 | nmdc:mga06z11_96061_c1 | |||
| 1721 | nmdc:mga07m45_18580_c1 | |||
| 1722 | nmdc:mga07m45_83827_c1 | |||
| 1723 | nmdc:mga05p37_178885_c1 | |||
| 1724 | nmdc:mga06r32_618063_c1 | |||
| 1725 | nmdc:mga08y16_88998_c1 | |||
| 1726 | nmdc:mga0sz30_114159_c1 | |||
| 1727 | nmdc:mga0sz30_25537_c1 | |||
| 1728 | Ga0495601_0046525 | |||
| 1729 | Ga0495601_0057492 | |||
| 1730 | Ga0500635_0003021 | |||
| 1731 | Ga0495595_0001205 | |||
| 1732 | Ga0495619_0003340 | |||
| 1733 | Ga0495619_0131741 | |||
| 1734 | Ga0500651_0073134 | |||
| 1735 | Ga0500566_0000896 | |||
| 1736 | Ga0500566_0002969 | |||
| 1737 | Ga0500566_0009283 | |||
| 1738 | Ga0500640_089234 | |||
| 1739 | Ga0500640_107333 | |||
| 1740 | Ga0500641_0001155 | |||
| 1741 | Ga0500556_0053429 | |||
| 1742 | Ga0500556_0062248 | |||
| 1743 | Ga0500572_000633 | |||
| 1744 | Ga0500572_008737 | |||
| 1745 | Ga0500591_119045 | |||
| 1746 | Ga0500595_000253 | |||
| 1747 | Ga0500595_012401 | |||
| 1748 | Ga0500607_048744 | |||
| 1749 | Ga0500607_115020 | |||
| 1750 | Ga0500614_020284 | |||
| 1751 | Ga0500655_023414 | |||
| 1752 | Ga0500658_0030957 | |||
| 1753 | Ga0500559_0001232 | |||
| 1754 | Ga0500559_0027725 | |||
| 1755 | Ga0500559_0031651 | |||
| 1756 | Ga0500559_0131436 | |||
| 1757 | Ga0500573_0037537 | |||
| 1758 | Ga0500577_0018436 | |||
| 1759 | Ga0500603_000165 | |||
| 1760 | Ga0500603_028425 | |||
| 1761 | Ga0500604_0016811 | |||
| 1762 | Ga0500619_071794 | |||
| 1763 | Ga0500630_082708 | |||
| 1764 | Ga0500638_026089 | |||
| 1765 | Ga0500638_083307 | |||
| 1766 | Ga0500639_004728 | |||
| 1767 | Ga0500639_025802 | |||
| 1768 | Ga0500636_0000075 | |||
| 1769 | Ga0500636_0031111 | |||
| 1770 | Ga0500636_0034808 | |||
| 1771 | Ga0500637_0002240 | |||
| 1772 | Ga0500637_0030717 | |||
| 1773 | Ga0500637_0182301 | |||
| 1774 | Ga0500637_0195048 | |||
| 1775 | Ga0500609_003969 | |||
| 1776 | Ga0500596_008366 | |||
| 1777 | Ga0500599_001855 | |||
| 1778 | Ga0500601_000821 | |||
| 1779 | Ga0501084_0540782 | |||
| 1780 | Ga0501082_0014060 | |||
| 1781 | 2507504843 | |||
| 1782 | 2508546198 | |||
| 1783 | 2508695130 | |||
| 1784 | 2511395456 | |||
| 1785 | 2513625425 | |||
| 1786 | 2513639554 | |||
| 1787 | 2513658232 | |||
| 1788 | 2513694928 | |||
| 1789 | 2513703352 | |||
| 1790 | 2513862938 | |||
| 1791 | 2513873913 | |||
| 1792 | 2513920276 | |||
| 1793 | 2514012886 | |||
| 1794 | 2515625864 | |||
| 1795 | 2517102386 | |||
| 1796 | 2517889304 | |||
| 1797 | 2528855138 | |||
| 1798 | 2617351701 | |||
| 1799 | 2617377249 | |||
| 1800 | 2671121416 | |||
| 1801 | 2723842025 | |||
| 1802 | 2728755360 | |||
| 1803 | 2793066048 | |||
| 1804 | 2793070961 | |||
| 1805 | 2793077426 | |||
| 1806 | 2805915996 | |||
| 1807 | 2818237280 | |||
| 1808 | 2824621107 | |||
| 1809 | 2824630114 | |||
| 1810 | 2824640731 | |||
| 1811 | 2824649822 | |||
| 1812 | 2824664729 | |||
| 1813 | 2824674854 | |||
| 1814 | 2824683557 | |||
| 1815 | 2824691922 | |||
| 1816 | 2824697651 | |||
| 1817 | 2824709662 | |||
| 1818 | 2824719827 | |||
| 1819 | 2824727931 | |||
| 1820 | 2824736250 | |||
| 1821 | 2824750286 | |||
| 1822 | 2824757114 | |||
| 1823 | 2824768450 | |||
| 1824 | 2824774943 | |||
| 1825 | 2838131018 | |||
| 1826 | 2841944459 | |||
| 1827 | 2841951600 | |||
| 1828 | 2841964613 | |||
| 1829 | 2841969236 | |||
| 1830 | 2841982901 | |||
| 1831 | 2841991017 | |||
| 1832 | 2842043883 | |||
| 1833 | 2842052127 | |||
| 1834 | 2847931469 | |||
| 1835 | 2847941753 | |||
| 1836 | 2874596837 | |||
| 1837 | 2874610363 | |||
| 1838 | 2874617919 | |||
| 1839 | 2874624421 | |||
| 1840 | 2874648642 | |||
| 1841 | 2876766413 | |||
| 1842 | 2876777301 | |||
| 1843 | 2876812842 | |||
| 1844 | 2876825383 | |||
| 1845 | 2879077632 | |||
| 1846 | 2879087494 | |||
| 1847 | 2879107225 | |||
| 1848 | 2879111682 | |||
| 1849 | 2879127662 | |||
| 1850 | 2879146065 | |||
| 1851 | 2881371002 | |||
| 1852 | 2881665696 | |||
| 1853 | 2885371399 | |||
| 1854 | 2885377732 | |||
| 1855 | 2885411719 | |||
| 1856 | 2888379963 | |||
| 1857 | 2888391041 | |||
| 1858 | 2888420772 | |||
| 1859 | 2889035075 | |||
| 1860 | 2903749921 | |||
| 1861 | 2904672240 | |||
| 1862 | 2904692505 | |||
| 1863 | 2904709174 | |||
| 1864 | 2904716183 | |||
| 1865 | 2906613220 | |||
| 1866 | 2906633524 | |||
| 1867 | 2906635489 | |||
| 1868 | 2906647591 | |||
| 1869 | 2906668620 | |||
| 1870 | 2908747904 | |||
| 1871 | 2908756773 | |||
| 1872 | 2908775765 | |||
| 1873 | 2922363334 | |||
| 1874 | 2922378349 | |||
| 1875 | 2922388613 | |||
| 1876 | 2922400797 | |||
| 1877 | 2922433717 | |||
| 1878 | 2929622550 | |||
| 1879 | 2929631232 | |||
| 1880 | 2932786346 | |||
| 1881 | 2932794686 | |||
| 1882 | 2932805503 | |||
| 1883 | 2932812579 | |||
| 1884 | 2932822941 | |||
| 1885 | 2932829584 | |||
| 1886 | 2933584371 | |||
| 1887 | 2935614958 | |||
| 1888 | 2935618102 | |||
| 1889 | 2935634763 | |||
| 1890 | 2935641500 | |||
| 1891 | 2935652985 | |||
| 1892 | 2935661568 | |||
| 1893 | 2935669442 | |||
| 1894 | 2935677960 | |||
| 1895 | 2935689589 | |||
| 1896 | 2935701802 | |||
| 1897 | 2935707267 | |||
| 1898 | 2935717108 | |||
| 1899 | 2935730058 | |||
| 1900 | 2935738523 | |||
| 1901 | 2935749229 | |||
| 1902 | 2935756942 | |||
| 1903 | 2935764444 | |||
| 1904 | 2935772771 | |||
| 1905 | 2935778092 | |||
| 1906 | 2935787320 | |||
| 1907 | 2935795892 | |||
| 1908 | 2935804354 | |||
| 1909 | 2935817215 | |||
| 1910 | 2935826003 | |||
| 1911 | 2935831231 | |||
| 1912 | 2935841840 | |||
| 1913 | 2935851622 | |||
| 1914 | 2935856399 | |||
| 1915 | 2935871078 | |||
| 1916 | 2935874575 | |||
| 1917 | 2935888900 | |||
| 1918 | 2935910356 | |||
| 1919 | 2935918358 | |||
| 1920 | 2935927733 | |||
| 1921 | 2935936395 | |||
| 1922 | 2935944052 | |||
| 1923 | 2935952489 | |||
| 1924 | 2935964144 | |||
| 1925 | 2935969329 | |||
| 1926 | 2935977906 | |||
| 1927 | 2935984790 | |||
| 1928 | 2935994036 | |||
| 1929 | 2936004953 | |||
| 1930 | 2936015703 | |||
| 1931 | 2936024337 | |||
| 1932 | 2936031776 | |||
| 1933 | 2936044011 | |||
| 1934 | 2936051598 | |||
| 1935 | 2936055961 | |||
| 1936 | 2940562856 | |||
| 1937 | 2941511907 | |||
| 1938 | 2941519609 | |||
| 1939 | 2941527699 | |||
| 1940 | 2941532354 | |||
| 1941 | 2941543913 | |||
| 1942 | 3005475544 | |||
| 1943 | 3005486417 | |||
| 1944 | 3005509545 | |||
| 1945 | 3005589022 | |||
| 1946 | 3005717928 | |||
| 1947 | 8006929777 | |||
| 1948 | 8006935754 | |||
| 1949 | 8006968312 | |||
| 1950 | 8006975673 | |||
| 1951 | 8006985953 | |||
| 1952 | 8007000243 | |||
| 1953 | 8016518626 | |||
| 1954 | 8016526597 | |||
| 1955 | 8016531682 | |||
| 1956 | 8016544880 | |||
| 1957 | 8016557196 | |||
| 1958 | 8016569951 | |||
| 1959 | 8016582530 | |||
| 1960 | 8016586810 | |||
| 1961 | 8016603166 | |||
| 1962 | 8016617965 | |||
| 1963 | 8016623607 | |||
| 1964 | 8016636086 | |||
| 1965 | 8017058044 | |||
| 1966 | 8019531504 | |||
| 1967 | 8019540028 | |||
| 1968 | 8019550628 | |||
| 1969 | 8019563038 | |||
| 1970 | 8019573119 | |||
| 1971 | 8019577690 | |||
| 1972 | 8019595789 | |||
| 1973 | 8019612561 | |||
| 1974 | 8019622557 | |||
| 1975 | 8019630556 | |||
| 1976 | 8019652877 | |||
| 1977 | 8019667382 | |||
| 1978 | 8019677156 | |||
| 1979 | 8019678829 | |||
| 1980 | 8019696703 | |||
| 1981 | 8055751001 | |||
| 1982 | 8056677725 | |||
| 1983 | 8056694113 | |||
| 1984 | 8056970916 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1h31-assembly3.cif.gz_E | oxidised soxax complex from rhodovulum sulfidophilum | 0.6967 | 81 | 284 |
| 2c1d-assembly4.cif.gz_G | crystal structure of soxxa from p. pantotrophus | 0.683 | 81 | 284 |
| 3ocd-assembly2.cif.gz_C | diheme soxax - c236m mutant | 0.672 | 76 | 283 |
| 3oa8-assembly1.cif.gz_E | diheme soxax | 0.6582 | 81 | 283 |
| 3ocd-assembly2.cif.gz_C | diheme soxax - c236m mutant | 0.6161 | 76 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1h31A02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8696 | 81 | 161 | 1.10.760.10 |
| 2c1dG02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8065 | 81 | 162 | 1.10.760.10 |
| 1h31A02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7984 | 81 | 161 | 1.10.760.10 |
| 4wqaA01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.763 | 81 | 168 | 1.10.760.10 |
| 2c1dG02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.744 | 81 | 162 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836T9R1-F1-model_v4 | deleted | 0.9273 | 28 | 185 |
|
| AF-A0A3M0Y9H3-F1-model_v4 | Sulfur oxidation c-type cytochrome SoxA | 0.9192 | 28 | 161 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2N6CQD7-F1-model_v4 | L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) | 0.9068 | 28 | 201 |
GO:0009055
GO:0016669 GO:0016740 GO:0019417 GO:0020037 GO:0042597 GO:0046872 GO:0070069 |
| AF-A0A218KLW5-F1-model_v4 | SoxA cytochrome complex subunit A | 0.8945 | 59 | 176 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A218KLW5-F1-model_v4 | SoxA cytochrome complex subunit A | 0.8737 | 59 | 176 |
GO:0009055
GO:0020037 GO:0046872 |