F487669
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 992 | 373 | 1984 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0010962|Ga0496105_0010962_522_1787 |
| Length | 421 |
| Sequence | LLPAALADPHNQPAPESPARPLISPVTSPRHLPNRAAFPYPPAMPAPAIQSLADLGDATRAPRIVIKVGSALLVDATGARRAWLAALVAELAQARARGQQVIVVSSGAIALGARKLGLEKGGRASLADAQAAAAVGQIALSGLWAELLEAHGLTAAQLLLTLDDLEDRRRYLNATATLTRLLDAGAVPVINENDSVATQEIRFGDNDRLAARIAQAARASAVVLLSDIDGLYDRHPSDPGAKRLPLVKAITPEIRAMASPVSGSGMGSGGMISKLQAAEIAQLAGIALAIGNGHVEAPLARIAAGEGTLFPARQRTAARKAWLGGRLRLKGELVVDQGAAVALANGSSLLARGITASSGQFHRGDAVAIRNQAGETLAHGLAEYDAAECALLIGRHSSEHADLLGYAPRPAIVHRDQLVLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 109 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 161 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 176 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 188 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 191 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 197 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 198 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 199 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 201 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 202 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 203 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 204 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 205 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 263 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 264 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 265 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 266 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 267 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 268 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 269 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 270 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 271 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 272 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 273 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 274 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 285 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 286 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 287 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 288 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 290 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 292 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 293 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 303 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 306 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 307 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 308 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 309 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 311 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 312 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 313 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 315 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 317 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 318 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 320 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 321 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 322 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 323 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 325 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 326 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 329 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 330 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 331 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 332 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 333 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 335 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 336 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 337 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 338 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 339 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 340 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 341 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 342 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 343 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 344 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 345 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 346 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 347 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 348 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 349 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 350 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 351 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 352 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 353 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 354 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 355 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 356 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 357 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 358 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 359 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 360 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 361 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 362 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 363 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 364 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 365 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 366 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 367 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 368 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 369 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 370 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 371 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 372 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 373 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.07 |
| Metatranscriptomes | 0 |
| Isolates | 3.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 11.49 |
| Nodule | 0.2 |
| Rhizoplane | 4.94 |
| Rhizosphere | 72.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496105_0010962 | 3300048908 | Bacteria | 7142 |
| 2 | SwRhRL2b_contig_2235436 | 2162886007 | Bacteria | 72815 |
| 3 | JGI24736J21556_1000256 | 3300001904 | Bacteria | 9743 |
| 4 | JGI24741J21665_1001032 | 3300001915 | Bacteria | 8381 |
| 5 | JGI24741J21665_1001215 | 3300001915 | Bacteria | 7580 |
| 6 | JGI24752J21851_1000062 | 3300001976 | Bacteria | 13721 |
| 7 | JGI24752J21851_1001369 | 3300001976 | Bacteria | 3295 |
| 8 | JGI24752J21851_1007004 | 3300001976 | Bacteria | 1473 |
| 9 | JGI24740J21852_10000540 | 3300001979 | Bacteria | 16192 |
| 10 | JGI24740J21852_10005886 | 3300001979 | Bacteria | 5139 |
| 11 | JGI24740J21852_10011274 | 3300001979 | Bacteria | 3408 |
| 12 | JGI24739J22299_10001027 | 3300001989 | Bacteria | 10334 |
| 13 | JGI24739J22299_10003942 | 3300001989 | Bacteria | 5678 |
| 14 | JGI24739J22299_10004578 | 3300001989 | Bacteria | 5287 |
| 15 | JGI24737J22298_10002455 | 3300001990 | Bacteria | 6602 |
| 16 | JGI24737J22298_10004191 | 3300001990 | Bacteria | 5041 |
| 17 | JGI24735J21928_10000861 | 3300002067 | Bacteria | 10803 |
| 18 | JGI24735J21928_10003084 | 3300002067 | Bacteria | 5704 |
| 19 | JGI24750J21931_1000036 | 3300002070 | Bacteria | 18006 |
| 20 | JGI24748J21848_1000103 | 3300002074 | Bacteria | 18872 |
| 21 | JGI24738J21930_10001565 | 3300002075 | Bacteria | 6314 |
| 22 | JGI24749J21850_1000087 | 3300002076 | Bacteria | 16750 |
| 23 | JGI24034J26672_10000057 | 3300002239 | Bacteria | 42515 |
| 24 | JGI24742J22300_10004425 | 3300002244 | Bacteria | 2300 |
| 25 | JGI24751J29686_10000054 | 3300002459 | Bacteria | 65209 |
| 26 | JGI24751J29686_10000140 | 3300002459 | Bacteria | 35958 |
| 27 | JGI25165J46597_1000012 | 3300003214 | Bacteria | 421074 |
| 28 | JGI25153J46596_10000005 | 3300003215 | Bacteria | 492839 |
| 29 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 30 | Ga0055542_1000355 | 3300003762 | Bacteria | 48043 |
| 31 | Ga0055529_1000045 | 3300003763 | Bacteria | 209617 |
| 32 | Ga0065165_1004400 | 3300005262 | Bacteria | 8781 |
| 33 | Ga0065704_10001493 | 3300005289 | Bacteria | 12929 |
| 34 | Ga0065704_10007473 | 3300005289 | Bacteria | 6245 |
| 35 | Ga0065704_10070176 | 3300005289 | Bacteria | 138803 |
| 36 | Ga0065704_10105609 | 3300005289 | Bacteria | 2101 |
| 37 | Ga0065707_10083253 | 3300005295 | Bacteria | 9789 |
| 38 | Ga0070658_10000067 | 3300005327 | Bacteria | 103026 |
| 39 | Ga0070658_10001571 | 3300005327 | Bacteria | 19350 |
| 40 | Ga0070658_10032881 | 3300005327 | Bacteria | 4171 |
| 41 | Ga0070658_10032902 | 3300005327 | Bacteria | 4169 |
| 42 | Ga0070658_10105365 | 3300005327 | Bacteria | 2333 |
| 43 | Ga0070683_100170222 | 3300005329 | Bacteria | 2068 |
| 44 | Ga0070683_100172906 | 3300005329 | Bacteria | 2051 |
| 45 | Ga0070690_100000011 | 3300005330 | Bacteria | 95472 |
| 46 | Ga0070690_100046244 | 3300005330 | Bacteria | 2767 |
| 47 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 48 | Ga0070670_100000210 | 3300005331 | Bacteria | 54177 |
| 49 | Ga0070670_100000965 | 3300005331 | Bacteria | 22582 |
| 50 | Ga0070670_100009509 | 3300005331 | Bacteria | 8297 |
| 51 | Ga0070670_100018785 | 3300005331 | Bacteria | 5926 |
| 52 | Ga0070670_100190597 | 3300005331 | Bacteria | 1781 |
| 53 | Ga0070670_100240614 | 3300005331 | Bacteria | 1576 |
| 54 | Ga0070666_10000035 | 3300005335 | Bacteria | 121458 |
| 55 | Ga0070666_10000089 | 3300005335 | Bacteria | 64147 |
| 56 | Ga0070666_10013840 | 3300005335 | Bacteria | 5127 |
| 57 | Ga0070666_10036618 | 3300005335 | Bacteria | 3259 |
| 58 | Ga0070666_10158615 | 3300005335 | Bacteria | 1581 |
| 59 | Ga0070666_10198050 | 3300005335 | Bacteria | 1413 |
| 60 | Ga0070680_100011845 | 3300005336 | Bacteria | 6763 |
| 61 | Ga0070660_100075680 | 3300005339 | Bacteria | 2636 |
| 62 | Ga0070660_100148168 | 3300005339 | Bacteria | 1886 |
| 63 | Ga0070689_100002742 | 3300005340 | Bacteria | 11551 |
| 64 | Ga0070661_100011173 | 3300005344 | Bacteria | 6255 |
| 65 | Ga0070668_100000003 | 3300005347 | Bacteria | 195738 |
| 66 | Ga0070668_100000014 | 3300005347 | Bacteria | 112374 |
| 67 | Ga0070668_100003251 | 3300005347 | Bacteria | 11982 |
| 68 | Ga0070668_100007280 | 3300005347 | Bacteria | 8209 |
| 69 | Ga0070668_100042436 | 3300005347 | Bacteria | 3487 |
| 70 | Ga0070669_100000020 | 3300005353 | Bacteria | 181297 |
| 71 | Ga0070669_100000024 | 3300005353 | Bacteria | 173107 |
| 72 | Ga0070669_100000334 | 3300005353 | Bacteria | 36683 |
| 73 | Ga0070669_100000473 | 3300005353 | Bacteria | 30554 |
| 74 | Ga0070669_100000712 | 3300005353 | Bacteria | 24397 |
| 75 | Ga0070669_100002131 | 3300005353 | Bacteria | 14306 |
| 76 | Ga0070669_100003995 | 3300005353 | Bacteria | 10660 |
| 77 | Ga0070669_100024149 | 3300005353 | Bacteria | 4357 |
| 78 | Ga0070669_100034312 | 3300005353 | Bacteria | 3673 |
| 79 | Ga0070669_100050393 | 3300005353 | Bacteria | 3041 |
| 80 | Ga0070669_100157764 | 3300005353 | Bacteria | 1761 |
| 81 | Ga0070671_100000006 | 3300005355 | Bacteria | 250635 |
| 82 | Ga0070671_100000138 | 3300005355 | Bacteria | 46941 |
| 83 | Ga0070671_100000435 | 3300005355 | Bacteria | 28993 |
| 84 | Ga0070671_100000542 | 3300005355 | Bacteria | 26647 |
| 85 | Ga0070671_100002625 | 3300005355 | Bacteria | 13916 |
| 86 | Ga0070671_100039115 | 3300005355 | Bacteria | 3937 |
| 87 | Ga0070671_100210640 | 3300005355 | Bacteria | 1648 |
| 88 | Ga0070674_100011307 | 3300005356 | Bacteria | 5430 |
| 89 | Ga0070688_100001328 | 3300005365 | Bacteria | 12256 |
| 90 | Ga0070659_100008121 | 3300005366 | Bacteria | 7656 |
| 91 | Ga0070659_100070457 | 3300005366 | Bacteria | 2777 |
| 92 | Ga0070659_100216272 | 3300005366 | Bacteria | 1581 |
| 93 | Ga0070667_100000051 | 3300005367 | Bacteria | 155117 |
| 94 | Ga0070667_100000128 | 3300005367 | Bacteria | 95780 |
| 95 | Ga0070667_100000298 | 3300005367 | Bacteria | 55786 |
| 96 | Ga0070667_100000851 | 3300005367 | Bacteria | 28385 |
| 97 | Ga0070667_100001003 | 3300005367 | Bacteria | 25848 |
| 98 | Ga0070667_100002068 | 3300005367 | Bacteria | 17765 |
| 99 | Ga0070667_100004204 | 3300005367 | Bacteria | 12158 |
| 100 | Ga0070667_100011284 | 3300005367 | Bacteria | 7391 |
| 101 | Ga0070667_100014546 | 3300005367 | Bacteria | 6503 |
| 102 | Ga0070667_100040604 | 3300005367 | Bacteria | 3902 |
| 103 | Ga0070667_100049569 | 3300005367 | Bacteria | 3537 |
| 104 | Ga0070667_100104253 | 3300005367 | Bacteria | 2453 |
| 105 | Ga0070705_100004759 | 3300005440 | Bacteria | 6608 |
| 106 | Ga0070705_100099149 | 3300005440 | Bacteria | 1835 |
| 107 | Ga0070708_100094332 | 3300005445 | Bacteria | 2730 |
| 108 | Ga0070663_100017417 | 3300005455 | Bacteria | 4689 |
| 109 | Ga0070663_100100915 | 3300005455 | Bacteria | 2153 |
| 110 | Ga0070663_100129135 | 3300005455 | Bacteria | 1917 |
| 111 | Ga0070678_100012555 | 3300005456 | Bacteria | 5274 |
| 112 | Ga0070662_100012698 | 3300005457 | Bacteria | 5590 |
| 113 | Ga0070681_10005668 | 3300005458 | Bacteria | 12071 |
| 114 | Ga0068867_100007513 | 3300005459 | Bacteria | 7706 |
| 115 | Ga0068867_100235491 | 3300005459 | Bacteria | 1482 |
| 116 | Ga0070685_10000168 | 3300005466 | Bacteria | 43369 |
| 117 | Ga0070679_100008282 | 3300005530 | Bacteria | 9782 |
| 118 | Ga0068853_100004036 | 3300005539 | Bacteria | 11295 |
| 119 | Ga0068853_100009085 | 3300005539 | Bacteria | 8003 |
| 120 | Ga0068853_100019326 | 3300005539 | Bacteria | 5648 |
| 121 | Ga0068853_100025577 | 3300005539 | Bacteria | 4954 |
| 122 | Ga0068853_100174305 | 3300005539 | Bacteria | 1947 |
| 123 | Ga0070672_100315773 | 3300005543 | Bacteria | 1327 |
| 124 | Ga0070686_100001324 | 3300005544 | Bacteria | 14003 |
| 125 | Ga0070686_100017427 | 3300005544 | Bacteria | 4197 |
| 126 | Ga0070665_100000161 | 3300005548 | Bacteria | 122088 |
| 127 | Ga0070665_100000206 | 3300005548 | Bacteria | 102989 |
| 128 | Ga0070665_100001356 | 3300005548 | Bacteria | 28943 |
| 129 | Ga0070665_100010985 | 3300005548 | Bacteria | 9156 |
| 130 | Ga0070665_100012580 | 3300005548 | Bacteria | 8522 |
| 131 | Ga0070665_100088252 | 3300005548 | Bacteria | 3107 |
| 132 | Ga0070665_100137757 | 3300005548 | Bacteria | 2444 |
| 133 | Ga0070665_100287580 | 3300005548 | Bacteria | 1646 |
| 134 | Ga0068855_100000962 | 3300005563 | Bacteria | 35800 |
| 135 | Ga0068855_100014816 | 3300005563 | Bacteria | 9389 |
| 136 | Ga0068855_100015135 | 3300005563 | Bacteria | 9288 |
| 137 | Ga0068855_100040224 | 3300005563 | Bacteria | 5549 |
| 138 | Ga0068855_100060879 | 3300005563 | Bacteria | 4412 |
| 139 | Ga0070664_100013946 | 3300005564 | Bacteria | 6552 |
| 140 | Ga0070664_100020427 | 3300005564 | Bacteria | 5453 |
| 141 | Ga0070664_100102464 | 3300005564 | Bacteria | 2490 |
| 142 | Ga0068857_100009607 | 3300005577 | Bacteria | 8404 |
| 143 | Ga0068857_100018029 | 3300005577 | Bacteria | 6193 |
| 144 | Ga0068857_100065228 | 3300005577 | Bacteria | 3237 |
| 145 | Ga0068857_100069212 | 3300005577 | Bacteria | 3143 |
| 146 | Ga0068857_100084922 | 3300005577 | Bacteria | 2829 |
| 147 | Ga0068857_100194718 | 3300005577 | Bacteria | 1847 |
| 148 | Ga0068857_100245112 | 3300005577 | Bacteria | 1641 |
| 149 | Ga0068854_100003154 | 3300005578 | Bacteria | 10274 |
| 150 | Ga0068854_100010741 | 3300005578 | Bacteria | 5941 |
| 151 | Ga0068854_100012195 | 3300005578 | Bacteria | 5624 |
| 152 | Ga0068854_100019472 | 3300005578 | Bacteria | 4574 |
| 153 | Ga0068854_100305493 | 3300005578 | Bacteria | 1288 |
| 154 | Ga0068856_100004323 | 3300005614 | Bacteria | 14177 |
| 155 | Ga0068856_100011400 | 3300005614 | Bacteria | 8622 |
| 156 | Ga0068856_100142927 | 3300005614 | Bacteria | 2400 |
| 157 | Ga0068856_100332962 | 3300005614 | Bacteria | 1536 |
| 158 | Ga0068856_100494178 | 3300005614 | Bacteria | 1244 |
| 159 | Ga0070702_100028407 | 3300005615 | Bacteria | 3031 |
| 160 | Ga0068852_100000075 | 3300005616 | Bacteria | 69379 |
| 161 | Ga0068852_100108194 | 3300005616 | Bacteria | 2523 |
| 162 | Ga0068852_100183379 | 3300005616 | Bacteria | 1970 |
| 163 | Ga0068859_100000256 | 3300005617 | Bacteria | 52870 |
| 164 | Ga0068859_100001299 | 3300005617 | Bacteria | 25520 |
| 165 | Ga0068859_100006610 | 3300005617 | Bacteria | 11774 |
| 166 | Ga0068859_100025168 | 3300005617 | Bacteria | 5973 |
| 167 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 168 | Ga0068864_100000332 | 3300005618 | Bacteria | 41671 |
| 169 | Ga0068864_100000642 | 3300005618 | Bacteria | 29378 |
| 170 | Ga0068864_100001753 | 3300005618 | Bacteria | 17839 |
| 171 | Ga0068864_100025454 | 3300005618 | Bacteria | 4983 |
| 172 | Ga0068864_100053335 | 3300005618 | Bacteria | 3488 |
| 173 | Ga0068864_100118219 | 3300005618 | Bacteria | 2367 |
| 174 | Ga0068861_100001329 | 3300005719 | Bacteria | 15509 |
| 175 | Ga0068861_100015879 | 3300005719 | Bacteria | 5317 |
| 176 | Ga0068861_100088296 | 3300005719 | Bacteria | 2441 |
| 177 | Ga0068851_10011445 | 3300005834 | Bacteria | 4161 |
| 178 | Ga0068851_10042184 | 3300005834 | Bacteria | 2296 |
| 179 | Ga0068863_100000016 | 3300005841 | Bacteria | 213575 |
| 180 | Ga0068863_100000028 | 3300005841 | Bacteria | 181662 |
| 181 | Ga0068863_100000060 | 3300005841 | Bacteria | 122123 |
| 182 | Ga0068863_100000456 | 3300005841 | Bacteria | 41671 |
| 183 | Ga0068863_100000719 | 3300005841 | Bacteria | 33262 |
| 184 | Ga0068863_100005237 | 3300005841 | Bacteria | 12796 |
| 185 | Ga0068863_100010358 | 3300005841 | Bacteria | 9058 |
| 186 | Ga0068863_100017269 | 3300005841 | Bacteria | 6922 |
| 187 | Ga0068863_100028865 | 3300005841 | Bacteria | 5298 |
| 188 | Ga0068863_100415980 | 3300005841 | Bacteria | 1316 |
| 189 | Ga0068858_100000304 | 3300005842 | Bacteria | 52470 |
| 190 | Ga0068858_100000472 | 3300005842 | Bacteria | 41922 |
| 191 | Ga0068858_100002895 | 3300005842 | Bacteria | 17259 |
| 192 | Ga0068858_100004091 | 3300005842 | Bacteria | 14368 |
| 193 | Ga0068858_100016712 | 3300005842 | Bacteria | 6891 |
| 194 | Ga0068858_100022636 | 3300005842 | Bacteria | 5860 |
| 195 | Ga0068858_100104346 | 3300005842 | Bacteria | 2644 |
| 196 | Ga0068860_100000126 | 3300005843 | Bacteria | 122923 |
| 197 | Ga0068860_100000143 | 3300005843 | Bacteria | 116787 |
| 198 | Ga0068860_100000168 | 3300005843 | Bacteria | 107408 |
| 199 | Ga0068860_100000412 | 3300005843 | Bacteria | 55786 |
| 200 | Ga0068860_100001698 | 3300005843 | Bacteria | 23527 |
| 201 | Ga0068860_100006149 | 3300005843 | Bacteria | 12074 |
| 202 | Ga0068860_100007410 | 3300005843 | Bacteria | 10976 |
| 203 | Ga0068860_100017637 | 3300005843 | Bacteria | 6956 |
| 204 | Ga0068860_100174989 | 3300005843 | Bacteria | 2074 |
| 205 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 206 | Ga0068862_100000085 | 3300005844 | Bacteria | 110879 |
| 207 | Ga0068862_100000168 | 3300005844 | Bacteria | 72749 |
| 208 | Ga0068862_100000310 | 3300005844 | Bacteria | 53315 |
| 209 | Ga0068862_100000506 | 3300005844 | Bacteria | 41538 |
| 210 | Ga0068862_100001574 | 3300005844 | Bacteria | 20794 |
| 211 | Ga0068862_100010705 | 3300005844 | Bacteria | 7573 |
| 212 | Ga0068862_100010728 | 3300005844 | Bacteria | 7566 |
| 213 | Ga0068862_100040836 | 3300005844 | Bacteria | 3945 |
| 214 | Ga0068862_100089890 | 3300005844 | Bacteria | 2673 |
| 215 | Ga0081455_10000131 | 3300005937 | Bacteria | 87553 |
| 216 | Ga0075368_10001483 | 3300006042 | Bacteria | 7519 |
| 217 | Ga0075368_10041808 | 3300006042 | Bacteria | 1801 |
| 218 | Ga0075363_100003377 | 3300006048 | Bacteria | 6781 |
| 219 | Ga0075363_100003814 | 3300006048 | Bacteria | 6495 |
| 220 | Ga0075364_10016692 | 3300006051 | Bacteria | 4572 |
| 221 | Ga0075432_10004187 | 3300006058 | Bacteria | 4911 |
| 222 | Ga0075362_10000234 | 3300006177 | Bacteria | 15472 |
| 223 | Ga0075362_10000526 | 3300006177 | Bacteria | 11123 |
| 224 | Ga0075367_10000092 | 3300006178 | Bacteria | 24598 |
| 225 | Ga0075366_10000168 | 3300006195 | Bacteria | 28069 |
| 226 | Ga0075366_10006887 | 3300006195 | Bacteria | 6254 |
| 227 | Ga0075366_10021504 | 3300006195 | Bacteria | 3750 |
| 228 | Ga0097621_100136045 | 3300006237 | Bacteria | 2096 |
| 229 | Ga0075370_10000032 | 3300006353 | Bacteria | 44839 |
| 230 | Ga0075370_10045379 | 3300006353 | Bacteria | 2486 |
| 231 | Ga0075429_100039568 | 3300006880 | Bacteria | 4103 |
| 232 | Ga0075429_100102528 | 3300006880 | Bacteria | 2498 |
| 233 | Ga0097620_100000256 | 3300006931 | Bacteria | 52870 |
| 234 | Ga0097620_100001299 | 3300006931 | Bacteria | 25520 |
| 235 | Ga0097620_100006610 | 3300006931 | Bacteria | 11774 |
| 236 | Ga0097620_100025168 | 3300006931 | Bacteria | 5973 |
| 237 | Ga0079104_1008150 | 3300006946 | Bacteria | 3705 |
| 238 | Ga0105251_10001625 | 3300009011 | Bacteria | 19048 |
| 239 | Ga0105251_10001861 | 3300009011 | Bacteria | 17335 |
| 240 | Ga0105251_10010467 | 3300009011 | Bacteria | 5379 |
| 241 | Ga0105251_10061191 | 3300009011 | Bacteria | 1771 |
| 242 | Ga0105251_10069374 | 3300009011 | Bacteria | 1643 |
| 243 | Ga0105240_10001848 | 3300009093 | Bacteria | 35437 |
| 244 | Ga0105240_10010488 | 3300009093 | Bacteria | 13024 |
| 245 | Ga0105240_10035481 | 3300009093 | Bacteria | 6426 |
| 246 | Ga0105240_10070426 | 3300009093 | Bacteria | 4326 |
| 247 | Ga0105240_10078303 | 3300009093 | Bacteria | 4071 |
| 248 | Ga0105245_10001108 | 3300009098 | Bacteria | 24360 |
| 249 | Ga0105247_10000644 | 3300009101 | Bacteria | 27956 |
| 250 | Ga0105247_10037912 | 3300009101 | Bacteria | 2941 |
| 251 | Ga0114129_10021496 | 3300009147 | Bacteria | 9159 |
| 252 | Ga0105243_10000423 | 3300009148 | Bacteria | 44393 |
| 253 | Ga0105243_10075604 | 3300009148 | Bacteria | 2734 |
| 254 | Ga0105243_10261150 | 3300009148 | Bacteria | 1550 |
| 255 | Ga0105241_10000997 | 3300009174 | Bacteria | 21452 |
| 256 | Ga0105241_10166400 | 3300009174 | Bacteria | 1817 |
| 257 | Ga0105248_10000029 | 3300009177 | Bacteria | 223366 |
| 258 | Ga0105248_10000086 | 3300009177 | Bacteria | 106349 |
| 259 | Ga0105248_10013528 | 3300009177 | Bacteria | 8982 |
| 260 | Ga0105248_10024262 | 3300009177 | Bacteria | 6743 |
| 261 | Ga0105248_10031271 | 3300009177 | Bacteria | 5949 |
| 262 | Ga0105248_10120069 | 3300009177 | Bacteria | 2965 |
| 263 | Ga0105248_10175942 | 3300009177 | Bacteria | 2412 |
| 264 | Ga0105237_10002073 | 3300009545 | Bacteria | 25405 |
| 265 | Ga0105237_10007129 | 3300009545 | Bacteria | 12280 |
| 266 | Ga0105237_10009460 | 3300009545 | Bacteria | 10438 |
| 267 | Ga0105237_10140837 | 3300009545 | Bacteria | 2406 |
| 268 | Ga0105238_10017115 | 3300009551 | Bacteria | 7359 |
| 269 | Ga0105238_10182143 | 3300009551 | Bacteria | 2077 |
| 270 | Ga0105238_10203403 | 3300009551 | Bacteria | 1956 |
| 271 | Ga0105238_10254974 | 3300009551 | Bacteria | 1733 |
| 272 | Ga0105249_10000024 | 3300009553 | Bacteria | 232947 |
| 273 | Ga0105249_10000038 | 3300009553 | Bacteria | 196425 |
| 274 | Ga0105249_10000094 | 3300009553 | Bacteria | 122611 |
| 275 | Ga0105249_10002324 | 3300009553 | Bacteria | 16499 |
| 276 | Ga0105249_10348210 | 3300009553 | Bacteria | 1500 |
| 277 | Ga0105148_100059 | 3300009978 | Bacteria | 17255 |
| 278 | Ga0105239_10027686 | 3300010375 | Bacteria | 6236 |
| 279 | Ga0105239_10067612 | 3300010375 | Bacteria | 3925 |
| 280 | Ga0105239_10618628 | 3300010375 | Bacteria | 1236 |
| 281 | Ga0157326_1000001 | 3300012513 | Bacteria | 19397 |
| 282 | Ga0157373_10003358 | 3300013100 | Bacteria | 12096 |
| 283 | Ga0157371_10000032 | 3300013102 | Bacteria | 230252 |
| 284 | Ga0157371_10003665 | 3300013102 | Bacteria | 13817 |
| 285 | Ga0157371_10140860 | 3300013102 | Bacteria | 1718 |
| 286 | Ga0157370_10013758 | 3300013104 | Bacteria | 8315 |
| 287 | Ga0157370_10051407 | 3300013104 | Bacteria | 3937 |
| 288 | Ga0157370_10053190 | 3300013104 | Bacteria | 3862 |
| 289 | Ga0157370_10330811 | 3300013104 | Bacteria | 1405 |
| 290 | Ga0157369_10115578 | 3300013105 | Bacteria | 2849 |
| 291 | Ga0157369_10289035 | 3300013105 | Bacteria | 1707 |
| 292 | Ga0157378_10187768 | 3300013297 | Bacteria | 1947 |
| 293 | Ga0163162_10003527 | 3300013306 | Bacteria | 14967 |
| 294 | Ga0163162_10012124 | 3300013306 | Bacteria | 8412 |
| 295 | Ga0163162_10015484 | 3300013306 | Bacteria | 7452 |
| 296 | Ga0163162_10044800 | 3300013306 | Bacteria | 4432 |
| 297 | Ga0157372_10035441 | 3300013307 | Bacteria | 5494 |
| 298 | Ga0157372_10242033 | 3300013307 | Bacteria | 2093 |
| 299 | Ga0157372_10328848 | 3300013307 | Bacteria | 1780 |
| 300 | Ga0163163_10008504 | 3300014325 | Bacteria | 9122 |
| 301 | Ga0163163_10172430 | 3300014325 | Bacteria | 2210 |
| 302 | Ga0157380_10000060 | 3300014326 | Bacteria | 62248 |
| 303 | Ga0157380_10000542 | 3300014326 | Bacteria | 23239 |
| 304 | Ga0157380_10148878 | 3300014326 | Bacteria | 2021 |
| 305 | Ga0157379_10004525 | 3300014968 | Bacteria | 11922 |
| 306 | Ga0157379_10042529 | 3300014968 | Bacteria | 4057 |
| 307 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 308 | Ga0163161_10000716 | 3300017792 | Bacteria | 26178 |
| 309 | Ga0163161_10082721 | 3300017792 | Bacteria | 2366 |
| 310 | Ga0213875_10000264 | 3300021388 | Bacteria | 52435 |
| 311 | Ga0209147_104064 | 3300025229 | Bacteria | 2558 |
| 312 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 313 | Ga0209677_104116 | 3300025253 | Bacteria | 4355 |
| 314 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 315 | Ga0209233_1000058 | 3300025261 | Bacteria | 421872 |
| 316 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 317 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 318 | Ga0209050_1000441 | 3300025298 | Bacteria | 75474 |
| 319 | Ga0207697_10000419 | 3300025315 | Bacteria | 24002 |
| 320 | Ga0207697_10012242 | 3300025315 | Bacteria | 3602 |
| 321 | Ga0207697_10015555 | 3300025315 | Bacteria | 3142 |
| 322 | Ga0207656_10000378 | 3300025321 | Bacteria | 14923 |
| 323 | Ga0207656_10005981 | 3300025321 | Bacteria | 4347 |
| 324 | Ga0207713_1002460 | 3300025735 | Bacteria | 13462 |
| 325 | Ga0207713_1016496 | 3300025735 | Bacteria | 3746 |
| 326 | Ga0207710_10006923 | 3300025900 | Bacteria | 4823 |
| 327 | Ga0207710_10035134 | 3300025900 | Bacteria | 2205 |
| 328 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 329 | Ga0207680_10000517 | 3300025903 | Bacteria | 18430 |
| 330 | Ga0207680_10003829 | 3300025903 | Bacteria | 7085 |
| 331 | Ga0207680_10125961 | 3300025903 | Bacteria | 1682 |
| 332 | Ga0207680_10140440 | 3300025903 | Bacteria | 1601 |
| 333 | Ga0207680_10155143 | 3300025903 | Bacteria | 1530 |
| 334 | Ga0207647_10008366 | 3300025904 | Bacteria | 7421 |
| 335 | Ga0207647_10026599 | 3300025904 | Bacteria | 3783 |
| 336 | Ga0207647_10064805 | 3300025904 | Bacteria | 2219 |
| 337 | Ga0207645_10165005 | 3300025907 | Bacteria | 1450 |
| 338 | Ga0207705_10000075 | 3300025909 | Bacteria | 123551 |
| 339 | Ga0207705_10000122 | 3300025909 | Bacteria | 86442 |
| 340 | Ga0207705_10090342 | 3300025909 | Bacteria | 2242 |
| 341 | Ga0207705_10123396 | 3300025909 | Bacteria | 1924 |
| 342 | Ga0207654_10002907 | 3300025911 | Bacteria | 8680 |
| 343 | Ga0207707_10069377 | 3300025912 | Bacteria | 3072 |
| 344 | Ga0207707_10141338 | 3300025912 | Bacteria | 2105 |
| 345 | Ga0207695_10000288 | 3300025913 | Bacteria | 125085 |
| 346 | Ga0207695_10006069 | 3300025913 | Bacteria | 15766 |
| 347 | Ga0207695_10015610 | 3300025913 | Bacteria | 8933 |
| 348 | Ga0207695_10036202 | 3300025913 | Bacteria | 5338 |
| 349 | Ga0207695_10055082 | 3300025913 | Bacteria | 4147 |
| 350 | Ga0207695_10075297 | 3300025913 | Bacteria | 3435 |
| 351 | Ga0207695_10095696 | 3300025913 | Bacteria | 2973 |
| 352 | Ga0207695_10150591 | 3300025913 | Bacteria | 2266 |
| 353 | Ga0207671_10001439 | 3300025914 | Bacteria | 27570 |
| 354 | Ga0207671_10006770 | 3300025914 | Bacteria | 10131 |
| 355 | Ga0207671_10018947 | 3300025914 | Bacteria | 5272 |
| 356 | Ga0207657_10000408 | 3300025919 | Bacteria | 45400 |
| 357 | Ga0207657_10002471 | 3300025919 | Bacteria | 19998 |
| 358 | Ga0207657_10007801 | 3300025919 | Bacteria | 10926 |
| 359 | Ga0207657_10011633 | 3300025919 | Bacteria | 8727 |
| 360 | Ga0207657_10085021 | 3300025919 | Bacteria | 2651 |
| 361 | Ga0207657_10186792 | 3300025919 | Bacteria | 1673 |
| 362 | Ga0207649_10000482 | 3300025920 | Bacteria | 28301 |
| 363 | Ga0207649_10159200 | 3300025920 | Bacteria | 1563 |
| 364 | Ga0207652_10008597 | 3300025921 | Bacteria | 8216 |
| 365 | Ga0207652_10114171 | 3300025921 | Bacteria | 2398 |
| 366 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 367 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 368 | Ga0207681_10000089 | 3300025923 | Bacteria | 79526 |
| 369 | Ga0207681_10000503 | 3300025923 | Bacteria | 27243 |
| 370 | Ga0207681_10000663 | 3300025923 | Bacteria | 22786 |
| 371 | Ga0207681_10001365 | 3300025923 | Bacteria | 15750 |
| 372 | Ga0207681_10004407 | 3300025923 | Bacteria | 8674 |
| 373 | Ga0207681_10018758 | 3300025923 | Bacteria | 4363 |
| 374 | Ga0207681_10041605 | 3300025923 | Bacteria | 3065 |
| 375 | Ga0207681_10140268 | 3300025923 | Bacteria | 1799 |
| 376 | Ga0207694_10005621 | 3300025924 | Bacteria | 9610 |
| 377 | Ga0207694_10009731 | 3300025924 | Bacteria | 7251 |
| 378 | Ga0207694_10018966 | 3300025924 | Bacteria | 5200 |
| 379 | Ga0207694_10061619 | 3300025924 | Bacteria | 2920 |
| 380 | Ga0207694_10175781 | 3300025924 | Bacteria | 1735 |
| 381 | Ga0207694_10182713 | 3300025924 | Bacteria | 1701 |
| 382 | Ga0207694_10237460 | 3300025924 | Bacteria | 1489 |
| 383 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 384 | Ga0207650_10000545 | 3300025925 | Bacteria | 30685 |
| 385 | Ga0207650_10010295 | 3300025925 | Bacteria | 6409 |
| 386 | Ga0207650_10015807 | 3300025925 | Bacteria | 5262 |
| 387 | Ga0207650_10047790 | 3300025925 | Bacteria | 3154 |
| 388 | Ga0207650_10083091 | 3300025925 | Bacteria | 2432 |
| 389 | Ga0207687_10000853 | 3300025927 | Bacteria | 20620 |
| 390 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 391 | Ga0207644_10000009 | 3300025931 | Bacteria | 251643 |
| 392 | Ga0207644_10000447 | 3300025931 | Bacteria | 26636 |
| 393 | Ga0207644_10001520 | 3300025931 | Bacteria | 14966 |
| 394 | Ga0207644_10003216 | 3300025931 | Bacteria | 10526 |
| 395 | Ga0207644_10020323 | 3300025931 | Bacteria | 4515 |
| 396 | Ga0207644_10021357 | 3300025931 | Bacteria | 4409 |
| 397 | Ga0207644_10070832 | 3300025931 | Bacteria | 2549 |
| 398 | Ga0207690_10000696 | 3300025932 | Bacteria | 21652 |
| 399 | Ga0207690_10023275 | 3300025932 | Bacteria | 3865 |
| 400 | Ga0207690_10031743 | 3300025932 | Bacteria | 3383 |
| 401 | Ga0207690_10225677 | 3300025932 | Bacteria | 1436 |
| 402 | Ga0207706_10002919 | 3300025933 | Bacteria | 16521 |
| 403 | Ga0207706_10004237 | 3300025933 | Bacteria | 13507 |
| 404 | Ga0207706_10012315 | 3300025933 | Bacteria | 7791 |
| 405 | Ga0207706_10075750 | 3300025933 | Bacteria | 2959 |
| 406 | Ga0207709_10000574 | 3300025935 | Bacteria | 30979 |
| 407 | Ga0207709_10193909 | 3300025935 | Bacteria | 1445 |
| 408 | Ga0207670_10013004 | 3300025936 | Bacteria | 4894 |
| 409 | Ga0207669_10006239 | 3300025937 | Bacteria | 5431 |
| 410 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 411 | Ga0207711_10000310 | 3300025941 | Bacteria | 52175 |
| 412 | Ga0207711_10002363 | 3300025941 | Bacteria | 16902 |
| 413 | Ga0207711_10019413 | 3300025941 | Bacteria | 5661 |
| 414 | Ga0207711_10024128 | 3300025941 | Bacteria | 5090 |
| 415 | Ga0207711_10048966 | 3300025941 | Bacteria | 3617 |
| 416 | Ga0207661_10256435 | 3300025944 | Bacteria | 1556 |
| 417 | Ga0207679_10100238 | 3300025945 | Bacteria | 2263 |
| 418 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 419 | Ga0207667_10004952 | 3300025949 | Bacteria | 16269 |
| 420 | Ga0207667_10008229 | 3300025949 | Bacteria | 12408 |
| 421 | Ga0207667_10013795 | 3300025949 | Bacteria | 9232 |
| 422 | Ga0207667_10118401 | 3300025949 | Bacteria | 2729 |
| 423 | Ga0207667_10301320 | 3300025949 | Bacteria | 1638 |
| 424 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 425 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 426 | Ga0207712_10000034 | 3300025961 | Bacteria | 202320 |
| 427 | Ga0207668_10000006 | 3300025972 | Bacteria | 191468 |
| 428 | Ga0207668_10000047 | 3300025972 | Bacteria | 101453 |
| 429 | Ga0207668_10003433 | 3300025972 | Bacteria | 9293 |
| 430 | Ga0207668_10003815 | 3300025972 | Bacteria | 8882 |
| 431 | Ga0207668_10004706 | 3300025972 | Bacteria | 8024 |
| 432 | Ga0207668_10009940 | 3300025972 | Bacteria | 5722 |
| 433 | Ga0207668_10316619 | 3300025972 | Bacteria | 1293 |
| 434 | Ga0207640_10000570 | 3300025981 | Bacteria | 21973 |
| 435 | Ga0207640_10000586 | 3300025981 | Bacteria | 21662 |
| 436 | Ga0207640_10002545 | 3300025981 | Bacteria | 9776 |
| 437 | Ga0207640_10018948 | 3300025981 | Bacteria | 4054 |
| 438 | Ga0207640_10070046 | 3300025981 | Bacteria | 2357 |
| 439 | Ga0207658_10000026 | 3300025986 | Bacteria | 178292 |
| 440 | Ga0207658_10000057 | 3300025986 | Bacteria | 124003 |
| 441 | Ga0207658_10000254 | 3300025986 | Bacteria | 55800 |
| 442 | Ga0207658_10000434 | 3300025986 | Bacteria | 39528 |
| 443 | Ga0207658_10001330 | 3300025986 | Bacteria | 19356 |
| 444 | Ga0207658_10002894 | 3300025986 | Bacteria | 12306 |
| 445 | Ga0207658_10002944 | 3300025986 | Bacteria | 12197 |
| 446 | Ga0207658_10003250 | 3300025986 | Bacteria | 11554 |
| 447 | Ga0207658_10007629 | 3300025986 | Bacteria | 7368 |
| 448 | Ga0207658_10025127 | 3300025986 | Bacteria | 4169 |
| 449 | Ga0207658_10031477 | 3300025986 | Bacteria | 3767 |
| 450 | Ga0207658_10110014 | 3300025986 | Bacteria | 2176 |
| 451 | Ga0207703_10000435 | 3300026035 | Bacteria | 43900 |
| 452 | Ga0207703_10000568 | 3300026035 | Bacteria | 37997 |
| 453 | Ga0207703_10001463 | 3300026035 | Bacteria | 21547 |
| 454 | Ga0207703_10001946 | 3300026035 | Bacteria | 18263 |
| 455 | Ga0207703_10001956 | 3300026035 | Bacteria | 18195 |
| 456 | Ga0207703_10012521 | 3300026035 | Bacteria | 6612 |
| 457 | Ga0207703_10070059 | 3300026035 | Bacteria | 2894 |
| 458 | Ga0207703_10109986 | 3300026035 | Bacteria | 2350 |
| 459 | Ga0207703_10126510 | 3300026035 | Bacteria | 2201 |
| 460 | Ga0207639_10000777 | 3300026041 | Bacteria | 21710 |
| 461 | Ga0207639_10003342 | 3300026041 | Bacteria | 10792 |
| 462 | Ga0207639_10018070 | 3300026041 | Bacteria | 5005 |
| 463 | Ga0207639_10020172 | 3300026041 | Bacteria | 4768 |
| 464 | Ga0207639_10045628 | 3300026041 | Bacteria | 3302 |
| 465 | Ga0207639_10074344 | 3300026041 | Bacteria | 2668 |
| 466 | Ga0207639_10224291 | 3300026041 | Bacteria | 1625 |
| 467 | Ga0207678_10000324 | 3300026067 | Bacteria | 42936 |
| 468 | Ga0207678_10005545 | 3300026067 | Bacteria | 11277 |
| 469 | Ga0207678_10013334 | 3300026067 | Bacteria | 7212 |
| 470 | Ga0207678_10041873 | 3300026067 | Bacteria | 3970 |
| 471 | Ga0207702_10005910 | 3300026078 | Bacteria | 10640 |
| 472 | Ga0207702_10006661 | 3300026078 | Bacteria | 9934 |
| 473 | Ga0207702_10037147 | 3300026078 | Bacteria | 4076 |
| 474 | Ga0207702_10113339 | 3300026078 | Bacteria | 2414 |
| 475 | Ga0207702_10113370 | 3300026078 | Bacteria | 2414 |
| 476 | Ga0207702_10255571 | 3300026078 | Bacteria | 1647 |
| 477 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 478 | Ga0207641_10000014 | 3300026088 | Bacteria | 336170 |
| 479 | Ga0207641_10000100 | 3300026088 | Bacteria | 122664 |
| 480 | Ga0207641_10000315 | 3300026088 | Bacteria | 60017 |
| 481 | Ga0207641_10000346 | 3300026088 | Bacteria | 55535 |
| 482 | Ga0207641_10002472 | 3300026088 | Bacteria | 17065 |
| 483 | Ga0207641_10002944 | 3300026088 | Bacteria | 15396 |
| 484 | Ga0207641_10017728 | 3300026088 | Bacteria | 5832 |
| 485 | Ga0207641_10022838 | 3300026088 | Bacteria | 5151 |
| 486 | Ga0207641_10025121 | 3300026088 | Bacteria | 4911 |
| 487 | Ga0207641_10025885 | 3300026088 | Bacteria | 4839 |
| 488 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 489 | Ga0207676_10000036 | 3300026095 | Bacteria | 198447 |
| 490 | Ga0207676_10000603 | 3300026095 | Bacteria | 29490 |
| 491 | Ga0207676_10002760 | 3300026095 | Bacteria | 12487 |
| 492 | Ga0207676_10003853 | 3300026095 | Bacteria | 10592 |
| 493 | Ga0207676_10004588 | 3300026095 | Bacteria | 9784 |
| 494 | Ga0207676_10011106 | 3300026095 | Bacteria | 6428 |
| 495 | Ga0207676_10028724 | 3300026095 | Bacteria | 4158 |
| 496 | Ga0207674_10003143 | 3300026116 | Bacteria | 20360 |
| 497 | Ga0207674_10004472 | 3300026116 | Bacteria | 16807 |
| 498 | Ga0207674_10009082 | 3300026116 | Bacteria | 11411 |
| 499 | Ga0207674_10012390 | 3300026116 | Bacteria | 9533 |
| 500 | Ga0207674_10014452 | 3300026116 | Bacteria | 8719 |
| 501 | Ga0207674_10085003 | 3300026116 | Bacteria | 3161 |
| 502 | Ga0207674_10100585 | 3300026116 | Bacteria | 2873 |
| 503 | Ga0207674_10161876 | 3300026116 | Bacteria | 2192 |
| 504 | Ga0207674_10330920 | 3300026116 | Bacteria | 1473 |
| 505 | Ga0207675_100000740 | 3300026118 | Bacteria | 32427 |
| 506 | Ga0207675_100003757 | 3300026118 | Bacteria | 14793 |
| 507 | Ga0207675_100020136 | 3300026118 | Bacteria | 6222 |
| 508 | Ga0207683_10022042 | 3300026121 | Bacteria | 5465 |
| 509 | Ga0207698_10000005 | 3300026142 | Bacteria | 295687 |
| 510 | Ga0207698_10027376 | 3300026142 | Bacteria | 4046 |
| 511 | Ga0209281_1010835 | 3300027111 | Bacteria | 2063 |
| 512 | Ga0209983_1009114 | 3300027665 | Bacteria | 2028 |
| 513 | Ga0209813_10000114 | 3300027866 | Bacteria | 29415 |
| 514 | Ga0209813_10000530 | 3300027866 | Bacteria | 9004 |
| 515 | Ga0207428_10036711 | 3300027907 | Bacteria | 3994 |
| 516 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 517 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 518 | Ga0268266_10000534 | 3300028379 | Bacteria | 53027 |
| 519 | Ga0268266_10008419 | 3300028379 | Bacteria | 9172 |
| 520 | Ga0268266_10015509 | 3300028379 | Bacteria | 6536 |
| 521 | Ga0268266_10029365 | 3300028379 | Bacteria | 4675 |
| 522 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 523 | Ga0268265_10000059 | 3300028380 | Bacteria | 152531 |
| 524 | Ga0268265_10000104 | 3300028380 | Bacteria | 105776 |
| 525 | Ga0268265_10000986 | 3300028380 | Bacteria | 25848 |
| 526 | Ga0268265_10001459 | 3300028380 | Bacteria | 19860 |
| 527 | Ga0268265_10002264 | 3300028380 | Bacteria | 14694 |
| 528 | Ga0268265_10002795 | 3300028380 | Bacteria | 12867 |
| 529 | Ga0268265_10013635 | 3300028380 | Bacteria | 5527 |
| 530 | Ga0268265_10070580 | 3300028380 | Bacteria | 2717 |
| 531 | Ga0268265_10107211 | 3300028380 | Bacteria | 2271 |
| 532 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 533 | Ga0268264_10000040 | 3300028381 | Bacteria | 373714 |
| 534 | Ga0268264_10000069 | 3300028381 | Bacteria | 270492 |
| 535 | Ga0268264_10000076 | 3300028381 | Bacteria | 255518 |
| 536 | Ga0268264_10000083 | 3300028381 | Bacteria | 245366 |
| 537 | Ga0268264_10004451 | 3300028381 | Bacteria | 11955 |
| 538 | Ga0268264_10012761 | 3300028381 | Bacteria | 6914 |
| 539 | Ga0268264_10029925 | 3300028381 | Bacteria | 4464 |
| 540 | Ga0268264_10146421 | 3300028381 | Bacteria | 2112 |
| 541 | Ga0265323_10023219 | 3300028653 | Bacteria | 2366 |
| 542 | Ga0307517_10076293 | 3300028786 | Bacteria | 2929 |
| 543 | Ga0265330_10009538 | 3300031235 | Unclassified | 4608 |
| 544 | Ga0265331_10064820 | 3300031250 | Bacteria | 1719 |
| 545 | Ga0265327_10034616 | 3300031251 | Bacteria | 2801 |
| 546 | Ga0265316_10002067 | 3300031344 | Bacteria | 21137 |
| 547 | Ga0307513_10006540 | 3300031456 | Bacteria | 15221 |
| 548 | Ga0307513_10040993 | 3300031456 | Bacteria | 5114 |
| 549 | Ga0307408_100024261 | 3300031548 | Bacteria | 4139 |
| 550 | Ga0307408_100062683 | 3300031548 | Bacteria | 2717 |
| 551 | Ga0307408_100069487 | 3300031548 | Bacteria | 2597 |
| 552 | Ga0307508_10001821 | 3300031616 | Bacteria | 23580 |
| 553 | Ga0265342_10103895 | 3300031712 | Bacteria | 1615 |
| 554 | Ga0307405_10003814 | 3300031731 | Bacteria | 7008 |
| 555 | Ga0307413_10061015 | 3300031824 | Bacteria | 2324 |
| 556 | Ga0307413_10246634 | 3300031824 | Bacteria | 1322 |
| 557 | Ga0307410_10032147 | 3300031852 | Bacteria | 3374 |
| 558 | Ga0307410_10131432 | 3300031852 | Bacteria | 1839 |
| 559 | Ga0307406_10043622 | 3300031901 | Bacteria | 2806 |
| 560 | Ga0307412_10000457 | 3300031911 | Bacteria | 24624 |
| 561 | Ga0307412_10002757 | 3300031911 | Bacteria | 9760 |
| 562 | Ga0307412_10004671 | 3300031911 | Bacteria | 7639 |
| 563 | Ga0307412_10025366 | 3300031911 | Bacteria | 3671 |
| 564 | Ga0307412_10025379 | 3300031911 | Bacteria | 3671 |
| 565 | Ga0307412_10043331 | 3300031911 | Bacteria | 2929 |
| 566 | Ga0307412_10066770 | 3300031911 | Bacteria | 2439 |
| 567 | Ga0307412_10086777 | 3300031911 | Bacteria | 2179 |
| 568 | Ga0307409_100108884 | 3300031995 | Bacteria | 2318 |
| 569 | Ga0307416_100046276 | 3300032002 | Bacteria | 3432 |
| 570 | Ga0307416_100080150 | 3300032002 | Bacteria | 2754 |
| 571 | Ga0307416_100111520 | 3300032002 | Bacteria | 2412 |
| 572 | Ga0307414_10000070 | 3300032004 | Bacteria | 96231 |
| 573 | Ga0307414_10000288 | 3300032004 | Bacteria | 29634 |
| 574 | Ga0307414_10000359 | 3300032004 | Bacteria | 25279 |
| 575 | Ga0307411_10007009 | 3300032005 | Bacteria | 5696 |
| 576 | Ga0307411_10230582 | 3300032005 | Bacteria | 1443 |
| 577 | Ga0307415_100206526 | 3300032126 | Bacteria | 1563 |
| 578 | Ga0316583_10008936 | 3300032133 | Bacteria | 3612 |
| 579 | Ga0307510_10008642 | 3300033180 | Bacteria | 12135 |
| 580 | Ga0373937_0071330 | 3300036401 | Bacteria | 3204 |
| 581 | Ga0316582_0014476 | 3300036647 | Bacteria | 4477 |
| 582 | Ga0316584_0074383 | 3300036712 | Bacteria | 2547 |
| 583 | Ga0316584_0087070 | 3300036712 | Bacteria | 2338 |
| 584 | Ga0395900_0044548 | 3300037418 | Bacteria | 4571 |
| 585 | Ga0395898_0018073 | 3300037466 | Bacteria | 7193 |
| 586 | Ga0436364_1200653 | 3300037853 | Bacteria | 55826 |
| 587 | Ga0395901_0018063 | 3300038443 | Bacteria | 7199 |
| 588 | Ga0439436_0009476 | 3300041404 | Bacteria | 2986 |
| 589 | Ga0439436_0018522 | 3300041404 | Bacteria | 2082 |
| 590 | Ga0439461_0000086 | 3300041410 | Bacteria | 12130 |
| 591 | Ga0439465_0001125 | 3300041413 | Bacteria | 8568 |
| 592 | Ga0439465_0016622 | 3300041413 | Bacteria | 2295 |
| 593 | Ga0451802_1561412 | 3300041460 | Bacteria | 1770 |
| 594 | Ga0439431_0000491 | 3300041997 | Bacteria | 8366 |
| 595 | Ga0439431_0020680 | 3300041997 | Bacteria | 1574 |
| 596 | Ga0439445_0011274 | 3300042004 | Bacteria | 2129 |
| 597 | Ga0439432_005779 | 3300042006 | Bacteria | 4444 |
| 598 | Ga0439452_025280 | 3300042010 | Bacteria | 1509 |
| 599 | Ga0439462_0002734 | 3300042015 | Bacteria | 4143 |
| 600 | Ga0453684_0260886 | 3300044712 | Bacteria | 1985 |
| 601 | Ga0451576_0000588 | 3300045051 | Bacteria | 77026 |
| 602 | Ga0451576_0215241 | 3300045051 | Bacteria | 2006 |
| 603 | Ga0466967_0082472 | 3300045976 | Bacteria | 2906 |
| 604 | Ga0495617_025936 | 3300046452 | Bacteria | 1974 |
| 605 | Ga0495627_000094 | 3300046453 | Bacteria | 108256 |
| 606 | Ga0495627_000391 | 3300046453 | Bacteria | 39764 |
| 607 | Ga0495627_001469 | 3300046453 | Bacteria | 13724 |
| 608 | Ga0495629_0046040 | 3300046459 | Bacteria | 3060 |
| 609 | Ga0495638_0000018 | 3300046460 | Bacteria | 389696 |
| 610 | Ga0495638_0001145 | 3300046460 | Bacteria | 25617 |
| 611 | Ga0495638_0006816 | 3300046460 | Bacteria | 8247 |
| 612 | Ga0495638_0015526 | 3300046460 | Bacteria | 5113 |
| 613 | Ga0495638_0017047 | 3300046460 | Bacteria | 4853 |
| 614 | Ga0495638_0043711 | 3300046460 | Bacteria | 2825 |
| 615 | Ga0495638_0111145 | 3300046460 | Bacteria | 1628 |
| 616 | Ga0495650_0000158 | 3300046471 | Bacteria | 154681 |
| 617 | Ga0495650_0001135 | 3300046471 | Bacteria | 28922 |
| 618 | Ga0495650_0021897 | 3300046471 | Bacteria | 3074 |
| 619 | Ga0495585_0007224 | 3300046492 | Bacteria | 6825 |
| 620 | Ga0495585_0070263 | 3300046492 | Bacteria | 1910 |
| 621 | Ga0495585_0107265 | 3300046492 | Bacteria | 1488 |
| 622 | Ga0495596_0000054 | 3300046500 | Bacteria | 83068 |
| 623 | Ga0495596_0001629 | 3300046500 | Bacteria | 12750 |
| 624 | Ga0495607_0011251 | 3300046501 | Bacteria | 5969 |
| 625 | Ga0495583_0000139 | 3300046506 | Bacteria | 123464 |
| 626 | Ga0495583_0000187 | 3300046506 | Bacteria | 104971 |
| 627 | Ga0495583_0000631 | 3300046506 | Bacteria | 46958 |
| 628 | Ga0495583_0010716 | 3300046506 | Bacteria | 5321 |
| 629 | Ga0495583_0032633 | 3300046506 | Bacteria | 2512 |
| 630 | Ga0495606_0000672 | 3300046507 | Bacteria | 53500 |
| 631 | Ga0495606_0000685 | 3300046507 | Bacteria | 52815 |
| 632 | Ga0495606_0033566 | 3300046507 | Bacteria | 3538 |
| 633 | Ga0495610_0000022 | 3300046512 | Bacteria | 317107 |
| 634 | Ga0495610_0000081 | 3300046512 | Bacteria | 113513 |
| 635 | Ga0495610_0000886 | 3300046512 | Bacteria | 27808 |
| 636 | Ga0495610_0002317 | 3300046512 | Bacteria | 16092 |
| 637 | Ga0495610_0020645 | 3300046512 | Bacteria | 3652 |
| 638 | Ga0495616_0000024 | 3300046513 | Bacteria | 145530 |
| 639 | Ga0495620_0017938 | 3300046515 | Bacteria | 3516 |
| 640 | Ga0495620_0076391 | 3300046515 | Bacteria | 1361 |
| 641 | Ga0495631_0023064 | 3300046518 | Bacteria | 2889 |
| 642 | Ga0495632_0000383 | 3300046519 | Bacteria | 42267 |
| 643 | Ga0495632_0000948 | 3300046519 | Bacteria | 25335 |
| 644 | Ga0495632_0008112 | 3300046519 | Bacteria | 6498 |
| 645 | Ga0495632_0027220 | 3300046519 | Bacteria | 2997 |
| 646 | Ga0495632_0052730 | 3300046519 | Bacteria | 1999 |
| 647 | Ga0495637_0008273 | 3300046520 | Bacteria | 5115 |
| 648 | Ga0495637_0040095 | 3300046520 | Bacteria | 2018 |
| 649 | Ga0495643_0000030 | 3300046522 | Bacteria | 260229 |
| 650 | Ga0495643_0000077 | 3300046522 | Bacteria | 163843 |
| 651 | Ga0495643_0006700 | 3300046522 | Bacteria | 7542 |
| 652 | Ga0495643_0008719 | 3300046522 | Bacteria | 6395 |
| 653 | Ga0495643_0012069 | 3300046522 | Bacteria | 5226 |
| 654 | Ga0495643_0015150 | 3300046522 | Bacteria | 4566 |
| 655 | Ga0495643_0122045 | 3300046522 | Bacteria | 1315 |
| 656 | Ga0495648_0000018 | 3300046524 | Bacteria | 282490 |
| 657 | Ga0495648_0000143 | 3300046524 | Bacteria | 85539 |
| 658 | Ga0495648_0039704 | 3300046524 | Bacteria | 2992 |
| 659 | Ga0495663_0000003 | 3300046525 | Bacteria | 362694 |
| 660 | Ga0495663_0007556 | 3300046525 | Bacteria | 3008 |
| 661 | Ga0495654_0005346 | 3300046530 | Bacteria | 7482 |
| 662 | Ga0495654_0041315 | 3300046530 | Bacteria | 2294 |
| 663 | Ga0495587_0019617 | 3300046536 | Bacteria | 4183 |
| 664 | Ga0495598_0015882 | 3300046537 | Bacteria | 1910 |
| 665 | Ga0495609_0015133 | 3300046538 | Bacteria | 3614 |
| 666 | Ga0495621_0016225 | 3300046539 | Bacteria | 2387 |
| 667 | Ga0495633_0000184 | 3300046558 | Bacteria | 81757 |
| 668 | Ga0495633_0000892 | 3300046558 | Bacteria | 25551 |
| 669 | Ga0495633_0011496 | 3300046558 | Bacteria | 4768 |
| 670 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 671 | Ga0495668_0010303 | 3300046616 | Bacteria | 5666 |
| 672 | Ga0495668_0011827 | 3300046616 | Bacteria | 5202 |
| 673 | Ga0495668_0041896 | 3300046616 | Bacteria | 2549 |
| 674 | Ga0495668_0082368 | 3300046616 | Bacteria | 1765 |
| 675 | Ga0495625_0000150 | 3300046660 | Bacteria | 106314 |
| 676 | Ga0495625_0000153 | 3300046660 | Bacteria | 105123 |
| 677 | Ga0495625_0003185 | 3300046660 | Bacteria | 16701 |
| 678 | Ga0495625_0008151 | 3300046660 | Bacteria | 8975 |
| 679 | Ga0495625_0025768 | 3300046660 | Bacteria | 4453 |
| 680 | Ga0495625_0093400 | 3300046660 | Bacteria | 2077 |
| 681 | Ga0495661_0038909 | 3300046665 | Bacteria | 2958 |
| 682 | Ga0495661_0068431 | 3300046665 | Bacteria | 2083 |
| 683 | Ga0495669_0000050 | 3300046684 | Bacteria | 80688 |
| 684 | Ga0495670_0059556 | 3300046691 | Bacteria | 1917 |
| 685 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 686 | Ga0495671_0000072 | 3300046692 | Bacteria | 97315 |
| 687 | Ga0495671_0005155 | 3300046692 | Bacteria | 7687 |
| 688 | Ga0495600_0000690 | 3300046809 | Bacteria | 17650 |
| 689 | Ga0495683_0000963 | 3300047323 | Bacteria | 20180 |
| 690 | Ga0495687_001845 | 3300047443 | Bacteria | 18538 |
| 691 | Ga0495687_002183 | 3300047443 | Bacteria | 16292 |
| 692 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 693 | Ga0495673_0014606 | 3300047469 | Bacteria | 4079 |
| 694 | Ga0495673_0018818 | 3300047469 | Bacteria | 3474 |
| 695 | Ga0495681_0000010 | 3300047470 | Bacteria | 203548 |
| 696 | Ga0495681_0000342 | 3300047470 | Bacteria | 36568 |
| 697 | Ga0495681_0011835 | 3300047470 | Bacteria | 5164 |
| 698 | Ga0495686_0000182 | 3300047472 | Bacteria | 119682 |
| 699 | Ga0495686_0000363 | 3300047472 | Bacteria | 73366 |
| 700 | Ga0495686_0005716 | 3300047472 | Bacteria | 9717 |
| 701 | Ga0495686_0010474 | 3300047472 | Bacteria | 6591 |
| 702 | Ga0495686_0023442 | 3300047472 | Bacteria | 4070 |
| 703 | Ga0495686_0039832 | 3300047472 | Bacteria | 2999 |
| 704 | Ga0495686_0043044 | 3300047472 | Bacteria | 2866 |
| 705 | Ga0495686_0099114 | 3300047472 | Bacteria | 1759 |
| 706 | Ga0495615_0000150 | 3300048090 | Bacteria | 17571 |
| 707 | Ga0495626_0001895 | 3300048091 | Bacteria | 15617 |
| 708 | Ga0496100_0147390 | 3300048903 | Bacteria | 1675 |
| 709 | Ga0496101_0029318 | 3300048904 | Bacteria | 3849 |
| 710 | Ga0496101_0041543 | 3300048904 | Bacteria | 3279 |
| 711 | Ga0496101_0047847 | 3300048904 | Bacteria | 3071 |
| 712 | Ga0496102_0000199 | 3300048905 | Bacteria | 81435 |
| 713 | Ga0496102_0000243 | 3300048905 | Bacteria | 71427 |
| 714 | Ga0496102_0000570 | 3300048905 | Bacteria | 39156 |
| 715 | Ga0496102_0043153 | 3300048905 | Bacteria | 4088 |
| 716 | Ga0496102_0369014 | 3300048905 | Bacteria | 1351 |
| 717 | Ga0496103_0000201 | 3300048906 | Bacteria | 59837 |
| 718 | Ga0496103_0000479 | 3300048906 | Bacteria | 33569 |
| 719 | Ga0496103_0000633 | 3300048906 | Bacteria | 26944 |
| 720 | Ga0496103_0001160 | 3300048906 | Bacteria | 18172 |
| 721 | Ga0496103_0010198 | 3300048906 | Bacteria | 5556 |
| 722 | Ga0496103_0018844 | 3300048906 | Bacteria | 4143 |
| 723 | Ga0496103_0050435 | 3300048906 | Bacteria | 2575 |
| 724 | Ga0496104_0000078 | 3300048907 | Bacteria | 100203 |
| 725 | Ga0496104_0014211 | 3300048907 | Bacteria | 7185 |
| 726 | Ga0496104_0038825 | 3300048907 | Bacteria | 4457 |
| 727 | Ga0496104_0090818 | 3300048907 | Bacteria | 2919 |
| 728 | Ga0496104_0103178 | 3300048907 | Bacteria | 2732 |
| 729 | Ga0496105_0000241 | 3300048908 | Bacteria | 36833 |
| 730 | Ga0496105_0000690 | 3300048908 | Bacteria | 22731 |
| 731 | Ga0496105_0026430 | 3300048908 | Bacteria | 4733 |
| 732 | Ga0496105_0115218 | 3300048908 | Bacteria | 2217 |
| 733 | Ga0496105_0131538 | 3300048908 | Bacteria | 2063 |
| 734 | Ga0496105_0275811 | 3300048908 | Bacteria | 1357 |
| 735 | Ga0496106_0017827 | 3300048909 | Bacteria | 5251 |
| 736 | Ga0496107_0000794 | 3300048910 | Bacteria | 18300 |
| 737 | Ga0496107_0026839 | 3300048910 | Bacteria | 4087 |
| 738 | Ga0496108_0036958 | 3300048911 | Bacteria | 4065 |
| 739 | Ga0496109_0069384 | 3300048912 | Bacteria | 3232 |
| 740 | Ga0496109_0076132 | 3300048912 | Bacteria | 3086 |
| 741 | Ga0496109_0122522 | 3300048912 | Bacteria | 2423 |
| 742 | Ga0496110_0017737 | 3300048913 | Bacteria | 5956 |
| 743 | Ga0496110_0063880 | 3300048913 | Bacteria | 3253 |
| 744 | Ga0496111_0061819 | 3300048914 | Bacteria | 2715 |
| 745 | Ga0496112_0112199 | 3300048915 | Bacteria | 2696 |
| 746 | Ga0496112_0629436 | 3300048915 | Bacteria | 1003 |
| 747 | Ga0496113_0003620 | 3300048916 | Bacteria | 9287 |
| 748 | Ga0496113_0004827 | 3300048916 | Bacteria | 8339 |
| 749 | Ga0496113_0017588 | 3300048916 | Bacteria | 4966 |
| 750 | Ga0496113_0141577 | 3300048916 | Bacteria | 1893 |
| 751 | Ga0496114_0019776 | 3300048917 | Bacteria | 5459 |
| 752 | Ga0496114_0074792 | 3300048917 | Bacteria | 2852 |
| 753 | Ga0496115_0000131 | 3300048918 | Bacteria | 68111 |
| 754 | Ga0496116_0000017 | 3300048919 | Bacteria | 554463 |
| 755 | Ga0496116_0002567 | 3300048919 | Bacteria | 18955 |
| 756 | Ga0496116_0034167 | 3300048919 | Bacteria | 3593 |
| 757 | Ga0496117_0000179 | 3300048920 | Bacteria | 130966 |
| 758 | Ga0496117_0000352 | 3300048920 | Bacteria | 81089 |
| 759 | Ga0496117_0003444 | 3300048920 | Bacteria | 18406 |
| 760 | Ga0496117_0006507 | 3300048920 | Bacteria | 11782 |
| 761 | Ga0496117_0006558 | 3300048920 | Bacteria | 11712 |
| 762 | Ga0496117_0012763 | 3300048920 | Bacteria | 7371 |
| 763 | Ga0496117_0013579 | 3300048920 | Bacteria | 7095 |
| 764 | Ga0496117_0013905 | 3300048920 | Bacteria | 6976 |
| 765 | Ga0496117_0021332 | 3300048920 | Bacteria | 5244 |
| 766 | Ga0496118_0000030 | 3300048921 | Bacteria | 339946 |
| 767 | Ga0496118_0000092 | 3300048921 | Bacteria | 169106 |
| 768 | Ga0496118_0004591 | 3300048921 | Bacteria | 16240 |
| 769 | Ga0496118_0007285 | 3300048921 | Bacteria | 11778 |
| 770 | Ga0496118_0007538 | 3300048921 | Bacteria | 11492 |
| 771 | Ga0496118_0012741 | 3300048921 | Bacteria | 8034 |
| 772 | Ga0496118_0031432 | 3300048921 | Bacteria | 4401 |
| 773 | Ga0496118_0094030 | 3300048921 | Bacteria | 2051 |
| 774 | Ga0496118_0179622 | 3300048921 | Bacteria | 1280 |
| 775 | Ga0496119_0000114 | 3300048922 | Bacteria | 114495 |
| 776 | Ga0496119_0004697 | 3300048922 | Bacteria | 13438 |
| 777 | Ga0496119_0023936 | 3300048922 | Bacteria | 4313 |
| 778 | Ga0496119_0090783 | 3300048922 | Bacteria | 1736 |
| 779 | Ga0496120_0000266 | 3300048923 | Bacteria | 87412 |
| 780 | Ga0496120_0047341 | 3300048923 | Bacteria | 2480 |
| 781 | Ga0496120_0051004 | 3300048923 | Bacteria | 2366 |
| 782 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 783 | Ga0496121_0000228 | 3300048924 | Bacteria | 120653 |
| 784 | Ga0496121_0000526 | 3300048924 | Bacteria | 72764 |
| 785 | Ga0496121_0000675 | 3300048924 | Bacteria | 63670 |
| 786 | Ga0496121_0001839 | 3300048924 | Bacteria | 34202 |
| 787 | Ga0496121_0001919 | 3300048924 | Bacteria | 33213 |
| 788 | Ga0496121_0003164 | 3300048924 | Bacteria | 23728 |
| 789 | Ga0496121_0009156 | 3300048924 | Bacteria | 11446 |
| 790 | Ga0496121_0012385 | 3300048924 | Bacteria | 9312 |
| 791 | Ga0496121_0023268 | 3300048924 | Bacteria | 5973 |
| 792 | Ga0496121_0045089 | 3300048924 | Bacteria | 3793 |
| 793 | Ga0496121_0081421 | 3300048924 | Bacteria | 2563 |
| 794 | Ga0496121_0086801 | 3300048924 | Bacteria | 2458 |
| 795 | Ga0496122_0000176 | 3300048925 | Bacteria | 152190 |
| 796 | Ga0496122_0013037 | 3300048925 | Bacteria | 8187 |
| 797 | Ga0496122_0016897 | 3300048925 | Bacteria | 6861 |
| 798 | Ga0496122_0041018 | 3300048925 | Bacteria | 3669 |
| 799 | Ga0496122_0082928 | 3300048925 | Bacteria | 2225 |
| 800 | Ga0496122_0096877 | 3300048925 | Bacteria | 1987 |
| 801 | Ga0496123_0000291 | 3300048926 | Bacteria | 97989 |
| 802 | Ga0496123_0001706 | 3300048926 | Bacteria | 29346 |
| 803 | Ga0496123_0001817 | 3300048926 | Bacteria | 28073 |
| 804 | Ga0496123_0010209 | 3300048926 | Bacteria | 8332 |
| 805 | Ga0496123_0011704 | 3300048926 | Bacteria | 7568 |
| 806 | Ga0496123_0016103 | 3300048926 | Bacteria | 6092 |
| 807 | Ga0496123_0023217 | 3300048926 | Bacteria | 4752 |
| 808 | Ga0496123_0040904 | 3300048926 | Bacteria | 3221 |
| 809 | Ga0496123_0050151 | 3300048926 | Bacteria | 2791 |
| 810 | Ga0496123_0079366 | 3300048926 | Bacteria | 2006 |
| 811 | Ga0496124_0000081 | 3300048927 | Bacteria | 208413 |
| 812 | Ga0496124_0000264 | 3300048927 | Bacteria | 101377 |
| 813 | Ga0496124_0000684 | 3300048927 | Bacteria | 55763 |
| 814 | Ga0496124_0001890 | 3300048927 | Bacteria | 28794 |
| 815 | Ga0496124_0002608 | 3300048927 | Bacteria | 23273 |
| 816 | Ga0496124_0003283 | 3300048927 | Bacteria | 19954 |
| 817 | Ga0496124_0035004 | 3300048927 | Bacteria | 4398 |
| 818 | Ga0496124_0066690 | 3300048927 | Bacteria | 2996 |
| 819 | Ga0496124_0138686 | 3300048927 | Bacteria | 1922 |
| 820 | Ga0496124_0149687 | 3300048927 | Bacteria | 1833 |
| 821 | Ga0496125_0000980 | 3300048928 | Bacteria | 44624 |
| 822 | Ga0496125_0009124 | 3300048928 | Bacteria | 10260 |
| 823 | Ga0496125_0022628 | 3300048928 | Bacteria | 5830 |
| 824 | Ga0496125_0037129 | 3300048928 | Bacteria | 4239 |
| 825 | Ga0496125_0053383 | 3300048928 | Bacteria | 3313 |
| 826 | Ga0496125_0088882 | 3300048928 | Bacteria | 2326 |
| 827 | Ga0496125_0095291 | 3300048928 | Bacteria | 2214 |
| 828 | Ga0496125_0129831 | 3300048928 | Bacteria | 1776 |
| 829 | Ga0496126_0000173 | 3300048929 | Bacteria | 146490 |
| 830 | Ga0496126_0000283 | 3300048929 | Bacteria | 107129 |
| 831 | Ga0496126_0001284 | 3300048929 | Bacteria | 40249 |
| 832 | Ga0496126_0095437 | 3300048929 | Bacteria | 2609 |
| 833 | Ga0496126_0140487 | 3300048929 | Bacteria | 2079 |
| 834 | Ga0496126_0142783 | 3300048929 | Bacteria | 2059 |
| 835 | Ga0496126_0148654 | 3300048929 | Bacteria | 2010 |
| 836 | Ga0496126_0166748 | 3300048929 | Bacteria | 1879 |
| 837 | Ga0496126_0274736 | 3300048929 | Bacteria | 1397 |
| 838 | Ga0501292_000247 | 3300049515 | Bacteria | 8012 |
| 839 | Ga0501032_0060590 | 3300049569 | Bacteria | 2538 |
| 840 | Ga0501033_0065135 | 3300049570 | Bacteria | 2681 |
| 841 | Ga0501038_0047716 | 3300049574 | Bacteria | 3709 |
| 842 | Ga0501043_0051084 | 3300049579 | Bacteria | 3249 |
| 843 | Ga0501047_0000447 | 3300049581 | Bacteria | 45607 |
| 844 | Ga0501070_0159647 | 3300049586 | Bacteria | 1859 |
| 845 | Ga0501211_000821 | 3300049658 | Bacteria | 3224 |
| 846 | Ga0501223_000010 | 3300049663 | Bacteria | 106901 |
| 847 | Ga0501223_000112 | 3300049663 | Bacteria | 23415 |
| 848 | Ga0501223_002105 | 3300049663 | Bacteria | 4464 |
| 849 | Ga0501224_000020 | 3300049664 | Bacteria | 74346 |
| 850 | Ga0501224_009536 | 3300049664 | Bacteria | 1421 |
| 851 | Ga0501233_001867 | 3300049668 | Bacteria | 3656 |
| 852 | Ga0501235_001604 | 3300049669 | Bacteria | 4846 |
| 853 | Ga0501235_002575 | 3300049669 | Bacteria | 3902 |
| 854 | Ga0501246_000669 | 3300049676 | Bacteria | 2516 |
| 855 | Ga0501257_000029 | 3300049686 | Bacteria | 42945 |
| 856 | Ga0501261_000214 | 3300049690 | Bacteria | 7972 |
| 857 | Ga0501225_0000008 | 3300049705 | Bacteria | 95521 |
| 858 | Ga0501225_0000135 | 3300049705 | Bacteria | 22383 |
| 859 | Ga0501225_0003339 | 3300049705 | Bacteria | 4887 |
| 860 | Ga0501245_000464 | 3300049708 | Bacteria | 4912 |
| 861 | Ga0501083_0079449 | 3300049744 | Bacteria | 2175 |
| 862 | Ga0501279_000220 | 3300049775 | Bacteria | 7984 |
| 863 | Ga0501280_000649 | 3300049776 | Bacteria | 7803 |
| 864 | Ga0501282_000493 | 3300049778 | Bacteria | 4700 |
| 865 | Ga0501035_0168692 | 3300049822 | Bacteria | 1892 |
| 866 | Ga0501044_0006548 | 3300049823 | Bacteria | 12857 |
| 867 | Ga0501044_0010061 | 3300049823 | Bacteria | 10279 |
| 868 | Ga0501226_000044 | 3300049853 | Bacteria | 56354 |
| 869 | nmdc:mga03683_229_c1 | 3300050489 | Bacteria | 17517 |
| 870 | nmdc:mga03683_463_c1 | 3300050489 | Bacteria | 11717 |
| 871 | nmdc:mga03n38_5700_c1 | 3300050490 | Bacteria | 4265 |
| 872 | nmdc:mga00v17_3081_c2 | 3300050491 | Bacteria | 3920 |
| 873 | nmdc:mga00v17_39430_c1 | 3300050491 | Bacteria | 2829 |
| 874 | nmdc:mga0k408_110078_c1 | 3300050493 | Bacteria | 1628 |
| 875 | nmdc:mga0k408_1430_c1 | 3300050493 | Bacteria | 12925 |
| 876 | nmdc:mga0k408_51841_c1 | 3300050493 | Bacteria | 2377 |
| 877 | nmdc:mga06z11_3692_c1 | 3300050494 | Bacteria | 5945 |
| 878 | nmdc:mga06z11_519_c1 | 3300050494 | Bacteria | 14218 |
| 879 | nmdc:mga04h51_69_c1 | 3300050495 | Bacteria | 33095 |
| 880 | nmdc:mga04h51_7426_c1 | 3300050495 | Bacteria | 2892 |
| 881 | nmdc:mga07m45_30503_c1 | 3300050496 | Bacteria | 2986 |
| 882 | nmdc:mga07m45_33_c1 | 3300050496 | Bacteria | 75596 |
| 883 | nmdc:mga07m45_50847_c1 | 3300050496 | Bacteria | 2336 |
| 884 | nmdc:mga07m45_73112_c1 | 3300050496 | Bacteria | 1952 |
| 885 | nmdc:mga07m45_8_c1 | 3300050496 | Bacteria | 214050 |
| 886 | nmdc:mga0sz30_15458_c1 | 3300050516 | Bacteria | 3016 |
| 887 | nmdc:mga0sz30_585_c1 | 3300050516 | Bacteria | 13728 |
| 888 | Ga0500610_0013948 | 3300053079 | Bacteria | 3756 |
| 889 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 890 | Ga0500643_000283 | 3300053087 | Bacteria | 43805 |
| 891 | Ga0500643_000330 | 3300053087 | Bacteria | 37938 |
| 892 | Ga0500643_000513 | 3300053087 | Bacteria | 27509 |
| 893 | Ga0500643_000620 | 3300053087 | Bacteria | 24035 |
| 894 | Ga0500643_001124 | 3300053087 | Bacteria | 15971 |
| 895 | Ga0500643_001505 | 3300053087 | Bacteria | 13338 |
| 896 | Ga0500643_006824 | 3300053087 | Bacteria | 4704 |
| 897 | Ga0500643_009073 | 3300053087 | Bacteria | 3835 |
| 898 | Ga0500651_0021296 | 3300053093 | Bacteria | 4041 |
| 899 | Ga0500555_003466 | 3300053103 | Bacteria | 4493 |
| 900 | Ga0500556_0000144 | 3300053104 | Bacteria | 59354 |
| 901 | Ga0500562_000252 | 3300053108 | Bacteria | 13785 |
| 902 | Ga0500592_000568 | 3300053116 | Bacteria | 6104 |
| 903 | Ga0500592_001514 | 3300053116 | Bacteria | 3762 |
| 904 | Ga0500592_003121 | 3300053116 | Bacteria | 2648 |
| 905 | Ga0500592_011306 | 3300053116 | Bacteria | 1427 |
| 906 | Ga0500607_000098 | 3300053121 | Bacteria | 65919 |
| 907 | Ga0500607_000381 | 3300053121 | Bacteria | 42415 |
| 908 | Ga0500608_000054 | 3300053122 | Bacteria | 51067 |
| 909 | Ga0500614_022454 | 3300053123 | Bacteria | 1473 |
| 910 | Ga0500618_000803 | 3300053125 | Bacteria | 17291 |
| 911 | Ga0500618_017176 | 3300053125 | Bacteria | 1803 |
| 912 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 913 | Ga0500642_0017110 | 3300053130 | Bacteria | 2771 |
| 914 | Ga0500655_000561 | 3300053133 | Bacteria | 7469 |
| 915 | Ga0500658_0001466 | 3300053134 | Bacteria | 9439 |
| 916 | Ga0500658_0001655 | 3300053134 | Bacteria | 8866 |
| 917 | Ga0500559_0000607 | 3300053136 | Bacteria | 24382 |
| 918 | Ga0500559_0001427 | 3300053136 | Bacteria | 13559 |
| 919 | Ga0500559_0011941 | 3300053136 | Bacteria | 3702 |
| 920 | Ga0500559_0012105 | 3300053136 | Bacteria | 3674 |
| 921 | Ga0500559_0024336 | 3300053136 | Bacteria | 2576 |
| 922 | Ga0500559_0054494 | 3300053136 | Bacteria | 1771 |
| 923 | Ga0500559_0054945 | 3300053136 | Bacteria | 1765 |
| 924 | Ga0500573_0000278 | 3300053140 | Bacteria | 21754 |
| 925 | Ga0500573_0119818 | 3300053140 | Bacteria | 1466 |
| 926 | Ga0500590_000301 | 3300053148 | Bacteria | 15719 |
| 927 | Ga0500590_017734 | 3300053148 | Bacteria | 3680 |
| 928 | Ga0500604_0002278 | 3300053151 | Bacteria | 5253 |
| 929 | Ga0500616_0001893 | 3300053153 | Bacteria | 18825 |
| 930 | Ga0500622_0001014 | 3300053156 | Bacteria | 23572 |
| 931 | Ga0500622_0057718 | 3300053156 | Bacteria | 1985 |
| 932 | Ga0500624_000015 | 3300053157 | Bacteria | 161928 |
| 933 | Ga0500624_000023 | 3300053157 | Bacteria | 114997 |
| 934 | Ga0500624_000289 | 3300053157 | Bacteria | 17376 |
| 935 | Ga0500627_0000104 | 3300053158 | Bacteria | 28060 |
| 936 | Ga0500627_0000488 | 3300053158 | Bacteria | 10673 |
| 937 | Ga0500627_0000778 | 3300053158 | Bacteria | 8492 |
| 938 | Ga0500636_0003237 | 3300053177 | Bacteria | 9121 |
| 939 | Ga0500636_0011030 | 3300053177 | Bacteria | 5286 |
| 940 | Ga0500636_0026651 | 3300053177 | Bacteria | 3414 |
| 941 | Ga0500637_0000013 | 3300053178 | Bacteria | 73168 |
| 942 | Ga0500637_0057843 | 3300053178 | Bacteria | 2217 |
| 943 | Ga0500567_007512 | 3300053723 | Bacteria | 5134 |
| 944 | Ga0500570_006332 | 3300053724 | Bacteria | 6424 |
| 945 | Ga0500611_002591 | 3300053727 | Bacteria | 2194 |
| 946 | Ga0500625_000002 | 3300053729 | Bacteria | 371909 |
| 947 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 948 | Ga0500645_000780 | 3300053730 | Bacteria | 19276 |
| 949 | Ga0500645_006477 | 3300053730 | Bacteria | 4171 |
| 950 | Ga0500645_013828 | 3300053730 | Bacteria | 2583 |
| 951 | Ga0500645_018269 | 3300053730 | Bacteria | 2191 |
| 952 | Ga0500645_021520 | 3300053730 | Bacteria | 1990 |
| 953 | Ga0500596_002731 | 3300053735 | Bacteria | 3458 |
| 954 | 2511127888 | 2510917021 | Bacteria | 5705459 |
| 955 | 2512643376 | 2512564014 | Bacteria | 4639632 |
| 956 | 2585261175 | 2582581305 | Bacteria | 4895574 |
| 957 | 2600227764 | 2599185359 | Bacteria | 4772316 |
| 958 | 2643728122 | 2643221541 | Bacteria | 5498788 |
| 959 | 2643950313 | 2643221588 | Bacteria | 3692460 |
| 960 | 2644038908 | 2643221605 | Bacteria | 4772303 |
| 961 | 2644042929 | 2643221606 | Bacteria | 5588032 |
| 962 | 2644395640 | 2643221671 | Bacteria | 5496681 |
| 963 | 2738709712 | 2738541275 | Bacteria | 4830863 |
| 964 | 2738848137 | 2738541301 | Bacteria | 4834102 |
| 965 | 2738863866 | 2738541304 | Bacteria | 4833665 |
| 966 | 2739296384 | 2738543022 | Bacteria | 4835059 |
| 967 | 2739358062 | 2738543033 | Bacteria | 4833336 |
| 968 | 2739651933 | 2739367664 | Bacteria | 4114334 |
| 969 | 2740030407 | 2739367865 | Bacteria | 4114482 |
| 970 | 2778125010 | 2775507255 | Bacteria | 3945731 |
| 971 | 2809062414 | 2808606401 | Bacteria | 4586670 |
| 972 | 2809078246 | 2808606404 | Bacteria | 4652788 |
| 973 | 2809082803 | 2808606405 | Bacteria | 4586632 |
| 974 | 2819552456 | 2818991438 | Bacteria | 5793701 |
| 975 | 2819714197 | 2818991466 | Bacteria | 4748179 |
| 976 | 2830078125 | 2830075706 | Bacteria | 3855215 |
| 977 | 2848297489 | 2848297114 | Bacteria | 3608511 |
| 978 | 2879166507 | 2879163058 | Bacteria | 4223965 |
| 979 | 2880522326 | 2880518877 | Bacteria | 5012590 |
| 980 | 2882808499 | 2882806704 | Bacteria | 3007728 |
| 981 | 2895884209 | 2895880812 | Bacteria | 11255272 |
| 982 | 2896186822 | 2896184354 | Bacteria | 3258548 |
| 983 | 2919142784 | 2919138771 | Bacteria | 5281312 |
| 984 | 2919709701 | 2919709256 | Bacteria | 4318106 |
| 985 | 2928101268 | 2928100450 | Bacteria | 4837635 |
| 986 | 2928530411 | 2928526807 | Bacteria | 4760224 |
| 987 | 2928960321 | 2928959182 | Bacteria | 4725774 |
| 988 | 2928968207 | 2928968154 | Bacteria | 4633371 |
| 989 | 2990266443 | 2990265787 | Bacteria | 3943888 |
| 990 | 2993695764 | 2993693658 | Bacteria | 4040749 |
| 991 | 3000866560 | 3000865235 | Bacteria | 3106258 |
| 992 | 8054304953 | 8054302542 | Bacteria | 5698134 |
| 993 | Ga0496105_0010962 | |||
| 994 | SwRhRL2b_contig_2235436 | |||
| 995 | JGI24736J21556_1000256 | |||
| 996 | JGI24741J21665_1001032 | |||
| 997 | JGI24741J21665_1001215 | |||
| 998 | JGI24752J21851_1000062 | |||
| 999 | JGI24752J21851_1001369 | |||
| 1000 | JGI24752J21851_1007004 | |||
| 1001 | JGI24740J21852_10000540 | |||
| 1002 | JGI24740J21852_10005886 | |||
| 1003 | JGI24740J21852_10011274 | |||
| 1004 | JGI24739J22299_10001027 | |||
| 1005 | JGI24739J22299_10003942 | |||
| 1006 | JGI24739J22299_10004578 | |||
| 1007 | JGI24737J22298_10002455 | |||
| 1008 | JGI24737J22298_10004191 | |||
| 1009 | JGI24735J21928_10000861 | |||
| 1010 | JGI24735J21928_10003084 | |||
| 1011 | JGI24750J21931_1000036 | |||
| 1012 | JGI24748J21848_1000103 | |||
| 1013 | JGI24738J21930_10001565 | |||
| 1014 | JGI24749J21850_1000087 | |||
| 1015 | JGI24034J26672_10000057 | |||
| 1016 | JGI24742J22300_10004425 | |||
| 1017 | JGI24751J29686_10000054 | |||
| 1018 | JGI24751J29686_10000140 | |||
| 1019 | JGI25165J46597_1000012 | |||
| 1020 | JGI25153J46596_10000005 | |||
| 1021 | Ga0055525_1000012 | |||
| 1022 | Ga0055542_1000355 | |||
| 1023 | Ga0055529_1000045 | |||
| 1024 | Ga0065165_1004400 | |||
| 1025 | Ga0065704_10001493 | |||
| 1026 | Ga0065704_10007473 | |||
| 1027 | Ga0065704_10070176 | |||
| 1028 | Ga0065704_10105609 | |||
| 1029 | Ga0065707_10083253 | |||
| 1030 | Ga0070658_10000067 | |||
| 1031 | Ga0070658_10001571 | |||
| 1032 | Ga0070658_10032881 | |||
| 1033 | Ga0070658_10032902 | |||
| 1034 | Ga0070658_10105365 | |||
| 1035 | Ga0070683_100170222 | |||
| 1036 | Ga0070683_100172906 | |||
| 1037 | Ga0070690_100000011 | |||
| 1038 | Ga0070690_100046244 | |||
| 1039 | Ga0070670_100000003 | |||
| 1040 | Ga0070670_100000210 | |||
| 1041 | Ga0070670_100000965 | |||
| 1042 | Ga0070670_100009509 | |||
| 1043 | Ga0070670_100018785 | |||
| 1044 | Ga0070670_100190597 | |||
| 1045 | Ga0070670_100240614 | |||
| 1046 | Ga0070666_10000035 | |||
| 1047 | Ga0070666_10000089 | |||
| 1048 | Ga0070666_10013840 | |||
| 1049 | Ga0070666_10036618 | |||
| 1050 | Ga0070666_10158615 | |||
| 1051 | Ga0070666_10198050 | |||
| 1052 | Ga0070680_100011845 | |||
| 1053 | Ga0070660_100075680 | |||
| 1054 | Ga0070660_100148168 | |||
| 1055 | Ga0070689_100002742 | |||
| 1056 | Ga0070661_100011173 | |||
| 1057 | Ga0070668_100000003 | |||
| 1058 | Ga0070668_100000014 | |||
| 1059 | Ga0070668_100003251 | |||
| 1060 | Ga0070668_100007280 | |||
| 1061 | Ga0070668_100042436 | |||
| 1062 | Ga0070669_100000020 | |||
| 1063 | Ga0070669_100000024 | |||
| 1064 | Ga0070669_100000334 | |||
| 1065 | Ga0070669_100000473 | |||
| 1066 | Ga0070669_100000712 | |||
| 1067 | Ga0070669_100002131 | |||
| 1068 | Ga0070669_100003995 | |||
| 1069 | Ga0070669_100024149 | |||
| 1070 | Ga0070669_100034312 | |||
| 1071 | Ga0070669_100050393 | |||
| 1072 | Ga0070669_100157764 | |||
| 1073 | Ga0070671_100000006 | |||
| 1074 | Ga0070671_100000138 | |||
| 1075 | Ga0070671_100000435 | |||
| 1076 | Ga0070671_100000542 | |||
| 1077 | Ga0070671_100002625 | |||
| 1078 | Ga0070671_100039115 | |||
| 1079 | Ga0070671_100210640 | |||
| 1080 | Ga0070674_100011307 | |||
| 1081 | Ga0070688_100001328 | |||
| 1082 | Ga0070659_100008121 | |||
| 1083 | Ga0070659_100070457 | |||
| 1084 | Ga0070659_100216272 | |||
| 1085 | Ga0070667_100000051 | |||
| 1086 | Ga0070667_100000128 | |||
| 1087 | Ga0070667_100000298 | |||
| 1088 | Ga0070667_100000851 | |||
| 1089 | Ga0070667_100001003 | |||
| 1090 | Ga0070667_100002068 | |||
| 1091 | Ga0070667_100004204 | |||
| 1092 | Ga0070667_100011284 | |||
| 1093 | Ga0070667_100014546 | |||
| 1094 | Ga0070667_100040604 | |||
| 1095 | Ga0070667_100049569 | |||
| 1096 | Ga0070667_100104253 | |||
| 1097 | Ga0070705_100004759 | |||
| 1098 | Ga0070705_100099149 | |||
| 1099 | Ga0070708_100094332 | |||
| 1100 | Ga0070663_100017417 | |||
| 1101 | Ga0070663_100100915 | |||
| 1102 | Ga0070663_100129135 | |||
| 1103 | Ga0070678_100012555 | |||
| 1104 | Ga0070662_100012698 | |||
| 1105 | Ga0070681_10005668 | |||
| 1106 | Ga0068867_100007513 | |||
| 1107 | Ga0068867_100235491 | |||
| 1108 | Ga0070685_10000168 | |||
| 1109 | Ga0070679_100008282 | |||
| 1110 | Ga0068853_100004036 | |||
| 1111 | Ga0068853_100009085 | |||
| 1112 | Ga0068853_100019326 | |||
| 1113 | Ga0068853_100025577 | |||
| 1114 | Ga0068853_100174305 | |||
| 1115 | Ga0070672_100315773 | |||
| 1116 | Ga0070686_100001324 | |||
| 1117 | Ga0070686_100017427 | |||
| 1118 | Ga0070665_100000161 | |||
| 1119 | Ga0070665_100000206 | |||
| 1120 | Ga0070665_100001356 | |||
| 1121 | Ga0070665_100010985 | |||
| 1122 | Ga0070665_100012580 | |||
| 1123 | Ga0070665_100088252 | |||
| 1124 | Ga0070665_100137757 | |||
| 1125 | Ga0070665_100287580 | |||
| 1126 | Ga0068855_100000962 | |||
| 1127 | Ga0068855_100014816 | |||
| 1128 | Ga0068855_100015135 | |||
| 1129 | Ga0068855_100040224 | |||
| 1130 | Ga0068855_100060879 | |||
| 1131 | Ga0070664_100013946 | |||
| 1132 | Ga0070664_100020427 | |||
| 1133 | Ga0070664_100102464 | |||
| 1134 | Ga0068857_100009607 | |||
| 1135 | Ga0068857_100018029 | |||
| 1136 | Ga0068857_100065228 | |||
| 1137 | Ga0068857_100069212 | |||
| 1138 | Ga0068857_100084922 | |||
| 1139 | Ga0068857_100194718 | |||
| 1140 | Ga0068857_100245112 | |||
| 1141 | Ga0068854_100003154 | |||
| 1142 | Ga0068854_100010741 | |||
| 1143 | Ga0068854_100012195 | |||
| 1144 | Ga0068854_100019472 | |||
| 1145 | Ga0068854_100305493 | |||
| 1146 | Ga0068856_100004323 | |||
| 1147 | Ga0068856_100011400 | |||
| 1148 | Ga0068856_100142927 | |||
| 1149 | Ga0068856_100332962 | |||
| 1150 | Ga0068856_100494178 | |||
| 1151 | Ga0070702_100028407 | |||
| 1152 | Ga0068852_100000075 | |||
| 1153 | Ga0068852_100108194 | |||
| 1154 | Ga0068852_100183379 | |||
| 1155 | Ga0068859_100000256 | |||
| 1156 | Ga0068859_100001299 | |||
| 1157 | Ga0068859_100006610 | |||
| 1158 | Ga0068859_100025168 | |||
| 1159 | Ga0068864_100000005 | |||
| 1160 | Ga0068864_100000332 | |||
| 1161 | Ga0068864_100000642 | |||
| 1162 | Ga0068864_100001753 | |||
| 1163 | Ga0068864_100025454 | |||
| 1164 | Ga0068864_100053335 | |||
| 1165 | Ga0068864_100118219 | |||
| 1166 | Ga0068861_100001329 | |||
| 1167 | Ga0068861_100015879 | |||
| 1168 | Ga0068861_100088296 | |||
| 1169 | Ga0068851_10011445 | |||
| 1170 | Ga0068851_10042184 | |||
| 1171 | Ga0068863_100000016 | |||
| 1172 | Ga0068863_100000028 | |||
| 1173 | Ga0068863_100000060 | |||
| 1174 | Ga0068863_100000456 | |||
| 1175 | Ga0068863_100000719 | |||
| 1176 | Ga0068863_100005237 | |||
| 1177 | Ga0068863_100010358 | |||
| 1178 | Ga0068863_100017269 | |||
| 1179 | Ga0068863_100028865 | |||
| 1180 | Ga0068863_100415980 | |||
| 1181 | Ga0068858_100000304 | |||
| 1182 | Ga0068858_100000472 | |||
| 1183 | Ga0068858_100002895 | |||
| 1184 | Ga0068858_100004091 | |||
| 1185 | Ga0068858_100016712 | |||
| 1186 | Ga0068858_100022636 | |||
| 1187 | Ga0068858_100104346 | |||
| 1188 | Ga0068860_100000126 | |||
| 1189 | Ga0068860_100000143 | |||
| 1190 | Ga0068860_100000168 | |||
| 1191 | Ga0068860_100000412 | |||
| 1192 | Ga0068860_100001698 | |||
| 1193 | Ga0068860_100006149 | |||
| 1194 | Ga0068860_100007410 | |||
| 1195 | Ga0068860_100017637 | |||
| 1196 | Ga0068860_100174989 | |||
| 1197 | Ga0068862_100000001 | |||
| 1198 | Ga0068862_100000085 | |||
| 1199 | Ga0068862_100000168 | |||
| 1200 | Ga0068862_100000310 | |||
| 1201 | Ga0068862_100000506 | |||
| 1202 | Ga0068862_100001574 | |||
| 1203 | Ga0068862_100010705 | |||
| 1204 | Ga0068862_100010728 | |||
| 1205 | Ga0068862_100040836 | |||
| 1206 | Ga0068862_100089890 | |||
| 1207 | Ga0081455_10000131 | |||
| 1208 | Ga0075368_10001483 | |||
| 1209 | Ga0075368_10041808 | |||
| 1210 | Ga0075363_100003377 | |||
| 1211 | Ga0075363_100003814 | |||
| 1212 | Ga0075364_10016692 | |||
| 1213 | Ga0075432_10004187 | |||
| 1214 | Ga0075362_10000234 | |||
| 1215 | Ga0075362_10000526 | |||
| 1216 | Ga0075367_10000092 | |||
| 1217 | Ga0075366_10000168 | |||
| 1218 | Ga0075366_10006887 | |||
| 1219 | Ga0075366_10021504 | |||
| 1220 | Ga0097621_100136045 | |||
| 1221 | Ga0075370_10000032 | |||
| 1222 | Ga0075370_10045379 | |||
| 1223 | Ga0075429_100039568 | |||
| 1224 | Ga0075429_100102528 | |||
| 1225 | Ga0097620_100000256 | |||
| 1226 | Ga0097620_100001299 | |||
| 1227 | Ga0097620_100006610 | |||
| 1228 | Ga0097620_100025168 | |||
| 1229 | Ga0079104_1008150 | |||
| 1230 | Ga0105251_10001625 | |||
| 1231 | Ga0105251_10001861 | |||
| 1232 | Ga0105251_10010467 | |||
| 1233 | Ga0105251_10061191 | |||
| 1234 | Ga0105251_10069374 | |||
| 1235 | Ga0105240_10001848 | |||
| 1236 | Ga0105240_10010488 | |||
| 1237 | Ga0105240_10035481 | |||
| 1238 | Ga0105240_10070426 | |||
| 1239 | Ga0105240_10078303 | |||
| 1240 | Ga0105245_10001108 | |||
| 1241 | Ga0105247_10000644 | |||
| 1242 | Ga0105247_10037912 | |||
| 1243 | Ga0114129_10021496 | |||
| 1244 | Ga0105243_10000423 | |||
| 1245 | Ga0105243_10075604 | |||
| 1246 | Ga0105243_10261150 | |||
| 1247 | Ga0105241_10000997 | |||
| 1248 | Ga0105241_10166400 | |||
| 1249 | Ga0105248_10000029 | |||
| 1250 | Ga0105248_10000086 | |||
| 1251 | Ga0105248_10013528 | |||
| 1252 | Ga0105248_10024262 | |||
| 1253 | Ga0105248_10031271 | |||
| 1254 | Ga0105248_10120069 | |||
| 1255 | Ga0105248_10175942 | |||
| 1256 | Ga0105237_10002073 | |||
| 1257 | Ga0105237_10007129 | |||
| 1258 | Ga0105237_10009460 | |||
| 1259 | Ga0105237_10140837 | |||
| 1260 | Ga0105238_10017115 | |||
| 1261 | Ga0105238_10182143 | |||
| 1262 | Ga0105238_10203403 | |||
| 1263 | Ga0105238_10254974 | |||
| 1264 | Ga0105249_10000024 | |||
| 1265 | Ga0105249_10000038 | |||
| 1266 | Ga0105249_10000094 | |||
| 1267 | Ga0105249_10002324 | |||
| 1268 | Ga0105249_10348210 | |||
| 1269 | Ga0105148_100059 | |||
| 1270 | Ga0105239_10027686 | |||
| 1271 | Ga0105239_10067612 | |||
| 1272 | Ga0105239_10618628 | |||
| 1273 | Ga0157326_1000001 | |||
| 1274 | Ga0157373_10003358 | |||
| 1275 | Ga0157371_10000032 | |||
| 1276 | Ga0157371_10003665 | |||
| 1277 | Ga0157371_10140860 | |||
| 1278 | Ga0157370_10013758 | |||
| 1279 | Ga0157370_10051407 | |||
| 1280 | Ga0157370_10053190 | |||
| 1281 | Ga0157370_10330811 | |||
| 1282 | Ga0157369_10115578 | |||
| 1283 | Ga0157369_10289035 | |||
| 1284 | Ga0157378_10187768 | |||
| 1285 | Ga0163162_10003527 | |||
| 1286 | Ga0163162_10012124 | |||
| 1287 | Ga0163162_10015484 | |||
| 1288 | Ga0163162_10044800 | |||
| 1289 | Ga0157372_10035441 | |||
| 1290 | Ga0157372_10242033 | |||
| 1291 | Ga0157372_10328848 | |||
| 1292 | Ga0163163_10008504 | |||
| 1293 | Ga0163163_10172430 | |||
| 1294 | Ga0157380_10000060 | |||
| 1295 | Ga0157380_10000542 | |||
| 1296 | Ga0157380_10148878 | |||
| 1297 | Ga0157379_10004525 | |||
| 1298 | Ga0157379_10042529 | |||
| 1299 | Ga0183363_1004 | |||
| 1300 | Ga0163161_10000716 | |||
| 1301 | Ga0163161_10082721 | |||
| 1302 | Ga0213875_10000264 | |||
| 1303 | Ga0209147_104064 | |||
| 1304 | Ga0209563_100030 | |||
| 1305 | Ga0209677_104116 | |||
| 1306 | Ga0209148_1000011 | |||
| 1307 | Ga0209233_1000058 | |||
| 1308 | Ga0209455_1000006 | |||
| 1309 | Ga0209758_1000001 | |||
| 1310 | Ga0209050_1000441 | |||
| 1311 | Ga0207697_10000419 | |||
| 1312 | Ga0207697_10012242 | |||
| 1313 | Ga0207697_10015555 | |||
| 1314 | Ga0207656_10000378 | |||
| 1315 | Ga0207656_10005981 | |||
| 1316 | Ga0207713_1002460 | |||
| 1317 | Ga0207713_1016496 | |||
| 1318 | Ga0207710_10006923 | |||
| 1319 | Ga0207710_10035134 | |||
| 1320 | Ga0207680_10000007 | |||
| 1321 | Ga0207680_10000517 | |||
| 1322 | Ga0207680_10003829 | |||
| 1323 | Ga0207680_10125961 | |||
| 1324 | Ga0207680_10140440 | |||
| 1325 | Ga0207680_10155143 | |||
| 1326 | Ga0207647_10008366 | |||
| 1327 | Ga0207647_10026599 | |||
| 1328 | Ga0207647_10064805 | |||
| 1329 | Ga0207645_10165005 | |||
| 1330 | Ga0207705_10000075 | |||
| 1331 | Ga0207705_10000122 | |||
| 1332 | Ga0207705_10090342 | |||
| 1333 | Ga0207705_10123396 | |||
| 1334 | Ga0207654_10002907 | |||
| 1335 | Ga0207707_10069377 | |||
| 1336 | Ga0207707_10141338 | |||
| 1337 | Ga0207695_10000288 | |||
| 1338 | Ga0207695_10006069 | |||
| 1339 | Ga0207695_10015610 | |||
| 1340 | Ga0207695_10036202 | |||
| 1341 | Ga0207695_10055082 | |||
| 1342 | Ga0207695_10075297 | |||
| 1343 | Ga0207695_10095696 | |||
| 1344 | Ga0207695_10150591 | |||
| 1345 | Ga0207671_10001439 | |||
| 1346 | Ga0207671_10006770 | |||
| 1347 | Ga0207671_10018947 | |||
| 1348 | Ga0207657_10000408 | |||
| 1349 | Ga0207657_10002471 | |||
| 1350 | Ga0207657_10007801 | |||
| 1351 | Ga0207657_10011633 | |||
| 1352 | Ga0207657_10085021 | |||
| 1353 | Ga0207657_10186792 | |||
| 1354 | Ga0207649_10000482 | |||
| 1355 | Ga0207649_10159200 | |||
| 1356 | Ga0207652_10008597 | |||
| 1357 | Ga0207652_10114171 | |||
| 1358 | Ga0207681_10000004 | |||
| 1359 | Ga0207681_10000005 | |||
| 1360 | Ga0207681_10000089 | |||
| 1361 | Ga0207681_10000503 | |||
| 1362 | Ga0207681_10000663 | |||
| 1363 | Ga0207681_10001365 | |||
| 1364 | Ga0207681_10004407 | |||
| 1365 | Ga0207681_10018758 | |||
| 1366 | Ga0207681_10041605 | |||
| 1367 | Ga0207681_10140268 | |||
| 1368 | Ga0207694_10005621 | |||
| 1369 | Ga0207694_10009731 | |||
| 1370 | Ga0207694_10018966 | |||
| 1371 | Ga0207694_10061619 | |||
| 1372 | Ga0207694_10175781 | |||
| 1373 | Ga0207694_10182713 | |||
| 1374 | Ga0207694_10237460 | |||
| 1375 | Ga0207650_10000004 | |||
| 1376 | Ga0207650_10000545 | |||
| 1377 | Ga0207650_10010295 | |||
| 1378 | Ga0207650_10015807 | |||
| 1379 | Ga0207650_10047790 | |||
| 1380 | Ga0207650_10083091 | |||
| 1381 | Ga0207687_10000853 | |||
| 1382 | Ga0207644_10000005 | |||
| 1383 | Ga0207644_10000009 | |||
| 1384 | Ga0207644_10000447 | |||
| 1385 | Ga0207644_10001520 | |||
| 1386 | Ga0207644_10003216 | |||
| 1387 | Ga0207644_10020323 | |||
| 1388 | Ga0207644_10021357 | |||
| 1389 | Ga0207644_10070832 | |||
| 1390 | Ga0207690_10000696 | |||
| 1391 | Ga0207690_10023275 | |||
| 1392 | Ga0207690_10031743 | |||
| 1393 | Ga0207690_10225677 | |||
| 1394 | Ga0207706_10002919 | |||
| 1395 | Ga0207706_10004237 | |||
| 1396 | Ga0207706_10012315 | |||
| 1397 | Ga0207706_10075750 | |||
| 1398 | Ga0207709_10000574 | |||
| 1399 | Ga0207709_10193909 | |||
| 1400 | Ga0207670_10013004 | |||
| 1401 | Ga0207669_10006239 | |||
| 1402 | Ga0207711_10000004 | |||
| 1403 | Ga0207711_10000310 | |||
| 1404 | Ga0207711_10002363 | |||
| 1405 | Ga0207711_10019413 | |||
| 1406 | Ga0207711_10024128 | |||
| 1407 | Ga0207711_10048966 | |||
| 1408 | Ga0207661_10256435 | |||
| 1409 | Ga0207679_10100238 | |||
| 1410 | Ga0207667_10000002 | |||
| 1411 | Ga0207667_10004952 | |||
| 1412 | Ga0207667_10008229 | |||
| 1413 | Ga0207667_10013795 | |||
| 1414 | Ga0207667_10118401 | |||
| 1415 | Ga0207667_10301320 | |||
| 1416 | Ga0207712_10000002 | |||
| 1417 | Ga0207712_10000004 | |||
| 1418 | Ga0207712_10000034 | |||
| 1419 | Ga0207668_10000006 | |||
| 1420 | Ga0207668_10000047 | |||
| 1421 | Ga0207668_10003433 | |||
| 1422 | Ga0207668_10003815 | |||
| 1423 | Ga0207668_10004706 | |||
| 1424 | Ga0207668_10009940 | |||
| 1425 | Ga0207668_10316619 | |||
| 1426 | Ga0207640_10000570 | |||
| 1427 | Ga0207640_10000586 | |||
| 1428 | Ga0207640_10002545 | |||
| 1429 | Ga0207640_10018948 | |||
| 1430 | Ga0207640_10070046 | |||
| 1431 | Ga0207658_10000026 | |||
| 1432 | Ga0207658_10000057 | |||
| 1433 | Ga0207658_10000254 | |||
| 1434 | Ga0207658_10000434 | |||
| 1435 | Ga0207658_10001330 | |||
| 1436 | Ga0207658_10002894 | |||
| 1437 | Ga0207658_10002944 | |||
| 1438 | Ga0207658_10003250 | |||
| 1439 | Ga0207658_10007629 | |||
| 1440 | Ga0207658_10025127 | |||
| 1441 | Ga0207658_10031477 | |||
| 1442 | Ga0207658_10110014 | |||
| 1443 | Ga0207703_10000435 | |||
| 1444 | Ga0207703_10000568 | |||
| 1445 | Ga0207703_10001463 | |||
| 1446 | Ga0207703_10001946 | |||
| 1447 | Ga0207703_10001956 | |||
| 1448 | Ga0207703_10012521 | |||
| 1449 | Ga0207703_10070059 | |||
| 1450 | Ga0207703_10109986 | |||
| 1451 | Ga0207703_10126510 | |||
| 1452 | Ga0207639_10000777 | |||
| 1453 | Ga0207639_10003342 | |||
| 1454 | Ga0207639_10018070 | |||
| 1455 | Ga0207639_10020172 | |||
| 1456 | Ga0207639_10045628 | |||
| 1457 | Ga0207639_10074344 | |||
| 1458 | Ga0207639_10224291 | |||
| 1459 | Ga0207678_10000324 | |||
| 1460 | Ga0207678_10005545 | |||
| 1461 | Ga0207678_10013334 | |||
| 1462 | Ga0207678_10041873 | |||
| 1463 | Ga0207702_10005910 | |||
| 1464 | Ga0207702_10006661 | |||
| 1465 | Ga0207702_10037147 | |||
| 1466 | Ga0207702_10113339 | |||
| 1467 | Ga0207702_10113370 | |||
| 1468 | Ga0207702_10255571 | |||
| 1469 | Ga0207641_10000010 | |||
| 1470 | Ga0207641_10000014 | |||
| 1471 | Ga0207641_10000100 | |||
| 1472 | Ga0207641_10000315 | |||
| 1473 | Ga0207641_10000346 | |||
| 1474 | Ga0207641_10002472 | |||
| 1475 | Ga0207641_10002944 | |||
| 1476 | Ga0207641_10017728 | |||
| 1477 | Ga0207641_10022838 | |||
| 1478 | Ga0207641_10025121 | |||
| 1479 | Ga0207641_10025885 | |||
| 1480 | Ga0207676_10000006 | |||
| 1481 | Ga0207676_10000036 | |||
| 1482 | Ga0207676_10000603 | |||
| 1483 | Ga0207676_10002760 | |||
| 1484 | Ga0207676_10003853 | |||
| 1485 | Ga0207676_10004588 | |||
| 1486 | Ga0207676_10011106 | |||
| 1487 | Ga0207676_10028724 | |||
| 1488 | Ga0207674_10003143 | |||
| 1489 | Ga0207674_10004472 | |||
| 1490 | Ga0207674_10009082 | |||
| 1491 | Ga0207674_10012390 | |||
| 1492 | Ga0207674_10014452 | |||
| 1493 | Ga0207674_10085003 | |||
| 1494 | Ga0207674_10100585 | |||
| 1495 | Ga0207674_10161876 | |||
| 1496 | Ga0207674_10330920 | |||
| 1497 | Ga0207675_100000740 | |||
| 1498 | Ga0207675_100003757 | |||
| 1499 | Ga0207675_100020136 | |||
| 1500 | Ga0207683_10022042 | |||
| 1501 | Ga0207698_10000005 | |||
| 1502 | Ga0207698_10027376 | |||
| 1503 | Ga0209281_1010835 | |||
| 1504 | Ga0209983_1009114 | |||
| 1505 | Ga0209813_10000114 | |||
| 1506 | Ga0209813_10000530 | |||
| 1507 | Ga0207428_10036711 | |||
| 1508 | Ga0268266_10000002 | |||
| 1509 | Ga0268266_10000040 | |||
| 1510 | Ga0268266_10000534 | |||
| 1511 | Ga0268266_10008419 | |||
| 1512 | Ga0268266_10015509 | |||
| 1513 | Ga0268266_10029365 | |||
| 1514 | Ga0268265_10000001 | |||
| 1515 | Ga0268265_10000059 | |||
| 1516 | Ga0268265_10000104 | |||
| 1517 | Ga0268265_10000986 | |||
| 1518 | Ga0268265_10001459 | |||
| 1519 | Ga0268265_10002264 | |||
| 1520 | Ga0268265_10002795 | |||
| 1521 | Ga0268265_10013635 | |||
| 1522 | Ga0268265_10070580 | |||
| 1523 | Ga0268265_10107211 | |||
| 1524 | Ga0268264_10000003 | |||
| 1525 | Ga0268264_10000040 | |||
| 1526 | Ga0268264_10000069 | |||
| 1527 | Ga0268264_10000076 | |||
| 1528 | Ga0268264_10000083 | |||
| 1529 | Ga0268264_10004451 | |||
| 1530 | Ga0268264_10012761 | |||
| 1531 | Ga0268264_10029925 | |||
| 1532 | Ga0268264_10146421 | |||
| 1533 | Ga0265323_10023219 | |||
| 1534 | Ga0307517_10076293 | |||
| 1535 | Ga0265330_10009538 | |||
| 1536 | Ga0265331_10064820 | |||
| 1537 | Ga0265327_10034616 | |||
| 1538 | Ga0265316_10002067 | |||
| 1539 | Ga0307513_10006540 | |||
| 1540 | Ga0307513_10040993 | |||
| 1541 | Ga0307408_100024261 | |||
| 1542 | Ga0307408_100062683 | |||
| 1543 | Ga0307408_100069487 | |||
| 1544 | Ga0307508_10001821 | |||
| 1545 | Ga0265342_10103895 | |||
| 1546 | Ga0307405_10003814 | |||
| 1547 | Ga0307413_10061015 | |||
| 1548 | Ga0307413_10246634 | |||
| 1549 | Ga0307410_10032147 | |||
| 1550 | Ga0307410_10131432 | |||
| 1551 | Ga0307406_10043622 | |||
| 1552 | Ga0307412_10000457 | |||
| 1553 | Ga0307412_10002757 | |||
| 1554 | Ga0307412_10004671 | |||
| 1555 | Ga0307412_10025366 | |||
| 1556 | Ga0307412_10025379 | |||
| 1557 | Ga0307412_10043331 | |||
| 1558 | Ga0307412_10066770 | |||
| 1559 | Ga0307412_10086777 | |||
| 1560 | Ga0307409_100108884 | |||
| 1561 | Ga0307416_100046276 | |||
| 1562 | Ga0307416_100080150 | |||
| 1563 | Ga0307416_100111520 | |||
| 1564 | Ga0307414_10000070 | |||
| 1565 | Ga0307414_10000288 | |||
| 1566 | Ga0307414_10000359 | |||
| 1567 | Ga0307411_10007009 | |||
| 1568 | Ga0307411_10230582 | |||
| 1569 | Ga0307415_100206526 | |||
| 1570 | Ga0316583_10008936 | |||
| 1571 | Ga0307510_10008642 | |||
| 1572 | Ga0373937_0071330 | |||
| 1573 | Ga0316582_0014476 | |||
| 1574 | Ga0316584_0074383 | |||
| 1575 | Ga0316584_0087070 | |||
| 1576 | Ga0395900_0044548 | |||
| 1577 | Ga0395898_0018073 | |||
| 1578 | Ga0436364_1200653 | |||
| 1579 | Ga0395901_0018063 | |||
| 1580 | Ga0439436_0009476 | |||
| 1581 | Ga0439436_0018522 | |||
| 1582 | Ga0439461_0000086 | |||
| 1583 | Ga0439465_0001125 | |||
| 1584 | Ga0439465_0016622 | |||
| 1585 | Ga0451802_1561412 | |||
| 1586 | Ga0439431_0000491 | |||
| 1587 | Ga0439431_0020680 | |||
| 1588 | Ga0439445_0011274 | |||
| 1589 | Ga0439432_005779 | |||
| 1590 | Ga0439452_025280 | |||
| 1591 | Ga0439462_0002734 | |||
| 1592 | Ga0453684_0260886 | |||
| 1593 | Ga0451576_0000588 | |||
| 1594 | Ga0451576_0215241 | |||
| 1595 | Ga0466967_0082472 | |||
| 1596 | Ga0495617_025936 | |||
| 1597 | Ga0495627_000094 | |||
| 1598 | Ga0495627_000391 | |||
| 1599 | Ga0495627_001469 | |||
| 1600 | Ga0495629_0046040 | |||
| 1601 | Ga0495638_0000018 | |||
| 1602 | Ga0495638_0001145 | |||
| 1603 | Ga0495638_0006816 | |||
| 1604 | Ga0495638_0015526 | |||
| 1605 | Ga0495638_0017047 | |||
| 1606 | Ga0495638_0043711 | |||
| 1607 | Ga0495638_0111145 | |||
| 1608 | Ga0495650_0000158 | |||
| 1609 | Ga0495650_0001135 | |||
| 1610 | Ga0495650_0021897 | |||
| 1611 | Ga0495585_0007224 | |||
| 1612 | Ga0495585_0070263 | |||
| 1613 | Ga0495585_0107265 | |||
| 1614 | Ga0495596_0000054 | |||
| 1615 | Ga0495596_0001629 | |||
| 1616 | Ga0495607_0011251 | |||
| 1617 | Ga0495583_0000139 | |||
| 1618 | Ga0495583_0000187 | |||
| 1619 | Ga0495583_0000631 | |||
| 1620 | Ga0495583_0010716 | |||
| 1621 | Ga0495583_0032633 | |||
| 1622 | Ga0495606_0000672 | |||
| 1623 | Ga0495606_0000685 | |||
| 1624 | Ga0495606_0033566 | |||
| 1625 | Ga0495610_0000022 | |||
| 1626 | Ga0495610_0000081 | |||
| 1627 | Ga0495610_0000886 | |||
| 1628 | Ga0495610_0002317 | |||
| 1629 | Ga0495610_0020645 | |||
| 1630 | Ga0495616_0000024 | |||
| 1631 | Ga0495620_0017938 | |||
| 1632 | Ga0495620_0076391 | |||
| 1633 | Ga0495631_0023064 | |||
| 1634 | Ga0495632_0000383 | |||
| 1635 | Ga0495632_0000948 | |||
| 1636 | Ga0495632_0008112 | |||
| 1637 | Ga0495632_0027220 | |||
| 1638 | Ga0495632_0052730 | |||
| 1639 | Ga0495637_0008273 | |||
| 1640 | Ga0495637_0040095 | |||
| 1641 | Ga0495643_0000030 | |||
| 1642 | Ga0495643_0000077 | |||
| 1643 | Ga0495643_0006700 | |||
| 1644 | Ga0495643_0008719 | |||
| 1645 | Ga0495643_0012069 | |||
| 1646 | Ga0495643_0015150 | |||
| 1647 | Ga0495643_0122045 | |||
| 1648 | Ga0495648_0000018 | |||
| 1649 | Ga0495648_0000143 | |||
| 1650 | Ga0495648_0039704 | |||
| 1651 | Ga0495663_0000003 | |||
| 1652 | Ga0495663_0007556 | |||
| 1653 | Ga0495654_0005346 | |||
| 1654 | Ga0495654_0041315 | |||
| 1655 | Ga0495587_0019617 | |||
| 1656 | Ga0495598_0015882 | |||
| 1657 | Ga0495609_0015133 | |||
| 1658 | Ga0495621_0016225 | |||
| 1659 | Ga0495633_0000184 | |||
| 1660 | Ga0495633_0000892 | |||
| 1661 | Ga0495633_0011496 | |||
| 1662 | Ga0495668_0000016 | |||
| 1663 | Ga0495668_0010303 | |||
| 1664 | Ga0495668_0011827 | |||
| 1665 | Ga0495668_0041896 | |||
| 1666 | Ga0495668_0082368 | |||
| 1667 | Ga0495625_0000150 | |||
| 1668 | Ga0495625_0000153 | |||
| 1669 | Ga0495625_0003185 | |||
| 1670 | Ga0495625_0008151 | |||
| 1671 | Ga0495625_0025768 | |||
| 1672 | Ga0495625_0093400 | |||
| 1673 | Ga0495661_0038909 | |||
| 1674 | Ga0495661_0068431 | |||
| 1675 | Ga0495669_0000050 | |||
| 1676 | Ga0495670_0059556 | |||
| 1677 | Ga0495671_0000011 | |||
| 1678 | Ga0495671_0000072 | |||
| 1679 | Ga0495671_0005155 | |||
| 1680 | Ga0495600_0000690 | |||
| 1681 | Ga0495683_0000963 | |||
| 1682 | Ga0495687_001845 | |||
| 1683 | Ga0495687_002183 | |||
| 1684 | Ga0495673_0000013 | |||
| 1685 | Ga0495673_0014606 | |||
| 1686 | Ga0495673_0018818 | |||
| 1687 | Ga0495681_0000010 | |||
| 1688 | Ga0495681_0000342 | |||
| 1689 | Ga0495681_0011835 | |||
| 1690 | Ga0495686_0000182 | |||
| 1691 | Ga0495686_0000363 | |||
| 1692 | Ga0495686_0005716 | |||
| 1693 | Ga0495686_0010474 | |||
| 1694 | Ga0495686_0023442 | |||
| 1695 | Ga0495686_0039832 | |||
| 1696 | Ga0495686_0043044 | |||
| 1697 | Ga0495686_0099114 | |||
| 1698 | Ga0495615_0000150 | |||
| 1699 | Ga0495626_0001895 | |||
| 1700 | Ga0496100_0147390 | |||
| 1701 | Ga0496101_0029318 | |||
| 1702 | Ga0496101_0041543 | |||
| 1703 | Ga0496101_0047847 | |||
| 1704 | Ga0496102_0000199 | |||
| 1705 | Ga0496102_0000243 | |||
| 1706 | Ga0496102_0000570 | |||
| 1707 | Ga0496102_0043153 | |||
| 1708 | Ga0496102_0369014 | |||
| 1709 | Ga0496103_0000201 | |||
| 1710 | Ga0496103_0000479 | |||
| 1711 | Ga0496103_0000633 | |||
| 1712 | Ga0496103_0001160 | |||
| 1713 | Ga0496103_0010198 | |||
| 1714 | Ga0496103_0018844 | |||
| 1715 | Ga0496103_0050435 | |||
| 1716 | Ga0496104_0000078 | |||
| 1717 | Ga0496104_0014211 | |||
| 1718 | Ga0496104_0038825 | |||
| 1719 | Ga0496104_0090818 | |||
| 1720 | Ga0496104_0103178 | |||
| 1721 | Ga0496105_0000241 | |||
| 1722 | Ga0496105_0000690 | |||
| 1723 | Ga0496105_0026430 | |||
| 1724 | Ga0496105_0115218 | |||
| 1725 | Ga0496105_0131538 | |||
| 1726 | Ga0496105_0275811 | |||
| 1727 | Ga0496106_0017827 | |||
| 1728 | Ga0496107_0000794 | |||
| 1729 | Ga0496107_0026839 | |||
| 1730 | Ga0496108_0036958 | |||
| 1731 | Ga0496109_0069384 | |||
| 1732 | Ga0496109_0076132 | |||
| 1733 | Ga0496109_0122522 | |||
| 1734 | Ga0496110_0017737 | |||
| 1735 | Ga0496110_0063880 | |||
| 1736 | Ga0496111_0061819 | |||
| 1737 | Ga0496112_0112199 | |||
| 1738 | Ga0496112_0629436 | |||
| 1739 | Ga0496113_0003620 | |||
| 1740 | Ga0496113_0004827 | |||
| 1741 | Ga0496113_0017588 | |||
| 1742 | Ga0496113_0141577 | |||
| 1743 | Ga0496114_0019776 | |||
| 1744 | Ga0496114_0074792 | |||
| 1745 | Ga0496115_0000131 | |||
| 1746 | Ga0496116_0000017 | |||
| 1747 | Ga0496116_0002567 | |||
| 1748 | Ga0496116_0034167 | |||
| 1749 | Ga0496117_0000179 | |||
| 1750 | Ga0496117_0000352 | |||
| 1751 | Ga0496117_0003444 | |||
| 1752 | Ga0496117_0006507 | |||
| 1753 | Ga0496117_0006558 | |||
| 1754 | Ga0496117_0012763 | |||
| 1755 | Ga0496117_0013579 | |||
| 1756 | Ga0496117_0013905 | |||
| 1757 | Ga0496117_0021332 | |||
| 1758 | Ga0496118_0000030 | |||
| 1759 | Ga0496118_0000092 | |||
| 1760 | Ga0496118_0004591 | |||
| 1761 | Ga0496118_0007285 | |||
| 1762 | Ga0496118_0007538 | |||
| 1763 | Ga0496118_0012741 | |||
| 1764 | Ga0496118_0031432 | |||
| 1765 | Ga0496118_0094030 | |||
| 1766 | Ga0496118_0179622 | |||
| 1767 | Ga0496119_0000114 | |||
| 1768 | Ga0496119_0004697 | |||
| 1769 | Ga0496119_0023936 | |||
| 1770 | Ga0496119_0090783 | |||
| 1771 | Ga0496120_0000266 | |||
| 1772 | Ga0496120_0047341 | |||
| 1773 | Ga0496120_0051004 | |||
| 1774 | Ga0496121_0000017 | |||
| 1775 | Ga0496121_0000228 | |||
| 1776 | Ga0496121_0000526 | |||
| 1777 | Ga0496121_0000675 | |||
| 1778 | Ga0496121_0001839 | |||
| 1779 | Ga0496121_0001919 | |||
| 1780 | Ga0496121_0003164 | |||
| 1781 | Ga0496121_0009156 | |||
| 1782 | Ga0496121_0012385 | |||
| 1783 | Ga0496121_0023268 | |||
| 1784 | Ga0496121_0045089 | |||
| 1785 | Ga0496121_0081421 | |||
| 1786 | Ga0496121_0086801 | |||
| 1787 | Ga0496122_0000176 | |||
| 1788 | Ga0496122_0013037 | |||
| 1789 | Ga0496122_0016897 | |||
| 1790 | Ga0496122_0041018 | |||
| 1791 | Ga0496122_0082928 | |||
| 1792 | Ga0496122_0096877 | |||
| 1793 | Ga0496123_0000291 | |||
| 1794 | Ga0496123_0001706 | |||
| 1795 | Ga0496123_0001817 | |||
| 1796 | Ga0496123_0010209 | |||
| 1797 | Ga0496123_0011704 | |||
| 1798 | Ga0496123_0016103 | |||
| 1799 | Ga0496123_0023217 | |||
| 1800 | Ga0496123_0040904 | |||
| 1801 | Ga0496123_0050151 | |||
| 1802 | Ga0496123_0079366 | |||
| 1803 | Ga0496124_0000081 | |||
| 1804 | Ga0496124_0000264 | |||
| 1805 | Ga0496124_0000684 | |||
| 1806 | Ga0496124_0001890 | |||
| 1807 | Ga0496124_0002608 | |||
| 1808 | Ga0496124_0003283 | |||
| 1809 | Ga0496124_0035004 | |||
| 1810 | Ga0496124_0066690 | |||
| 1811 | Ga0496124_0138686 | |||
| 1812 | Ga0496124_0149687 | |||
| 1813 | Ga0496125_0000980 | |||
| 1814 | Ga0496125_0009124 | |||
| 1815 | Ga0496125_0022628 | |||
| 1816 | Ga0496125_0037129 | |||
| 1817 | Ga0496125_0053383 | |||
| 1818 | Ga0496125_0088882 | |||
| 1819 | Ga0496125_0095291 | |||
| 1820 | Ga0496125_0129831 | |||
| 1821 | Ga0496126_0000173 | |||
| 1822 | Ga0496126_0000283 | |||
| 1823 | Ga0496126_0001284 | |||
| 1824 | Ga0496126_0095437 | |||
| 1825 | Ga0496126_0140487 | |||
| 1826 | Ga0496126_0142783 | |||
| 1827 | Ga0496126_0148654 | |||
| 1828 | Ga0496126_0166748 | |||
| 1829 | Ga0496126_0274736 | |||
| 1830 | Ga0501292_000247 | |||
| 1831 | Ga0501032_0060590 | |||
| 1832 | Ga0501033_0065135 | |||
| 1833 | Ga0501038_0047716 | |||
| 1834 | Ga0501043_0051084 | |||
| 1835 | Ga0501047_0000447 | |||
| 1836 | Ga0501070_0159647 | |||
| 1837 | Ga0501211_000821 | |||
| 1838 | Ga0501223_000010 | |||
| 1839 | Ga0501223_000112 | |||
| 1840 | Ga0501223_002105 | |||
| 1841 | Ga0501224_000020 | |||
| 1842 | Ga0501224_009536 | |||
| 1843 | Ga0501233_001867 | |||
| 1844 | Ga0501235_001604 | |||
| 1845 | Ga0501235_002575 | |||
| 1846 | Ga0501246_000669 | |||
| 1847 | Ga0501257_000029 | |||
| 1848 | Ga0501261_000214 | |||
| 1849 | Ga0501225_0000008 | |||
| 1850 | Ga0501225_0000135 | |||
| 1851 | Ga0501225_0003339 | |||
| 1852 | Ga0501245_000464 | |||
| 1853 | Ga0501083_0079449 | |||
| 1854 | Ga0501279_000220 | |||
| 1855 | Ga0501280_000649 | |||
| 1856 | Ga0501282_000493 | |||
| 1857 | Ga0501035_0168692 | |||
| 1858 | Ga0501044_0006548 | |||
| 1859 | Ga0501044_0010061 | |||
| 1860 | Ga0501226_000044 | |||
| 1861 | nmdc:mga03683_229_c1 | |||
| 1862 | nmdc:mga03683_463_c1 | |||
| 1863 | nmdc:mga03n38_5700_c1 | |||
| 1864 | nmdc:mga00v17_3081_c2 | |||
| 1865 | nmdc:mga00v17_39430_c1 | |||
| 1866 | nmdc:mga0k408_110078_c1 | |||
| 1867 | nmdc:mga0k408_1430_c1 | |||
| 1868 | nmdc:mga0k408_51841_c1 | |||
| 1869 | nmdc:mga06z11_3692_c1 | |||
| 1870 | nmdc:mga06z11_519_c1 | |||
| 1871 | nmdc:mga04h51_69_c1 | |||
| 1872 | nmdc:mga04h51_7426_c1 | |||
| 1873 | nmdc:mga07m45_30503_c1 | |||
| 1874 | nmdc:mga07m45_33_c1 | |||
| 1875 | nmdc:mga07m45_50847_c1 | |||
| 1876 | nmdc:mga07m45_73112_c1 | |||
| 1877 | nmdc:mga07m45_8_c1 | |||
| 1878 | nmdc:mga0sz30_15458_c1 | |||
| 1879 | nmdc:mga0sz30_585_c1 | |||
| 1880 | Ga0500610_0013948 | |||
| 1881 | Ga0500643_000004 | |||
| 1882 | Ga0500643_000283 | |||
| 1883 | Ga0500643_000330 | |||
| 1884 | Ga0500643_000513 | |||
| 1885 | Ga0500643_000620 | |||
| 1886 | Ga0500643_001124 | |||
| 1887 | Ga0500643_001505 | |||
| 1888 | Ga0500643_006824 | |||
| 1889 | Ga0500643_009073 | |||
| 1890 | Ga0500651_0021296 | |||
| 1891 | Ga0500555_003466 | |||
| 1892 | Ga0500556_0000144 | |||
| 1893 | Ga0500562_000252 | |||
| 1894 | Ga0500592_000568 | |||
| 1895 | Ga0500592_001514 | |||
| 1896 | Ga0500592_003121 | |||
| 1897 | Ga0500592_011306 | |||
| 1898 | Ga0500607_000098 | |||
| 1899 | Ga0500607_000381 | |||
| 1900 | Ga0500608_000054 | |||
| 1901 | Ga0500614_022454 | |||
| 1902 | Ga0500618_000803 | |||
| 1903 | Ga0500618_017176 | |||
| 1904 | Ga0500642_0000001 | |||
| 1905 | Ga0500642_0017110 | |||
| 1906 | Ga0500655_000561 | |||
| 1907 | Ga0500658_0001466 | |||
| 1908 | Ga0500658_0001655 | |||
| 1909 | Ga0500559_0000607 | |||
| 1910 | Ga0500559_0001427 | |||
| 1911 | Ga0500559_0011941 | |||
| 1912 | Ga0500559_0012105 | |||
| 1913 | Ga0500559_0024336 | |||
| 1914 | Ga0500559_0054494 | |||
| 1915 | Ga0500559_0054945 | |||
| 1916 | Ga0500573_0000278 | |||
| 1917 | Ga0500573_0119818 | |||
| 1918 | Ga0500590_000301 | |||
| 1919 | Ga0500590_017734 | |||
| 1920 | Ga0500604_0002278 | |||
| 1921 | Ga0500616_0001893 | |||
| 1922 | Ga0500622_0001014 | |||
| 1923 | Ga0500622_0057718 | |||
| 1924 | Ga0500624_000015 | |||
| 1925 | Ga0500624_000023 | |||
| 1926 | Ga0500624_000289 | |||
| 1927 | Ga0500627_0000104 | |||
| 1928 | Ga0500627_0000488 | |||
| 1929 | Ga0500627_0000778 | |||
| 1930 | Ga0500636_0003237 | |||
| 1931 | Ga0500636_0011030 | |||
| 1932 | Ga0500636_0026651 | |||
| 1933 | Ga0500637_0000013 | |||
| 1934 | Ga0500637_0057843 | |||
| 1935 | Ga0500567_007512 | |||
| 1936 | Ga0500570_006332 | |||
| 1937 | Ga0500611_002591 | |||
| 1938 | Ga0500625_000002 | |||
| 1939 | Ga0500645_000002 | |||
| 1940 | Ga0500645_000780 | |||
| 1941 | Ga0500645_006477 | |||
| 1942 | Ga0500645_013828 | |||
| 1943 | Ga0500645_018269 | |||
| 1944 | Ga0500645_021520 | |||
| 1945 | Ga0500596_002731 | |||
| 1946 | 2511127888 | |||
| 1947 | 2512643376 | |||
| 1948 | 2585261175 | |||
| 1949 | 2600227764 | |||
| 1950 | 2643728122 | |||
| 1951 | 2643950313 | |||
| 1952 | 2644038908 | |||
| 1953 | 2644042929 | |||
| 1954 | 2644395640 | |||
| 1955 | 2738709712 | |||
| 1956 | 2738848137 | |||
| 1957 | 2738863866 | |||
| 1958 | 2739296384 | |||
| 1959 | 2739358062 | |||
| 1960 | 2739651933 | |||
| 1961 | 2740030407 | |||
| 1962 | 2778125010 | |||
| 1963 | 2809062414 | |||
| 1964 | 2809078246 | |||
| 1965 | 2809082803 | |||
| 1966 | 2819552456 | |||
| 1967 | 2819714197 | |||
| 1968 | 2830078125 | |||
| 1969 | 2848297489 | |||
| 1970 | 2879166507 | |||
| 1971 | 2880522326 | |||
| 1972 | 2882808499 | |||
| 1973 | 2895884209 | |||
| 1974 | 2896186822 | |||
| 1975 | 2919142784 | |||
| 1976 | 2919709701 | |||
| 1977 | 2928101268 | |||
| 1978 | 2928530411 | |||
| 1979 | 2928960321 | |||
| 1980 | 2928968207 | |||
| 1981 | 2990266443 | |||
| 1982 | 2993695764 | |||
| 1983 | 3000866560 | |||
| 1984 | 8054304953 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2as0-assembly1.cif.gz_B | crystal structure of ph1915 (apc 5817): a hypothetical rna methyltransferase | 0.9268 | 287 | 338 |
| 2w21-assembly1.cif.gz_A-2 | crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli. | 0.919 | 16 | 264 |
| 3zv0-assembly1.cif.gz_D | structure of the shq1p-cbf5p complex | 0.9132 | 286 | 346 |
| 3zv0-assembly1.cif.gz_C | structure of the shq1p-cbf5p complex | 0.9126 | 286 | 346 |
| 3uai-assembly1.cif.gz_A | structure of the shq1-cbf5-nop10-gar1 complex from saccharomyces cerevisiae | 0.9107 | 286 | 345 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2j5tB02 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain | 0.9745 | 286 | 377 | 2.30.130.10 |
| af_Q54LB6_223_322_2.30.130.10 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain | 0.9563 | 284 | 377 | 2.30.130.10 |
| af_A0A1D8PU95_3_196_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9459 | 17 | 201 | 3.40.1160.10 |
| 2j5tB02 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain | 0.9443 | 286 | 377 | 2.30.130.10 |
| af_O13810_285_387_2.30.130.10 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain | 0.9421 | 283 | 377 | 2.30.130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A355T3B8-F1-model_v4 | Glutamate 5-kinase | 0.9995 | 289 | 377 |
GO:0003723
GO:0004349 GO:0005524 GO:0005829 GO:0006561 |
| AF-A0A4Q3C6E4-F1-model_v4 | Glutamate 5-kinase | 0.9975 | 291 | 375 |
GO:0003723
GO:0004349 GO:0005524 GO:0005829 GO:0006561 |
| AF-A0A435K544-F1-model_v4 | deleted | 0.9939 | 295 | 377 |
|
| AF-A0A259IKD3-F1-model_v4 | deleted | 0.9916 | 291 | 377 |
|
| AF-A0A845Z6K0-F1-model_v4 | Glutamate 5-kinase | 0.9902 | 302 | 377 |
GO:0003723
GO:0004349 GO:0005524 GO:0005829 GO:0006561 |