F487669

General Info

Members Datasets Scaffolds Average Seq Length
992 373 1984 372

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0010962|Ga0496105_0010962_522_1787
Length 421
Sequence LLPAALADPHNQPAPESPARPLISPVTSPRHLPNRAAFPYPPAMPAPAIQSLADLGDATRAPRIVIKVGSALLVDATGARRAWLAALVAELAQARARGQQVIVVSSGAIALGARKLGLEKGGRASLADAQAAAAVGQIALSGLWAELLEAHGLTAAQLLLTLDDLEDRRRYLNATATLTRLLDAGAVPVINENDSVATQEIRFGDNDRLAARIAQAARASAVVLLSDIDGLYDRHPSDPGAKRLPLVKAITPEIRAMASPVSGSGMGSGGMISKLQAAEIAQLAGIALAIGNGHVEAPLARIAAGEGTLFPARQRTAARKAWLGGRLRLKGELVVDQGAAVALANGSSLLARGITASSGQFHRGDAVAIRNQAGETLAHGLAEYDAAECALLIGRHSSEHADLLGYAPRPAIVHRDQLVLL

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
197 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
198 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
204 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
246 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
281 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
282 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
283 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
284 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
285 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
286 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
287 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
288 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
289 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
292 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
293 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
297 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
298 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
302 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
305 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
306 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
307 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
308 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
311 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
312 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
313 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
314 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
315 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
316 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
317 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
318 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
321 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
322 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
326 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
327 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
328 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
329 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
330 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
331 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
332 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
333 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
334 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
335 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
336 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
337 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
338 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
339 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
340 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
341 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
342 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
343 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
344 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
345 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
346 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
347 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
348 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
349 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
350 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
351 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
352 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
353 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
354 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
355 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
356 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
357 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
358 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
359 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
360 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
361 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
362 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
363 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
364 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
365 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
366 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
367 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
368 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
369 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
370 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
371 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
372 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
373 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.07
Metatranscriptomes 0
Isolates 3.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 11.49
Nodule 0.2
Rhizoplane 4.94
Rhizosphere 72.08
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0010962 3300048908 Bacteria 7142
2 SwRhRL2b_contig_2235436 2162886007 Bacteria 72815
3 JGI24736J21556_1000256 3300001904 Bacteria 9743
4 JGI24741J21665_1001032 3300001915 Bacteria 8381
5 JGI24741J21665_1001215 3300001915 Bacteria 7580
6 JGI24752J21851_1000062 3300001976 Bacteria 13721
7 JGI24752J21851_1001369 3300001976 Bacteria 3295
8 JGI24752J21851_1007004 3300001976 Bacteria 1473
9 JGI24740J21852_10000540 3300001979 Bacteria 16192
10 JGI24740J21852_10005886 3300001979 Bacteria 5139
11 JGI24740J21852_10011274 3300001979 Bacteria 3408
12 JGI24739J22299_10001027 3300001989 Bacteria 10334
13 JGI24739J22299_10003942 3300001989 Bacteria 5678
14 JGI24739J22299_10004578 3300001989 Bacteria 5287
15 JGI24737J22298_10002455 3300001990 Bacteria 6602
16 JGI24737J22298_10004191 3300001990 Bacteria 5041
17 JGI24735J21928_10000861 3300002067 Bacteria 10803
18 JGI24735J21928_10003084 3300002067 Bacteria 5704
19 JGI24750J21931_1000036 3300002070 Bacteria 18006
20 JGI24748J21848_1000103 3300002074 Bacteria 18872
21 JGI24738J21930_10001565 3300002075 Bacteria 6314
22 JGI24749J21850_1000087 3300002076 Bacteria 16750
23 JGI24034J26672_10000057 3300002239 Bacteria 42515
24 JGI24742J22300_10004425 3300002244 Bacteria 2300
25 JGI24751J29686_10000054 3300002459 Bacteria 65209
26 JGI24751J29686_10000140 3300002459 Bacteria 35958
27 JGI25165J46597_1000012 3300003214 Bacteria 421074
28 JGI25153J46596_10000005 3300003215 Bacteria 492839
29 Ga0055525_1000012 3300003759 Bacteria 486564
30 Ga0055542_1000355 3300003762 Bacteria 48043
31 Ga0055529_1000045 3300003763 Bacteria 209617
32 Ga0065165_1004400 3300005262 Bacteria 8781
33 Ga0065704_10001493 3300005289 Bacteria 12929
34 Ga0065704_10007473 3300005289 Bacteria 6245
35 Ga0065704_10070176 3300005289 Bacteria 138803
36 Ga0065704_10105609 3300005289 Bacteria 2101
37 Ga0065707_10083253 3300005295 Bacteria 9789
38 Ga0070658_10000067 3300005327 Bacteria 103026
39 Ga0070658_10001571 3300005327 Bacteria 19350
40 Ga0070658_10032881 3300005327 Bacteria 4171
41 Ga0070658_10032902 3300005327 Bacteria 4169
42 Ga0070658_10105365 3300005327 Bacteria 2333
43 Ga0070683_100170222 3300005329 Bacteria 2068
44 Ga0070683_100172906 3300005329 Bacteria 2051
45 Ga0070690_100000011 3300005330 Bacteria 95472
46 Ga0070690_100046244 3300005330 Bacteria 2767
47 Ga0070670_100000003 3300005331 Bacteria 529510
48 Ga0070670_100000210 3300005331 Bacteria 54177
49 Ga0070670_100000965 3300005331 Bacteria 22582
50 Ga0070670_100009509 3300005331 Bacteria 8297
51 Ga0070670_100018785 3300005331 Bacteria 5926
52 Ga0070670_100190597 3300005331 Bacteria 1781
53 Ga0070670_100240614 3300005331 Bacteria 1576
54 Ga0070666_10000035 3300005335 Bacteria 121458
55 Ga0070666_10000089 3300005335 Bacteria 64147
56 Ga0070666_10013840 3300005335 Bacteria 5127
57 Ga0070666_10036618 3300005335 Bacteria 3259
58 Ga0070666_10158615 3300005335 Bacteria 1581
59 Ga0070666_10198050 3300005335 Bacteria 1413
60 Ga0070680_100011845 3300005336 Bacteria 6763
61 Ga0070660_100075680 3300005339 Bacteria 2636
62 Ga0070660_100148168 3300005339 Bacteria 1886
63 Ga0070689_100002742 3300005340 Bacteria 11551
64 Ga0070661_100011173 3300005344 Bacteria 6255
65 Ga0070668_100000003 3300005347 Bacteria 195738
66 Ga0070668_100000014 3300005347 Bacteria 112374
67 Ga0070668_100003251 3300005347 Bacteria 11982
68 Ga0070668_100007280 3300005347 Bacteria 8209
69 Ga0070668_100042436 3300005347 Bacteria 3487
70 Ga0070669_100000020 3300005353 Bacteria 181297
71 Ga0070669_100000024 3300005353 Bacteria 173107
72 Ga0070669_100000334 3300005353 Bacteria 36683
73 Ga0070669_100000473 3300005353 Bacteria 30554
74 Ga0070669_100000712 3300005353 Bacteria 24397
75 Ga0070669_100002131 3300005353 Bacteria 14306
76 Ga0070669_100003995 3300005353 Bacteria 10660
77 Ga0070669_100024149 3300005353 Bacteria 4357
78 Ga0070669_100034312 3300005353 Bacteria 3673
79 Ga0070669_100050393 3300005353 Bacteria 3041
80 Ga0070669_100157764 3300005353 Bacteria 1761
81 Ga0070671_100000006 3300005355 Bacteria 250635
82 Ga0070671_100000138 3300005355 Bacteria 46941
83 Ga0070671_100000435 3300005355 Bacteria 28993
84 Ga0070671_100000542 3300005355 Bacteria 26647
85 Ga0070671_100002625 3300005355 Bacteria 13916
86 Ga0070671_100039115 3300005355 Bacteria 3937
87 Ga0070671_100210640 3300005355 Bacteria 1648
88 Ga0070674_100011307 3300005356 Bacteria 5430
89 Ga0070688_100001328 3300005365 Bacteria 12256
90 Ga0070659_100008121 3300005366 Bacteria 7656
91 Ga0070659_100070457 3300005366 Bacteria 2777
92 Ga0070659_100216272 3300005366 Bacteria 1581
93 Ga0070667_100000051 3300005367 Bacteria 155117
94 Ga0070667_100000128 3300005367 Bacteria 95780
95 Ga0070667_100000298 3300005367 Bacteria 55786
96 Ga0070667_100000851 3300005367 Bacteria 28385
97 Ga0070667_100001003 3300005367 Bacteria 25848
98 Ga0070667_100002068 3300005367 Bacteria 17765
99 Ga0070667_100004204 3300005367 Bacteria 12158
100 Ga0070667_100011284 3300005367 Bacteria 7391
101 Ga0070667_100014546 3300005367 Bacteria 6503
102 Ga0070667_100040604 3300005367 Bacteria 3902
103 Ga0070667_100049569 3300005367 Bacteria 3537
104 Ga0070667_100104253 3300005367 Bacteria 2453
105 Ga0070705_100004759 3300005440 Bacteria 6608
106 Ga0070705_100099149 3300005440 Bacteria 1835
107 Ga0070708_100094332 3300005445 Bacteria 2730
108 Ga0070663_100017417 3300005455 Bacteria 4689
109 Ga0070663_100100915 3300005455 Bacteria 2153
110 Ga0070663_100129135 3300005455 Bacteria 1917
111 Ga0070678_100012555 3300005456 Bacteria 5274
112 Ga0070662_100012698 3300005457 Bacteria 5590
113 Ga0070681_10005668 3300005458 Bacteria 12071
114 Ga0068867_100007513 3300005459 Bacteria 7706
115 Ga0068867_100235491 3300005459 Bacteria 1482
116 Ga0070685_10000168 3300005466 Bacteria 43369
117 Ga0070679_100008282 3300005530 Bacteria 9782
118 Ga0068853_100004036 3300005539 Bacteria 11295
119 Ga0068853_100009085 3300005539 Bacteria 8003
120 Ga0068853_100019326 3300005539 Bacteria 5648
121 Ga0068853_100025577 3300005539 Bacteria 4954
122 Ga0068853_100174305 3300005539 Bacteria 1947
123 Ga0070672_100315773 3300005543 Bacteria 1327
124 Ga0070686_100001324 3300005544 Bacteria 14003
125 Ga0070686_100017427 3300005544 Bacteria 4197
126 Ga0070665_100000161 3300005548 Bacteria 122088
127 Ga0070665_100000206 3300005548 Bacteria 102989
128 Ga0070665_100001356 3300005548 Bacteria 28943
129 Ga0070665_100010985 3300005548 Bacteria 9156
130 Ga0070665_100012580 3300005548 Bacteria 8522
131 Ga0070665_100088252 3300005548 Bacteria 3107
132 Ga0070665_100137757 3300005548 Bacteria 2444
133 Ga0070665_100287580 3300005548 Bacteria 1646
134 Ga0068855_100000962 3300005563 Bacteria 35800
135 Ga0068855_100014816 3300005563 Bacteria 9389
136 Ga0068855_100015135 3300005563 Bacteria 9288
137 Ga0068855_100040224 3300005563 Bacteria 5549
138 Ga0068855_100060879 3300005563 Bacteria 4412
139 Ga0070664_100013946 3300005564 Bacteria 6552
140 Ga0070664_100020427 3300005564 Bacteria 5453
141 Ga0070664_100102464 3300005564 Bacteria 2490
142 Ga0068857_100009607 3300005577 Bacteria 8404
143 Ga0068857_100018029 3300005577 Bacteria 6193
144 Ga0068857_100065228 3300005577 Bacteria 3237
145 Ga0068857_100069212 3300005577 Bacteria 3143
146 Ga0068857_100084922 3300005577 Bacteria 2829
147 Ga0068857_100194718 3300005577 Bacteria 1847
148 Ga0068857_100245112 3300005577 Bacteria 1641
149 Ga0068854_100003154 3300005578 Bacteria 10274
150 Ga0068854_100010741 3300005578 Bacteria 5941
151 Ga0068854_100012195 3300005578 Bacteria 5624
152 Ga0068854_100019472 3300005578 Bacteria 4574
153 Ga0068854_100305493 3300005578 Bacteria 1288
154 Ga0068856_100004323 3300005614 Bacteria 14177
155 Ga0068856_100011400 3300005614 Bacteria 8622
156 Ga0068856_100142927 3300005614 Bacteria 2400
157 Ga0068856_100332962 3300005614 Bacteria 1536
158 Ga0068856_100494178 3300005614 Bacteria 1244
159 Ga0070702_100028407 3300005615 Bacteria 3031
160 Ga0068852_100000075 3300005616 Bacteria 69379
161 Ga0068852_100108194 3300005616 Bacteria 2523
162 Ga0068852_100183379 3300005616 Bacteria 1970
163 Ga0068859_100000256 3300005617 Bacteria 52870
164 Ga0068859_100001299 3300005617 Bacteria 25520
165 Ga0068859_100006610 3300005617 Bacteria 11774
166 Ga0068859_100025168 3300005617 Bacteria 5973
167 Ga0068864_100000005 3300005618 Bacteria 400840
168 Ga0068864_100000332 3300005618 Bacteria 41671
169 Ga0068864_100000642 3300005618 Bacteria 29378
170 Ga0068864_100001753 3300005618 Bacteria 17839
171 Ga0068864_100025454 3300005618 Bacteria 4983
172 Ga0068864_100053335 3300005618 Bacteria 3488
173 Ga0068864_100118219 3300005618 Bacteria 2367
174 Ga0068861_100001329 3300005719 Bacteria 15509
175 Ga0068861_100015879 3300005719 Bacteria 5317
176 Ga0068861_100088296 3300005719 Bacteria 2441
177 Ga0068851_10011445 3300005834 Bacteria 4161
178 Ga0068851_10042184 3300005834 Bacteria 2296
179 Ga0068863_100000016 3300005841 Bacteria 213575
180 Ga0068863_100000028 3300005841 Bacteria 181662
181 Ga0068863_100000060 3300005841 Bacteria 122123
182 Ga0068863_100000456 3300005841 Bacteria 41671
183 Ga0068863_100000719 3300005841 Bacteria 33262
184 Ga0068863_100005237 3300005841 Bacteria 12796
185 Ga0068863_100010358 3300005841 Bacteria 9058
186 Ga0068863_100017269 3300005841 Bacteria 6922
187 Ga0068863_100028865 3300005841 Bacteria 5298
188 Ga0068863_100415980 3300005841 Bacteria 1316
189 Ga0068858_100000304 3300005842 Bacteria 52470
190 Ga0068858_100000472 3300005842 Bacteria 41922
191 Ga0068858_100002895 3300005842 Bacteria 17259
192 Ga0068858_100004091 3300005842 Bacteria 14368
193 Ga0068858_100016712 3300005842 Bacteria 6891
194 Ga0068858_100022636 3300005842 Bacteria 5860
195 Ga0068858_100104346 3300005842 Bacteria 2644
196 Ga0068860_100000126 3300005843 Bacteria 122923
197 Ga0068860_100000143 3300005843 Bacteria 116787
198 Ga0068860_100000168 3300005843 Bacteria 107408
199 Ga0068860_100000412 3300005843 Bacteria 55786
200 Ga0068860_100001698 3300005843 Bacteria 23527
201 Ga0068860_100006149 3300005843 Bacteria 12074
202 Ga0068860_100007410 3300005843 Bacteria 10976
203 Ga0068860_100017637 3300005843 Bacteria 6956
204 Ga0068860_100174989 3300005843 Bacteria 2074
205 Ga0068862_100000001 3300005844 Bacteria 523031
206 Ga0068862_100000085 3300005844 Bacteria 110879
207 Ga0068862_100000168 3300005844 Bacteria 72749
208 Ga0068862_100000310 3300005844 Bacteria 53315
209 Ga0068862_100000506 3300005844 Bacteria 41538
210 Ga0068862_100001574 3300005844 Bacteria 20794
211 Ga0068862_100010705 3300005844 Bacteria 7573
212 Ga0068862_100010728 3300005844 Bacteria 7566
213 Ga0068862_100040836 3300005844 Bacteria 3945
214 Ga0068862_100089890 3300005844 Bacteria 2673
215 Ga0081455_10000131 3300005937 Bacteria 87553
216 Ga0075368_10001483 3300006042 Bacteria 7519
217 Ga0075368_10041808 3300006042 Bacteria 1801
218 Ga0075363_100003377 3300006048 Bacteria 6781
219 Ga0075363_100003814 3300006048 Bacteria 6495
220 Ga0075364_10016692 3300006051 Bacteria 4572
221 Ga0075432_10004187 3300006058 Bacteria 4911
222 Ga0075362_10000234 3300006177 Bacteria 15472
223 Ga0075362_10000526 3300006177 Bacteria 11123
224 Ga0075367_10000092 3300006178 Bacteria 24598
225 Ga0075366_10000168 3300006195 Bacteria 28069
226 Ga0075366_10006887 3300006195 Bacteria 6254
227 Ga0075366_10021504 3300006195 Bacteria 3750
228 Ga0097621_100136045 3300006237 Bacteria 2096
229 Ga0075370_10000032 3300006353 Bacteria 44839
230 Ga0075370_10045379 3300006353 Bacteria 2486
231 Ga0075429_100039568 3300006880 Bacteria 4103
232 Ga0075429_100102528 3300006880 Bacteria 2498
233 Ga0097620_100000256 3300006931 Bacteria 52870
234 Ga0097620_100001299 3300006931 Bacteria 25520
235 Ga0097620_100006610 3300006931 Bacteria 11774
236 Ga0097620_100025168 3300006931 Bacteria 5973
237 Ga0079104_1008150 3300006946 Bacteria 3705
238 Ga0105251_10001625 3300009011 Bacteria 19048
239 Ga0105251_10001861 3300009011 Bacteria 17335
240 Ga0105251_10010467 3300009011 Bacteria 5379
241 Ga0105251_10061191 3300009011 Bacteria 1771
242 Ga0105251_10069374 3300009011 Bacteria 1643
243 Ga0105240_10001848 3300009093 Bacteria 35437
244 Ga0105240_10010488 3300009093 Bacteria 13024
245 Ga0105240_10035481 3300009093 Bacteria 6426
246 Ga0105240_10070426 3300009093 Bacteria 4326
247 Ga0105240_10078303 3300009093 Bacteria 4071
248 Ga0105245_10001108 3300009098 Bacteria 24360
249 Ga0105247_10000644 3300009101 Bacteria 27956
250 Ga0105247_10037912 3300009101 Bacteria 2941
251 Ga0114129_10021496 3300009147 Bacteria 9159
252 Ga0105243_10000423 3300009148 Bacteria 44393
253 Ga0105243_10075604 3300009148 Bacteria 2734
254 Ga0105243_10261150 3300009148 Bacteria 1550
255 Ga0105241_10000997 3300009174 Bacteria 21452
256 Ga0105241_10166400 3300009174 Bacteria 1817
257 Ga0105248_10000029 3300009177 Bacteria 223366
258 Ga0105248_10000086 3300009177 Bacteria 106349
259 Ga0105248_10013528 3300009177 Bacteria 8982
260 Ga0105248_10024262 3300009177 Bacteria 6743
261 Ga0105248_10031271 3300009177 Bacteria 5949
262 Ga0105248_10120069 3300009177 Bacteria 2965
263 Ga0105248_10175942 3300009177 Bacteria 2412
264 Ga0105237_10002073 3300009545 Bacteria 25405
265 Ga0105237_10007129 3300009545 Bacteria 12280
266 Ga0105237_10009460 3300009545 Bacteria 10438
267 Ga0105237_10140837 3300009545 Bacteria 2406
268 Ga0105238_10017115 3300009551 Bacteria 7359
269 Ga0105238_10182143 3300009551 Bacteria 2077
270 Ga0105238_10203403 3300009551 Bacteria 1956
271 Ga0105238_10254974 3300009551 Bacteria 1733
272 Ga0105249_10000024 3300009553 Bacteria 232947
273 Ga0105249_10000038 3300009553 Bacteria 196425
274 Ga0105249_10000094 3300009553 Bacteria 122611
275 Ga0105249_10002324 3300009553 Bacteria 16499
276 Ga0105249_10348210 3300009553 Bacteria 1500
277 Ga0105148_100059 3300009978 Bacteria 17255
278 Ga0105239_10027686 3300010375 Bacteria 6236
279 Ga0105239_10067612 3300010375 Bacteria 3925
280 Ga0105239_10618628 3300010375 Bacteria 1236
281 Ga0157326_1000001 3300012513 Bacteria 19397
282 Ga0157373_10003358 3300013100 Bacteria 12096
283 Ga0157371_10000032 3300013102 Bacteria 230252
284 Ga0157371_10003665 3300013102 Bacteria 13817
285 Ga0157371_10140860 3300013102 Bacteria 1718
286 Ga0157370_10013758 3300013104 Bacteria 8315
287 Ga0157370_10051407 3300013104 Bacteria 3937
288 Ga0157370_10053190 3300013104 Bacteria 3862
289 Ga0157370_10330811 3300013104 Bacteria 1405
290 Ga0157369_10115578 3300013105 Bacteria 2849
291 Ga0157369_10289035 3300013105 Bacteria 1707
292 Ga0157378_10187768 3300013297 Bacteria 1947
293 Ga0163162_10003527 3300013306 Bacteria 14967
294 Ga0163162_10012124 3300013306 Bacteria 8412
295 Ga0163162_10015484 3300013306 Bacteria 7452
296 Ga0163162_10044800 3300013306 Bacteria 4432
297 Ga0157372_10035441 3300013307 Bacteria 5494
298 Ga0157372_10242033 3300013307 Bacteria 2093
299 Ga0157372_10328848 3300013307 Bacteria 1780
300 Ga0163163_10008504 3300014325 Bacteria 9122
301 Ga0163163_10172430 3300014325 Bacteria 2210
302 Ga0157380_10000060 3300014326 Bacteria 62248
303 Ga0157380_10000542 3300014326 Bacteria 23239
304 Ga0157380_10148878 3300014326 Bacteria 2021
305 Ga0157379_10004525 3300014968 Bacteria 11922
306 Ga0157379_10042529 3300014968 Bacteria 4057
307 Ga0183363_1004 3300015690 Bacteria 416766
308 Ga0163161_10000716 3300017792 Bacteria 26178
309 Ga0163161_10082721 3300017792 Bacteria 2366
310 Ga0213875_10000264 3300021388 Bacteria 52435
311 Ga0209147_104064 3300025229 Bacteria 2558
312 Ga0209563_100030 3300025230 Bacteria 489259
313 Ga0209677_104116 3300025253 Bacteria 4355
314 Ga0209148_1000011 3300025254 Bacteria 1196503
315 Ga0209233_1000058 3300025261 Bacteria 421872
316 Ga0209455_1000006 3300025272 Bacteria 1196503
317 Ga0209758_1000001 3300025297 Bacteria 1981790
318 Ga0209050_1000441 3300025298 Bacteria 75474
319 Ga0207697_10000419 3300025315 Bacteria 24002
320 Ga0207697_10012242 3300025315 Bacteria 3602
321 Ga0207697_10015555 3300025315 Bacteria 3142
322 Ga0207656_10000378 3300025321 Bacteria 14923
323 Ga0207656_10005981 3300025321 Bacteria 4347
324 Ga0207713_1002460 3300025735 Bacteria 13462
325 Ga0207713_1016496 3300025735 Bacteria 3746
326 Ga0207710_10006923 3300025900 Bacteria 4823
327 Ga0207710_10035134 3300025900 Bacteria 2205
328 Ga0207680_10000007 3300025903 Bacteria 623574
329 Ga0207680_10000517 3300025903 Bacteria 18430
330 Ga0207680_10003829 3300025903 Bacteria 7085
331 Ga0207680_10125961 3300025903 Bacteria 1682
332 Ga0207680_10140440 3300025903 Bacteria 1601
333 Ga0207680_10155143 3300025903 Bacteria 1530
334 Ga0207647_10008366 3300025904 Bacteria 7421
335 Ga0207647_10026599 3300025904 Bacteria 3783
336 Ga0207647_10064805 3300025904 Bacteria 2219
337 Ga0207645_10165005 3300025907 Bacteria 1450
338 Ga0207705_10000075 3300025909 Bacteria 123551
339 Ga0207705_10000122 3300025909 Bacteria 86442
340 Ga0207705_10090342 3300025909 Bacteria 2242
341 Ga0207705_10123396 3300025909 Bacteria 1924
342 Ga0207654_10002907 3300025911 Bacteria 8680
343 Ga0207707_10069377 3300025912 Bacteria 3072
344 Ga0207707_10141338 3300025912 Bacteria 2105
345 Ga0207695_10000288 3300025913 Bacteria 125085
346 Ga0207695_10006069 3300025913 Bacteria 15766
347 Ga0207695_10015610 3300025913 Bacteria 8933
348 Ga0207695_10036202 3300025913 Bacteria 5338
349 Ga0207695_10055082 3300025913 Bacteria 4147
350 Ga0207695_10075297 3300025913 Bacteria 3435
351 Ga0207695_10095696 3300025913 Bacteria 2973
352 Ga0207695_10150591 3300025913 Bacteria 2266
353 Ga0207671_10001439 3300025914 Bacteria 27570
354 Ga0207671_10006770 3300025914 Bacteria 10131
355 Ga0207671_10018947 3300025914 Bacteria 5272
356 Ga0207657_10000408 3300025919 Bacteria 45400
357 Ga0207657_10002471 3300025919 Bacteria 19998
358 Ga0207657_10007801 3300025919 Bacteria 10926
359 Ga0207657_10011633 3300025919 Bacteria 8727
360 Ga0207657_10085021 3300025919 Bacteria 2651
361 Ga0207657_10186792 3300025919 Bacteria 1673
362 Ga0207649_10000482 3300025920 Bacteria 28301
363 Ga0207649_10159200 3300025920 Bacteria 1563
364 Ga0207652_10008597 3300025921 Bacteria 8216
365 Ga0207652_10114171 3300025921 Bacteria 2398
366 Ga0207681_10000004 3300025923 Bacteria 559005
367 Ga0207681_10000005 3300025923 Bacteria 555724
368 Ga0207681_10000089 3300025923 Bacteria 79526
369 Ga0207681_10000503 3300025923 Bacteria 27243
370 Ga0207681_10000663 3300025923 Bacteria 22786
371 Ga0207681_10001365 3300025923 Bacteria 15750
372 Ga0207681_10004407 3300025923 Bacteria 8674
373 Ga0207681_10018758 3300025923 Bacteria 4363
374 Ga0207681_10041605 3300025923 Bacteria 3065
375 Ga0207681_10140268 3300025923 Bacteria 1799
376 Ga0207694_10005621 3300025924 Bacteria 9610
377 Ga0207694_10009731 3300025924 Bacteria 7251
378 Ga0207694_10018966 3300025924 Bacteria 5200
379 Ga0207694_10061619 3300025924 Bacteria 2920
380 Ga0207694_10175781 3300025924 Bacteria 1735
381 Ga0207694_10182713 3300025924 Bacteria 1701
382 Ga0207694_10237460 3300025924 Bacteria 1489
383 Ga0207650_10000004 3300025925 Bacteria 743372
384 Ga0207650_10000545 3300025925 Bacteria 30685
385 Ga0207650_10010295 3300025925 Bacteria 6409
386 Ga0207650_10015807 3300025925 Bacteria 5262
387 Ga0207650_10047790 3300025925 Bacteria 3154
388 Ga0207650_10083091 3300025925 Bacteria 2432
389 Ga0207687_10000853 3300025927 Bacteria 20620
390 Ga0207644_10000005 3300025931 Bacteria 441948
391 Ga0207644_10000009 3300025931 Bacteria 251643
392 Ga0207644_10000447 3300025931 Bacteria 26636
393 Ga0207644_10001520 3300025931 Bacteria 14966
394 Ga0207644_10003216 3300025931 Bacteria 10526
395 Ga0207644_10020323 3300025931 Bacteria 4515
396 Ga0207644_10021357 3300025931 Bacteria 4409
397 Ga0207644_10070832 3300025931 Bacteria 2549
398 Ga0207690_10000696 3300025932 Bacteria 21652
399 Ga0207690_10023275 3300025932 Bacteria 3865
400 Ga0207690_10031743 3300025932 Bacteria 3383
401 Ga0207690_10225677 3300025932 Bacteria 1436
402 Ga0207706_10002919 3300025933 Bacteria 16521
403 Ga0207706_10004237 3300025933 Bacteria 13507
404 Ga0207706_10012315 3300025933 Bacteria 7791
405 Ga0207706_10075750 3300025933 Bacteria 2959
406 Ga0207709_10000574 3300025935 Bacteria 30979
407 Ga0207709_10193909 3300025935 Bacteria 1445
408 Ga0207670_10013004 3300025936 Bacteria 4894
409 Ga0207669_10006239 3300025937 Bacteria 5431
410 Ga0207711_10000004 3300025941 Bacteria 870636
411 Ga0207711_10000310 3300025941 Bacteria 52175
412 Ga0207711_10002363 3300025941 Bacteria 16902
413 Ga0207711_10019413 3300025941 Bacteria 5661
414 Ga0207711_10024128 3300025941 Bacteria 5090
415 Ga0207711_10048966 3300025941 Bacteria 3617
416 Ga0207661_10256435 3300025944 Bacteria 1556
417 Ga0207679_10100238 3300025945 Bacteria 2263
418 Ga0207667_10000002 3300025949 Bacteria 895662
419 Ga0207667_10004952 3300025949 Bacteria 16269
420 Ga0207667_10008229 3300025949 Bacteria 12408
421 Ga0207667_10013795 3300025949 Bacteria 9232
422 Ga0207667_10118401 3300025949 Bacteria 2729
423 Ga0207667_10301320 3300025949 Bacteria 1638
424 Ga0207712_10000002 3300025961 Bacteria 706628
425 Ga0207712_10000004 3300025961 Bacteria 614655
426 Ga0207712_10000034 3300025961 Bacteria 202320
427 Ga0207668_10000006 3300025972 Bacteria 191468
428 Ga0207668_10000047 3300025972 Bacteria 101453
429 Ga0207668_10003433 3300025972 Bacteria 9293
430 Ga0207668_10003815 3300025972 Bacteria 8882
431 Ga0207668_10004706 3300025972 Bacteria 8024
432 Ga0207668_10009940 3300025972 Bacteria 5722
433 Ga0207668_10316619 3300025972 Bacteria 1293
434 Ga0207640_10000570 3300025981 Bacteria 21973
435 Ga0207640_10000586 3300025981 Bacteria 21662
436 Ga0207640_10002545 3300025981 Bacteria 9776
437 Ga0207640_10018948 3300025981 Bacteria 4054
438 Ga0207640_10070046 3300025981 Bacteria 2357
439 Ga0207658_10000026 3300025986 Bacteria 178292
440 Ga0207658_10000057 3300025986 Bacteria 124003
441 Ga0207658_10000254 3300025986 Bacteria 55800
442 Ga0207658_10000434 3300025986 Bacteria 39528
443 Ga0207658_10001330 3300025986 Bacteria 19356
444 Ga0207658_10002894 3300025986 Bacteria 12306
445 Ga0207658_10002944 3300025986 Bacteria 12197
446 Ga0207658_10003250 3300025986 Bacteria 11554
447 Ga0207658_10007629 3300025986 Bacteria 7368
448 Ga0207658_10025127 3300025986 Bacteria 4169
449 Ga0207658_10031477 3300025986 Bacteria 3767
450 Ga0207658_10110014 3300025986 Bacteria 2176
451 Ga0207703_10000435 3300026035 Bacteria 43900
452 Ga0207703_10000568 3300026035 Bacteria 37997
453 Ga0207703_10001463 3300026035 Bacteria 21547
454 Ga0207703_10001946 3300026035 Bacteria 18263
455 Ga0207703_10001956 3300026035 Bacteria 18195
456 Ga0207703_10012521 3300026035 Bacteria 6612
457 Ga0207703_10070059 3300026035 Bacteria 2894
458 Ga0207703_10109986 3300026035 Bacteria 2350
459 Ga0207703_10126510 3300026035 Bacteria 2201
460 Ga0207639_10000777 3300026041 Bacteria 21710
461 Ga0207639_10003342 3300026041 Bacteria 10792
462 Ga0207639_10018070 3300026041 Bacteria 5005
463 Ga0207639_10020172 3300026041 Bacteria 4768
464 Ga0207639_10045628 3300026041 Bacteria 3302
465 Ga0207639_10074344 3300026041 Bacteria 2668
466 Ga0207639_10224291 3300026041 Bacteria 1625
467 Ga0207678_10000324 3300026067 Bacteria 42936
468 Ga0207678_10005545 3300026067 Bacteria 11277
469 Ga0207678_10013334 3300026067 Bacteria 7212
470 Ga0207678_10041873 3300026067 Bacteria 3970
471 Ga0207702_10005910 3300026078 Bacteria 10640
472 Ga0207702_10006661 3300026078 Bacteria 9934
473 Ga0207702_10037147 3300026078 Bacteria 4076
474 Ga0207702_10113339 3300026078 Bacteria 2414
475 Ga0207702_10113370 3300026078 Bacteria 2414
476 Ga0207702_10255571 3300026078 Bacteria 1647
477 Ga0207641_10000010 3300026088 Bacteria 402193
478 Ga0207641_10000014 3300026088 Bacteria 336170
479 Ga0207641_10000100 3300026088 Bacteria 122664
480 Ga0207641_10000315 3300026088 Bacteria 60017
481 Ga0207641_10000346 3300026088 Bacteria 55535
482 Ga0207641_10002472 3300026088 Bacteria 17065
483 Ga0207641_10002944 3300026088 Bacteria 15396
484 Ga0207641_10017728 3300026088 Bacteria 5832
485 Ga0207641_10022838 3300026088 Bacteria 5151
486 Ga0207641_10025121 3300026088 Bacteria 4911
487 Ga0207641_10025885 3300026088 Bacteria 4839
488 Ga0207676_10000006 3300026095 Bacteria 681936
489 Ga0207676_10000036 3300026095 Bacteria 198447
490 Ga0207676_10000603 3300026095 Bacteria 29490
491 Ga0207676_10002760 3300026095 Bacteria 12487
492 Ga0207676_10003853 3300026095 Bacteria 10592
493 Ga0207676_10004588 3300026095 Bacteria 9784
494 Ga0207676_10011106 3300026095 Bacteria 6428
495 Ga0207676_10028724 3300026095 Bacteria 4158
496 Ga0207674_10003143 3300026116 Bacteria 20360
497 Ga0207674_10004472 3300026116 Bacteria 16807
498 Ga0207674_10009082 3300026116 Bacteria 11411
499 Ga0207674_10012390 3300026116 Bacteria 9533
500 Ga0207674_10014452 3300026116 Bacteria 8719
501 Ga0207674_10085003 3300026116 Bacteria 3161
502 Ga0207674_10100585 3300026116 Bacteria 2873
503 Ga0207674_10161876 3300026116 Bacteria 2192
504 Ga0207674_10330920 3300026116 Bacteria 1473
505 Ga0207675_100000740 3300026118 Bacteria 32427
506 Ga0207675_100003757 3300026118 Bacteria 14793
507 Ga0207675_100020136 3300026118 Bacteria 6222
508 Ga0207683_10022042 3300026121 Bacteria 5465
509 Ga0207698_10000005 3300026142 Bacteria 295687
510 Ga0207698_10027376 3300026142 Bacteria 4046
511 Ga0209281_1010835 3300027111 Bacteria 2063
512 Ga0209983_1009114 3300027665 Bacteria 2028
513 Ga0209813_10000114 3300027866 Bacteria 29415
514 Ga0209813_10000530 3300027866 Bacteria 9004
515 Ga0207428_10036711 3300027907 Bacteria 3994
516 Ga0268266_10000002 3300028379 Bacteria 3059047
517 Ga0268266_10000040 3300028379 Bacteria 323843
518 Ga0268266_10000534 3300028379 Bacteria 53027
519 Ga0268266_10008419 3300028379 Bacteria 9172
520 Ga0268266_10015509 3300028379 Bacteria 6536
521 Ga0268266_10029365 3300028379 Bacteria 4675
522 Ga0268265_10000001 3300028380 Bacteria 1230727
523 Ga0268265_10000059 3300028380 Bacteria 152531
524 Ga0268265_10000104 3300028380 Bacteria 105776
525 Ga0268265_10000986 3300028380 Bacteria 25848
526 Ga0268265_10001459 3300028380 Bacteria 19860
527 Ga0268265_10002264 3300028380 Bacteria 14694
528 Ga0268265_10002795 3300028380 Bacteria 12867
529 Ga0268265_10013635 3300028380 Bacteria 5527
530 Ga0268265_10070580 3300028380 Bacteria 2717
531 Ga0268265_10107211 3300028380 Bacteria 2271
532 Ga0268264_10000003 3300028381 Bacteria 1141976
533 Ga0268264_10000040 3300028381 Bacteria 373714
534 Ga0268264_10000069 3300028381 Bacteria 270492
535 Ga0268264_10000076 3300028381 Bacteria 255518
536 Ga0268264_10000083 3300028381 Bacteria 245366
537 Ga0268264_10004451 3300028381 Bacteria 11955
538 Ga0268264_10012761 3300028381 Bacteria 6914
539 Ga0268264_10029925 3300028381 Bacteria 4464
540 Ga0268264_10146421 3300028381 Bacteria 2112
541 Ga0265323_10023219 3300028653 Bacteria 2366
542 Ga0307517_10076293 3300028786 Bacteria 2929
543 Ga0265330_10009538 3300031235 Unclassified 4608
544 Ga0265331_10064820 3300031250 Bacteria 1719
545 Ga0265327_10034616 3300031251 Bacteria 2801
546 Ga0265316_10002067 3300031344 Bacteria 21137
547 Ga0307513_10006540 3300031456 Bacteria 15221
548 Ga0307513_10040993 3300031456 Bacteria 5114
549 Ga0307408_100024261 3300031548 Bacteria 4139
550 Ga0307408_100062683 3300031548 Bacteria 2717
551 Ga0307408_100069487 3300031548 Bacteria 2597
552 Ga0307508_10001821 3300031616 Bacteria 23580
553 Ga0265342_10103895 3300031712 Bacteria 1615
554 Ga0307405_10003814 3300031731 Bacteria 7008
555 Ga0307413_10061015 3300031824 Bacteria 2324
556 Ga0307413_10246634 3300031824 Bacteria 1322
557 Ga0307410_10032147 3300031852 Bacteria 3374
558 Ga0307410_10131432 3300031852 Bacteria 1839
559 Ga0307406_10043622 3300031901 Bacteria 2806
560 Ga0307412_10000457 3300031911 Bacteria 24624
561 Ga0307412_10002757 3300031911 Bacteria 9760
562 Ga0307412_10004671 3300031911 Bacteria 7639
563 Ga0307412_10025366 3300031911 Bacteria 3671
564 Ga0307412_10025379 3300031911 Bacteria 3671
565 Ga0307412_10043331 3300031911 Bacteria 2929
566 Ga0307412_10066770 3300031911 Bacteria 2439
567 Ga0307412_10086777 3300031911 Bacteria 2179
568 Ga0307409_100108884 3300031995 Bacteria 2318
569 Ga0307416_100046276 3300032002 Bacteria 3432
570 Ga0307416_100080150 3300032002 Bacteria 2754
571 Ga0307416_100111520 3300032002 Bacteria 2412
572 Ga0307414_10000070 3300032004 Bacteria 96231
573 Ga0307414_10000288 3300032004 Bacteria 29634
574 Ga0307414_10000359 3300032004 Bacteria 25279
575 Ga0307411_10007009 3300032005 Bacteria 5696
576 Ga0307411_10230582 3300032005 Bacteria 1443
577 Ga0307415_100206526 3300032126 Bacteria 1563
578 Ga0316583_10008936 3300032133 Bacteria 3612
579 Ga0307510_10008642 3300033180 Bacteria 12135
580 Ga0373937_0071330 3300036401 Bacteria 3204
581 Ga0316582_0014476 3300036647 Bacteria 4477
582 Ga0316584_0074383 3300036712 Bacteria 2547
583 Ga0316584_0087070 3300036712 Bacteria 2338
584 Ga0395900_0044548 3300037418 Bacteria 4571
585 Ga0395898_0018073 3300037466 Bacteria 7193
586 Ga0436364_1200653 3300037853 Bacteria 55826
587 Ga0395901_0018063 3300038443 Bacteria 7199
588 Ga0439436_0009476 3300041404 Bacteria 2986
589 Ga0439436_0018522 3300041404 Bacteria 2082
590 Ga0439461_0000086 3300041410 Bacteria 12130
591 Ga0439465_0001125 3300041413 Bacteria 8568
592 Ga0439465_0016622 3300041413 Bacteria 2295
593 Ga0451802_1561412 3300041460 Bacteria 1770
594 Ga0439431_0000491 3300041997 Bacteria 8366
595 Ga0439431_0020680 3300041997 Bacteria 1574
596 Ga0439445_0011274 3300042004 Bacteria 2129
597 Ga0439432_005779 3300042006 Bacteria 4444
598 Ga0439452_025280 3300042010 Bacteria 1509
599 Ga0439462_0002734 3300042015 Bacteria 4143
600 Ga0453684_0260886 3300044712 Bacteria 1985
601 Ga0451576_0000588 3300045051 Bacteria 77026
602 Ga0451576_0215241 3300045051 Bacteria 2006
603 Ga0466967_0082472 3300045976 Bacteria 2906
604 Ga0495617_025936 3300046452 Bacteria 1974
605 Ga0495627_000094 3300046453 Bacteria 108256
606 Ga0495627_000391 3300046453 Bacteria 39764
607 Ga0495627_001469 3300046453 Bacteria 13724
608 Ga0495629_0046040 3300046459 Bacteria 3060
609 Ga0495638_0000018 3300046460 Bacteria 389696
610 Ga0495638_0001145 3300046460 Bacteria 25617
611 Ga0495638_0006816 3300046460 Bacteria 8247
612 Ga0495638_0015526 3300046460 Bacteria 5113
613 Ga0495638_0017047 3300046460 Bacteria 4853
614 Ga0495638_0043711 3300046460 Bacteria 2825
615 Ga0495638_0111145 3300046460 Bacteria 1628
616 Ga0495650_0000158 3300046471 Bacteria 154681
617 Ga0495650_0001135 3300046471 Bacteria 28922
618 Ga0495650_0021897 3300046471 Bacteria 3074
619 Ga0495585_0007224 3300046492 Bacteria 6825
620 Ga0495585_0070263 3300046492 Bacteria 1910
621 Ga0495585_0107265 3300046492 Bacteria 1488
622 Ga0495596_0000054 3300046500 Bacteria 83068
623 Ga0495596_0001629 3300046500 Bacteria 12750
624 Ga0495607_0011251 3300046501 Bacteria 5969
625 Ga0495583_0000139 3300046506 Bacteria 123464
626 Ga0495583_0000187 3300046506 Bacteria 104971
627 Ga0495583_0000631 3300046506 Bacteria 46958
628 Ga0495583_0010716 3300046506 Bacteria 5321
629 Ga0495583_0032633 3300046506 Bacteria 2512
630 Ga0495606_0000672 3300046507 Bacteria 53500
631 Ga0495606_0000685 3300046507 Bacteria 52815
632 Ga0495606_0033566 3300046507 Bacteria 3538
633 Ga0495610_0000022 3300046512 Bacteria 317107
634 Ga0495610_0000081 3300046512 Bacteria 113513
635 Ga0495610_0000886 3300046512 Bacteria 27808
636 Ga0495610_0002317 3300046512 Bacteria 16092
637 Ga0495610_0020645 3300046512 Bacteria 3652
638 Ga0495616_0000024 3300046513 Bacteria 145530
639 Ga0495620_0017938 3300046515 Bacteria 3516
640 Ga0495620_0076391 3300046515 Bacteria 1361
641 Ga0495631_0023064 3300046518 Bacteria 2889
642 Ga0495632_0000383 3300046519 Bacteria 42267
643 Ga0495632_0000948 3300046519 Bacteria 25335
644 Ga0495632_0008112 3300046519 Bacteria 6498
645 Ga0495632_0027220 3300046519 Bacteria 2997
646 Ga0495632_0052730 3300046519 Bacteria 1999
647 Ga0495637_0008273 3300046520 Bacteria 5115
648 Ga0495637_0040095 3300046520 Bacteria 2018
649 Ga0495643_0000030 3300046522 Bacteria 260229
650 Ga0495643_0000077 3300046522 Bacteria 163843
651 Ga0495643_0006700 3300046522 Bacteria 7542
652 Ga0495643_0008719 3300046522 Bacteria 6395
653 Ga0495643_0012069 3300046522 Bacteria 5226
654 Ga0495643_0015150 3300046522 Bacteria 4566
655 Ga0495643_0122045 3300046522 Bacteria 1315
656 Ga0495648_0000018 3300046524 Bacteria 282490
657 Ga0495648_0000143 3300046524 Bacteria 85539
658 Ga0495648_0039704 3300046524 Bacteria 2992
659 Ga0495663_0000003 3300046525 Bacteria 362694
660 Ga0495663_0007556 3300046525 Bacteria 3008
661 Ga0495654_0005346 3300046530 Bacteria 7482
662 Ga0495654_0041315 3300046530 Bacteria 2294
663 Ga0495587_0019617 3300046536 Bacteria 4183
664 Ga0495598_0015882 3300046537 Bacteria 1910
665 Ga0495609_0015133 3300046538 Bacteria 3614
666 Ga0495621_0016225 3300046539 Bacteria 2387
667 Ga0495633_0000184 3300046558 Bacteria 81757
668 Ga0495633_0000892 3300046558 Bacteria 25551
669 Ga0495633_0011496 3300046558 Bacteria 4768
670 Ga0495668_0000016 3300046616 Bacteria 438197
671 Ga0495668_0010303 3300046616 Bacteria 5666
672 Ga0495668_0011827 3300046616 Bacteria 5202
673 Ga0495668_0041896 3300046616 Bacteria 2549
674 Ga0495668_0082368 3300046616 Bacteria 1765
675 Ga0495625_0000150 3300046660 Bacteria 106314
676 Ga0495625_0000153 3300046660 Bacteria 105123
677 Ga0495625_0003185 3300046660 Bacteria 16701
678 Ga0495625_0008151 3300046660 Bacteria 8975
679 Ga0495625_0025768 3300046660 Bacteria 4453
680 Ga0495625_0093400 3300046660 Bacteria 2077
681 Ga0495661_0038909 3300046665 Bacteria 2958
682 Ga0495661_0068431 3300046665 Bacteria 2083
683 Ga0495669_0000050 3300046684 Bacteria 80688
684 Ga0495670_0059556 3300046691 Bacteria 1917
685 Ga0495671_0000011 3300046692 Bacteria 365582
686 Ga0495671_0000072 3300046692 Bacteria 97315
687 Ga0495671_0005155 3300046692 Bacteria 7687
688 Ga0495600_0000690 3300046809 Bacteria 17650
689 Ga0495683_0000963 3300047323 Bacteria 20180
690 Ga0495687_001845 3300047443 Bacteria 18538
691 Ga0495687_002183 3300047443 Bacteria 16292
692 Ga0495673_0000013 3300047469 Bacteria 612902
693 Ga0495673_0014606 3300047469 Bacteria 4079
694 Ga0495673_0018818 3300047469 Bacteria 3474
695 Ga0495681_0000010 3300047470 Bacteria 203548
696 Ga0495681_0000342 3300047470 Bacteria 36568
697 Ga0495681_0011835 3300047470 Bacteria 5164
698 Ga0495686_0000182 3300047472 Bacteria 119682
699 Ga0495686_0000363 3300047472 Bacteria 73366
700 Ga0495686_0005716 3300047472 Bacteria 9717
701 Ga0495686_0010474 3300047472 Bacteria 6591
702 Ga0495686_0023442 3300047472 Bacteria 4070
703 Ga0495686_0039832 3300047472 Bacteria 2999
704 Ga0495686_0043044 3300047472 Bacteria 2866
705 Ga0495686_0099114 3300047472 Bacteria 1759
706 Ga0495615_0000150 3300048090 Bacteria 17571
707 Ga0495626_0001895 3300048091 Bacteria 15617
708 Ga0496100_0147390 3300048903 Bacteria 1675
709 Ga0496101_0029318 3300048904 Bacteria 3849
710 Ga0496101_0041543 3300048904 Bacteria 3279
711 Ga0496101_0047847 3300048904 Bacteria 3071
712 Ga0496102_0000199 3300048905 Bacteria 81435
713 Ga0496102_0000243 3300048905 Bacteria 71427
714 Ga0496102_0000570 3300048905 Bacteria 39156
715 Ga0496102_0043153 3300048905 Bacteria 4088
716 Ga0496102_0369014 3300048905 Bacteria 1351
717 Ga0496103_0000201 3300048906 Bacteria 59837
718 Ga0496103_0000479 3300048906 Bacteria 33569
719 Ga0496103_0000633 3300048906 Bacteria 26944
720 Ga0496103_0001160 3300048906 Bacteria 18172
721 Ga0496103_0010198 3300048906 Bacteria 5556
722 Ga0496103_0018844 3300048906 Bacteria 4143
723 Ga0496103_0050435 3300048906 Bacteria 2575
724 Ga0496104_0000078 3300048907 Bacteria 100203
725 Ga0496104_0014211 3300048907 Bacteria 7185
726 Ga0496104_0038825 3300048907 Bacteria 4457
727 Ga0496104_0090818 3300048907 Bacteria 2919
728 Ga0496104_0103178 3300048907 Bacteria 2732
729 Ga0496105_0000241 3300048908 Bacteria 36833
730 Ga0496105_0000690 3300048908 Bacteria 22731
731 Ga0496105_0026430 3300048908 Bacteria 4733
732 Ga0496105_0115218 3300048908 Bacteria 2217
733 Ga0496105_0131538 3300048908 Bacteria 2063
734 Ga0496105_0275811 3300048908 Bacteria 1357
735 Ga0496106_0017827 3300048909 Bacteria 5251
736 Ga0496107_0000794 3300048910 Bacteria 18300
737 Ga0496107_0026839 3300048910 Bacteria 4087
738 Ga0496108_0036958 3300048911 Bacteria 4065
739 Ga0496109_0069384 3300048912 Bacteria 3232
740 Ga0496109_0076132 3300048912 Bacteria 3086
741 Ga0496109_0122522 3300048912 Bacteria 2423
742 Ga0496110_0017737 3300048913 Bacteria 5956
743 Ga0496110_0063880 3300048913 Bacteria 3253
744 Ga0496111_0061819 3300048914 Bacteria 2715
745 Ga0496112_0112199 3300048915 Bacteria 2696
746 Ga0496112_0629436 3300048915 Bacteria 1003
747 Ga0496113_0003620 3300048916 Bacteria 9287
748 Ga0496113_0004827 3300048916 Bacteria 8339
749 Ga0496113_0017588 3300048916 Bacteria 4966
750 Ga0496113_0141577 3300048916 Bacteria 1893
751 Ga0496114_0019776 3300048917 Bacteria 5459
752 Ga0496114_0074792 3300048917 Bacteria 2852
753 Ga0496115_0000131 3300048918 Bacteria 68111
754 Ga0496116_0000017 3300048919 Bacteria 554463
755 Ga0496116_0002567 3300048919 Bacteria 18955
756 Ga0496116_0034167 3300048919 Bacteria 3593
757 Ga0496117_0000179 3300048920 Bacteria 130966
758 Ga0496117_0000352 3300048920 Bacteria 81089
759 Ga0496117_0003444 3300048920 Bacteria 18406
760 Ga0496117_0006507 3300048920 Bacteria 11782
761 Ga0496117_0006558 3300048920 Bacteria 11712
762 Ga0496117_0012763 3300048920 Bacteria 7371
763 Ga0496117_0013579 3300048920 Bacteria 7095
764 Ga0496117_0013905 3300048920 Bacteria 6976
765 Ga0496117_0021332 3300048920 Bacteria 5244
766 Ga0496118_0000030 3300048921 Bacteria 339946
767 Ga0496118_0000092 3300048921 Bacteria 169106
768 Ga0496118_0004591 3300048921 Bacteria 16240
769 Ga0496118_0007285 3300048921 Bacteria 11778
770 Ga0496118_0007538 3300048921 Bacteria 11492
771 Ga0496118_0012741 3300048921 Bacteria 8034
772 Ga0496118_0031432 3300048921 Bacteria 4401
773 Ga0496118_0094030 3300048921 Bacteria 2051
774 Ga0496118_0179622 3300048921 Bacteria 1280
775 Ga0496119_0000114 3300048922 Bacteria 114495
776 Ga0496119_0004697 3300048922 Bacteria 13438
777 Ga0496119_0023936 3300048922 Bacteria 4313
778 Ga0496119_0090783 3300048922 Bacteria 1736
779 Ga0496120_0000266 3300048923 Bacteria 87412
780 Ga0496120_0047341 3300048923 Bacteria 2480
781 Ga0496120_0051004 3300048923 Bacteria 2366
782 Ga0496121_0000017 3300048924 Bacteria 546415
783 Ga0496121_0000228 3300048924 Bacteria 120653
784 Ga0496121_0000526 3300048924 Bacteria 72764
785 Ga0496121_0000675 3300048924 Bacteria 63670
786 Ga0496121_0001839 3300048924 Bacteria 34202
787 Ga0496121_0001919 3300048924 Bacteria 33213
788 Ga0496121_0003164 3300048924 Bacteria 23728
789 Ga0496121_0009156 3300048924 Bacteria 11446
790 Ga0496121_0012385 3300048924 Bacteria 9312
791 Ga0496121_0023268 3300048924 Bacteria 5973
792 Ga0496121_0045089 3300048924 Bacteria 3793
793 Ga0496121_0081421 3300048924 Bacteria 2563
794 Ga0496121_0086801 3300048924 Bacteria 2458
795 Ga0496122_0000176 3300048925 Bacteria 152190
796 Ga0496122_0013037 3300048925 Bacteria 8187
797 Ga0496122_0016897 3300048925 Bacteria 6861
798 Ga0496122_0041018 3300048925 Bacteria 3669
799 Ga0496122_0082928 3300048925 Bacteria 2225
800 Ga0496122_0096877 3300048925 Bacteria 1987
801 Ga0496123_0000291 3300048926 Bacteria 97989
802 Ga0496123_0001706 3300048926 Bacteria 29346
803 Ga0496123_0001817 3300048926 Bacteria 28073
804 Ga0496123_0010209 3300048926 Bacteria 8332
805 Ga0496123_0011704 3300048926 Bacteria 7568
806 Ga0496123_0016103 3300048926 Bacteria 6092
807 Ga0496123_0023217 3300048926 Bacteria 4752
808 Ga0496123_0040904 3300048926 Bacteria 3221
809 Ga0496123_0050151 3300048926 Bacteria 2791
810 Ga0496123_0079366 3300048926 Bacteria 2006
811 Ga0496124_0000081 3300048927 Bacteria 208413
812 Ga0496124_0000264 3300048927 Bacteria 101377
813 Ga0496124_0000684 3300048927 Bacteria 55763
814 Ga0496124_0001890 3300048927 Bacteria 28794
815 Ga0496124_0002608 3300048927 Bacteria 23273
816 Ga0496124_0003283 3300048927 Bacteria 19954
817 Ga0496124_0035004 3300048927 Bacteria 4398
818 Ga0496124_0066690 3300048927 Bacteria 2996
819 Ga0496124_0138686 3300048927 Bacteria 1922
820 Ga0496124_0149687 3300048927 Bacteria 1833
821 Ga0496125_0000980 3300048928 Bacteria 44624
822 Ga0496125_0009124 3300048928 Bacteria 10260
823 Ga0496125_0022628 3300048928 Bacteria 5830
824 Ga0496125_0037129 3300048928 Bacteria 4239
825 Ga0496125_0053383 3300048928 Bacteria 3313
826 Ga0496125_0088882 3300048928 Bacteria 2326
827 Ga0496125_0095291 3300048928 Bacteria 2214
828 Ga0496125_0129831 3300048928 Bacteria 1776
829 Ga0496126_0000173 3300048929 Bacteria 146490
830 Ga0496126_0000283 3300048929 Bacteria 107129
831 Ga0496126_0001284 3300048929 Bacteria 40249
832 Ga0496126_0095437 3300048929 Bacteria 2609
833 Ga0496126_0140487 3300048929 Bacteria 2079
834 Ga0496126_0142783 3300048929 Bacteria 2059
835 Ga0496126_0148654 3300048929 Bacteria 2010
836 Ga0496126_0166748 3300048929 Bacteria 1879
837 Ga0496126_0274736 3300048929 Bacteria 1397
838 Ga0501292_000247 3300049515 Bacteria 8012
839 Ga0501032_0060590 3300049569 Bacteria 2538
840 Ga0501033_0065135 3300049570 Bacteria 2681
841 Ga0501038_0047716 3300049574 Bacteria 3709
842 Ga0501043_0051084 3300049579 Bacteria 3249
843 Ga0501047_0000447 3300049581 Bacteria 45607
844 Ga0501070_0159647 3300049586 Bacteria 1859
845 Ga0501211_000821 3300049658 Bacteria 3224
846 Ga0501223_000010 3300049663 Bacteria 106901
847 Ga0501223_000112 3300049663 Bacteria 23415
848 Ga0501223_002105 3300049663 Bacteria 4464
849 Ga0501224_000020 3300049664 Bacteria 74346
850 Ga0501224_009536 3300049664 Bacteria 1421
851 Ga0501233_001867 3300049668 Bacteria 3656
852 Ga0501235_001604 3300049669 Bacteria 4846
853 Ga0501235_002575 3300049669 Bacteria 3902
854 Ga0501246_000669 3300049676 Bacteria 2516
855 Ga0501257_000029 3300049686 Bacteria 42945
856 Ga0501261_000214 3300049690 Bacteria 7972
857 Ga0501225_0000008 3300049705 Bacteria 95521
858 Ga0501225_0000135 3300049705 Bacteria 22383
859 Ga0501225_0003339 3300049705 Bacteria 4887
860 Ga0501245_000464 3300049708 Bacteria 4912
861 Ga0501083_0079449 3300049744 Bacteria 2175
862 Ga0501279_000220 3300049775 Bacteria 7984
863 Ga0501280_000649 3300049776 Bacteria 7803
864 Ga0501282_000493 3300049778 Bacteria 4700
865 Ga0501035_0168692 3300049822 Bacteria 1892
866 Ga0501044_0006548 3300049823 Bacteria 12857
867 Ga0501044_0010061 3300049823 Bacteria 10279
868 Ga0501226_000044 3300049853 Bacteria 56354
869 nmdc:mga03683_229_c1 3300050489 Bacteria 17517
870 nmdc:mga03683_463_c1 3300050489 Bacteria 11717
871 nmdc:mga03n38_5700_c1 3300050490 Bacteria 4265
872 nmdc:mga00v17_3081_c2 3300050491 Bacteria 3920
873 nmdc:mga00v17_39430_c1 3300050491 Bacteria 2829
874 nmdc:mga0k408_110078_c1 3300050493 Bacteria 1628
875 nmdc:mga0k408_1430_c1 3300050493 Bacteria 12925
876 nmdc:mga0k408_51841_c1 3300050493 Bacteria 2377
877 nmdc:mga06z11_3692_c1 3300050494 Bacteria 5945
878 nmdc:mga06z11_519_c1 3300050494 Bacteria 14218
879 nmdc:mga04h51_69_c1 3300050495 Bacteria 33095
880 nmdc:mga04h51_7426_c1 3300050495 Bacteria 2892
881 nmdc:mga07m45_30503_c1 3300050496 Bacteria 2986
882 nmdc:mga07m45_33_c1 3300050496 Bacteria 75596
883 nmdc:mga07m45_50847_c1 3300050496 Bacteria 2336
884 nmdc:mga07m45_73112_c1 3300050496 Bacteria 1952
885 nmdc:mga07m45_8_c1 3300050496 Bacteria 214050
886 nmdc:mga0sz30_15458_c1 3300050516 Bacteria 3016
887 nmdc:mga0sz30_585_c1 3300050516 Bacteria 13728
888 Ga0500610_0013948 3300053079 Bacteria 3756
889 Ga0500643_000004 3300053087 Bacteria 857484
890 Ga0500643_000283 3300053087 Bacteria 43805
891 Ga0500643_000330 3300053087 Bacteria 37938
892 Ga0500643_000513 3300053087 Bacteria 27509
893 Ga0500643_000620 3300053087 Bacteria 24035
894 Ga0500643_001124 3300053087 Bacteria 15971
895 Ga0500643_001505 3300053087 Bacteria 13338
896 Ga0500643_006824 3300053087 Bacteria 4704
897 Ga0500643_009073 3300053087 Bacteria 3835
898 Ga0500651_0021296 3300053093 Bacteria 4041
899 Ga0500555_003466 3300053103 Bacteria 4493
900 Ga0500556_0000144 3300053104 Bacteria 59354
901 Ga0500562_000252 3300053108 Bacteria 13785
902 Ga0500592_000568 3300053116 Bacteria 6104
903 Ga0500592_001514 3300053116 Bacteria 3762
904 Ga0500592_003121 3300053116 Bacteria 2648
905 Ga0500592_011306 3300053116 Bacteria 1427
906 Ga0500607_000098 3300053121 Bacteria 65919
907 Ga0500607_000381 3300053121 Bacteria 42415
908 Ga0500608_000054 3300053122 Bacteria 51067
909 Ga0500614_022454 3300053123 Bacteria 1473
910 Ga0500618_000803 3300053125 Bacteria 17291
911 Ga0500618_017176 3300053125 Bacteria 1803
912 Ga0500642_0000001 3300053130 Bacteria 1468402
913 Ga0500642_0017110 3300053130 Bacteria 2771
914 Ga0500655_000561 3300053133 Bacteria 7469
915 Ga0500658_0001466 3300053134 Bacteria 9439
916 Ga0500658_0001655 3300053134 Bacteria 8866
917 Ga0500559_0000607 3300053136 Bacteria 24382
918 Ga0500559_0001427 3300053136 Bacteria 13559
919 Ga0500559_0011941 3300053136 Bacteria 3702
920 Ga0500559_0012105 3300053136 Bacteria 3674
921 Ga0500559_0024336 3300053136 Bacteria 2576
922 Ga0500559_0054494 3300053136 Bacteria 1771
923 Ga0500559_0054945 3300053136 Bacteria 1765
924 Ga0500573_0000278 3300053140 Bacteria 21754
925 Ga0500573_0119818 3300053140 Bacteria 1466
926 Ga0500590_000301 3300053148 Bacteria 15719
927 Ga0500590_017734 3300053148 Bacteria 3680
928 Ga0500604_0002278 3300053151 Bacteria 5253
929 Ga0500616_0001893 3300053153 Bacteria 18825
930 Ga0500622_0001014 3300053156 Bacteria 23572
931 Ga0500622_0057718 3300053156 Bacteria 1985
932 Ga0500624_000015 3300053157 Bacteria 161928
933 Ga0500624_000023 3300053157 Bacteria 114997
934 Ga0500624_000289 3300053157 Bacteria 17376
935 Ga0500627_0000104 3300053158 Bacteria 28060
936 Ga0500627_0000488 3300053158 Bacteria 10673
937 Ga0500627_0000778 3300053158 Bacteria 8492
938 Ga0500636_0003237 3300053177 Bacteria 9121
939 Ga0500636_0011030 3300053177 Bacteria 5286
940 Ga0500636_0026651 3300053177 Bacteria 3414
941 Ga0500637_0000013 3300053178 Bacteria 73168
942 Ga0500637_0057843 3300053178 Bacteria 2217
943 Ga0500567_007512 3300053723 Bacteria 5134
944 Ga0500570_006332 3300053724 Bacteria 6424
945 Ga0500611_002591 3300053727 Bacteria 2194
946 Ga0500625_000002 3300053729 Bacteria 371909
947 Ga0500645_000002 3300053730 Bacteria 388892
948 Ga0500645_000780 3300053730 Bacteria 19276
949 Ga0500645_006477 3300053730 Bacteria 4171
950 Ga0500645_013828 3300053730 Bacteria 2583
951 Ga0500645_018269 3300053730 Bacteria 2191
952 Ga0500645_021520 3300053730 Bacteria 1990
953 Ga0500596_002731 3300053735 Bacteria 3458
954 2511127888 2510917021 Bacteria 5705459
955 2512643376 2512564014 Bacteria 4639632
956 2585261175 2582581305 Bacteria 4895574
957 2600227764 2599185359 Bacteria 4772316
958 2643728122 2643221541 Bacteria 5498788
959 2643950313 2643221588 Bacteria 3692460
960 2644038908 2643221605 Bacteria 4772303
961 2644042929 2643221606 Bacteria 5588032
962 2644395640 2643221671 Bacteria 5496681
963 2738709712 2738541275 Bacteria 4830863
964 2738848137 2738541301 Bacteria 4834102
965 2738863866 2738541304 Bacteria 4833665
966 2739296384 2738543022 Bacteria 4835059
967 2739358062 2738543033 Bacteria 4833336
968 2739651933 2739367664 Bacteria 4114334
969 2740030407 2739367865 Bacteria 4114482
970 2778125010 2775507255 Bacteria 3945731
971 2809062414 2808606401 Bacteria 4586670
972 2809078246 2808606404 Bacteria 4652788
973 2809082803 2808606405 Bacteria 4586632
974 2819552456 2818991438 Bacteria 5793701
975 2819714197 2818991466 Bacteria 4748179
976 2830078125 2830075706 Bacteria 3855215
977 2848297489 2848297114 Bacteria 3608511
978 2879166507 2879163058 Bacteria 4223965
979 2880522326 2880518877 Bacteria 5012590
980 2882808499 2882806704 Bacteria 3007728
981 2895884209 2895880812 Bacteria 11255272
982 2896186822 2896184354 Bacteria 3258548
983 2919142784 2919138771 Bacteria 5281312
984 2919709701 2919709256 Bacteria 4318106
985 2928101268 2928100450 Bacteria 4837635
986 2928530411 2928526807 Bacteria 4760224
987 2928960321 2928959182 Bacteria 4725774
988 2928968207 2928968154 Bacteria 4633371
989 2990266443 2990265787 Bacteria 3943888
990 2993695764 2993693658 Bacteria 4040749
991 3000866560 3000865235 Bacteria 3106258
992 8054304953 8054302542 Bacteria 5698134
993 Ga0496105_0010962
994 SwRhRL2b_contig_2235436
995 JGI24736J21556_1000256
996 JGI24741J21665_1001032
997 JGI24741J21665_1001215
998 JGI24752J21851_1000062
999 JGI24752J21851_1001369
1000 JGI24752J21851_1007004
1001 JGI24740J21852_10000540
1002 JGI24740J21852_10005886
1003 JGI24740J21852_10011274
1004 JGI24739J22299_10001027
1005 JGI24739J22299_10003942
1006 JGI24739J22299_10004578
1007 JGI24737J22298_10002455
1008 JGI24737J22298_10004191
1009 JGI24735J21928_10000861
1010 JGI24735J21928_10003084
1011 JGI24750J21931_1000036
1012 JGI24748J21848_1000103
1013 JGI24738J21930_10001565
1014 JGI24749J21850_1000087
1015 JGI24034J26672_10000057
1016 JGI24742J22300_10004425
1017 JGI24751J29686_10000054
1018 JGI24751J29686_10000140
1019 JGI25165J46597_1000012
1020 JGI25153J46596_10000005
1021 Ga0055525_1000012
1022 Ga0055542_1000355
1023 Ga0055529_1000045
1024 Ga0065165_1004400
1025 Ga0065704_10001493
1026 Ga0065704_10007473
1027 Ga0065704_10070176
1028 Ga0065704_10105609
1029 Ga0065707_10083253
1030 Ga0070658_10000067
1031 Ga0070658_10001571
1032 Ga0070658_10032881
1033 Ga0070658_10032902
1034 Ga0070658_10105365
1035 Ga0070683_100170222
1036 Ga0070683_100172906
1037 Ga0070690_100000011
1038 Ga0070690_100046244
1039 Ga0070670_100000003
1040 Ga0070670_100000210
1041 Ga0070670_100000965
1042 Ga0070670_100009509
1043 Ga0070670_100018785
1044 Ga0070670_100190597
1045 Ga0070670_100240614
1046 Ga0070666_10000035
1047 Ga0070666_10000089
1048 Ga0070666_10013840
1049 Ga0070666_10036618
1050 Ga0070666_10158615
1051 Ga0070666_10198050
1052 Ga0070680_100011845
1053 Ga0070660_100075680
1054 Ga0070660_100148168
1055 Ga0070689_100002742
1056 Ga0070661_100011173
1057 Ga0070668_100000003
1058 Ga0070668_100000014
1059 Ga0070668_100003251
1060 Ga0070668_100007280
1061 Ga0070668_100042436
1062 Ga0070669_100000020
1063 Ga0070669_100000024
1064 Ga0070669_100000334
1065 Ga0070669_100000473
1066 Ga0070669_100000712
1067 Ga0070669_100002131
1068 Ga0070669_100003995
1069 Ga0070669_100024149
1070 Ga0070669_100034312
1071 Ga0070669_100050393
1072 Ga0070669_100157764
1073 Ga0070671_100000006
1074 Ga0070671_100000138
1075 Ga0070671_100000435
1076 Ga0070671_100000542
1077 Ga0070671_100002625
1078 Ga0070671_100039115
1079 Ga0070671_100210640
1080 Ga0070674_100011307
1081 Ga0070688_100001328
1082 Ga0070659_100008121
1083 Ga0070659_100070457
1084 Ga0070659_100216272
1085 Ga0070667_100000051
1086 Ga0070667_100000128
1087 Ga0070667_100000298
1088 Ga0070667_100000851
1089 Ga0070667_100001003
1090 Ga0070667_100002068
1091 Ga0070667_100004204
1092 Ga0070667_100011284
1093 Ga0070667_100014546
1094 Ga0070667_100040604
1095 Ga0070667_100049569
1096 Ga0070667_100104253
1097 Ga0070705_100004759
1098 Ga0070705_100099149
1099 Ga0070708_100094332
1100 Ga0070663_100017417
1101 Ga0070663_100100915
1102 Ga0070663_100129135
1103 Ga0070678_100012555
1104 Ga0070662_100012698
1105 Ga0070681_10005668
1106 Ga0068867_100007513
1107 Ga0068867_100235491
1108 Ga0070685_10000168
1109 Ga0070679_100008282
1110 Ga0068853_100004036
1111 Ga0068853_100009085
1112 Ga0068853_100019326
1113 Ga0068853_100025577
1114 Ga0068853_100174305
1115 Ga0070672_100315773
1116 Ga0070686_100001324
1117 Ga0070686_100017427
1118 Ga0070665_100000161
1119 Ga0070665_100000206
1120 Ga0070665_100001356
1121 Ga0070665_100010985
1122 Ga0070665_100012580
1123 Ga0070665_100088252
1124 Ga0070665_100137757
1125 Ga0070665_100287580
1126 Ga0068855_100000962
1127 Ga0068855_100014816
1128 Ga0068855_100015135
1129 Ga0068855_100040224
1130 Ga0068855_100060879
1131 Ga0070664_100013946
1132 Ga0070664_100020427
1133 Ga0070664_100102464
1134 Ga0068857_100009607
1135 Ga0068857_100018029
1136 Ga0068857_100065228
1137 Ga0068857_100069212
1138 Ga0068857_100084922
1139 Ga0068857_100194718
1140 Ga0068857_100245112
1141 Ga0068854_100003154
1142 Ga0068854_100010741
1143 Ga0068854_100012195
1144 Ga0068854_100019472
1145 Ga0068854_100305493
1146 Ga0068856_100004323
1147 Ga0068856_100011400
1148 Ga0068856_100142927
1149 Ga0068856_100332962
1150 Ga0068856_100494178
1151 Ga0070702_100028407
1152 Ga0068852_100000075
1153 Ga0068852_100108194
1154 Ga0068852_100183379
1155 Ga0068859_100000256
1156 Ga0068859_100001299
1157 Ga0068859_100006610
1158 Ga0068859_100025168
1159 Ga0068864_100000005
1160 Ga0068864_100000332
1161 Ga0068864_100000642
1162 Ga0068864_100001753
1163 Ga0068864_100025454
1164 Ga0068864_100053335
1165 Ga0068864_100118219
1166 Ga0068861_100001329
1167 Ga0068861_100015879
1168 Ga0068861_100088296
1169 Ga0068851_10011445
1170 Ga0068851_10042184
1171 Ga0068863_100000016
1172 Ga0068863_100000028
1173 Ga0068863_100000060
1174 Ga0068863_100000456
1175 Ga0068863_100000719
1176 Ga0068863_100005237
1177 Ga0068863_100010358
1178 Ga0068863_100017269
1179 Ga0068863_100028865
1180 Ga0068863_100415980
1181 Ga0068858_100000304
1182 Ga0068858_100000472
1183 Ga0068858_100002895
1184 Ga0068858_100004091
1185 Ga0068858_100016712
1186 Ga0068858_100022636
1187 Ga0068858_100104346
1188 Ga0068860_100000126
1189 Ga0068860_100000143
1190 Ga0068860_100000168
1191 Ga0068860_100000412
1192 Ga0068860_100001698
1193 Ga0068860_100006149
1194 Ga0068860_100007410
1195 Ga0068860_100017637
1196 Ga0068860_100174989
1197 Ga0068862_100000001
1198 Ga0068862_100000085
1199 Ga0068862_100000168
1200 Ga0068862_100000310
1201 Ga0068862_100000506
1202 Ga0068862_100001574
1203 Ga0068862_100010705
1204 Ga0068862_100010728
1205 Ga0068862_100040836
1206 Ga0068862_100089890
1207 Ga0081455_10000131
1208 Ga0075368_10001483
1209 Ga0075368_10041808
1210 Ga0075363_100003377
1211 Ga0075363_100003814
1212 Ga0075364_10016692
1213 Ga0075432_10004187
1214 Ga0075362_10000234
1215 Ga0075362_10000526
1216 Ga0075367_10000092
1217 Ga0075366_10000168
1218 Ga0075366_10006887
1219 Ga0075366_10021504
1220 Ga0097621_100136045
1221 Ga0075370_10000032
1222 Ga0075370_10045379
1223 Ga0075429_100039568
1224 Ga0075429_100102528
1225 Ga0097620_100000256
1226 Ga0097620_100001299
1227 Ga0097620_100006610
1228 Ga0097620_100025168
1229 Ga0079104_1008150
1230 Ga0105251_10001625
1231 Ga0105251_10001861
1232 Ga0105251_10010467
1233 Ga0105251_10061191
1234 Ga0105251_10069374
1235 Ga0105240_10001848
1236 Ga0105240_10010488
1237 Ga0105240_10035481
1238 Ga0105240_10070426
1239 Ga0105240_10078303
1240 Ga0105245_10001108
1241 Ga0105247_10000644
1242 Ga0105247_10037912
1243 Ga0114129_10021496
1244 Ga0105243_10000423
1245 Ga0105243_10075604
1246 Ga0105243_10261150
1247 Ga0105241_10000997
1248 Ga0105241_10166400
1249 Ga0105248_10000029
1250 Ga0105248_10000086
1251 Ga0105248_10013528
1252 Ga0105248_10024262
1253 Ga0105248_10031271
1254 Ga0105248_10120069
1255 Ga0105248_10175942
1256 Ga0105237_10002073
1257 Ga0105237_10007129
1258 Ga0105237_10009460
1259 Ga0105237_10140837
1260 Ga0105238_10017115
1261 Ga0105238_10182143
1262 Ga0105238_10203403
1263 Ga0105238_10254974
1264 Ga0105249_10000024
1265 Ga0105249_10000038
1266 Ga0105249_10000094
1267 Ga0105249_10002324
1268 Ga0105249_10348210
1269 Ga0105148_100059
1270 Ga0105239_10027686
1271 Ga0105239_10067612
1272 Ga0105239_10618628
1273 Ga0157326_1000001
1274 Ga0157373_10003358
1275 Ga0157371_10000032
1276 Ga0157371_10003665
1277 Ga0157371_10140860
1278 Ga0157370_10013758
1279 Ga0157370_10051407
1280 Ga0157370_10053190
1281 Ga0157370_10330811
1282 Ga0157369_10115578
1283 Ga0157369_10289035
1284 Ga0157378_10187768
1285 Ga0163162_10003527
1286 Ga0163162_10012124
1287 Ga0163162_10015484
1288 Ga0163162_10044800
1289 Ga0157372_10035441
1290 Ga0157372_10242033
1291 Ga0157372_10328848
1292 Ga0163163_10008504
1293 Ga0163163_10172430
1294 Ga0157380_10000060
1295 Ga0157380_10000542
1296 Ga0157380_10148878
1297 Ga0157379_10004525
1298 Ga0157379_10042529
1299 Ga0183363_1004
1300 Ga0163161_10000716
1301 Ga0163161_10082721
1302 Ga0213875_10000264
1303 Ga0209147_104064
1304 Ga0209563_100030
1305 Ga0209677_104116
1306 Ga0209148_1000011
1307 Ga0209233_1000058
1308 Ga0209455_1000006
1309 Ga0209758_1000001
1310 Ga0209050_1000441
1311 Ga0207697_10000419
1312 Ga0207697_10012242
1313 Ga0207697_10015555
1314 Ga0207656_10000378
1315 Ga0207656_10005981
1316 Ga0207713_1002460
1317 Ga0207713_1016496
1318 Ga0207710_10006923
1319 Ga0207710_10035134
1320 Ga0207680_10000007
1321 Ga0207680_10000517
1322 Ga0207680_10003829
1323 Ga0207680_10125961
1324 Ga0207680_10140440
1325 Ga0207680_10155143
1326 Ga0207647_10008366
1327 Ga0207647_10026599
1328 Ga0207647_10064805
1329 Ga0207645_10165005
1330 Ga0207705_10000075
1331 Ga0207705_10000122
1332 Ga0207705_10090342
1333 Ga0207705_10123396
1334 Ga0207654_10002907
1335 Ga0207707_10069377
1336 Ga0207707_10141338
1337 Ga0207695_10000288
1338 Ga0207695_10006069
1339 Ga0207695_10015610
1340 Ga0207695_10036202
1341 Ga0207695_10055082
1342 Ga0207695_10075297
1343 Ga0207695_10095696
1344 Ga0207695_10150591
1345 Ga0207671_10001439
1346 Ga0207671_10006770
1347 Ga0207671_10018947
1348 Ga0207657_10000408
1349 Ga0207657_10002471
1350 Ga0207657_10007801
1351 Ga0207657_10011633
1352 Ga0207657_10085021
1353 Ga0207657_10186792
1354 Ga0207649_10000482
1355 Ga0207649_10159200
1356 Ga0207652_10008597
1357 Ga0207652_10114171
1358 Ga0207681_10000004
1359 Ga0207681_10000005
1360 Ga0207681_10000089
1361 Ga0207681_10000503
1362 Ga0207681_10000663
1363 Ga0207681_10001365
1364 Ga0207681_10004407
1365 Ga0207681_10018758
1366 Ga0207681_10041605
1367 Ga0207681_10140268
1368 Ga0207694_10005621
1369 Ga0207694_10009731
1370 Ga0207694_10018966
1371 Ga0207694_10061619
1372 Ga0207694_10175781
1373 Ga0207694_10182713
1374 Ga0207694_10237460
1375 Ga0207650_10000004
1376 Ga0207650_10000545
1377 Ga0207650_10010295
1378 Ga0207650_10015807
1379 Ga0207650_10047790
1380 Ga0207650_10083091
1381 Ga0207687_10000853
1382 Ga0207644_10000005
1383 Ga0207644_10000009
1384 Ga0207644_10000447
1385 Ga0207644_10001520
1386 Ga0207644_10003216
1387 Ga0207644_10020323
1388 Ga0207644_10021357
1389 Ga0207644_10070832
1390 Ga0207690_10000696
1391 Ga0207690_10023275
1392 Ga0207690_10031743
1393 Ga0207690_10225677
1394 Ga0207706_10002919
1395 Ga0207706_10004237
1396 Ga0207706_10012315
1397 Ga0207706_10075750
1398 Ga0207709_10000574
1399 Ga0207709_10193909
1400 Ga0207670_10013004
1401 Ga0207669_10006239
1402 Ga0207711_10000004
1403 Ga0207711_10000310
1404 Ga0207711_10002363
1405 Ga0207711_10019413
1406 Ga0207711_10024128
1407 Ga0207711_10048966
1408 Ga0207661_10256435
1409 Ga0207679_10100238
1410 Ga0207667_10000002
1411 Ga0207667_10004952
1412 Ga0207667_10008229
1413 Ga0207667_10013795
1414 Ga0207667_10118401
1415 Ga0207667_10301320
1416 Ga0207712_10000002
1417 Ga0207712_10000004
1418 Ga0207712_10000034
1419 Ga0207668_10000006
1420 Ga0207668_10000047
1421 Ga0207668_10003433
1422 Ga0207668_10003815
1423 Ga0207668_10004706
1424 Ga0207668_10009940
1425 Ga0207668_10316619
1426 Ga0207640_10000570
1427 Ga0207640_10000586
1428 Ga0207640_10002545
1429 Ga0207640_10018948
1430 Ga0207640_10070046
1431 Ga0207658_10000026
1432 Ga0207658_10000057
1433 Ga0207658_10000254
1434 Ga0207658_10000434
1435 Ga0207658_10001330
1436 Ga0207658_10002894
1437 Ga0207658_10002944
1438 Ga0207658_10003250
1439 Ga0207658_10007629
1440 Ga0207658_10025127
1441 Ga0207658_10031477
1442 Ga0207658_10110014
1443 Ga0207703_10000435
1444 Ga0207703_10000568
1445 Ga0207703_10001463
1446 Ga0207703_10001946
1447 Ga0207703_10001956
1448 Ga0207703_10012521
1449 Ga0207703_10070059
1450 Ga0207703_10109986
1451 Ga0207703_10126510
1452 Ga0207639_10000777
1453 Ga0207639_10003342
1454 Ga0207639_10018070
1455 Ga0207639_10020172
1456 Ga0207639_10045628
1457 Ga0207639_10074344
1458 Ga0207639_10224291
1459 Ga0207678_10000324
1460 Ga0207678_10005545
1461 Ga0207678_10013334
1462 Ga0207678_10041873
1463 Ga0207702_10005910
1464 Ga0207702_10006661
1465 Ga0207702_10037147
1466 Ga0207702_10113339
1467 Ga0207702_10113370
1468 Ga0207702_10255571
1469 Ga0207641_10000010
1470 Ga0207641_10000014
1471 Ga0207641_10000100
1472 Ga0207641_10000315
1473 Ga0207641_10000346
1474 Ga0207641_10002472
1475 Ga0207641_10002944
1476 Ga0207641_10017728
1477 Ga0207641_10022838
1478 Ga0207641_10025121
1479 Ga0207641_10025885
1480 Ga0207676_10000006
1481 Ga0207676_10000036
1482 Ga0207676_10000603
1483 Ga0207676_10002760
1484 Ga0207676_10003853
1485 Ga0207676_10004588
1486 Ga0207676_10011106
1487 Ga0207676_10028724
1488 Ga0207674_10003143
1489 Ga0207674_10004472
1490 Ga0207674_10009082
1491 Ga0207674_10012390
1492 Ga0207674_10014452
1493 Ga0207674_10085003
1494 Ga0207674_10100585
1495 Ga0207674_10161876
1496 Ga0207674_10330920
1497 Ga0207675_100000740
1498 Ga0207675_100003757
1499 Ga0207675_100020136
1500 Ga0207683_10022042
1501 Ga0207698_10000005
1502 Ga0207698_10027376
1503 Ga0209281_1010835
1504 Ga0209983_1009114
1505 Ga0209813_10000114
1506 Ga0209813_10000530
1507 Ga0207428_10036711
1508 Ga0268266_10000002
1509 Ga0268266_10000040
1510 Ga0268266_10000534
1511 Ga0268266_10008419
1512 Ga0268266_10015509
1513 Ga0268266_10029365
1514 Ga0268265_10000001
1515 Ga0268265_10000059
1516 Ga0268265_10000104
1517 Ga0268265_10000986
1518 Ga0268265_10001459
1519 Ga0268265_10002264
1520 Ga0268265_10002795
1521 Ga0268265_10013635
1522 Ga0268265_10070580
1523 Ga0268265_10107211
1524 Ga0268264_10000003
1525 Ga0268264_10000040
1526 Ga0268264_10000069
1527 Ga0268264_10000076
1528 Ga0268264_10000083
1529 Ga0268264_10004451
1530 Ga0268264_10012761
1531 Ga0268264_10029925
1532 Ga0268264_10146421
1533 Ga0265323_10023219
1534 Ga0307517_10076293
1535 Ga0265330_10009538
1536 Ga0265331_10064820
1537 Ga0265327_10034616
1538 Ga0265316_10002067
1539 Ga0307513_10006540
1540 Ga0307513_10040993
1541 Ga0307408_100024261
1542 Ga0307408_100062683
1543 Ga0307408_100069487
1544 Ga0307508_10001821
1545 Ga0265342_10103895
1546 Ga0307405_10003814
1547 Ga0307413_10061015
1548 Ga0307413_10246634
1549 Ga0307410_10032147
1550 Ga0307410_10131432
1551 Ga0307406_10043622
1552 Ga0307412_10000457
1553 Ga0307412_10002757
1554 Ga0307412_10004671
1555 Ga0307412_10025366
1556 Ga0307412_10025379
1557 Ga0307412_10043331
1558 Ga0307412_10066770
1559 Ga0307412_10086777
1560 Ga0307409_100108884
1561 Ga0307416_100046276
1562 Ga0307416_100080150
1563 Ga0307416_100111520
1564 Ga0307414_10000070
1565 Ga0307414_10000288
1566 Ga0307414_10000359
1567 Ga0307411_10007009
1568 Ga0307411_10230582
1569 Ga0307415_100206526
1570 Ga0316583_10008936
1571 Ga0307510_10008642
1572 Ga0373937_0071330
1573 Ga0316582_0014476
1574 Ga0316584_0074383
1575 Ga0316584_0087070
1576 Ga0395900_0044548
1577 Ga0395898_0018073
1578 Ga0436364_1200653
1579 Ga0395901_0018063
1580 Ga0439436_0009476
1581 Ga0439436_0018522
1582 Ga0439461_0000086
1583 Ga0439465_0001125
1584 Ga0439465_0016622
1585 Ga0451802_1561412
1586 Ga0439431_0000491
1587 Ga0439431_0020680
1588 Ga0439445_0011274
1589 Ga0439432_005779
1590 Ga0439452_025280
1591 Ga0439462_0002734
1592 Ga0453684_0260886
1593 Ga0451576_0000588
1594 Ga0451576_0215241
1595 Ga0466967_0082472
1596 Ga0495617_025936
1597 Ga0495627_000094
1598 Ga0495627_000391
1599 Ga0495627_001469
1600 Ga0495629_0046040
1601 Ga0495638_0000018
1602 Ga0495638_0001145
1603 Ga0495638_0006816
1604 Ga0495638_0015526
1605 Ga0495638_0017047
1606 Ga0495638_0043711
1607 Ga0495638_0111145
1608 Ga0495650_0000158
1609 Ga0495650_0001135
1610 Ga0495650_0021897
1611 Ga0495585_0007224
1612 Ga0495585_0070263
1613 Ga0495585_0107265
1614 Ga0495596_0000054
1615 Ga0495596_0001629
1616 Ga0495607_0011251
1617 Ga0495583_0000139
1618 Ga0495583_0000187
1619 Ga0495583_0000631
1620 Ga0495583_0010716
1621 Ga0495583_0032633
1622 Ga0495606_0000672
1623 Ga0495606_0000685
1624 Ga0495606_0033566
1625 Ga0495610_0000022
1626 Ga0495610_0000081
1627 Ga0495610_0000886
1628 Ga0495610_0002317
1629 Ga0495610_0020645
1630 Ga0495616_0000024
1631 Ga0495620_0017938
1632 Ga0495620_0076391
1633 Ga0495631_0023064
1634 Ga0495632_0000383
1635 Ga0495632_0000948
1636 Ga0495632_0008112
1637 Ga0495632_0027220
1638 Ga0495632_0052730
1639 Ga0495637_0008273
1640 Ga0495637_0040095
1641 Ga0495643_0000030
1642 Ga0495643_0000077
1643 Ga0495643_0006700
1644 Ga0495643_0008719
1645 Ga0495643_0012069
1646 Ga0495643_0015150
1647 Ga0495643_0122045
1648 Ga0495648_0000018
1649 Ga0495648_0000143
1650 Ga0495648_0039704
1651 Ga0495663_0000003
1652 Ga0495663_0007556
1653 Ga0495654_0005346
1654 Ga0495654_0041315
1655 Ga0495587_0019617
1656 Ga0495598_0015882
1657 Ga0495609_0015133
1658 Ga0495621_0016225
1659 Ga0495633_0000184
1660 Ga0495633_0000892
1661 Ga0495633_0011496
1662 Ga0495668_0000016
1663 Ga0495668_0010303
1664 Ga0495668_0011827
1665 Ga0495668_0041896
1666 Ga0495668_0082368
1667 Ga0495625_0000150
1668 Ga0495625_0000153
1669 Ga0495625_0003185
1670 Ga0495625_0008151
1671 Ga0495625_0025768
1672 Ga0495625_0093400
1673 Ga0495661_0038909
1674 Ga0495661_0068431
1675 Ga0495669_0000050
1676 Ga0495670_0059556
1677 Ga0495671_0000011
1678 Ga0495671_0000072
1679 Ga0495671_0005155
1680 Ga0495600_0000690
1681 Ga0495683_0000963
1682 Ga0495687_001845
1683 Ga0495687_002183
1684 Ga0495673_0000013
1685 Ga0495673_0014606
1686 Ga0495673_0018818
1687 Ga0495681_0000010
1688 Ga0495681_0000342
1689 Ga0495681_0011835
1690 Ga0495686_0000182
1691 Ga0495686_0000363
1692 Ga0495686_0005716
1693 Ga0495686_0010474
1694 Ga0495686_0023442
1695 Ga0495686_0039832
1696 Ga0495686_0043044
1697 Ga0495686_0099114
1698 Ga0495615_0000150
1699 Ga0495626_0001895
1700 Ga0496100_0147390
1701 Ga0496101_0029318
1702 Ga0496101_0041543
1703 Ga0496101_0047847
1704 Ga0496102_0000199
1705 Ga0496102_0000243
1706 Ga0496102_0000570
1707 Ga0496102_0043153
1708 Ga0496102_0369014
1709 Ga0496103_0000201
1710 Ga0496103_0000479
1711 Ga0496103_0000633
1712 Ga0496103_0001160
1713 Ga0496103_0010198
1714 Ga0496103_0018844
1715 Ga0496103_0050435
1716 Ga0496104_0000078
1717 Ga0496104_0014211
1718 Ga0496104_0038825
1719 Ga0496104_0090818
1720 Ga0496104_0103178
1721 Ga0496105_0000241
1722 Ga0496105_0000690
1723 Ga0496105_0026430
1724 Ga0496105_0115218
1725 Ga0496105_0131538
1726 Ga0496105_0275811
1727 Ga0496106_0017827
1728 Ga0496107_0000794
1729 Ga0496107_0026839
1730 Ga0496108_0036958
1731 Ga0496109_0069384
1732 Ga0496109_0076132
1733 Ga0496109_0122522
1734 Ga0496110_0017737
1735 Ga0496110_0063880
1736 Ga0496111_0061819
1737 Ga0496112_0112199
1738 Ga0496112_0629436
1739 Ga0496113_0003620
1740 Ga0496113_0004827
1741 Ga0496113_0017588
1742 Ga0496113_0141577
1743 Ga0496114_0019776
1744 Ga0496114_0074792
1745 Ga0496115_0000131
1746 Ga0496116_0000017
1747 Ga0496116_0002567
1748 Ga0496116_0034167
1749 Ga0496117_0000179
1750 Ga0496117_0000352
1751 Ga0496117_0003444
1752 Ga0496117_0006507
1753 Ga0496117_0006558
1754 Ga0496117_0012763
1755 Ga0496117_0013579
1756 Ga0496117_0013905
1757 Ga0496117_0021332
1758 Ga0496118_0000030
1759 Ga0496118_0000092
1760 Ga0496118_0004591
1761 Ga0496118_0007285
1762 Ga0496118_0007538
1763 Ga0496118_0012741
1764 Ga0496118_0031432
1765 Ga0496118_0094030
1766 Ga0496118_0179622
1767 Ga0496119_0000114
1768 Ga0496119_0004697
1769 Ga0496119_0023936
1770 Ga0496119_0090783
1771 Ga0496120_0000266
1772 Ga0496120_0047341
1773 Ga0496120_0051004
1774 Ga0496121_0000017
1775 Ga0496121_0000228
1776 Ga0496121_0000526
1777 Ga0496121_0000675
1778 Ga0496121_0001839
1779 Ga0496121_0001919
1780 Ga0496121_0003164
1781 Ga0496121_0009156
1782 Ga0496121_0012385
1783 Ga0496121_0023268
1784 Ga0496121_0045089
1785 Ga0496121_0081421
1786 Ga0496121_0086801
1787 Ga0496122_0000176
1788 Ga0496122_0013037
1789 Ga0496122_0016897
1790 Ga0496122_0041018
1791 Ga0496122_0082928
1792 Ga0496122_0096877
1793 Ga0496123_0000291
1794 Ga0496123_0001706
1795 Ga0496123_0001817
1796 Ga0496123_0010209
1797 Ga0496123_0011704
1798 Ga0496123_0016103
1799 Ga0496123_0023217
1800 Ga0496123_0040904
1801 Ga0496123_0050151
1802 Ga0496123_0079366
1803 Ga0496124_0000081
1804 Ga0496124_0000264
1805 Ga0496124_0000684
1806 Ga0496124_0001890
1807 Ga0496124_0002608
1808 Ga0496124_0003283
1809 Ga0496124_0035004
1810 Ga0496124_0066690
1811 Ga0496124_0138686
1812 Ga0496124_0149687
1813 Ga0496125_0000980
1814 Ga0496125_0009124
1815 Ga0496125_0022628
1816 Ga0496125_0037129
1817 Ga0496125_0053383
1818 Ga0496125_0088882
1819 Ga0496125_0095291
1820 Ga0496125_0129831
1821 Ga0496126_0000173
1822 Ga0496126_0000283
1823 Ga0496126_0001284
1824 Ga0496126_0095437
1825 Ga0496126_0140487
1826 Ga0496126_0142783
1827 Ga0496126_0148654
1828 Ga0496126_0166748
1829 Ga0496126_0274736
1830 Ga0501292_000247
1831 Ga0501032_0060590
1832 Ga0501033_0065135
1833 Ga0501038_0047716
1834 Ga0501043_0051084
1835 Ga0501047_0000447
1836 Ga0501070_0159647
1837 Ga0501211_000821
1838 Ga0501223_000010
1839 Ga0501223_000112
1840 Ga0501223_002105
1841 Ga0501224_000020
1842 Ga0501224_009536
1843 Ga0501233_001867
1844 Ga0501235_001604
1845 Ga0501235_002575
1846 Ga0501246_000669
1847 Ga0501257_000029
1848 Ga0501261_000214
1849 Ga0501225_0000008
1850 Ga0501225_0000135
1851 Ga0501225_0003339
1852 Ga0501245_000464
1853 Ga0501083_0079449
1854 Ga0501279_000220
1855 Ga0501280_000649
1856 Ga0501282_000493
1857 Ga0501035_0168692
1858 Ga0501044_0006548
1859 Ga0501044_0010061
1860 Ga0501226_000044
1861 nmdc:mga03683_229_c1
1862 nmdc:mga03683_463_c1
1863 nmdc:mga03n38_5700_c1
1864 nmdc:mga00v17_3081_c2
1865 nmdc:mga00v17_39430_c1
1866 nmdc:mga0k408_110078_c1
1867 nmdc:mga0k408_1430_c1
1868 nmdc:mga0k408_51841_c1
1869 nmdc:mga06z11_3692_c1
1870 nmdc:mga06z11_519_c1
1871 nmdc:mga04h51_69_c1
1872 nmdc:mga04h51_7426_c1
1873 nmdc:mga07m45_30503_c1
1874 nmdc:mga07m45_33_c1
1875 nmdc:mga07m45_50847_c1
1876 nmdc:mga07m45_73112_c1
1877 nmdc:mga07m45_8_c1
1878 nmdc:mga0sz30_15458_c1
1879 nmdc:mga0sz30_585_c1
1880 Ga0500610_0013948
1881 Ga0500643_000004
1882 Ga0500643_000283
1883 Ga0500643_000330
1884 Ga0500643_000513
1885 Ga0500643_000620
1886 Ga0500643_001124
1887 Ga0500643_001505
1888 Ga0500643_006824
1889 Ga0500643_009073
1890 Ga0500651_0021296
1891 Ga0500555_003466
1892 Ga0500556_0000144
1893 Ga0500562_000252
1894 Ga0500592_000568
1895 Ga0500592_001514
1896 Ga0500592_003121
1897 Ga0500592_011306
1898 Ga0500607_000098
1899 Ga0500607_000381
1900 Ga0500608_000054
1901 Ga0500614_022454
1902 Ga0500618_000803
1903 Ga0500618_017176
1904 Ga0500642_0000001
1905 Ga0500642_0017110
1906 Ga0500655_000561
1907 Ga0500658_0001466
1908 Ga0500658_0001655
1909 Ga0500559_0000607
1910 Ga0500559_0001427
1911 Ga0500559_0011941
1912 Ga0500559_0012105
1913 Ga0500559_0024336
1914 Ga0500559_0054494
1915 Ga0500559_0054945
1916 Ga0500573_0000278
1917 Ga0500573_0119818
1918 Ga0500590_000301
1919 Ga0500590_017734
1920 Ga0500604_0002278
1921 Ga0500616_0001893
1922 Ga0500622_0001014
1923 Ga0500622_0057718
1924 Ga0500624_000015
1925 Ga0500624_000023
1926 Ga0500624_000289
1927 Ga0500627_0000104
1928 Ga0500627_0000488
1929 Ga0500627_0000778
1930 Ga0500636_0003237
1931 Ga0500636_0011030
1932 Ga0500636_0026651
1933 Ga0500637_0000013
1934 Ga0500637_0057843
1935 Ga0500567_007512
1936 Ga0500570_006332
1937 Ga0500611_002591
1938 Ga0500625_000002
1939 Ga0500645_000002
1940 Ga0500645_000780
1941 Ga0500645_006477
1942 Ga0500645_013828
1943 Ga0500645_018269
1944 Ga0500645_021520
1945 Ga0500596_002731
1946 2511127888
1947 2512643376
1948 2585261175
1949 2600227764
1950 2643728122
1951 2643950313
1952 2644038908
1953 2644042929
1954 2644395640
1955 2738709712
1956 2738848137
1957 2738863866
1958 2739296384
1959 2739358062
1960 2739651933
1961 2740030407
1962 2778125010
1963 2809062414
1964 2809078246
1965 2809082803
1966 2819552456
1967 2819714197
1968 2830078125
1969 2848297489
1970 2879166507
1971 2880522326
1972 2882808499
1973 2895884209
1974 2896186822
1975 2919142784
1976 2919709701
1977 2928101268
1978 2928530411
1979 2928960321
1980 2928968207
1981 2990266443
1982 2993695764
1983 3000866560
1984 8054304953

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01472

PUA

PUA domain

331

404

0.96

PF00696

AA_kinase

Amino acid kinase family

62

292

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2as0-assembly1.cif.gz_B crystal structure of ph1915 (apc 5817): a hypothetical rna methyltransferase 0.9268 287 338
2w21-assembly1.cif.gz_A-2 crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli. 0.919 16 264
3zv0-assembly1.cif.gz_D structure of the shq1p-cbf5p complex 0.9132 286 346
3zv0-assembly1.cif.gz_C structure of the shq1p-cbf5p complex 0.9126 286 346
3uai-assembly1.cif.gz_A structure of the shq1-cbf5-nop10-gar1 complex from saccharomyces cerevisiae 0.9107 286 345
ID Description Score Start End Superfamily
2j5tB02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9745 286 377 2.30.130.10
af_Q54LB6_223_322_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9563 284 377 2.30.130.10
af_A0A1D8PU95_3_196_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9459 17 201 3.40.1160.10
2j5tB02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9443 286 377 2.30.130.10
af_O13810_285_387_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9421 283 377 2.30.130.10
ID Description Score Start End GO Terms
AF-A0A355T3B8-F1-model_v4 Glutamate 5-kinase 0.9995 289 377 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A4Q3C6E4-F1-model_v4 Glutamate 5-kinase 0.9975 291 375 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A435K544-F1-model_v4 deleted 0.9939 295 377
AF-A0A259IKD3-F1-model_v4 deleted 0.9916 291 377
AF-A0A845Z6K0-F1-model_v4 Glutamate 5-kinase 0.9902 302 377 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561

Map