F487672

General Info

Members Datasets Scaffolds Average Seq Length
993 284 1986 132

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_101183598|Ga0070662_1011835982
Length 143
Sequence VEADRTGVVEMNSRTASCRCGQLRATVTGEPVRVSACHCLDCKKRSGSAFAVQARWPADGVTIEGRSKTHVNTADSGNRITFHFCPDCGSDVHYEIEGKFDGLIAIPLGAFDDPYFASPRFSVWEQRKHDWVDISGEGVEHSD

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
216 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
217 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
218 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
222 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
223 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
224 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
264 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
265 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
266 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
267 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
270 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
271 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
280 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 1.81
Rhizosphere 95.67
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_101183598 3300005457 Unclassified 657
2 JGI24752J21851_1030148 3300001976 Bacteria 715
3 JGI24740J21852_10008551 3300001979 Bacteria 4071
4 JGI24739J22299_10000184 3300001989 Bacteria 20773
5 JGI24739J22299_10043691 3300001989 Bacteria 1480
6 JGI24737J22298_10000120 3300001990 Bacteria 24095
7 JGI24737J22298_10015531 3300001990 Bacteria 2465
8 JGI24737J22298_10025264 3300001990 Bacteria 1879
9 JGI24737J22298_10045334 3300001990 Bacteria 1343
10 JGI24743J22301_10013530 3300001991 Unclassified 1495
11 JGI24735J21928_10001498 3300002067 Bacteria 8266
12 JGI24735J21928_10055813 3300002067 Bacteria 1137
13 JGI24735J21928_10206636 3300002067 Bacteria 570
14 JGI24745J21846_1001479 3300002073 Bacteria 2284
15 JGI24738J21930_10000025 3300002075 Bacteria 28033
16 JGI24738J21930_10000388 3300002075 Bacteria 12262
17 JGI24742J22300_10032806 3300002244 Unclassified 911
18 Ga0055537_1001791 3300003773 Bacteria 7833
19 Ga0055524_1000118 3300003775 Bacteria 93202
20 Ga0055528_1015087 3300003790 Bacteria 2810
21 Ga0055530_10045844 3300003791 Bacteria 1041
22 Ga0055531_10017268 3300003794 Bacteria 3058
23 Ga0055543_1056480 3300004625 Bacteria 636
24 Ga0065165_1002154 3300005262 Bacteria 17814
25 Ga0065165_1012937 3300005262 Bacteria 3354
26 Ga0065714_10088404 3300005288 Bacteria 2018
27 Ga0065715_10787164 3300005293 Bacteria 615
28 Ga0070658_10069397 3300005327 Bacteria 2883
29 Ga0070658_10150792 3300005327 Bacteria 1946
30 Ga0070658_10254686 3300005327 Bacteria 1489
31 Ga0070658_10445932 3300005327 Bacteria 1115
32 Ga0070658_10565275 3300005327 Bacteria 984
33 Ga0070658_10767445 3300005327 Bacteria 837
34 Ga0070658_10814098 3300005327 Bacteria 811
35 Ga0070658_11108442 3300005327 Bacteria 688
36 Ga0070658_11224562 3300005327 Unclassified 652
37 Ga0070658_11327314 3300005327 Bacteria 625
38 Ga0070676_10002223 3300005328 Bacteria 9898
39 Ga0070676_10438581 3300005328 Bacteria 916
40 Ga0070683_100534152 3300005329 Bacteria 1121
41 Ga0070683_102014977 3300005329 Bacteria 555
42 Ga0070690_100042396 3300005330 Bacteria 2882
43 Ga0070670_100009174 3300005331 Bacteria 8457
44 Ga0070670_100038800 3300005331 Bacteria 4095
45 Ga0070670_100058083 3300005331 Bacteria 3321
46 Ga0070670_100088439 3300005331 Bacteria 2663
47 Ga0070670_100102369 3300005331 Bacteria 2466
48 Ga0070670_100196311 3300005331 Bacteria 1753
49 Ga0070670_101374981 3300005331 Bacteria 647
50 Ga0070677_10000586 3300005333 Bacteria 12335
51 Ga0070677_10132314 3300005333 Unclassified 1140
52 Ga0068869_100000003 3300005334 Bacteria 136262
53 Ga0068869_100212629 3300005334 Bacteria 1529
54 Ga0068869_100254904 3300005334 Bacteria 1403
55 Ga0070666_10039034 3300005335 Bacteria 3162
56 Ga0070666_10112768 3300005335 Bacteria 1881
57 Ga0070666_10163693 3300005335 Unclassified 1555
58 Ga0070666_10344696 3300005335 Bacteria 1065
59 Ga0070682_100016233 3300005337 Bacteria 4327
60 Ga0070682_100106997 3300005337 Bacteria 1857
61 Ga0070682_100212095 3300005337 Bacteria 1373
62 Ga0068868_100000379 3300005338 Bacteria 30367
63 Ga0068868_100147294 3300005338 Bacteria 1937
64 Ga0068868_100282704 3300005338 Bacteria 1405
65 Ga0068868_100502527 3300005338 Bacteria 1062
66 Ga0070660_100001636 3300005339 Bacteria 15411
67 Ga0070660_100004190 3300005339 Bacteria 9956
68 Ga0070660_100146337 3300005339 Bacteria 1898
69 Ga0070660_100183066 3300005339 Bacteria 1696
70 Ga0070660_100202182 3300005339 Bacteria 1611
71 Ga0070660_100263992 3300005339 Bacteria 1406
72 Ga0070660_100499953 3300005339 Bacteria 1011
73 Ga0070660_100525575 3300005339 Bacteria 986
74 Ga0070660_101355093 3300005339 Bacteria 604
75 Ga0070689_100071572 3300005340 Bacteria 2709
76 Ga0070691_10098557 3300005341 Bacteria 1449
77 Ga0070687_100052731 3300005343 Unclassified 2112
78 Ga0070661_100011430 3300005344 Bacteria 6184
79 Ga0070661_100029761 3300005344 Bacteria 3943
80 Ga0070661_100345945 3300005344 Bacteria 1166
81 Ga0070661_100507817 3300005344 Bacteria 966
82 Ga0070661_100613617 3300005344 Bacteria 880
83 Ga0070661_100654436 3300005344 Bacteria 853
84 Ga0070661_101368539 3300005344 Bacteria 595
85 Ga0070692_10008007 3300005345 Bacteria 4689
86 Ga0070668_100009629 3300005347 Bacteria 7169
87 Ga0070668_100138489 3300005347 Bacteria 1959
88 Ga0070668_100935095 3300005347 Bacteria 776
89 Ga0070668_101096079 3300005347 Bacteria 718
90 Ga0070668_101236010 3300005347 Unclassified 678
91 Ga0070668_101362901 3300005347 Bacteria 646
92 Ga0070669_100000138 3300005353 Bacteria 65433
93 Ga0070669_100014941 3300005353 Bacteria 5533
94 Ga0070669_100070379 3300005353 Bacteria 2586
95 Ga0070669_100087526 3300005353 Bacteria 2329
96 Ga0070669_100176800 3300005353 Bacteria 1668
97 Ga0070669_100232852 3300005353 Bacteria 1460
98 Ga0070669_100266977 3300005353 Bacteria 1367
99 Ga0070669_100406252 3300005353 Bacteria 1115
100 Ga0070675_100004728 3300005354 Bacteria 10394
101 Ga0070675_100005801 3300005354 Bacteria 9454
102 Ga0070671_100073064 3300005355 Bacteria 2865
103 Ga0070671_100316520 3300005355 Bacteria 1329
104 Ga0070671_100333268 3300005355 Bacteria 1293
105 Ga0070671_100503579 3300005355 Unclassified 1042
106 Ga0070671_100530059 3300005355 Bacteria 1014
107 Ga0070671_100847392 3300005355 Bacteria 797
108 Ga0070671_101077878 3300005355 Bacteria 705
109 Ga0070674_100055107 3300005356 Bacteria 2752
110 Ga0070674_100096255 3300005356 Bacteria 2148
111 Ga0070674_100232926 3300005356 Bacteria 1438
112 Ga0070673_100000154 3300005364 Bacteria 33033
113 Ga0070673_100073729 3300005364 Bacteria 2748
114 Ga0070673_100198149 3300005364 Bacteria 1728
115 Ga0070673_100224519 3300005364 Bacteria 1627
116 Ga0070688_100245323 3300005365 Unclassified 1273
117 Ga0070659_100000360 3300005366 Bacteria 34640
118 Ga0070659_100002156 3300005366 Bacteria 14026
119 Ga0070659_100007699 3300005366 Bacteria 7834
120 Ga0070659_100019596 3300005366 Bacteria 5130
121 Ga0070659_100114985 3300005366 Bacteria 2174
122 Ga0070659_100120466 3300005366 Bacteria 2125
123 Ga0070659_100204998 3300005366 Bacteria 1624
124 Ga0070659_100218853 3300005366 Bacteria 1571
125 Ga0070659_100226342 3300005366 Bacteria 1545
126 Ga0070659_100484786 3300005366 Bacteria 1052
127 Ga0070659_100566445 3300005366 Bacteria 974
128 Ga0070659_101117924 3300005366 Bacteria 695
129 Ga0070659_101324675 3300005366 Bacteria 639
130 Ga0070659_102065948 3300005366 Unclassified 512
131 Ga0070667_100003405 3300005367 Bacteria 13540
132 Ga0070667_100025127 3300005367 Bacteria 4952
133 Ga0070667_100228708 3300005367 Bacteria 1658
134 Ga0070667_100347354 3300005367 Bacteria 1342
135 Ga0070667_100865504 3300005367 Bacteria 840
136 Ga0070714_100070944 3300005435 Bacteria 3012
137 Ga0070714_100350159 3300005435 Bacteria 1387
138 Ga0070714_100631853 3300005435 Unclassified 1030
139 Ga0070714_100640366 3300005435 Bacteria 1023
140 Ga0070713_100344609 3300005436 Bacteria 1381
141 Ga0070701_10390391 3300005438 Bacteria 879
142 Ga0070694_100025797 3300005444 Bacteria 3805
143 Ga0070663_100081762 3300005455 Bacteria 2375
144 Ga0070663_100273942 3300005455 Bacteria 1343
145 Ga0070663_100288972 3300005455 Bacteria 1309
146 Ga0070663_100330948 3300005455 Bacteria 1228
147 Ga0070663_100451400 3300005455 Bacteria 1060
148 Ga0070678_100333668 3300005456 Bacteria 1298
149 Ga0070678_100770051 3300005456 Bacteria 872
150 Ga0070662_100000265 3300005457 Bacteria 30618
151 Ga0070662_100003781 3300005457 Bacteria 9469
152 Ga0070662_100098428 3300005457 Unclassified 2209
153 Ga0070662_100171408 3300005457 Bacteria 1704
154 Ga0070662_100460534 3300005457 Bacteria 1057
155 Ga0070662_100488268 3300005457 Unclassified 1026
156 Ga0070662_101040152 3300005457 Bacteria 702
157 Ga0070662_101091086 3300005457 Bacteria 685
158 Ga0070662_101516725 3300005457 Bacteria 578
159 Ga0070681_10824535 3300005458 Bacteria 845
160 Ga0068867_100000505 3300005459 Bacteria 26038
161 Ga0068867_100027399 3300005459 Bacteria 4094
162 Ga0068867_101537550 3300005459 Bacteria 620
163 Ga0070685_10085527 3300005466 Bacteria 1899
164 Ga0070679_101065266 3300005530 Bacteria 753
165 Ga0070679_101891691 3300005530 Bacteria 545
166 Ga0070684_100725038 3300005535 Bacteria 927
167 Ga0068853_100001049 3300005539 Bacteria 19524
168 Ga0068853_100010276 3300005539 Bacteria 7572
169 Ga0068853_100051976 3300005539 Bacteria 3529
170 Ga0068853_100065209 3300005539 Bacteria 3160
171 Ga0068853_100081687 3300005539 Bacteria 2830
172 Ga0068853_101994028 3300005539 Bacteria 563
173 Ga0070672_100000498 3300005543 Bacteria 22839
174 Ga0070672_100048499 3300005543 Bacteria 3300
175 Ga0070672_100118880 3300005543 Bacteria 2161
176 Ga0070686_100077659 3300005544 Bacteria 2190
177 Ga0070696_100001328 3300005546 Bacteria 16123
178 Ga0070696_100086604 3300005546 Bacteria 2224
179 Ga0070696_101646462 3300005546 Unclassified 552
180 Ga0070693_101051060 3300005547 Bacteria 619
181 Ga0070665_100074892 3300005548 Bacteria 3391
182 Ga0070665_100148854 3300005548 Bacteria 2344
183 Ga0070665_100352137 3300005548 Bacteria 1478
184 Ga0070665_100421499 3300005548 Bacteria 1343
185 Ga0070665_101322241 3300005548 Bacteria 730
186 Ga0070704_100457632 3300005549 Bacteria 1100
187 Ga0068855_100009865 3300005563 Bacteria 11517
188 Ga0068855_100061554 3300005563 Bacteria 4385
189 Ga0068855_100223896 3300005563 Bacteria 2108
190 Ga0068855_100365900 3300005563 Bacteria 1586
191 Ga0068855_100541236 3300005563 Bacteria 1261
192 Ga0068855_100573513 3300005563 Bacteria 1219
193 Ga0068855_100865158 3300005563 Bacteria 957
194 Ga0068855_101016667 3300005563 Bacteria 870
195 Ga0068855_101320474 3300005563 Bacteria 746
196 Ga0068855_101451239 3300005563 Bacteria 706
197 Ga0068855_101475448 3300005563 Bacteria 699
198 Ga0070664_100012015 3300005564 Bacteria 7034
199 Ga0070664_100021606 3300005564 Bacteria 5307
200 Ga0070664_100072962 3300005564 Bacteria 2944
201 Ga0070664_100196752 3300005564 Bacteria 1797
202 Ga0070664_100286069 3300005564 Bacteria 1487
203 Ga0070664_100493964 3300005564 Unclassified 1127
204 Ga0070664_100509090 3300005564 Unclassified 1110
205 Ga0068857_100007857 3300005577 Bacteria 9201
206 Ga0068857_100015251 3300005577 Bacteria 6707
207 Ga0068857_100017687 3300005577 Bacteria 6251
208 Ga0068857_100038562 3300005577 Bacteria 4231
209 Ga0068857_100064176 3300005577 Bacteria 3265
210 Ga0068857_100127223 3300005577 Bacteria 2296
211 Ga0068857_100237615 3300005577 Bacteria 1667
212 Ga0068857_100375255 3300005577 Bacteria 1320
213 Ga0068857_100568256 3300005577 Bacteria 1070
214 Ga0068857_100881305 3300005577 Unclassified 857
215 Ga0068857_101996550 3300005577 Bacteria 569
216 Ga0068854_100000358 3300005578 Bacteria 29248
217 Ga0068854_100010269 3300005578 Bacteria 6070
218 Ga0068854_100069813 3300005578 Bacteria 2566
219 Ga0068854_100200505 3300005578 Bacteria 1568
220 Ga0068854_100213601 3300005578 Bacteria 1523
221 Ga0068854_100223633 3300005578 Bacteria 1490
222 Ga0068854_100415344 3300005578 Bacteria 1116
223 Ga0068854_100590272 3300005578 Bacteria 947
224 Ga0068854_100876201 3300005578 Bacteria 788
225 Ga0068856_100091060 3300005614 Bacteria 3034
226 Ga0068856_100192181 3300005614 Bacteria 2055
227 Ga0068856_100251862 3300005614 Bacteria 1781
228 Ga0068856_100348577 3300005614 Unclassified 1499
229 Ga0068856_100553155 3300005614 Bacteria 1172
230 Ga0068856_100727391 3300005614 Bacteria 1013
231 Ga0068856_100893110 3300005614 Bacteria 907
232 Ga0068856_101119659 3300005614 Unclassified 804
233 Ga0068852_100000496 3300005616 Bacteria 25774
234 Ga0068852_100003104 3300005616 Bacteria 11562
235 Ga0068852_100062688 3300005616 Bacteria 3234
236 Ga0068852_100290662 3300005616 Bacteria 1579
237 Ga0068852_100331852 3300005616 Bacteria 1480
238 Ga0068852_100414880 3300005616 Bacteria 1327
239 Ga0068852_100938501 3300005616 Bacteria 883
240 Ga0068859_100007540 3300005617 Bacteria 11050
241 Ga0068859_100012095 3300005617 Bacteria 8673
242 Ga0068859_100268504 3300005617 Bacteria 1798
243 Ga0068859_100424131 3300005617 Bacteria 1426
244 Ga0068859_100650078 3300005617 Bacteria 1146
245 Ga0068859_101008678 3300005617 Bacteria 914
246 Ga0068864_100000047 3300005618 Bacteria 150798
247 Ga0068864_100006177 3300005618 Bacteria 9824
248 Ga0068864_100322790 3300005618 Bacteria 1450
249 Ga0068864_100350391 3300005618 Bacteria 1393
250 Ga0068866_10031681 3300005718 Bacteria 2549
251 Ga0068866_10032541 3300005718 Bacteria 2523
252 Ga0068861_100020837 3300005719 Bacteria 4703
253 Ga0068861_100261958 3300005719 Bacteria 1480
254 Ga0068861_100921413 3300005719 Bacteria 829
255 Ga0068861_101202772 3300005719 Bacteria 733
256 Ga0068861_102381194 3300005719 Bacteria 532
257 Ga0068851_10083765 3300005834 Unclassified 1669
258 Ga0068851_10124800 3300005834 Unclassified 1387
259 Ga0068851_10366054 3300005834 Bacteria 842
260 Ga0068851_10529549 3300005834 Bacteria 710
261 Ga0068870_10116604 3300005840 Unclassified 1532
262 Ga0068870_10224138 3300005840 Bacteria 1152
263 Ga0068863_100000468 3300005841 Bacteria 41287
264 Ga0068863_100002397 3300005841 Bacteria 18643
265 Ga0068863_100009582 3300005841 Bacteria 9447
266 Ga0068863_100141281 3300005841 Bacteria 2301
267 Ga0068863_100225723 3300005841 Bacteria 1805
268 Ga0068863_100703134 3300005841 Bacteria 1005
269 Ga0068858_100012571 3300005842 Bacteria 7983
270 Ga0068858_100015068 3300005842 Bacteria 7272
271 Ga0068858_100044002 3300005842 Bacteria 4139
272 Ga0068858_100864621 3300005842 Bacteria 883
273 Ga0068860_100035520 3300005843 Bacteria 4780
274 Ga0068860_100319205 3300005843 Bacteria 1524
275 Ga0068860_100342136 3300005843 Bacteria 1471
276 Ga0068860_100449559 3300005843 Unclassified 1281
277 Ga0068860_100503693 3300005843 Bacteria 1209
278 Ga0068860_102183311 3300005843 Unclassified 575
279 Ga0068862_100165354 3300005844 Bacteria 1977
280 Ga0068862_100736489 3300005844 Bacteria 958
281 Ga0081539_10006545 3300005985 Bacteria 11115
282 Ga0081539_10071795 3300005985 Bacteria 1852
283 Ga0070717_10214041 3300006028 Bacteria 1692
284 Ga0097621_100190307 3300006237 Unclassified 1777
285 Ga0068871_100131641 3300006358 Unclassified 2121
286 Ga0075428_100463464 3300006844 Bacteria 1357
287 Ga0075431_101142144 3300006847 Bacteria 743
288 Ga0075433_10174113 3300006852 Bacteria 1914
289 Ga0075433_10700859 3300006852 Bacteria 887
290 Ga0075434_100567650 3300006871 Bacteria 1154
291 Ga0068865_100004215 3300006881 Bacteria 8667
292 Ga0068865_101274472 3300006881 Bacteria 653
293 Ga0097620_100007540 3300006931 Bacteria 11050
294 Ga0097620_100012095 3300006931 Bacteria 8673
295 Ga0097620_100268499 3300006931 Bacteria 1798
296 Ga0097620_100424146 3300006931 Bacteria 1426
297 Ga0097620_100650109 3300006931 Bacteria 1146
298 Ga0097620_101008714 3300006931 Bacteria 914
299 Ga0105251_10241291 3300009011 Bacteria 814
300 Ga0105240_10082810 3300009093 Bacteria 3940
301 Ga0105240_10150746 3300009093 Bacteria 2770
302 Ga0105240_10155141 3300009093 Bacteria 2724
303 Ga0105240_10245372 3300009093 Bacteria 2074
304 Ga0105240_10496768 3300009093 Bacteria 1357
305 Ga0111539_10195370 3300009094 Bacteria 2360
306 Ga0105245_10000198 3300009098 Bacteria 57372
307 Ga0105245_10627440 3300009098 Bacteria 1103
308 Ga0105245_13097458 3300009098 Unclassified 515
309 Ga0105247_10476121 3300009101 Bacteria 905
310 Ga0114129_10168688 3300009147 Bacteria 2985
311 Ga0114129_10677065 3300009147 Bacteria 1328
312 Ga0105243_10104023 3300009148 Unclassified 2362
313 Ga0105243_10345568 3300009148 Bacteria 1364
314 Ga0105241_10024842 3300009174 Bacteria 4452
315 Ga0105241_10091714 3300009174 Bacteria 2398
316 Ga0105241_10114060 3300009174 Bacteria 2167
317 Ga0105241_10264346 3300009174 Bacteria 1463
318 Ga0105242_10381026 3300009176 Bacteria 1311
319 Ga0105242_11186416 3300009176 Unclassified 782
320 Ga0105248_10000391 3300009177 Bacteria 50565
321 Ga0105248_10019149 3300009177 Bacteria 7572
322 Ga0105248_10070376 3300009177 Bacteria 3929
323 Ga0105248_11036106 3300009177 Bacteria 927
324 Ga0105237_10027469 3300009545 Bacteria 5810
325 Ga0105237_10109380 3300009545 Bacteria 2756
326 Ga0105238_10004928 3300009551 Bacteria 13213
327 Ga0105238_10023625 3300009551 Bacteria 6264
328 Ga0105238_10397275 3300009551 Bacteria 1371
329 Ga0105238_10539740 3300009551 Bacteria 1170
330 Ga0105249_10006569 3300009553 Bacteria 10120
331 Ga0105249_10508507 3300009553 Bacteria 1251
332 Ga0105239_10057841 3300010375 Bacteria 4253
333 Ga0105239_10419537 3300010375 Bacteria 1516
334 Ga0105239_10529899 3300010375 Bacteria 1340
335 Ga0105246_10011519 3300011119 Bacteria 5489
336 Ga0105246_10045186 3300011119 Bacteria 2997
337 Ga0105246_10128757 3300011119 Unclassified 1887
338 Ga0105246_10800936 3300011119 Bacteria 836
339 Ga0105246_10978938 3300011119 Bacteria 764
340 Ga0157373_10036574 3300013100 Bacteria 3523
341 Ga0157373_10112571 3300013100 Bacteria 1913
342 Ga0157373_10200923 3300013100 Unclassified 1405
343 Ga0157373_10421410 3300013100 Bacteria 958
344 Ga0157373_10514517 3300013100 Bacteria 866
345 Ga0157373_10836363 3300013100 Bacteria 680
346 Ga0157371_10001384 3300013102 Bacteria 25410
347 Ga0157371_10019102 3300013102 Bacteria 5060
348 Ga0157371_10053929 3300013102 Bacteria 2855
349 Ga0157371_10156092 3300013102 Bacteria 1629
350 Ga0157371_10570962 3300013102 Bacteria 840
351 Ga0157371_11096468 3300013102 Bacteria 610
352 Ga0157370_10012142 3300013104 Bacteria 8958
353 Ga0157370_10012582 3300013104 Bacteria 8769
354 Ga0157370_10056957 3300013104 Bacteria 3719
355 Ga0157370_10294795 3300013104 Bacteria 1498
356 Ga0157370_10440240 3300013104 Unclassified 1199
357 Ga0157370_10761277 3300013104 Bacteria 882
358 Ga0157370_11392803 3300013104 Bacteria 631
359 Ga0157370_11579018 3300013104 Bacteria 590
360 Ga0157370_11851505 3300013104 Unclassified 541
361 Ga0157369_10000457 3300013105 Bacteria 54100
362 Ga0157369_10021058 3300013105 Bacteria 7289
363 Ga0157369_10076235 3300013105 Bacteria 3594
364 Ga0157369_10156639 3300013105 Bacteria 2406
365 Ga0157369_10160897 3300013105 Bacteria 2370
366 Ga0157369_10285112 3300013105 Bacteria 1720
367 Ga0157369_11563525 3300013105 Bacteria 671
368 Ga0157374_11985457 3300013296 Bacteria 608
369 Ga0157374_12852061 3300013296 Bacteria 511
370 Ga0157378_10001767 3300013297 Bacteria 19410
371 Ga0157378_11172066 3300013297 Bacteria 807
372 Ga0157378_12737795 3300013297 Unclassified 546
373 Ga0163162_10046170 3300013306 Bacteria 4366
374 Ga0163162_10086983 3300013306 Bacteria 3204
375 Ga0163162_10554224 3300013306 Bacteria 1278
376 Ga0157372_10112895 3300013307 Bacteria 3114
377 Ga0157372_10273612 3300013307 Bacteria 1963
378 Ga0157372_10376629 3300013307 Bacteria 1654
379 Ga0157372_10562961 3300013307 Bacteria 1328
380 Ga0157372_10595360 3300013307 Bacteria 1289
381 Ga0157372_10997475 3300013307 Bacteria 970
382 Ga0157372_12569809 3300013307 Unclassified 584
383 Ga0157372_12851967 3300013307 Bacteria 554
384 Ga0157372_13266939 3300013307 Unclassified 517
385 Ga0157375_10122243 3300013308 Bacteria 2715
386 Ga0157375_10417988 3300013308 Bacteria 1507
387 Ga0157375_10856468 3300013308 Bacteria 1055
388 Ga0157380_10167350 3300014326 Bacteria 1917
389 Ga0157380_11126477 3300014326 Bacteria 825
390 Ga0182008_10056797 3300014497 Unclassified 1933
391 Ga0157377_10098203 3300014745 Bacteria 1740
392 Ga0157379_10116177 3300014968 Bacteria 2406
393 Ga0157379_10324422 3300014968 Bacteria 1406
394 Ga0157379_11783519 3300014968 Bacteria 604
395 Ga0197907_10321886 3300020069 Bacteria 1261
396 Ga0206356_10452544 3300020070 Bacteria 2116
397 Ga0213875_10045185 3300021388 Bacteria 2067
398 Ga0207425_1016568 3300025245 Bacteria 1633
399 Ga0209565_1000011 3300025263 Bacteria 637062
400 Ga0209673_1005937 3300025273 Bacteria 6026
401 Ga0209758_1008619 3300025297 Bacteria 6550
402 Ga0209050_1026362 3300025298 Bacteria 1947
403 Ga0209256_1000016 3300025299 Bacteria 599092
404 Ga0207426_1071662 3300025302 Bacteria 964
405 Ga0209257_1004174 3300025304 Bacteria 11471
406 Ga0207697_10000033 3300025315 Bacteria 50935
407 Ga0207656_10290443 3300025321 Bacteria 808
408 Ga0207682_10000575 3300025893 Bacteria 16991
409 Ga0207682_10030067 3300025893 Bacteria 2174
410 Ga0207642_10021293 3300025899 Bacteria 2550
411 Ga0207688_10000292 3300025901 Bacteria 22907
412 Ga0207688_10074465 3300025901 Bacteria 1931
413 Ga0207680_10053408 3300025903 Bacteria 2426
414 Ga0207680_10148817 3300025903 Bacteria 1559
415 Ga0207680_10376007 3300025903 Bacteria 1001
416 Ga0207680_10839037 3300025903 Bacteria 659
417 Ga0207647_10000843 3300025904 Bacteria 23770
418 Ga0207647_10002661 3300025904 Bacteria 13485
419 Ga0207647_10036469 3300025904 Bacteria 3124
420 Ga0207647_10105081 3300025904 Bacteria 1673
421 Ga0207647_10159989 3300025904 Bacteria 1314
422 Ga0207647_10209241 3300025904 Bacteria 1127
423 Ga0207647_10400898 3300025904 Bacteria 773
424 Ga0207647_10427528 3300025904 Unclassified 744
425 Ga0207699_10597829 3300025906 Unclassified 803
426 Ga0207645_10004701 3300025907 Bacteria 10045
427 Ga0207645_10338809 3300025907 Bacteria 1005
428 Ga0207645_10359642 3300025907 Bacteria 975
429 Ga0207645_10408771 3300025907 Bacteria 913
430 Ga0207643_10009288 3300025908 Bacteria 5284
431 Ga0207643_10206750 3300025908 Unclassified 1197
432 Ga0207705_10026052 3300025909 Bacteria 4172
433 Ga0207705_10055084 3300025909 Bacteria 2867
434 Ga0207705_10059412 3300025909 Bacteria 2759
435 Ga0207705_10131978 3300025909 Bacteria 1859
436 Ga0207705_10184633 3300025909 Bacteria 1575
437 Ga0207705_10202588 3300025909 Bacteria 1504
438 Ga0207705_10215364 3300025909 Bacteria 1457
439 Ga0207705_10392903 3300025909 Unclassified 1072
440 Ga0207705_10611158 3300025909 Bacteria 848
441 Ga0207705_10831574 3300025909 Bacteria 716
442 Ga0207705_11035049 3300025909 Unclassified 634
443 Ga0207705_11039170 3300025909 Bacteria 632
444 Ga0207705_11291651 3300025909 Bacteria 557
445 Ga0207654_10110953 3300025911 Bacteria 1707
446 Ga0207654_10294760 3300025911 Unclassified 1101
447 Ga0207654_10910506 3300025911 Bacteria 638
448 Ga0207707_10220451 3300025912 Bacteria 1651
449 Ga0207707_10395730 3300025912 Bacteria 1186
450 Ga0207695_10016587 3300025913 Bacteria 8611
451 Ga0207695_10027242 3300025913 Bacteria 6367
452 Ga0207695_10603653 3300025913 Bacteria 978
453 Ga0207671_10094566 3300025914 Bacteria 2256
454 Ga0207660_10072792 3300025917 Bacteria 2504
455 Ga0207660_10192782 3300025917 Bacteria 1588
456 Ga0207662_10030906 3300025918 Bacteria 3111
457 Ga0207657_10000737 3300025919 Bacteria 34706
458 Ga0207657_10006621 3300025919 Bacteria 11994
459 Ga0207657_10110851 3300025919 Bacteria 2266
460 Ga0207657_10145610 3300025919 Bacteria 1933
461 Ga0207657_10271644 3300025919 Bacteria 1348
462 Ga0207657_10295217 3300025919 Bacteria 1284
463 Ga0207657_10335764 3300025919 Bacteria 1193
464 Ga0207657_10479929 3300025919 Bacteria 974
465 Ga0207649_10030758 3300025920 Bacteria 3183
466 Ga0207649_10076707 3300025920 Bacteria 2151
467 Ga0207649_10311095 3300025920 Bacteria 1155
468 Ga0207649_10445415 3300025920 Bacteria 976
469 Ga0207649_10476777 3300025920 Bacteria 946
470 Ga0207649_11139458 3300025920 Bacteria 616
471 Ga0207649_11372384 3300025920 Bacteria 559
472 Ga0207649_11530173 3300025920 Unclassified 528
473 Ga0207652_10170844 3300025921 Bacteria 1951
474 Ga0207652_11507577 3300025921 Bacteria 576
475 Ga0207681_10000355 3300025923 Bacteria 32681
476 Ga0207681_10041976 3300025923 Bacteria 3052
477 Ga0207681_10173723 3300025923 Bacteria 1635
478 Ga0207681_10319802 3300025923 Bacteria 1234
479 Ga0207681_10372731 3300025923 Bacteria 1147
480 Ga0207694_10008107 3300025924 Bacteria 7938
481 Ga0207694_10028515 3300025924 Bacteria 4257
482 Ga0207694_10178698 3300025924 Bacteria 1720
483 Ga0207694_10584429 3300025924 Bacteria 939
484 Ga0207650_10009826 3300025925 Bacteria 6544
485 Ga0207650_10022527 3300025925 Bacteria 4459
486 Ga0207650_10157672 3300025925 Bacteria 1796
487 Ga0207650_10244364 3300025925 Bacteria 1451
488 Ga0207650_10279465 3300025925 Bacteria 1359
489 Ga0207650_10449275 3300025925 Unclassified 1072
490 Ga0207650_10674158 3300025925 Bacteria 872
491 Ga0207650_11185113 3300025925 Bacteria 650
492 Ga0207659_10008412 3300025926 Bacteria 6405
493 Ga0207659_10153349 3300025926 Bacteria 1801
494 Ga0207659_10192402 3300025926 Bacteria 1624
495 Ga0207687_10002290 3300025927 Bacteria 13038
496 Ga0207687_11209292 3300025927 Unclassified 649
497 Ga0207664_10012294 3300025929 Bacteria 6115
498 Ga0207664_10055301 3300025929 Bacteria 3149
499 Ga0207644_10010107 3300025931 Bacteria 6216
500 Ga0207644_10195743 3300025931 Bacteria 1592
501 Ga0207644_10212008 3300025931 Bacteria 1532
502 Ga0207644_10400307 3300025931 Bacteria 1122
503 Ga0207644_10741175 3300025931 Bacteria 820
504 Ga0207644_10961959 3300025931 Bacteria 716
505 Ga0207690_10000402 3300025932 Bacteria 28577
506 Ga0207690_10006964 3300025932 Bacteria 6702
507 Ga0207690_10025971 3300025932 Bacteria 3685
508 Ga0207690_10030108 3300025932 Bacteria 3458
509 Ga0207690_10033722 3300025932 Bacteria 3294
510 Ga0207690_10123526 3300025932 Bacteria 1884
511 Ga0207690_10129176 3300025932 Bacteria 1847
512 Ga0207690_10169206 3300025932 Bacteria 1636
513 Ga0207690_10205688 3300025932 Bacteria 1498
514 Ga0207690_10362216 3300025932 Bacteria 1149
515 Ga0207690_10386511 3300025932 Bacteria 1113
516 Ga0207706_10000020 3300025933 Bacteria 162063
517 Ga0207706_10018403 3300025933 Bacteria 6286
518 Ga0207706_10023551 3300025933 Bacteria 5528
519 Ga0207706_10051934 3300025933 Bacteria 3619
520 Ga0207706_10113258 3300025933 Bacteria 2386
521 Ga0207706_10120754 3300025933 Bacteria 2304
522 Ga0207706_10296231 3300025933 Bacteria 1410
523 Ga0207706_10340102 3300025933 Unclassified 1305
524 Ga0207706_10373260 3300025933 Bacteria 1238
525 Ga0207706_10421533 3300025933 Bacteria 1156
526 Ga0207706_10423079 3300025933 Bacteria 1154
527 Ga0207706_10927183 3300025933 Bacteria 735
528 Ga0207686_10951130 3300025934 Unclassified 695
529 Ga0207709_10061002 3300025935 Unclassified 2354
530 Ga0207709_10223608 3300025935 Bacteria 1359
531 Ga0207670_10054071 3300025936 Bacteria 2708
532 Ga0207669_10079150 3300025937 Bacteria 2097
533 Ga0207669_10629720 3300025937 Bacteria 875
534 Ga0207704_10009284 3300025938 Bacteria 4735
535 Ga0207704_10573727 3300025938 Bacteria 920
536 Ga0207704_11167143 3300025938 Bacteria 656
537 Ga0207691_10000047 3300025940 Bacteria 99519
538 Ga0207691_10058855 3300025940 Bacteria 3495
539 Ga0207691_10523075 3300025940 Bacteria 1007
540 Ga0207711_10003234 3300025941 Bacteria 14200
541 Ga0207711_10013865 3300025941 Bacteria 6694
542 Ga0207711_10267924 3300025941 Bacteria 1571
543 Ga0207711_11096072 3300025941 Unclassified 737
544 Ga0207689_10000002 3300025942 Bacteria 198437
545 Ga0207689_10115175 3300025942 Bacteria 2210
546 Ga0207689_10285825 3300025942 Bacteria 1366
547 Ga0207689_10324236 3300025942 Bacteria 1278
548 Ga0207661_10201730 3300025944 Bacteria 1749
549 Ga0207661_10472783 3300025944 Bacteria 1144
550 Ga0207679_10011404 3300025945 Bacteria 5754
551 Ga0207679_10029698 3300025945 Bacteria 3808
552 Ga0207679_10347936 3300025945 Bacteria 1291
553 Ga0207679_10354490 3300025945 Bacteria 1280
554 Ga0207679_10573460 3300025945 Bacteria 1014
555 Ga0207679_10809600 3300025945 Bacteria 854
556 Ga0207679_11253706 3300025945 Unclassified 680
557 Ga0207667_10013340 3300025949 Bacteria 9408
558 Ga0207667_10041224 3300025949 Bacteria 4911
559 Ga0207667_10325314 3300025949 Bacteria 1570
560 Ga0207667_10355489 3300025949 Bacteria 1494
561 Ga0207667_10455962 3300025949 Bacteria 1299
562 Ga0207667_10519999 3300025949 Bacteria 1205
563 Ga0207667_10656572 3300025949 Bacteria 1054
564 Ga0207667_10994217 3300025949 Bacteria 826
565 Ga0207667_11408533 3300025949 Bacteria 670
566 Ga0207651_10000445 3300025960 Bacteria 17481
567 Ga0207651_10279820 3300025960 Bacteria 1378
568 Ga0207712_10002789 3300025961 Bacteria 11176
569 Ga0207668_10016932 3300025972 Bacteria 4561
570 Ga0207668_10124251 3300025972 Bacteria 1959
571 Ga0207668_10735846 3300025972 Bacteria 869
572 Ga0207668_10962182 3300025972 Bacteria 762
573 Ga0207640_10000415 3300025981 Bacteria 26811
574 Ga0207640_10001597 3300025981 Bacteria 12184
575 Ga0207640_10049707 3300025981 Bacteria 2717
576 Ga0207640_10062393 3300025981 Bacteria 2473
577 Ga0207640_10126426 3300025981 Bacteria 1841
578 Ga0207640_10141447 3300025981 Bacteria 1755
579 Ga0207640_10172719 3300025981 Bacteria 1612
580 Ga0207640_10229884 3300025981 Bacteria 1426
581 Ga0207640_10353969 3300025981 Bacteria 1181
582 Ga0207640_10439767 3300025981 Bacteria 1072
583 Ga0207658_10002093 3300025986 Bacteria 14829
584 Ga0207658_10009516 3300025986 Bacteria 6597
585 Ga0207658_10050332 3300025986 Bacteria 3065
586 Ga0207658_10104245 3300025986 Bacteria 2228
587 Ga0207658_10421181 3300025986 Bacteria 1177
588 Ga0207658_10951115 3300025986 Bacteria 783
589 Ga0207677_10001382 3300026023 Bacteria 12949
590 Ga0207677_10065855 3300026023 Bacteria 2530
591 Ga0207703_10001138 3300026035 Bacteria 25123
592 Ga0207703_10004446 3300026035 Bacteria 11517
593 Ga0207703_10041212 3300026035 Bacteria 3698
594 Ga0207703_11283293 3300026035 Bacteria 704
595 Ga0207639_10000074 3300026041 Bacteria 91671
596 Ga0207639_10001353 3300026041 Bacteria 16541
597 Ga0207639_10092247 3300026041 Bacteria 2427
598 Ga0207639_10100442 3300026041 Bacteria 2337
599 Ga0207639_10110195 3300026041 Bacteria 2242
600 Ga0207639_10372989 3300026041 Bacteria 1280
601 Ga0207678_10027276 3300026067 Bacteria 4980
602 Ga0207678_10093683 3300026067 Bacteria 2566
603 Ga0207678_10177803 3300026067 Bacteria 1817
604 Ga0207678_10182630 3300026067 Bacteria 1791
605 Ga0207678_10313198 3300026067 Bacteria 1350
606 Ga0207678_10365373 3300026067 Bacteria 1246
607 Ga0207708_10409816 3300026075 Bacteria 1122
608 Ga0207702_10136993 3300026078 Bacteria 2210
609 Ga0207702_10170935 3300026078 Unclassified 1993
610 Ga0207702_10414828 3300026078 Bacteria 1301
611 Ga0207702_10423192 3300026078 Bacteria 1288
612 Ga0207702_10449298 3300026078 Bacteria 1250
613 Ga0207702_10559365 3300026078 Bacteria 1119
614 Ga0207702_10570216 3300026078 Bacteria 1109
615 Ga0207702_10648690 3300026078 Bacteria 1038
616 Ga0207641_10012319 3300026088 Bacteria 7016
617 Ga0207641_10017664 3300026088 Bacteria 5842
618 Ga0207641_10042054 3300026088 Bacteria 3832
619 Ga0207641_10108664 3300026088 Bacteria 2455
620 Ga0207648_10001030 3300026089 Bacteria 31326
621 Ga0207648_10026079 3300026089 Bacteria 5196
622 Ga0207676_10001020 3300026095 Bacteria 21453
623 Ga0207676_10159667 3300026095 Bacteria 1951
624 Ga0207676_10467239 3300026095 Bacteria 1192
625 Ga0207674_10000660 3300026116 Bacteria 44851
626 Ga0207674_10000881 3300026116 Bacteria 39300
627 Ga0207674_10003858 3300026116 Bacteria 18268
628 Ga0207674_10006970 3300026116 Bacteria 13229
629 Ga0207674_10009571 3300026116 Bacteria 11056
630 Ga0207674_10016191 3300026116 Bacteria 8166
631 Ga0207674_10062245 3300026116 Bacteria 3769
632 Ga0207674_10288376 3300026116 Bacteria 1590
633 Ga0207674_10566533 3300026116 Bacteria 1097
634 Ga0207674_10598930 3300026116 Bacteria 1065
635 Ga0207674_10769370 3300026116 Bacteria 929
636 Ga0207674_10996666 3300026116 Bacteria 807
637 Ga0207675_100014437 3300026118 Bacteria 7364
638 Ga0207675_100131888 3300026118 Bacteria 2370
639 Ga0207675_100946979 3300026118 Bacteria 878
640 Ga0207683_10455492 3300026121 Bacteria 1180
641 Ga0207698_10000833 3300026142 Bacteria 17878
642 Ga0207698_10012259 3300026142 Bacteria 5602
643 Ga0207698_10044704 3300026142 Bacteria 3331
644 Ga0207698_10150868 3300026142 Bacteria 2017
645 Ga0207698_10208522 3300026142 Bacteria 1756
646 Ga0207698_10276994 3300026142 Bacteria 1549
647 Ga0207698_10332248 3300026142 Bacteria 1428
648 Ga0207698_10908331 3300026142 Bacteria 888
649 Ga0207698_12023677 3300026142 Bacteria 590
650 Ga0268266_10178089 3300028379 Bacteria 1934
651 Ga0268266_11579920 3300028379 Bacteria 631
652 Ga0268265_10009142 3300028380 Bacteria 6696
653 Ga0268265_10153767 3300028380 Bacteria 1944
654 Ga0268265_10311061 3300028380 Bacteria 1422
655 Ga0268265_10925126 3300028380 Bacteria 857
656 Ga0268264_10007102 3300028381 Bacteria 9385
657 Ga0268264_10159513 3300028381 Bacteria 2030
658 Ga0268264_10334001 3300028381 Bacteria 1437
659 Ga0268264_10581901 3300028381 Unclassified 1101
660 Ga0316182_1080945 3300030745 Bacteria 1184
661 Ga0316182_1240096 3300030745 Bacteria 902
662 Ga0307408_100177635 3300031548 Bacteria 1704
663 Ga0307408_100182053 3300031548 Bacteria 1686
664 Ga0307408_100183750 3300031548 Bacteria 1679
665 Ga0307408_100288098 3300031548 Bacteria 1370
666 Ga0307408_100381514 3300031548 Bacteria 1205
667 Ga0307408_101068512 3300031548 Unclassified 747
668 Ga0307408_101215796 3300031548 Unclassified 703
669 Ga0307405_10015872 3300031731 Bacteria 4091
670 Ga0307405_10049410 3300031731 Bacteria 2599
671 Ga0307405_10063465 3300031731 Bacteria 2343
672 Ga0307405_10158693 3300031731 Bacteria 1599
673 Ga0307405_10208973 3300031731 Bacteria 1423
674 Ga0307405_10621175 3300031731 Bacteria 885
675 Ga0307405_11314503 3300031731 Bacteria 629
676 Ga0307405_11933173 3300031731 Bacteria 527
677 Ga0307413_10003886 3300031824 Bacteria 6388
678 Ga0307413_10012003 3300031824 Bacteria 4290
679 Ga0307413_10119561 3300031824 Bacteria 1781
680 Ga0307413_10123461 3300031824 Bacteria 1758
681 Ga0307413_10209509 3300031824 Bacteria 1414
682 Ga0307413_10293631 3300031824 Bacteria 1229
683 Ga0307413_10327280 3300031824 Bacteria 1173
684 Ga0307413_10432872 3300031824 Bacteria 1039
685 Ga0307413_10523655 3300031824 Bacteria 956
686 Ga0307413_10666127 3300031824 Bacteria 860
687 Ga0307413_11165572 3300031824 Bacteria 669
688 Ga0307413_11376771 3300031824 Bacteria 620
689 Ga0307413_11557854 3300031824 Bacteria 586
690 Ga0307410_10000627 3300031852 Bacteria 14547
691 Ga0307410_10007397 3300031852 Bacteria 6010
692 Ga0307410_10019559 3300031852 Bacteria 4122
693 Ga0307410_10019771 3300031852 Bacteria 4104
694 Ga0307410_10139669 3300031852 Bacteria 1790
695 Ga0307410_10244413 3300031852 Bacteria 1392
696 Ga0307410_10376351 3300031852 Bacteria 1141
697 Ga0307410_10662665 3300031852 Bacteria 876
698 Ga0307410_10953260 3300031852 Bacteria 738
699 Ga0307410_11341568 3300031852 Bacteria 627
700 Ga0307406_10002922 3300031901 Bacteria 9303
701 Ga0307406_10076306 3300031901 Bacteria 2213
702 Ga0307406_10118163 3300031901 Bacteria 1838
703 Ga0307406_10176855 3300031901 Bacteria 1550
704 Ga0307406_10246819 3300031901 Bacteria 1342
705 Ga0307406_10252101 3300031901 Bacteria 1330
706 Ga0307406_10352710 3300031901 Bacteria 1150
707 Ga0307406_10371106 3300031901 Bacteria 1125
708 Ga0307406_10724806 3300031901 Bacteria 832
709 Ga0307406_11016365 3300031901 Bacteria 712
710 Ga0307407_10008725 3300031903 Bacteria 4672
711 Ga0307407_10075940 3300031903 Bacteria 2016
712 Ga0307407_10076257 3300031903 Bacteria 2013
713 Ga0307407_10132544 3300031903 Bacteria 1596
714 Ga0307407_10307696 3300031903 Bacteria 1107
715 Ga0307412_10014789 3300031911 Bacteria 4611
716 Ga0307412_10019484 3300031911 Bacteria 4111
717 Ga0307412_10062321 3300031911 Bacteria 2510
718 Ga0307412_10181060 3300031911 Bacteria 1585
719 Ga0307412_10356632 3300031911 Bacteria 1176
720 Ga0307412_10421029 3300031911 Bacteria 1092
721 Ga0307412_10519461 3300031911 Bacteria 995
722 Ga0307412_10627760 3300031911 Bacteria 914
723 Ga0307412_10806981 3300031911 Bacteria 815
724 Ga0307409_100006675 3300031995 Bacteria 6817
725 Ga0307409_100015053 3300031995 Bacteria 5059
726 Ga0307409_100059086 3300031995 Bacteria 2982
727 Ga0307409_100080029 3300031995 Bacteria 2635
728 Ga0307409_100089576 3300031995 Bacteria 2515
729 Ga0307409_100142185 3300031995 Bacteria 2069
730 Ga0307409_100378967 3300031995 Bacteria 1344
731 Ga0307409_100387027 3300031995 Bacteria 1331
732 Ga0307409_100470293 3300031995 Bacteria 1217
733 Ga0307409_100969319 3300031995 Bacteria 867
734 Ga0307409_101060159 3300031995 Bacteria 831
735 Ga0307409_101590923 3300031995 Unclassified 682
736 Ga0307416_100017277 3300032002 Bacteria 5041
737 Ga0307416_100021305 3300032002 Bacteria 4650
738 Ga0307416_100051175 3300032002 Bacteria 3297
739 Ga0307416_100199609 3300032002 Bacteria 1896
740 Ga0307416_100564881 3300032002 Bacteria 1213
741 Ga0307416_100928262 3300032002 Bacteria 971
742 Ga0307416_100934826 3300032002 Bacteria 968
743 Ga0307416_100963399 3300032002 Bacteria 955
744 Ga0307416_101410243 3300032002 Bacteria 802
745 Ga0307416_101676488 3300032002 Bacteria 740
746 Ga0307416_101784021 3300032002 Bacteria 719
747 Ga0307416_103222126 3300032002 Bacteria 546
748 Ga0307416_103411373 3300032002 Unclassified 532
749 Ga0307414_10005561 3300032004 Bacteria 6951
750 Ga0307414_10018283 3300032004 Bacteria 4310
751 Ga0307414_10031792 3300032004 Bacteria 3466
752 Ga0307414_10058343 3300032004 Bacteria 2719
753 Ga0307414_10143495 3300032004 Bacteria 1873
754 Ga0307414_10215012 3300032004 Bacteria 1574
755 Ga0307414_10309282 3300032004 Bacteria 1340
756 Ga0307414_10484496 3300032004 Bacteria 1091
757 Ga0307414_10778303 3300032004 Bacteria 871
758 Ga0307414_10778844 3300032004 Bacteria 871
759 Ga0307411_10017067 3300032005 Bacteria 4124
760 Ga0307411_10028066 3300032005 Bacteria 3416
761 Ga0307411_10033140 3300032005 Bacteria 3201
762 Ga0307411_10080386 3300032005 Bacteria 2241
763 Ga0307411_10119675 3300032005 Bacteria 1902
764 Ga0307411_10139144 3300032005 Bacteria 1787
765 Ga0307411_10142593 3300032005 Bacteria 1768
766 Ga0307411_10170848 3300032005 Bacteria 1639
767 Ga0307411_10177292 3300032005 Bacteria 1614
768 Ga0307411_10207546 3300032005 Bacteria 1510
769 Ga0307411_10460041 3300032005 Bacteria 1066
770 Ga0307415_100020856 3300032126 Bacteria 4011
771 Ga0307415_100052770 3300032126 Bacteria 2767
772 Ga0307415_100077113 3300032126 Bacteria 2365
773 Ga0307415_100149746 3300032126 Bacteria 1794
774 Ga0307415_100582002 3300032126 Bacteria 993
775 Ga0307415_100693048 3300032126 Bacteria 918
776 Ga0307415_101216119 3300032126 Bacteria 710
777 Ga0373923_0040408 3300035111 Unclassified 1920
778 Ga0373954_0287550 3300035118 Bacteria 810
779 Ga0373955_0047478 3300035172 Bacteria 2325
780 Ga0373931_0487584 3300035691 Bacteria 793
781 Ga0373931_0641707 3300035691 Bacteria 697
782 Ga0373933_0085793 3300035724 Unclassified 1936
783 Ga0373937_0003627 3300036401 Bacteria 13023
784 Ga0395899_0001745 3300037312 Bacteria 18084
785 Ga0395899_0009558 3300037312 Bacteria 7442
786 Ga0395899_0009970 3300037312 Bacteria 7286
787 Ga0395899_0046230 3300037312 Bacteria 3242
788 Ga0395899_0069146 3300037312 Bacteria 2587
789 Ga0395899_0141151 3300037312 Bacteria 1714
790 Ga0395899_0195526 3300037312 Bacteria 1413
791 Ga0395899_0201996 3300037312 Bacteria 1385
792 Ga0395899_0243059 3300037312 Bacteria 1238
793 Ga0395899_0329638 3300037312 Bacteria 1026
794 Ga0395899_0345259 3300037312 Bacteria 997
795 Ga0395899_0829710 3300037312 Bacteria 569
796 Ga0395900_0004511 3300037418 Bacteria 14732
797 Ga0395900_0017492 3300037418 Bacteria 7316
798 Ga0395900_0019280 3300037418 Bacteria 6955
799 Ga0395900_0027008 3300037418 Bacteria 5877
800 Ga0395900_0044751 3300037418 Bacteria 4560
801 Ga0395900_0064663 3300037418 Bacteria 3758
802 Ga0395900_0068656 3300037418 Bacteria 3642
803 Ga0395900_0077098 3300037418 Bacteria 3424
804 Ga0395900_0137522 3300037418 Bacteria 2503
805 Ga0395900_0161088 3300037418 Bacteria 2288
806 Ga0395900_0166367 3300037418 Bacteria 2247
807 Ga0395900_0170610 3300037418 Bacteria 2215
808 Ga0395900_0195143 3300037418 Bacteria 2052
809 Ga0395900_0205876 3300037418 Bacteria 1988
810 Ga0395900_0215425 3300037418 Bacteria 1938
811 Ga0395900_0281993 3300037418 Bacteria 1653
812 Ga0395900_0284256 3300037418 Bacteria 1645
813 Ga0395900_0285752 3300037418 Unclassified 1640
814 Ga0395900_0292482 3300037418 Bacteria 1617
815 Ga0395900_0293086 3300037418 Bacteria 1615
816 Ga0395900_0351896 3300037418 Bacteria 1446
817 Ga0395900_0529610 3300037418 Unclassified 1125
818 Ga0395900_0624867 3300037418 Bacteria 1016
819 Ga0395900_1106923 3300037418 Bacteria 709
820 Ga0395898_0006840 3300037466 Bacteria 12125
821 Ga0395898_0020031 3300037466 Bacteria 6799
822 Ga0395898_0024151 3300037466 Bacteria 6134
823 Ga0395898_0026010 3300037466 Bacteria 5893
824 Ga0395898_0034976 3300037466 Bacteria 5000
825 Ga0395898_0090449 3300037466 Bacteria 2945
826 Ga0395898_0154976 3300037466 Bacteria 2191
827 Ga0395898_0175796 3300037466 Bacteria 2046
828 Ga0395898_0226538 3300037466 Bacteria 1783
829 Ga0395898_0291150 3300037466 Unclassified 1558
830 Ga0395898_0383599 3300037466 Bacteria 1340
831 Ga0395898_0522622 3300037466 Bacteria 1128
832 Ga0395898_0885333 3300037466 Bacteria 831
833 Ga0395898_0945963 3300037466 Bacteria 799
834 Ga0395898_1109579 3300037466 Bacteria 724
835 Ga0395898_1897024 3300037466 Bacteria 516
836 Ga0395905_0002770 3300037471 Bacteria 19205
837 Ga0395905_0004357 3300037471 Bacteria 14736
838 Ga0395905_0005968 3300037471 Bacteria 12337
839 Ga0395905_0019802 3300037471 Bacteria 6378
840 Ga0395905_0022733 3300037471 Bacteria 5929
841 Ga0395905_0029060 3300037471 Bacteria 5209
842 Ga0395905_0032161 3300037471 Bacteria 4935
843 Ga0395905_0035402 3300037471 Bacteria 4688
844 Ga0395905_0036207 3300037471 Bacteria 4634
845 Ga0395905_0041829 3300037471 Bacteria 4300
846 Ga0395905_0045447 3300037471 Bacteria 4118
847 Ga0395905_0048149 3300037471 Bacteria 3995
848 Ga0395905_0052021 3300037471 Bacteria 3836
849 Ga0395905_0064594 3300037471 Bacteria 3425
850 Ga0395905_0132207 3300037471 Bacteria 2347
851 Ga0395905_0135126 3300037471 Bacteria 2320
852 Ga0395905_0190523 3300037471 Bacteria 1924
853 Ga0395905_0225630 3300037471 Bacteria 1752
854 Ga0395905_0245839 3300037471 Bacteria 1671
855 Ga0395905_0262485 3300037471 Bacteria 1612
856 Ga0395905_0334024 3300037471 Bacteria 1406
857 Ga0395905_0364366 3300037471 Bacteria 1338
858 Ga0395905_0449740 3300037471 Bacteria 1186
859 Ga0395905_0733308 3300037471 Unclassified 890
860 Ga0395905_0843258 3300037471 Bacteria 819
861 Ga0395905_0876429 3300037471 Bacteria 801
862 Ga0395905_1072842 3300037471 Bacteria 708
863 Ga0395905_1076340 3300037471 Bacteria 707
864 Ga0395905_1081077 3300037471 Bacteria 705
865 Ga0395905_1138891 3300037471 Bacteria 683
866 Ga0395905_1144472 3300037471 Unclassified 681
867 Ga0395905_1188185 3300037471 Bacteria 666
868 Ga0395905_1490159 3300037471 Bacteria 581
869 Ga0395905_1491683 3300037471 Bacteria 580
870 Ga0436364_1351497 3300037853 Bacteria 37033
871 Ga0395901_0004565 3300038443 Bacteria 13977
872 Ga0395901_0006859 3300038443 Bacteria 11503
873 Ga0395901_0016746 3300038443 Bacteria 7469
874 Ga0395901_0020377 3300038443 Bacteria 6788
875 Ga0395901_0030699 3300038443 Bacteria 5537
876 Ga0395901_0032904 3300038443 Bacteria 5349
877 Ga0395901_0033946 3300038443 Bacteria 5268
878 Ga0395901_0044503 3300038443 Bacteria 4604
879 Ga0395901_0073895 3300038443 Bacteria 3556
880 Ga0395901_0093575 3300038443 Bacteria 3147
881 Ga0395901_0117936 3300038443 Bacteria 2789
882 Ga0395901_0133263 3300038443 Bacteria 2611
883 Ga0395901_0171080 3300038443 Unclassified 2279
884 Ga0395901_0208651 3300038443 Bacteria 2045
885 Ga0395901_0294749 3300038443 Unclassified 1682
886 Ga0395901_0359761 3300038443 Unclassified 1501
887 Ga0395901_0417945 3300038443 Bacteria 1375
888 Ga0395901_0425947 3300038443 Unclassified 1360
889 Ga0395901_0651775 3300038443 Bacteria 1056
890 Ga0395901_0661314 3300038443 Bacteria 1047
891 Ga0395901_0843162 3300038443 Bacteria 902
892 Ga0395901_0892598 3300038443 Bacteria 871
893 Ga0395901_1115703 3300038443 Bacteria 758
894 Ga0395901_1163210 3300038443 Unclassified 739
895 Ga0395901_2053583 3300038443 Bacteria 517
896 Ga0395901_2070677 3300038443 Bacteria 514
897 Ga0436365_0189939 3300039437 Bacteria 5374
898 Ga0439439_0115426 3300041406 Bacteria 746
899 Ga0439466_0176241 3300041411 Unclassified 652
900 Ga0451793_0698699 3300041452 Unclassified 899
901 Ga0439448_0016258 3300042005 Bacteria 2262
902 Ga0439448_0251385 3300042005 Bacteria 624
903 Ga0439448_0332366 3300042005 Unclassified 541
904 Ga0439432_054537 3300042006 Bacteria 1242
905 Ga0439449_0033202 3300042007 Bacteria 1923
906 Ga0450912_004580 3300042116 Bacteria 1031
907 Ga0450905_000273 3300042142 Bacteria 6124
908 Ga0439458_0000012 3300042157 Bacteria 27891
909 Ga0439458_0005375 3300042157 Bacteria 2880
910 Ga0439464_0171416 3300042439 Unclassified 684
911 Ga0466969_0024800 3300044656 Bacteria 3084
912 Ga0466969_0026423 3300044656 Bacteria 2977
913 Ga0466966_0010189 3300044684 Bacteria 6235
914 Ga0466966_0039309 3300044684 Bacteria 3047
915 Ga0466961_0010290 3300044693 Bacteria 5961
916 Ga0466961_0014580 3300044693 Bacteria 5050
917 Ga0466961_0201031 3300044693 Bacteria 1232
918 Ga0466963_0012367 3300044694 Bacteria 5222
919 Ga0466963_0034079 3300044694 Bacteria 3312
920 Ga0466963_0232683 3300044694 Bacteria 1291
921 Ga0466964_0024856 3300044706 Bacteria 2336
922 Ga0466964_0089345 3300044706 Bacteria 1338
923 Ga0466964_0259682 3300044706 Unclassified 860
924 Ga0466971_0036617 3300044719 Bacteria 2200
925 Ga0466970_0092937 3300044765 Bacteria 1638
926 Ga0466970_0327489 3300044765 Bacteria 867
927 Ga0466957_0026217 3300044842 Bacteria 3457
928 Ga0466957_0187948 3300044842 Bacteria 1352
929 Ga0466957_0300470 3300044842 Bacteria 1078
930 Ga0466959_0008522 3300045049 Bacteria 7255
931 Ga0466959_0453746 3300045049 Bacteria 869
932 Ga0466958_0024293 3300045836 Bacteria 3565
933 Ga0466958_0045388 3300045836 Bacteria 2650
934 Ga0466967_0019097 3300045976 Bacteria 5503
935 Ga0466967_0133550 3300045976 Bacteria 2306
936 Ga0466967_0403396 3300045976 Unclassified 1330
937 Ga0466967_0785212 3300045976 Bacteria 945
938 Ga0495638_0000266 3300046460 Bacteria 70490
939 Ga0495620_0300413 3300046515 Bacteria 610
940 Ga0495643_0279872 3300046522 Unclassified 768
941 Ga0495663_0165612 3300046525 Unclassified 760
942 Ga0495663_0351739 3300046525 Unclassified 537
943 Ga0495642_0122134 3300046528 Bacteria 1118
944 Ga0495597_0385878 3300046542 Bacteria 534
945 Ga0495625_0000274 3300046660 Bacteria 80067
946 Ga0495659_0075217 3300046664 Bacteria 1272
947 Ga0495669_0055317 3300046684 Bacteria 1787
948 Ga0495669_0145743 3300046684 Bacteria 1119
949 Ga0495670_0110035 3300046691 Bacteria 1425
950 Ga0495602_0015681 3300048088 Bacteria 7639
951 Ga0496100_0360668 3300048903 Bacteria 1100
952 Ga0496101_0121185 3300048904 Unclassified 1978
953 Ga0496102_1169793 3300048905 Bacteria 689
954 Ga0496103_0089798 3300048906 Bacteria 1938
955 Ga0496105_0823916 3300048908 Bacteria 704
956 Ga0496106_0257603 3300048909 Bacteria 1396
957 Ga0496107_0079181 3300048910 Bacteria 2395
958 Ga0496107_0121909 3300048910 Bacteria 1921
959 Ga0496108_0005550 3300048911 Bacteria 10210
960 Ga0496108_0984300 3300048911 Unclassified 721
961 Ga0496109_0019914 3300048912 Bacteria 5922
962 Ga0496110_0002888 3300048913 Bacteria 12994
963 Ga0496111_0010747 3300048914 Bacteria 6155
964 Ga0496112_0021033 3300048915 Bacteria 6197
965 Ga0496112_0172086 3300048915 Bacteria 2131
966 Ga0496113_0001781 3300048916 Bacteria 12223
967 Ga0496113_0735452 3300048916 Bacteria 786
968 Ga0501034_0088943 3300049571 Bacteria 3086
969 Ga0501069_0002869 3300049585 Bacteria 8843
970 Ga0501070_0066047 3300049586 Bacteria 2995
971 Ga0501216_056234 3300049660 Bacteria 784
972 Ga0501249_002749 3300049679 Bacteria 3544
973 Ga0501258_002574 3300049687 Bacteria 1603
974 Ga0501259_054204 3300049688 Bacteria 822
975 Ga0501221_066409 3300049704 Bacteria 844
976 Ga0501221_245332 3300049704 Unclassified 513
977 Ga0501225_0166843 3300049705 Bacteria 680
978 Ga0501270_003684 3300049767 Bacteria 1673
979 Ga0501273_019305 3300049770 Bacteria 913
980 Ga0501212_001202 3300049851 Bacteria 2867
981 nmdc:mga06r32_930599_c1 3300050510 Bacteria 824
982 nmdc:mga08y16_174322_c1 3300050511 Bacteria 2233
983 nmdc:mga0n895_390682_c1 3300050512 Bacteria 1407
984 nmdc:mga0rr50_775770_c1 3300050513 Bacteria 818
985 nmdc:mga0a205_40805_c1 3300050515 Bacteria 4469
986 Ga0500566_0029440 3300053094 Bacteria 3208
987 Ga0500641_0012181 3300053096 Bacteria 3135
988 Ga0500562_009695 3300053108 Bacteria 2435
989 Ga0500658_0002916 3300053134 Bacteria 6570
990 Ga0500568_0036642 3300053139 Bacteria 1995
991 Ga0500604_0047178 3300053151 Bacteria 1320
992 Ga0466962_0006629 3300061719 Bacteria 5559
993 Ga0530510_0385849 3300061734 Bacteria 1055
994 Ga0070662_101183598
995 JGI24752J21851_1030148
996 JGI24740J21852_10008551
997 JGI24739J22299_10000184
998 JGI24739J22299_10043691
999 JGI24737J22298_10000120
1000 JGI24737J22298_10015531
1001 JGI24737J22298_10025264
1002 JGI24737J22298_10045334
1003 JGI24743J22301_10013530
1004 JGI24735J21928_10001498
1005 JGI24735J21928_10055813
1006 JGI24735J21928_10206636
1007 JGI24745J21846_1001479
1008 JGI24738J21930_10000025
1009 JGI24738J21930_10000388
1010 JGI24742J22300_10032806
1011 Ga0055537_1001791
1012 Ga0055524_1000118
1013 Ga0055528_1015087
1014 Ga0055530_10045844
1015 Ga0055531_10017268
1016 Ga0055543_1056480
1017 Ga0065165_1002154
1018 Ga0065165_1012937
1019 Ga0065714_10088404
1020 Ga0065715_10787164
1021 Ga0070658_10069397
1022 Ga0070658_10150792
1023 Ga0070658_10254686
1024 Ga0070658_10445932
1025 Ga0070658_10565275
1026 Ga0070658_10767445
1027 Ga0070658_10814098
1028 Ga0070658_11108442
1029 Ga0070658_11224562
1030 Ga0070658_11327314
1031 Ga0070676_10002223
1032 Ga0070676_10438581
1033 Ga0070683_100534152
1034 Ga0070683_102014977
1035 Ga0070690_100042396
1036 Ga0070670_100009174
1037 Ga0070670_100038800
1038 Ga0070670_100058083
1039 Ga0070670_100088439
1040 Ga0070670_100102369
1041 Ga0070670_100196311
1042 Ga0070670_101374981
1043 Ga0070677_10000586
1044 Ga0070677_10132314
1045 Ga0068869_100000003
1046 Ga0068869_100212629
1047 Ga0068869_100254904
1048 Ga0070666_10039034
1049 Ga0070666_10112768
1050 Ga0070666_10163693
1051 Ga0070666_10344696
1052 Ga0070682_100016233
1053 Ga0070682_100106997
1054 Ga0070682_100212095
1055 Ga0068868_100000379
1056 Ga0068868_100147294
1057 Ga0068868_100282704
1058 Ga0068868_100502527
1059 Ga0070660_100001636
1060 Ga0070660_100004190
1061 Ga0070660_100146337
1062 Ga0070660_100183066
1063 Ga0070660_100202182
1064 Ga0070660_100263992
1065 Ga0070660_100499953
1066 Ga0070660_100525575
1067 Ga0070660_101355093
1068 Ga0070689_100071572
1069 Ga0070691_10098557
1070 Ga0070687_100052731
1071 Ga0070661_100011430
1072 Ga0070661_100029761
1073 Ga0070661_100345945
1074 Ga0070661_100507817
1075 Ga0070661_100613617
1076 Ga0070661_100654436
1077 Ga0070661_101368539
1078 Ga0070692_10008007
1079 Ga0070668_100009629
1080 Ga0070668_100138489
1081 Ga0070668_100935095
1082 Ga0070668_101096079
1083 Ga0070668_101236010
1084 Ga0070668_101362901
1085 Ga0070669_100000138
1086 Ga0070669_100014941
1087 Ga0070669_100070379
1088 Ga0070669_100087526
1089 Ga0070669_100176800
1090 Ga0070669_100232852
1091 Ga0070669_100266977
1092 Ga0070669_100406252
1093 Ga0070675_100004728
1094 Ga0070675_100005801
1095 Ga0070671_100073064
1096 Ga0070671_100316520
1097 Ga0070671_100333268
1098 Ga0070671_100503579
1099 Ga0070671_100530059
1100 Ga0070671_100847392
1101 Ga0070671_101077878
1102 Ga0070674_100055107
1103 Ga0070674_100096255
1104 Ga0070674_100232926
1105 Ga0070673_100000154
1106 Ga0070673_100073729
1107 Ga0070673_100198149
1108 Ga0070673_100224519
1109 Ga0070688_100245323
1110 Ga0070659_100000360
1111 Ga0070659_100002156
1112 Ga0070659_100007699
1113 Ga0070659_100019596
1114 Ga0070659_100114985
1115 Ga0070659_100120466
1116 Ga0070659_100204998
1117 Ga0070659_100218853
1118 Ga0070659_100226342
1119 Ga0070659_100484786
1120 Ga0070659_100566445
1121 Ga0070659_101117924
1122 Ga0070659_101324675
1123 Ga0070659_102065948
1124 Ga0070667_100003405
1125 Ga0070667_100025127
1126 Ga0070667_100228708
1127 Ga0070667_100347354
1128 Ga0070667_100865504
1129 Ga0070714_100070944
1130 Ga0070714_100350159
1131 Ga0070714_100631853
1132 Ga0070714_100640366
1133 Ga0070713_100344609
1134 Ga0070701_10390391
1135 Ga0070694_100025797
1136 Ga0070663_100081762
1137 Ga0070663_100273942
1138 Ga0070663_100288972
1139 Ga0070663_100330948
1140 Ga0070663_100451400
1141 Ga0070678_100333668
1142 Ga0070678_100770051
1143 Ga0070662_100000265
1144 Ga0070662_100003781
1145 Ga0070662_100098428
1146 Ga0070662_100171408
1147 Ga0070662_100460534
1148 Ga0070662_100488268
1149 Ga0070662_101040152
1150 Ga0070662_101091086
1151 Ga0070662_101516725
1152 Ga0070681_10824535
1153 Ga0068867_100000505
1154 Ga0068867_100027399
1155 Ga0068867_101537550
1156 Ga0070685_10085527
1157 Ga0070679_101065266
1158 Ga0070679_101891691
1159 Ga0070684_100725038
1160 Ga0068853_100001049
1161 Ga0068853_100010276
1162 Ga0068853_100051976
1163 Ga0068853_100065209
1164 Ga0068853_100081687
1165 Ga0068853_101994028
1166 Ga0070672_100000498
1167 Ga0070672_100048499
1168 Ga0070672_100118880
1169 Ga0070686_100077659
1170 Ga0070696_100001328
1171 Ga0070696_100086604
1172 Ga0070696_101646462
1173 Ga0070693_101051060
1174 Ga0070665_100074892
1175 Ga0070665_100148854
1176 Ga0070665_100352137
1177 Ga0070665_100421499
1178 Ga0070665_101322241
1179 Ga0070704_100457632
1180 Ga0068855_100009865
1181 Ga0068855_100061554
1182 Ga0068855_100223896
1183 Ga0068855_100365900
1184 Ga0068855_100541236
1185 Ga0068855_100573513
1186 Ga0068855_100865158
1187 Ga0068855_101016667
1188 Ga0068855_101320474
1189 Ga0068855_101451239
1190 Ga0068855_101475448
1191 Ga0070664_100012015
1192 Ga0070664_100021606
1193 Ga0070664_100072962
1194 Ga0070664_100196752
1195 Ga0070664_100286069
1196 Ga0070664_100493964
1197 Ga0070664_100509090
1198 Ga0068857_100007857
1199 Ga0068857_100015251
1200 Ga0068857_100017687
1201 Ga0068857_100038562
1202 Ga0068857_100064176
1203 Ga0068857_100127223
1204 Ga0068857_100237615
1205 Ga0068857_100375255
1206 Ga0068857_100568256
1207 Ga0068857_100881305
1208 Ga0068857_101996550
1209 Ga0068854_100000358
1210 Ga0068854_100010269
1211 Ga0068854_100069813
1212 Ga0068854_100200505
1213 Ga0068854_100213601
1214 Ga0068854_100223633
1215 Ga0068854_100415344
1216 Ga0068854_100590272
1217 Ga0068854_100876201
1218 Ga0068856_100091060
1219 Ga0068856_100192181
1220 Ga0068856_100251862
1221 Ga0068856_100348577
1222 Ga0068856_100553155
1223 Ga0068856_100727391
1224 Ga0068856_100893110
1225 Ga0068856_101119659
1226 Ga0068852_100000496
1227 Ga0068852_100003104
1228 Ga0068852_100062688
1229 Ga0068852_100290662
1230 Ga0068852_100331852
1231 Ga0068852_100414880
1232 Ga0068852_100938501
1233 Ga0068859_100007540
1234 Ga0068859_100012095
1235 Ga0068859_100268504
1236 Ga0068859_100424131
1237 Ga0068859_100650078
1238 Ga0068859_101008678
1239 Ga0068864_100000047
1240 Ga0068864_100006177
1241 Ga0068864_100322790
1242 Ga0068864_100350391
1243 Ga0068866_10031681
1244 Ga0068866_10032541
1245 Ga0068861_100020837
1246 Ga0068861_100261958
1247 Ga0068861_100921413
1248 Ga0068861_101202772
1249 Ga0068861_102381194
1250 Ga0068851_10083765
1251 Ga0068851_10124800
1252 Ga0068851_10366054
1253 Ga0068851_10529549
1254 Ga0068870_10116604
1255 Ga0068870_10224138
1256 Ga0068863_100000468
1257 Ga0068863_100002397
1258 Ga0068863_100009582
1259 Ga0068863_100141281
1260 Ga0068863_100225723
1261 Ga0068863_100703134
1262 Ga0068858_100012571
1263 Ga0068858_100015068
1264 Ga0068858_100044002
1265 Ga0068858_100864621
1266 Ga0068860_100035520
1267 Ga0068860_100319205
1268 Ga0068860_100342136
1269 Ga0068860_100449559
1270 Ga0068860_100503693
1271 Ga0068860_102183311
1272 Ga0068862_100165354
1273 Ga0068862_100736489
1274 Ga0081539_10006545
1275 Ga0081539_10071795
1276 Ga0070717_10214041
1277 Ga0097621_100190307
1278 Ga0068871_100131641
1279 Ga0075428_100463464
1280 Ga0075431_101142144
1281 Ga0075433_10174113
1282 Ga0075433_10700859
1283 Ga0075434_100567650
1284 Ga0068865_100004215
1285 Ga0068865_101274472
1286 Ga0097620_100007540
1287 Ga0097620_100012095
1288 Ga0097620_100268499
1289 Ga0097620_100424146
1290 Ga0097620_100650109
1291 Ga0097620_101008714
1292 Ga0105251_10241291
1293 Ga0105240_10082810
1294 Ga0105240_10150746
1295 Ga0105240_10155141
1296 Ga0105240_10245372
1297 Ga0105240_10496768
1298 Ga0111539_10195370
1299 Ga0105245_10000198
1300 Ga0105245_10627440
1301 Ga0105245_13097458
1302 Ga0105247_10476121
1303 Ga0114129_10168688
1304 Ga0114129_10677065
1305 Ga0105243_10104023
1306 Ga0105243_10345568
1307 Ga0105241_10024842
1308 Ga0105241_10091714
1309 Ga0105241_10114060
1310 Ga0105241_10264346
1311 Ga0105242_10381026
1312 Ga0105242_11186416
1313 Ga0105248_10000391
1314 Ga0105248_10019149
1315 Ga0105248_10070376
1316 Ga0105248_11036106
1317 Ga0105237_10027469
1318 Ga0105237_10109380
1319 Ga0105238_10004928
1320 Ga0105238_10023625
1321 Ga0105238_10397275
1322 Ga0105238_10539740
1323 Ga0105249_10006569
1324 Ga0105249_10508507
1325 Ga0105239_10057841
1326 Ga0105239_10419537
1327 Ga0105239_10529899
1328 Ga0105246_10011519
1329 Ga0105246_10045186
1330 Ga0105246_10128757
1331 Ga0105246_10800936
1332 Ga0105246_10978938
1333 Ga0157373_10036574
1334 Ga0157373_10112571
1335 Ga0157373_10200923
1336 Ga0157373_10421410
1337 Ga0157373_10514517
1338 Ga0157373_10836363
1339 Ga0157371_10001384
1340 Ga0157371_10019102
1341 Ga0157371_10053929
1342 Ga0157371_10156092
1343 Ga0157371_10570962
1344 Ga0157371_11096468
1345 Ga0157370_10012142
1346 Ga0157370_10012582
1347 Ga0157370_10056957
1348 Ga0157370_10294795
1349 Ga0157370_10440240
1350 Ga0157370_10761277
1351 Ga0157370_11392803
1352 Ga0157370_11579018
1353 Ga0157370_11851505
1354 Ga0157369_10000457
1355 Ga0157369_10021058
1356 Ga0157369_10076235
1357 Ga0157369_10156639
1358 Ga0157369_10160897
1359 Ga0157369_10285112
1360 Ga0157369_11563525
1361 Ga0157374_11985457
1362 Ga0157374_12852061
1363 Ga0157378_10001767
1364 Ga0157378_11172066
1365 Ga0157378_12737795
1366 Ga0163162_10046170
1367 Ga0163162_10086983
1368 Ga0163162_10554224
1369 Ga0157372_10112895
1370 Ga0157372_10273612
1371 Ga0157372_10376629
1372 Ga0157372_10562961
1373 Ga0157372_10595360
1374 Ga0157372_10997475
1375 Ga0157372_12569809
1376 Ga0157372_12851967
1377 Ga0157372_13266939
1378 Ga0157375_10122243
1379 Ga0157375_10417988
1380 Ga0157375_10856468
1381 Ga0157380_10167350
1382 Ga0157380_11126477
1383 Ga0182008_10056797
1384 Ga0157377_10098203
1385 Ga0157379_10116177
1386 Ga0157379_10324422
1387 Ga0157379_11783519
1388 Ga0197907_10321886
1389 Ga0206356_10452544
1390 Ga0213875_10045185
1391 Ga0207425_1016568
1392 Ga0209565_1000011
1393 Ga0209673_1005937
1394 Ga0209758_1008619
1395 Ga0209050_1026362
1396 Ga0209256_1000016
1397 Ga0207426_1071662
1398 Ga0209257_1004174
1399 Ga0207697_10000033
1400 Ga0207656_10290443
1401 Ga0207682_10000575
1402 Ga0207682_10030067
1403 Ga0207642_10021293
1404 Ga0207688_10000292
1405 Ga0207688_10074465
1406 Ga0207680_10053408
1407 Ga0207680_10148817
1408 Ga0207680_10376007
1409 Ga0207680_10839037
1410 Ga0207647_10000843
1411 Ga0207647_10002661
1412 Ga0207647_10036469
1413 Ga0207647_10105081
1414 Ga0207647_10159989
1415 Ga0207647_10209241
1416 Ga0207647_10400898
1417 Ga0207647_10427528
1418 Ga0207699_10597829
1419 Ga0207645_10004701
1420 Ga0207645_10338809
1421 Ga0207645_10359642
1422 Ga0207645_10408771
1423 Ga0207643_10009288
1424 Ga0207643_10206750
1425 Ga0207705_10026052
1426 Ga0207705_10055084
1427 Ga0207705_10059412
1428 Ga0207705_10131978
1429 Ga0207705_10184633
1430 Ga0207705_10202588
1431 Ga0207705_10215364
1432 Ga0207705_10392903
1433 Ga0207705_10611158
1434 Ga0207705_10831574
1435 Ga0207705_11035049
1436 Ga0207705_11039170
1437 Ga0207705_11291651
1438 Ga0207654_10110953
1439 Ga0207654_10294760
1440 Ga0207654_10910506
1441 Ga0207707_10220451
1442 Ga0207707_10395730
1443 Ga0207695_10016587
1444 Ga0207695_10027242
1445 Ga0207695_10603653
1446 Ga0207671_10094566
1447 Ga0207660_10072792
1448 Ga0207660_10192782
1449 Ga0207662_10030906
1450 Ga0207657_10000737
1451 Ga0207657_10006621
1452 Ga0207657_10110851
1453 Ga0207657_10145610
1454 Ga0207657_10271644
1455 Ga0207657_10295217
1456 Ga0207657_10335764
1457 Ga0207657_10479929
1458 Ga0207649_10030758
1459 Ga0207649_10076707
1460 Ga0207649_10311095
1461 Ga0207649_10445415
1462 Ga0207649_10476777
1463 Ga0207649_11139458
1464 Ga0207649_11372384
1465 Ga0207649_11530173
1466 Ga0207652_10170844
1467 Ga0207652_11507577
1468 Ga0207681_10000355
1469 Ga0207681_10041976
1470 Ga0207681_10173723
1471 Ga0207681_10319802
1472 Ga0207681_10372731
1473 Ga0207694_10008107
1474 Ga0207694_10028515
1475 Ga0207694_10178698
1476 Ga0207694_10584429
1477 Ga0207650_10009826
1478 Ga0207650_10022527
1479 Ga0207650_10157672
1480 Ga0207650_10244364
1481 Ga0207650_10279465
1482 Ga0207650_10449275
1483 Ga0207650_10674158
1484 Ga0207650_11185113
1485 Ga0207659_10008412
1486 Ga0207659_10153349
1487 Ga0207659_10192402
1488 Ga0207687_10002290
1489 Ga0207687_11209292
1490 Ga0207664_10012294
1491 Ga0207664_10055301
1492 Ga0207644_10010107
1493 Ga0207644_10195743
1494 Ga0207644_10212008
1495 Ga0207644_10400307
1496 Ga0207644_10741175
1497 Ga0207644_10961959
1498 Ga0207690_10000402
1499 Ga0207690_10006964
1500 Ga0207690_10025971
1501 Ga0207690_10030108
1502 Ga0207690_10033722
1503 Ga0207690_10123526
1504 Ga0207690_10129176
1505 Ga0207690_10169206
1506 Ga0207690_10205688
1507 Ga0207690_10362216
1508 Ga0207690_10386511
1509 Ga0207706_10000020
1510 Ga0207706_10018403
1511 Ga0207706_10023551
1512 Ga0207706_10051934
1513 Ga0207706_10113258
1514 Ga0207706_10120754
1515 Ga0207706_10296231
1516 Ga0207706_10340102
1517 Ga0207706_10373260
1518 Ga0207706_10421533
1519 Ga0207706_10423079
1520 Ga0207706_10927183
1521 Ga0207686_10951130
1522 Ga0207709_10061002
1523 Ga0207709_10223608
1524 Ga0207670_10054071
1525 Ga0207669_10079150
1526 Ga0207669_10629720
1527 Ga0207704_10009284
1528 Ga0207704_10573727
1529 Ga0207704_11167143
1530 Ga0207691_10000047
1531 Ga0207691_10058855
1532 Ga0207691_10523075
1533 Ga0207711_10003234
1534 Ga0207711_10013865
1535 Ga0207711_10267924
1536 Ga0207711_11096072
1537 Ga0207689_10000002
1538 Ga0207689_10115175
1539 Ga0207689_10285825
1540 Ga0207689_10324236
1541 Ga0207661_10201730
1542 Ga0207661_10472783
1543 Ga0207679_10011404
1544 Ga0207679_10029698
1545 Ga0207679_10347936
1546 Ga0207679_10354490
1547 Ga0207679_10573460
1548 Ga0207679_10809600
1549 Ga0207679_11253706
1550 Ga0207667_10013340
1551 Ga0207667_10041224
1552 Ga0207667_10325314
1553 Ga0207667_10355489
1554 Ga0207667_10455962
1555 Ga0207667_10519999
1556 Ga0207667_10656572
1557 Ga0207667_10994217
1558 Ga0207667_11408533
1559 Ga0207651_10000445
1560 Ga0207651_10279820
1561 Ga0207712_10002789
1562 Ga0207668_10016932
1563 Ga0207668_10124251
1564 Ga0207668_10735846
1565 Ga0207668_10962182
1566 Ga0207640_10000415
1567 Ga0207640_10001597
1568 Ga0207640_10049707
1569 Ga0207640_10062393
1570 Ga0207640_10126426
1571 Ga0207640_10141447
1572 Ga0207640_10172719
1573 Ga0207640_10229884
1574 Ga0207640_10353969
1575 Ga0207640_10439767
1576 Ga0207658_10002093
1577 Ga0207658_10009516
1578 Ga0207658_10050332
1579 Ga0207658_10104245
1580 Ga0207658_10421181
1581 Ga0207658_10951115
1582 Ga0207677_10001382
1583 Ga0207677_10065855
1584 Ga0207703_10001138
1585 Ga0207703_10004446
1586 Ga0207703_10041212
1587 Ga0207703_11283293
1588 Ga0207639_10000074
1589 Ga0207639_10001353
1590 Ga0207639_10092247
1591 Ga0207639_10100442
1592 Ga0207639_10110195
1593 Ga0207639_10372989
1594 Ga0207678_10027276
1595 Ga0207678_10093683
1596 Ga0207678_10177803
1597 Ga0207678_10182630
1598 Ga0207678_10313198
1599 Ga0207678_10365373
1600 Ga0207708_10409816
1601 Ga0207702_10136993
1602 Ga0207702_10170935
1603 Ga0207702_10414828
1604 Ga0207702_10423192
1605 Ga0207702_10449298
1606 Ga0207702_10559365
1607 Ga0207702_10570216
1608 Ga0207702_10648690
1609 Ga0207641_10012319
1610 Ga0207641_10017664
1611 Ga0207641_10042054
1612 Ga0207641_10108664
1613 Ga0207648_10001030
1614 Ga0207648_10026079
1615 Ga0207676_10001020
1616 Ga0207676_10159667
1617 Ga0207676_10467239
1618 Ga0207674_10000660
1619 Ga0207674_10000881
1620 Ga0207674_10003858
1621 Ga0207674_10006970
1622 Ga0207674_10009571
1623 Ga0207674_10016191
1624 Ga0207674_10062245
1625 Ga0207674_10288376
1626 Ga0207674_10566533
1627 Ga0207674_10598930
1628 Ga0207674_10769370
1629 Ga0207674_10996666
1630 Ga0207675_100014437
1631 Ga0207675_100131888
1632 Ga0207675_100946979
1633 Ga0207683_10455492
1634 Ga0207698_10000833
1635 Ga0207698_10012259
1636 Ga0207698_10044704
1637 Ga0207698_10150868
1638 Ga0207698_10208522
1639 Ga0207698_10276994
1640 Ga0207698_10332248
1641 Ga0207698_10908331
1642 Ga0207698_12023677
1643 Ga0268266_10178089
1644 Ga0268266_11579920
1645 Ga0268265_10009142
1646 Ga0268265_10153767
1647 Ga0268265_10311061
1648 Ga0268265_10925126
1649 Ga0268264_10007102
1650 Ga0268264_10159513
1651 Ga0268264_10334001
1652 Ga0268264_10581901
1653 Ga0316182_1080945
1654 Ga0316182_1240096
1655 Ga0307408_100177635
1656 Ga0307408_100182053
1657 Ga0307408_100183750
1658 Ga0307408_100288098
1659 Ga0307408_100381514
1660 Ga0307408_101068512
1661 Ga0307408_101215796
1662 Ga0307405_10015872
1663 Ga0307405_10049410
1664 Ga0307405_10063465
1665 Ga0307405_10158693
1666 Ga0307405_10208973
1667 Ga0307405_10621175
1668 Ga0307405_11314503
1669 Ga0307405_11933173
1670 Ga0307413_10003886
1671 Ga0307413_10012003
1672 Ga0307413_10119561
1673 Ga0307413_10123461
1674 Ga0307413_10209509
1675 Ga0307413_10293631
1676 Ga0307413_10327280
1677 Ga0307413_10432872
1678 Ga0307413_10523655
1679 Ga0307413_10666127
1680 Ga0307413_11165572
1681 Ga0307413_11376771
1682 Ga0307413_11557854
1683 Ga0307410_10000627
1684 Ga0307410_10007397
1685 Ga0307410_10019559
1686 Ga0307410_10019771
1687 Ga0307410_10139669
1688 Ga0307410_10244413
1689 Ga0307410_10376351
1690 Ga0307410_10662665
1691 Ga0307410_10953260
1692 Ga0307410_11341568
1693 Ga0307406_10002922
1694 Ga0307406_10076306
1695 Ga0307406_10118163
1696 Ga0307406_10176855
1697 Ga0307406_10246819
1698 Ga0307406_10252101
1699 Ga0307406_10352710
1700 Ga0307406_10371106
1701 Ga0307406_10724806
1702 Ga0307406_11016365
1703 Ga0307407_10008725
1704 Ga0307407_10075940
1705 Ga0307407_10076257
1706 Ga0307407_10132544
1707 Ga0307407_10307696
1708 Ga0307412_10014789
1709 Ga0307412_10019484
1710 Ga0307412_10062321
1711 Ga0307412_10181060
1712 Ga0307412_10356632
1713 Ga0307412_10421029
1714 Ga0307412_10519461
1715 Ga0307412_10627760
1716 Ga0307412_10806981
1717 Ga0307409_100006675
1718 Ga0307409_100015053
1719 Ga0307409_100059086
1720 Ga0307409_100080029
1721 Ga0307409_100089576
1722 Ga0307409_100142185
1723 Ga0307409_100378967
1724 Ga0307409_100387027
1725 Ga0307409_100470293
1726 Ga0307409_100969319
1727 Ga0307409_101060159
1728 Ga0307409_101590923
1729 Ga0307416_100017277
1730 Ga0307416_100021305
1731 Ga0307416_100051175
1732 Ga0307416_100199609
1733 Ga0307416_100564881
1734 Ga0307416_100928262
1735 Ga0307416_100934826
1736 Ga0307416_100963399
1737 Ga0307416_101410243
1738 Ga0307416_101676488
1739 Ga0307416_101784021
1740 Ga0307416_103222126
1741 Ga0307416_103411373
1742 Ga0307414_10005561
1743 Ga0307414_10018283
1744 Ga0307414_10031792
1745 Ga0307414_10058343
1746 Ga0307414_10143495
1747 Ga0307414_10215012
1748 Ga0307414_10309282
1749 Ga0307414_10484496
1750 Ga0307414_10778303
1751 Ga0307414_10778844
1752 Ga0307411_10017067
1753 Ga0307411_10028066
1754 Ga0307411_10033140
1755 Ga0307411_10080386
1756 Ga0307411_10119675
1757 Ga0307411_10139144
1758 Ga0307411_10142593
1759 Ga0307411_10170848
1760 Ga0307411_10177292
1761 Ga0307411_10207546
1762 Ga0307411_10460041
1763 Ga0307415_100020856
1764 Ga0307415_100052770
1765 Ga0307415_100077113
1766 Ga0307415_100149746
1767 Ga0307415_100582002
1768 Ga0307415_100693048
1769 Ga0307415_101216119
1770 Ga0373923_0040408
1771 Ga0373954_0287550
1772 Ga0373955_0047478
1773 Ga0373931_0487584
1774 Ga0373931_0641707
1775 Ga0373933_0085793
1776 Ga0373937_0003627
1777 Ga0395899_0001745
1778 Ga0395899_0009558
1779 Ga0395899_0009970
1780 Ga0395899_0046230
1781 Ga0395899_0069146
1782 Ga0395899_0141151
1783 Ga0395899_0195526
1784 Ga0395899_0201996
1785 Ga0395899_0243059
1786 Ga0395899_0329638
1787 Ga0395899_0345259
1788 Ga0395899_0829710
1789 Ga0395900_0004511
1790 Ga0395900_0017492
1791 Ga0395900_0019280
1792 Ga0395900_0027008
1793 Ga0395900_0044751
1794 Ga0395900_0064663
1795 Ga0395900_0068656
1796 Ga0395900_0077098
1797 Ga0395900_0137522
1798 Ga0395900_0161088
1799 Ga0395900_0166367
1800 Ga0395900_0170610
1801 Ga0395900_0195143
1802 Ga0395900_0205876
1803 Ga0395900_0215425
1804 Ga0395900_0281993
1805 Ga0395900_0284256
1806 Ga0395900_0285752
1807 Ga0395900_0292482
1808 Ga0395900_0293086
1809 Ga0395900_0351896
1810 Ga0395900_0529610
1811 Ga0395900_0624867
1812 Ga0395900_1106923
1813 Ga0395898_0006840
1814 Ga0395898_0020031
1815 Ga0395898_0024151
1816 Ga0395898_0026010
1817 Ga0395898_0034976
1818 Ga0395898_0090449
1819 Ga0395898_0154976
1820 Ga0395898_0175796
1821 Ga0395898_0226538
1822 Ga0395898_0291150
1823 Ga0395898_0383599
1824 Ga0395898_0522622
1825 Ga0395898_0885333
1826 Ga0395898_0945963
1827 Ga0395898_1109579
1828 Ga0395898_1897024
1829 Ga0395905_0002770
1830 Ga0395905_0004357
1831 Ga0395905_0005968
1832 Ga0395905_0019802
1833 Ga0395905_0022733
1834 Ga0395905_0029060
1835 Ga0395905_0032161
1836 Ga0395905_0035402
1837 Ga0395905_0036207
1838 Ga0395905_0041829
1839 Ga0395905_0045447
1840 Ga0395905_0048149
1841 Ga0395905_0052021
1842 Ga0395905_0064594
1843 Ga0395905_0132207
1844 Ga0395905_0135126
1845 Ga0395905_0190523
1846 Ga0395905_0225630
1847 Ga0395905_0245839
1848 Ga0395905_0262485
1849 Ga0395905_0334024
1850 Ga0395905_0364366
1851 Ga0395905_0449740
1852 Ga0395905_0733308
1853 Ga0395905_0843258
1854 Ga0395905_0876429
1855 Ga0395905_1072842
1856 Ga0395905_1076340
1857 Ga0395905_1081077
1858 Ga0395905_1138891
1859 Ga0395905_1144472
1860 Ga0395905_1188185
1861 Ga0395905_1490159
1862 Ga0395905_1491683
1863 Ga0436364_1351497
1864 Ga0395901_0004565
1865 Ga0395901_0006859
1866 Ga0395901_0016746
1867 Ga0395901_0020377
1868 Ga0395901_0030699
1869 Ga0395901_0032904
1870 Ga0395901_0033946
1871 Ga0395901_0044503
1872 Ga0395901_0073895
1873 Ga0395901_0093575
1874 Ga0395901_0117936
1875 Ga0395901_0133263
1876 Ga0395901_0171080
1877 Ga0395901_0208651
1878 Ga0395901_0294749
1879 Ga0395901_0359761
1880 Ga0395901_0417945
1881 Ga0395901_0425947
1882 Ga0395901_0651775
1883 Ga0395901_0661314
1884 Ga0395901_0843162
1885 Ga0395901_0892598
1886 Ga0395901_1115703
1887 Ga0395901_1163210
1888 Ga0395901_2053583
1889 Ga0395901_2070677
1890 Ga0436365_0189939
1891 Ga0439439_0115426
1892 Ga0439466_0176241
1893 Ga0451793_0698699
1894 Ga0439448_0016258
1895 Ga0439448_0251385
1896 Ga0439448_0332366
1897 Ga0439432_054537
1898 Ga0439449_0033202
1899 Ga0450912_004580
1900 Ga0450905_000273
1901 Ga0439458_0000012
1902 Ga0439458_0005375
1903 Ga0439464_0171416
1904 Ga0466969_0024800
1905 Ga0466969_0026423
1906 Ga0466966_0010189
1907 Ga0466966_0039309
1908 Ga0466961_0010290
1909 Ga0466961_0014580
1910 Ga0466961_0201031
1911 Ga0466963_0012367
1912 Ga0466963_0034079
1913 Ga0466963_0232683
1914 Ga0466964_0024856
1915 Ga0466964_0089345
1916 Ga0466964_0259682
1917 Ga0466971_0036617
1918 Ga0466970_0092937
1919 Ga0466970_0327489
1920 Ga0466957_0026217
1921 Ga0466957_0187948
1922 Ga0466957_0300470
1923 Ga0466959_0008522
1924 Ga0466959_0453746
1925 Ga0466958_0024293
1926 Ga0466958_0045388
1927 Ga0466967_0019097
1928 Ga0466967_0133550
1929 Ga0466967_0403396
1930 Ga0466967_0785212
1931 Ga0495638_0000266
1932 Ga0495620_0300413
1933 Ga0495643_0279872
1934 Ga0495663_0165612
1935 Ga0495663_0351739
1936 Ga0495642_0122134
1937 Ga0495597_0385878
1938 Ga0495625_0000274
1939 Ga0495659_0075217
1940 Ga0495669_0055317
1941 Ga0495669_0145743
1942 Ga0495670_0110035
1943 Ga0495602_0015681
1944 Ga0496100_0360668
1945 Ga0496101_0121185
1946 Ga0496102_1169793
1947 Ga0496103_0089798
1948 Ga0496105_0823916
1949 Ga0496106_0257603
1950 Ga0496107_0079181
1951 Ga0496107_0121909
1952 Ga0496108_0005550
1953 Ga0496108_0984300
1954 Ga0496109_0019914
1955 Ga0496110_0002888
1956 Ga0496111_0010747
1957 Ga0496112_0021033
1958 Ga0496112_0172086
1959 Ga0496113_0001781
1960 Ga0496113_0735452
1961 Ga0501034_0088943
1962 Ga0501069_0002869
1963 Ga0501070_0066047
1964 Ga0501216_056234
1965 Ga0501249_002749
1966 Ga0501258_002574
1967 Ga0501259_054204
1968 Ga0501221_066409
1969 Ga0501221_245332
1970 Ga0501225_0166843
1971 Ga0501270_003684
1972 Ga0501273_019305
1973 Ga0501212_001202
1974 nmdc:mga06r32_930599_c1
1975 nmdc:mga08y16_174322_c1
1976 nmdc:mga0n895_390682_c1
1977 nmdc:mga0rr50_775770_c1
1978 nmdc:mga0a205_40805_c1
1979 Ga0500566_0029440
1980 Ga0500641_0012181
1981 Ga0500562_009695
1982 Ga0500658_0002916
1983 Ga0500568_0036642
1984 Ga0500604_0047178
1985 Ga0466962_0006629
1986 Ga0530510_0385849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

35

127

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.9235 1 132
4zgr-assembly1.cif.gz_A structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with t-antigen. 0.8375 56 85
2jjr-assembly1.cif.gz_A v232k, n236d-trichosanthin 0.8335 56 85
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8242 1 132
1bry-assembly2.cif.gz_Z bryodin type i rip 0.818 55 85
ID Description Score Start End Superfamily
4z8sA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8343 56 85 3.40.420.10
3ku0B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8179 57 86 3.40.420.10
2k7iB01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;YegP-like 0.8011 56 85 3.30.160.160
1br5A01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7963 56 87 3.40.420.10
1ahbA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7921 55 84 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A2S3UK63-F1-model_v4 CENP-V/GFA domain-containing protein 0.9762 1 131 GO:0016846
GO:0046872
AF-A0A2P7AYE0-F1-model_v4 Aldehyde-activating protein 0.9757 2 132 GO:0016846
GO:0046872
AF-A0A526S5J8-F1-model_v4 Aldehyde-activating protein 0.9729 1 89 GO:0016846
GO:0046872
AF-A0A6P0BQ83-F1-model_v4 deleted 0.9712 2 125
AF-A0A848Q840-F1-model_v4 deleted 0.968 1 85

Map