F487682

General Info

Members Datasets Scaffolds Average Seq Length
993 387 1986 190

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10541274|Ga0105237_105412742
Length 220
Sequence MVLIEQAFNGVSISNSYKVITNSEPNLYVSMFIEPHIKGERRGWIEVICGSMFSGKTEELIRRLKRAKIANLKVEIFKPSMDIRYHEHNIVSHDESTILSSPIDNSQTILLMASDVDVIGIDEAQFFDDQLPEVCDQLAFRGIRVIVAGLDMDFTAKPFGQMPFLLAKADYITKLHAICVKCGNIANYSYRKSRADSQVLLGEKDLYEPRCRNCYYNQVP

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
228 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
229 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
230 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
281 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
300 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
301 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
302 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
303 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
304 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
305 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
306 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
307 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
308 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
309 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
310 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
311 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
312 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
313 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
314 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
315 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
316 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
317 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
318 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
319 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
320 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
321 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
322 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
323 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
324 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
325 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
326 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
327 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
328 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
329 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
330 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
331 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
332 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
333 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
334 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
338 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
347 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
348 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
349 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
350 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
351 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
352 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
353 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
354 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
355 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
356 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
357 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
358 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
361 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
362 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
363 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
364 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
367 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
368 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
369 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
370 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
371 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
372 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
373 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
374 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
375 2738541278 Niastella sp. CF465 Isolate Unclassified
376 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
377 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
378 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
379 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
380 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
381 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
382 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
383 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
384 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
385 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
386 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
387 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.46
Nodule 0
Rhizoplane 0.81
Rhizosphere 86.91
Stem 0
Stem Tuber 0
Unclassified 7.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10541274 3300009545 Bacteria 1171
2 JGI24740J21852_10013829 3300001979 Bacteria 2997
3 JGI24739J22299_10018562 3300001989 Bacteria 2498
4 JGI25158J39367_1005868 3300002739 Bacteria 1780
5 JGI25153J46596_10000209 3300003215 Bacteria 52915
6 JGI25153J46596_10023975 3300003215 Bacteria 2208
7 rootH2_10011602 3300003320 Bacteria 11970
8 rootH2_10087314 3300003320 Bacteria 1812
9 rootH2_10090059 3300003320 Bacteria 2516
10 rootH2_10137001 3300003320 Bacteria 6424
11 rootH1_10043692 3300003323 Bacteria 17024
12 rootH1_10137701 3300003323 Unclassified 3887
13 rootH1_10203057 3300003323 Bacteria 3559
14 JGI25160J50197_1001403 3300003354 Bacteria 12081
15 JGI25160J50197_1003289 3300003354 Bacteria 7276
16 JGI25160J50197_1009333 3300003354 Bacteria 3651
17 Ga0055542_1005560 3300003762 Bacteria 2824
18 Ga0055526_1021827 3300003771 Bacteria 2208
19 Ga0055526_1038025 3300003771 Bacteria 1247
20 Ga0055528_1000308 3300003790 Bacteria 41407
21 Ga0055528_1000809 3300003790 Bacteria 21549
22 Ga0055530_10000385 3300003791 Bacteria 39749
23 Ga0055531_10000027 3300003794 Bacteria 160284
24 Ga0065165_1000053 3300005262 Bacteria 189081
25 Ga0065165_1004556 3300005262 Bacteria 8464
26 Ga0065165_1046879 3300005262 Bacteria 1251
27 Ga0065714_10214071 3300005288 Bacteria 858
28 Ga0065704_10029955 3300005289 Bacteria 1419
29 Ga0065704_10244930 3300005289 Bacteria 1005
30 Ga0065712_10014379 3300005290 Bacteria 1582
31 Ga0065712_10019139 3300005290 Bacteria 3687
32 Ga0065712_10029565 3300005290 Unclassified 881
33 Ga0065712_10208997 3300005290 Bacteria 1080
34 Ga0065712_10263719 3300005290 Bacteria 931
35 Ga0065707_10166336 3300005295 Bacteria 1519
36 Ga0065707_10385028 3300005295 Bacteria 855
37 Ga0070676_10389108 3300005328 Bacteria 967
38 Ga0070676_10780897 3300005328 Bacteria 703
39 Ga0070683_100030331 3300005329 Bacteria 4907
40 Ga0070670_100018081 3300005331 Bacteria 6051
41 Ga0070670_100068080 3300005331 Bacteria 3055
42 Ga0070670_100092898 3300005331 Bacteria 2595
43 Ga0070670_100150457 3300005331 Bacteria 2014
44 Ga0070670_100219101 3300005331 Bacteria 1655
45 Ga0070670_100231408 3300005331 Bacteria 1608
46 Ga0070670_100490162 3300005331 Bacteria 1092
47 Ga0070677_10013451 3300005333 Unclassified 2862
48 Ga0070677_10063065 3300005333 Bacteria 1535
49 Ga0070677_10142571 3300005333 Bacteria 1107
50 Ga0068869_100006542 3300005334 Bacteria 7390
51 Ga0068869_100007079 3300005334 Bacteria 7144
52 Ga0068869_100092954 3300005334 Bacteria 2271
53 Ga0068869_100161706 3300005334 Bacteria 1743
54 Ga0068869_100167040 3300005334 Bacteria 1716
55 Ga0068869_100274879 3300005334 Unclassified 1353
56 Ga0070666_10000536 3300005335 Bacteria 22907
57 Ga0070666_10076765 3300005335 Unclassified 2280
58 Ga0070666_10211835 3300005335 Bacteria 1365
59 Ga0070682_100000628 3300005337 Bacteria 21473
60 Ga0070682_100627674 3300005337 Bacteria 852
61 Ga0068868_100006435 3300005338 Bacteria 8312
62 Ga0068868_100221867 3300005338 Bacteria 1583
63 Ga0068868_100238903 3300005338 Bacteria 1526
64 Ga0068868_100452219 3300005338 Bacteria 1117
65 Ga0068868_100564460 3300005338 Bacteria 1004
66 Ga0070660_100044390 3300005339 Bacteria 3400
67 Ga0070660_100181694 3300005339 Unclassified 1702
68 Ga0070660_100275914 3300005339 Bacteria 1375
69 Ga0070660_100858708 3300005339 Bacteria 764
70 Ga0070691_10415273 3300005341 Bacteria 761
71 Ga0070687_100011322 3300005343 Bacteria 3900
72 Ga0070687_100031401 3300005343 Bacteria 2606
73 Ga0070687_100105272 3300005343 Bacteria 1587
74 Ga0070687_100367826 3300005343 Bacteria 933
75 Ga0070661_100592694 3300005344 Bacteria 895
76 Ga0070661_101133903 3300005344 Bacteria 652
77 Ga0070668_100030711 3300005347 Bacteria 4087
78 Ga0070668_100078394 3300005347 Bacteria 2584
79 Ga0070668_100222169 3300005347 Bacteria 1558
80 Ga0070668_100391018 3300005347 Unclassified 1185
81 Ga0070669_100169400 3300005353 Bacteria 1702
82 Ga0070669_100185767 3300005353 Bacteria 1628
83 Ga0070669_100264686 3300005353 Bacteria 1373
84 Ga0070675_100017651 3300005354 Bacteria 5675
85 Ga0070675_100123475 3300005354 Bacteria 2201
86 Ga0070675_100129986 3300005354 Bacteria 2145
87 Ga0070675_100290018 3300005354 Bacteria 1440
88 Ga0070675_100770431 3300005354 Unclassified 878
89 Ga0070671_100100262 3300005355 Bacteria 2429
90 Ga0070671_100184160 3300005355 Bacteria 1769
91 Ga0070671_101091380 3300005355 Bacteria 701
92 Ga0070674_100100564 3300005356 Bacteria 2105
93 Ga0070674_100122851 3300005356 Bacteria 1924
94 Ga0070674_100178240 3300005356 Bacteria 1626
95 Ga0070674_100304792 3300005356 Bacteria 1271
96 Ga0070673_100004723 3300005364 Bacteria 8650
97 Ga0070673_100006253 3300005364 Bacteria 7723
98 Ga0070673_100013324 3300005364 Bacteria 5682
99 Ga0070673_100276452 3300005364 Unclassified 1471
100 Ga0070673_100276840 3300005364 Bacteria 1470
101 Ga0070673_100668681 3300005364 Bacteria 952
102 Ga0070688_100344574 3300005365 Bacteria 1089
103 Ga0070688_100570944 3300005365 Bacteria 862
104 Ga0070688_100645700 3300005365 Unclassified 814
105 Ga0070659_100003227 3300005366 Bacteria 11613
106 Ga0070659_100088075 3300005366 Bacteria 2486
107 Ga0070667_100005388 3300005367 Bacteria 10686
108 Ga0070667_100015282 3300005367 Bacteria 6345
109 Ga0070667_100059103 3300005367 Bacteria 3243
110 Ga0070667_100457465 3300005367 Bacteria 1167
111 Ga0070667_100460105 3300005367 Bacteria 1163
112 Ga0070667_100466195 3300005367 Bacteria 1155
113 Ga0070667_100575414 3300005367 Bacteria 1036
114 Ga0070709_10625398 3300005434 Bacteria 831
115 Ga0070713_100837017 3300005436 Bacteria 883
116 Ga0070701_10195924 3300005438 Bacteria 1191
117 Ga0070700_100010950 3300005441 Bacteria 5016
118 Ga0070700_100280319 3300005441 Bacteria 1208
119 Ga0070700_100577515 3300005441 Bacteria 877
120 Ga0070694_100129554 3300005444 Bacteria 1821
121 Ga0070708_100620020 3300005445 Bacteria 1020
122 Ga0070663_100019412 3300005455 Bacteria 4479
123 Ga0070663_100321602 3300005455 Bacteria 1244
124 Ga0070678_100056590 3300005456 Bacteria 2869
125 Ga0070678_100068026 3300005456 Unclassified 2653
126 Ga0070678_100227551 3300005456 Bacteria 1553
127 Ga0070681_10008396 3300005458 Bacteria 10112
128 Ga0070681_10024676 3300005458 Bacteria 6050
129 Ga0070681_10042169 3300005458 Bacteria 4574
130 Ga0068867_100017763 3300005459 Bacteria 5050
131 Ga0068867_100019000 3300005459 Bacteria 4893
132 Ga0068867_100023075 3300005459 Bacteria 4453
133 Ga0068867_100075165 3300005459 Bacteria 2534
134 Ga0068867_100117576 3300005459 Bacteria 2050
135 Ga0068867_100133111 3300005459 Bacteria 1935
136 Ga0068867_100451034 3300005459 Bacteria 1096
137 Ga0068867_100517768 3300005459 Bacteria 1028
138 Ga0068867_100688958 3300005459 Unclassified 901
139 Ga0068867_101344111 3300005459 Bacteria 661
140 Ga0070685_10020796 3300005466 Bacteria 3556
141 Ga0070685_10078569 3300005466 Unclassified 1973
142 Ga0070685_10093120 3300005466 Unclassified 1827
143 Ga0070685_10150879 3300005466 Bacteria 1473
144 Ga0070685_10285159 3300005466 Bacteria 1107
145 Ga0070698_100000661 3300005471 Bacteria 36847
146 Ga0070698_100005764 3300005471 Bacteria 13543
147 Ga0070679_100018252 3300005530 Bacteria 6804
148 Ga0070679_100155055 3300005530 Bacteria 2265
149 Ga0070684_100001895 3300005535 Bacteria 15325
150 Ga0070684_100803610 3300005535 Unclassified 879
151 Ga0068853_100008728 3300005539 Bacteria 8153
152 Ga0068853_100014820 3300005539 Bacteria 6400
153 Ga0068853_100088156 3300005539 Bacteria 2724
154 Ga0068853_100239648 3300005539 Bacteria 1662
155 Ga0068853_100360163 3300005539 Bacteria 1355
156 Ga0068853_100626989 3300005539 Bacteria 1022
157 Ga0068853_101435349 3300005539 Bacteria 668
158 Ga0070672_100023427 3300005543 Bacteria 4552
159 Ga0070672_100025969 3300005543 Bacteria 4351
160 Ga0070672_100047689 3300005543 Bacteria 3325
161 Ga0070672_100054432 3300005543 Bacteria 3132
162 Ga0070672_100242480 3300005543 Bacteria 1516
163 Ga0070672_100263024 3300005543 Bacteria 1455
164 Ga0070672_100313140 3300005543 Bacteria 1333
165 Ga0070672_100314732 3300005543 Unclassified 1329
166 Ga0070672_100475207 3300005543 Bacteria 1079
167 Ga0070672_100509640 3300005543 Bacteria 1041
168 Ga0070672_100961930 3300005543 Bacteria 756
169 Ga0070686_100019526 3300005544 Bacteria 3996
170 Ga0070686_100361632 3300005544 Bacteria 1093
171 Ga0070696_100133873 3300005546 Unclassified 1806
172 Ga0070693_100008596 3300005547 Bacteria 5045
173 Ga0070665_100000008 3300005548 Bacteria 606341
174 Ga0070665_100019926 3300005548 Bacteria 6736
175 Ga0070665_100890085 3300005548 Unclassified 903
176 Ga0068855_100001250 3300005563 Bacteria 31562
177 Ga0068855_100001274 3300005563 Bacteria 31259
178 Ga0068855_100025826 3300005563 Bacteria 7024
179 Ga0068855_100091452 3300005563 Bacteria 3510
180 Ga0068855_100139770 3300005563 Bacteria 2762
181 Ga0068855_100644205 3300005563 Bacteria 1138
182 Ga0070664_100108824 3300005564 Bacteria 2417
183 Ga0070664_100124998 3300005564 Unclassified 2255
184 Ga0070664_100138162 3300005564 Bacteria 2144
185 Ga0068857_100151517 3300005577 Bacteria 2101
186 Ga0068857_100281164 3300005577 Bacteria 1531
187 Ga0068857_100523938 3300005577 Bacteria 1114
188 Ga0068857_100747755 3300005577 Bacteria 931
189 Ga0068854_100014234 3300005578 Bacteria 5239
190 Ga0068854_100014439 3300005578 Bacteria 5208
191 Ga0068854_100193632 3300005578 Bacteria 1594
192 Ga0068854_100201852 3300005578 Bacteria 1563
193 Ga0068854_100416099 3300005578 Bacteria 1115
194 Ga0068854_100454151 3300005578 Bacteria 1071
195 Ga0068856_100093229 3300005614 Bacteria 2997
196 Ga0068856_100379535 3300005614 Bacteria 1433
197 Ga0070702_100022492 3300005615 Bacteria 3334
198 Ga0070702_100216324 3300005615 Bacteria 1278
199 Ga0068852_100000180 3300005616 Bacteria 43078
200 Ga0068852_100001996 3300005616 Bacteria 13908
201 Ga0068852_100303661 3300005616 Bacteria 1546
202 Ga0068852_101335593 3300005616 Unclassified 739
203 Ga0068859_100000007 3300005617 Bacteria 390070
204 Ga0068859_100001403 3300005617 Bacteria 24458
205 Ga0068859_100029222 3300005617 Bacteria 5531
206 Ga0068859_100083124 3300005617 Unclassified 3244
207 Ga0068859_100093110 3300005617 Bacteria 3065
208 Ga0068859_100384798 3300005617 Bacteria 1498
209 Ga0068859_100614679 3300005617 Bacteria 1179
210 Ga0068859_100780385 3300005617 Bacteria 1044
211 Ga0068864_100001316 3300005618 Bacteria 20650
212 Ga0068864_100145703 3300005618 Bacteria 2141
213 Ga0068864_101165821 3300005618 Bacteria 768
214 Ga0068866_10103285 3300005718 Bacteria 1577
215 Ga0068861_100080332 3300005719 Bacteria 2551
216 Ga0068861_100964043 3300005719 Bacteria 812
217 Ga0068851_10070919 3300005834 Bacteria 1802
218 Ga0068851_10090465 3300005834 Bacteria 1610
219 Ga0068851_10321220 3300005834 Bacteria 894
220 Ga0068870_10025539 3300005840 Bacteria 2934
221 Ga0068870_10197145 3300005840 Bacteria 1219
222 Ga0068863_100000444 3300005841 Bacteria 41977
223 Ga0068863_100007099 3300005841 Bacteria 10983
224 Ga0068863_100024194 3300005841 Bacteria 5793
225 Ga0068863_100215718 3300005841 Bacteria 1848
226 Ga0068863_100226590 3300005841 Bacteria 1802
227 Ga0068863_100306485 3300005841 Bacteria 1541
228 Ga0068863_100503435 3300005841 Bacteria 1193
229 Ga0068863_100650341 3300005841 Bacteria 1045
230 Ga0068863_101267734 3300005841 Unclassified 743
231 Ga0068863_101291900 3300005841 Bacteria 736
232 Ga0068858_100000829 3300005842 Bacteria 32222
233 Ga0068858_100351746 3300005842 Bacteria 1411
234 Ga0068858_100482081 3300005842 Bacteria 1197
235 Ga0068858_100530908 3300005842 Unclassified 1138
236 Ga0068858_100822543 3300005842 Bacteria 906
237 Ga0068860_100000029 3300005843 Bacteria 259192
238 Ga0068860_100005394 3300005843 Bacteria 12976
239 Ga0068860_100010234 3300005843 Bacteria 9282
240 Ga0068860_100024948 3300005843 Bacteria 5771
241 Ga0068860_100061290 3300005843 Bacteria 3574
242 Ga0068860_100121471 3300005843 Bacteria 2501
243 Ga0068860_100130163 3300005843 Bacteria 2414
244 Ga0068860_100351346 3300005843 Bacteria 1451
245 Ga0068862_100236663 3300005844 Bacteria 1658
246 Ga0081540_1074941 3300005983 Bacteria 1548
247 Ga0075366_10007240 3300006195 Bacteria 6115
248 Ga0075366_10209743 3300006195 Bacteria 1186
249 Ga0075366_10313920 3300006195 Bacteria 960
250 Ga0097621_100000711 3300006237 Bacteria 23348
251 Ga0097621_100012629 3300006237 Bacteria 6268
252 Ga0097621_100077083 3300006237 Bacteria 2766
253 Ga0097621_100092526 3300006237 Bacteria 2533
254 Ga0097621_100126956 3300006237 Bacteria 2167
255 Ga0097621_100158266 3300006237 Unclassified 1946
256 Ga0097621_100428706 3300006237 Unclassified 1188
257 Ga0097621_100627510 3300006237 Bacteria 984
258 Ga0097621_100840136 3300006237 Unclassified 853
259 Ga0075370_10159619 3300006353 Bacteria 1323
260 Ga0068871_100000351 3300006358 Bacteria 31972
261 Ga0068871_100018089 3300006358 Bacteria 5350
262 Ga0068871_100020023 3300006358 Bacteria 5119
263 Ga0068871_100075432 3300006358 Unclassified 2784
264 Ga0068871_100165258 3300006358 Bacteria 1894
265 Ga0068871_100414105 3300006358 Bacteria 1202
266 Ga0068871_100614016 3300006358 Bacteria 990
267 Ga0068871_100643525 3300006358 Bacteria 967
268 Ga0068871_101066465 3300006358 Bacteria 755
269 Ga0075428_100025171 3300006844 Bacteria 6585
270 Ga0075428_100059396 3300006844 Bacteria 4187
271 Ga0075430_100021698 3300006846 Bacteria 5457
272 Ga0075430_100030675 3300006846 Bacteria 4566
273 Ga0075433_10519812 3300006852 Bacteria 1047
274 Ga0075429_100005315 3300006880 Bacteria 11083
275 Ga0075429_100081239 3300006880 Unclassified 2826
276 Ga0068865_100020694 3300006881 Bacteria 4270
277 Ga0068865_100186132 3300006881 Bacteria 1602
278 Ga0068865_100316585 3300006881 Bacteria 1254
279 Ga0068865_100516213 3300006881 Bacteria 998
280 Ga0097620_100000007 3300006931 Bacteria 390070
281 Ga0097620_100001403 3300006931 Bacteria 24458
282 Ga0097620_100029222 3300006931 Bacteria 5531
283 Ga0097620_100083124 3300006931 Unclassified 3244
284 Ga0097620_100093114 3300006931 Bacteria 3065
285 Ga0097620_100384790 3300006931 Bacteria 1498
286 Ga0097620_100614642 3300006931 Bacteria 1179
287 Ga0097620_100780398 3300006931 Bacteria 1044
288 Ga0097620_101262741 3300006931 Bacteria 814
289 Ga0105240_10001800 3300009093 Bacteria 36076
290 Ga0105240_10003960 3300009093 Bacteria 22876
291 Ga0105240_10003982 3300009093 Bacteria 22790
292 Ga0105240_10008182 3300009093 Bacteria 14995
293 Ga0105240_10010900 3300009093 Bacteria 12735
294 Ga0105240_10050422 3300009093 Bacteria 5248
295 Ga0105240_10099692 3300009093 Bacteria 3535
296 Ga0105240_10117609 3300009093 Bacteria 3204
297 Ga0105240_10791516 3300009093 Bacteria 1028
298 Ga0111539_10125769 3300009094 Bacteria 3004
299 Ga0105247_10001984 3300009101 Bacteria 14204
300 Ga0105247_10165240 3300009101 Unclassified 1468
301 Ga0105247_10262399 3300009101 Unclassified 1185
302 Ga0114129_10153798 3300009147 Bacteria 3147
303 Ga0114129_10208548 3300009147 Unclassified 2643
304 Ga0105243_10387332 3300009148 Unclassified 1295
305 Ga0105243_10459542 3300009148 Unclassified 1197
306 Ga0105243_10520306 3300009148 Bacteria 1131
307 Ga0105241_10000206 3300009174 Bacteria 44346
308 Ga0105241_10001098 3300009174 Bacteria 20609
309 Ga0105241_10142957 3300009174 Bacteria 1950
310 Ga0105241_10275092 3300009174 Bacteria 1436
311 Ga0105241_10515071 3300009174 Bacteria 1069
312 Ga0105242_10030077 3300009176 Bacteria 4335
313 Ga0105242_10162697 3300009176 Bacteria 1955
314 Ga0105242_10350443 3300009176 Bacteria 1363
315 Ga0105242_10382148 3300009176 Bacteria 1309
316 Ga0105242_10936432 3300009176 Bacteria 869
317 Ga0105248_10046848 3300009177 Bacteria 4847
318 Ga0105248_10241525 3300009177 Unclassified 2033
319 Ga0105248_10417121 3300009177 Bacteria 1512
320 Ga0105248_10790839 3300009177 Bacteria 1071
321 Ga0105237_10000780 3300009545 Bacteria 43609
322 Ga0105237_10003152 3300009545 Bacteria 19845
323 Ga0105237_10009612 3300009545 Bacteria 10356
324 Ga0105237_10012022 3300009545 Bacteria 9143
325 Ga0105237_10013020 3300009545 Bacteria 8734
326 Ga0105237_10026858 3300009545 Bacteria 5883
327 Ga0105237_10080975 3300009545 Bacteria 3237
328 Ga0105237_10135210 3300009545 Unclassified 2460
329 Ga0105237_10200736 3300009545 Bacteria 1994
330 Ga0105237_10346499 3300009545 Bacteria 1490
331 Ga0105237_11104143 3300009545 Bacteria 800
332 Ga0105238_10032669 3300009551 Bacteria 5296
333 Ga0105238_10037294 3300009551 Bacteria 4941
334 Ga0105238_10045389 3300009551 Bacteria 4439
335 Ga0105238_10056683 3300009551 Bacteria 3931
336 Ga0105238_10291713 3300009551 Bacteria 1613
337 Ga0105249_10008328 3300009553 Bacteria 9028
338 Ga0105249_10009665 3300009553 Bacteria 8450
339 Ga0105249_10042329 3300009553 Bacteria 4142
340 Ga0105249_10197991 3300009553 Bacteria 1964
341 Ga0105249_10497010 3300009553 Unclassified 1264
342 Ga0105249_10598379 3300009553 Bacteria 1157
343 Ga0105239_10000135 3300010375 Bacteria 103223
344 Ga0105239_10000337 3300010375 Bacteria 68698
345 Ga0105239_10007270 3300010375 Bacteria 12721
346 Ga0105239_10009606 3300010375 Bacteria 10882
347 Ga0105239_10011821 3300010375 Bacteria 9742
348 Ga0105239_10066192 3300010375 Bacteria 3969
349 Ga0105239_10224526 3300010375 Bacteria 2107
350 Ga0105239_10237019 3300010375 Bacteria 2048
351 Ga0105239_10278360 3300010375 Bacteria 1883
352 Ga0105239_10390573 3300010375 Bacteria 1574
353 Ga0105239_10701481 3300010375 Bacteria 1157
354 Ga0105246_10432029 3300011119 Bacteria 1102
355 Ga0157373_10048519 3300013100 Bacteria 3027
356 Ga0157373_10171891 3300013100 Bacteria 1525
357 Ga0157373_10588544 3300013100 Bacteria 809
358 Ga0157371_10036310 3300013102 Bacteria 3529
359 Ga0157371_10069202 3300013102 Bacteria 2499
360 Ga0157371_10072834 3300013102 Bacteria 2433
361 Ga0157371_10095188 3300013102 Bacteria 2110
362 Ga0157371_10107422 3300013102 Unclassified 1981
363 Ga0157371_10172210 3300013102 Bacteria 1547
364 Ga0157371_10524499 3300013102 Bacteria 876
365 Ga0157370_10000426 3300013104 Bacteria 52773
366 Ga0157370_10004831 3300013104 Bacteria 15322
367 Ga0157370_10029393 3300013104 Bacteria 5393
368 Ga0157370_10030890 3300013104 Bacteria 5246
369 Ga0157370_10150085 3300013104 Bacteria 2169
370 Ga0157370_10219831 3300013104 Bacteria 1760
371 Ga0157370_10620046 3300013104 Bacteria 990
372 Ga0157370_10981652 3300013104 Unclassified 765
373 Ga0157369_10014091 3300013105 Bacteria 9036
374 Ga0157369_10019728 3300013105 Bacteria 7544
375 Ga0157369_10040395 3300013105 Bacteria 5093
376 Ga0157369_10044422 3300013105 Bacteria 4836
377 Ga0157369_10061816 3300013105 Bacteria 4037
378 Ga0157369_10178489 3300013105 Bacteria 2235
379 Ga0157369_10224634 3300013105 Unclassified 1965
380 Ga0157369_10252953 3300013105 Bacteria 1838
381 Ga0157369_10628330 3300013105 Bacteria 1108
382 Ga0157369_10780015 3300013105 Bacteria 982
383 Ga0157374_10000009 3300013296 Bacteria 564330
384 Ga0157374_10045471 3300013296 Bacteria 4064
385 Ga0157374_10067126 3300013296 Bacteria 3371
386 Ga0157374_10087081 3300013296 Bacteria 2973
387 Ga0157374_10213072 3300013296 Bacteria 1894
388 Ga0157374_10360574 3300013296 Bacteria 1445
389 Ga0157374_10480758 3300013296 Bacteria 1245
390 Ga0157378_10000837 3300013297 Bacteria 28570
391 Ga0157378_10002924 3300013297 Bacteria 15193
392 Ga0157378_10025999 3300013297 Bacteria 5159
393 Ga0157378_11033314 3300013297 Bacteria 857
394 Ga0163162_10000795 3300013306 Bacteria 29353
395 Ga0163162_10000833 3300013306 Bacteria 28693
396 Ga0163162_10008664 3300013306 Bacteria 9901
397 Ga0163162_10041885 3300013306 Bacteria 4582
398 Ga0163162_10050448 3300013306 Bacteria 4173
399 Ga0163162_10069707 3300013306 Unclassified 3568
400 Ga0163162_10453531 3300013306 Bacteria 1414
401 Ga0163162_10924282 3300013306 Bacteria 984
402 Ga0163162_12497444 3300013306 Bacteria 594
403 Ga0157372_10000258 3300013307 Bacteria 58520
404 Ga0157372_10002260 3300013307 Bacteria 20878
405 Ga0157372_10002978 3300013307 Bacteria 18242
406 Ga0157372_10011005 3300013307 Bacteria 9628
407 Ga0157372_10023612 3300013307 Bacteria 6671
408 Ga0157372_10051584 3300013307 Bacteria 4579
409 Ga0157372_10073608 3300013307 Bacteria 3851
410 Ga0157372_10092182 3300013307 Bacteria 3446
411 Ga0157372_10144797 3300013307 Bacteria 2740
412 Ga0157372_10147167 3300013307 Bacteria 2716
413 Ga0157372_10201517 3300013307 Bacteria 2305
414 Ga0157372_10239550 3300013307 Bacteria 2105
415 Ga0157372_10305136 3300013307 Bacteria 1852
416 Ga0157372_10388125 3300013307 Bacteria 1627
417 Ga0157372_10482550 3300013307 Bacteria 1445
418 Ga0157372_10714512 3300013307 Bacteria 1166
419 Ga0157372_10777371 3300013307 Bacteria 1113
420 Ga0157372_10902539 3300013307 Bacteria 1025
421 Ga0157375_10000073 3300013308 Bacteria 105972
422 Ga0157375_10020587 3300013308 Bacteria 6029
423 Ga0157375_10057461 3300013308 Unclassified 3846
424 Ga0157375_10131910 3300013308 Bacteria 2619
425 Ga0157375_10243220 3300013308 Bacteria 1959
426 Ga0157375_10322028 3300013308 Unclassified 1711
427 Ga0157375_10748546 3300013308 Bacteria 1129
428 Ga0157375_10759834 3300013308 Bacteria 1120
429 Ga0157375_10789262 3300013308 Bacteria 1099
430 Ga0163163_10052456 3300014325 Bacteria 4023
431 Ga0163163_10166806 3300014325 Bacteria 2248
432 Ga0163163_10308727 3300014325 Bacteria 1634
433 Ga0163163_10396844 3300014325 Bacteria 1437
434 Ga0163163_11112991 3300014325 Bacteria 853
435 Ga0163163_11144436 3300014325 Bacteria 841
436 Ga0163163_11808531 3300014325 Bacteria 671
437 Ga0157380_10030099 3300014326 Bacteria 4155
438 Ga0157380_10053087 3300014326 Bacteria 3212
439 Ga0157380_10357361 3300014326 Bacteria 1369
440 Ga0157380_10437181 3300014326 Bacteria 1253
441 Ga0157380_10809469 3300014326 Unclassified 955
442 Ga0157377_10044754 3300014745 Bacteria 2469
443 Ga0157377_10137773 3300014745 Bacteria 1497
444 Ga0157379_10070073 3300014968 Bacteria 3137
445 Ga0157379_10119948 3300014968 Bacteria 2365
446 Ga0157379_10185442 3300014968 Unclassified 1880
447 Ga0157379_10186973 3300014968 Bacteria 1872
448 Ga0157379_10213085 3300014968 Unclassified 1749
449 Ga0157379_10356112 3300014968 Bacteria 1341
450 Ga0157379_10778880 3300014968 Bacteria 902
451 Ga0157379_11162181 3300014968 Bacteria 741
452 Ga0157376_10001803 3300014969 Bacteria 14251
453 Ga0157376_10001988 3300014969 Bacteria 13680
454 Ga0157376_10006687 3300014969 Bacteria 8161
455 Ga0157376_10144472 3300014969 Bacteria 2138
456 Ga0157376_10282659 3300014969 Bacteria 1563
457 Ga0157376_10378279 3300014969 Unclassified 1363
458 Ga0182005_1000081 3300015265 Bacteria 73899
459 Ga0163161_10019399 3300017792 Bacteria 4771
460 Ga0163161_10358962 3300017792 Bacteria 1160
461 Ga0209436_100566 3300025208 Bacteria 15905
462 Ga0209436_102659 3300025208 Bacteria 5200
463 Ga0209258_100041 3300025242 Bacteria 381381
464 Ga0207425_1015563 3300025245 Bacteria 1704
465 Ga0209646_1000002 3300025246 Bacteria 1425781
466 Ga0209026_1000233 3300025250 Bacteria 74825
467 Ga0209148_1000090 3300025254 Bacteria 250982
468 Ga0207666_1004090 3300025271 Bacteria 1816
469 Ga0209673_1000034 3300025273 Bacteria 328788
470 Ga0209130_1001027 3300025284 Bacteria 21399
471 Ga0209564_1040205 3300025295 Bacteria 1273
472 Ga0209564_1043670 3300025295 Bacteria 1173
473 Ga0209758_1000419 3300025297 Bacteria 72133
474 Ga0209758_1061714 3300025297 Bacteria 1232
475 Ga0209050_1000353 3300025298 Bacteria 88509
476 Ga0207426_1000002 3300025302 Bacteria 1249660
477 Ga0207426_1000177 3300025302 Bacteria 159426
478 Ga0207426_1000324 3300025302 Bacteria 91661
479 Ga0207426_1000592 3300025302 Bacteria 47901
480 Ga0209257_1000001 3300025304 Bacteria 2274655
481 Ga0209257_1002086 3300025304 Bacteria 21027
482 Ga0207656_10046417 3300025321 Bacteria 1863
483 Ga0207656_10064710 3300025321 Bacteria 1612
484 Ga0207656_10405269 3300025321 Bacteria 686
485 Ga0207682_10038675 3300025893 Bacteria 1937
486 Ga0207682_10069708 3300025893 Bacteria 1487
487 Ga0207682_10086730 3300025893 Bacteria 1351
488 Ga0207682_10109391 3300025893 Unclassified 1215
489 Ga0207642_10040607 3300025899 Bacteria 2031
490 Ga0207710_10001075 3300025900 Bacteria 14094
491 Ga0207688_10033901 3300025901 Bacteria 2825
492 Ga0207688_10165903 3300025901 Bacteria 1311
493 Ga0207680_10000067 3300025903 Bacteria 46002
494 Ga0207680_10063588 3300025903 Unclassified 2259
495 Ga0207680_10348173 3300025903 Bacteria 1040
496 Ga0207647_10000962 3300025904 Bacteria 22327
497 Ga0207647_10005595 3300025904 Bacteria 9181
498 Ga0207647_10070519 3300025904 Unclassified 2111
499 Ga0207647_10395305 3300025904 Bacteria 779
500 Ga0207645_10001205 3300025907 Bacteria 21317
501 Ga0207645_10022729 3300025907 Bacteria 4077
502 Ga0207645_10123146 3300025907 Bacteria 1684
503 Ga0207645_10412634 3300025907 Bacteria 909
504 Ga0207645_10655112 3300025907 Bacteria 713
505 Ga0207643_10038079 3300025908 Bacteria 2700
506 Ga0207643_10133312 3300025908 Bacteria 1480
507 Ga0207643_10332560 3300025908 Bacteria 951
508 Ga0207705_10001654 3300025909 Bacteria 17699
509 Ga0207705_10087634 3300025909 Bacteria 2276
510 Ga0207705_10598273 3300025909 Bacteria 858
511 Ga0207654_10000661 3300025911 Bacteria 19557
512 Ga0207654_10000842 3300025911 Bacteria 16890
513 Ga0207654_10045682 3300025911 Bacteria 2494
514 Ga0207654_10061375 3300025911 Bacteria 2199
515 Ga0207654_10269864 3300025911 Bacteria 1147
516 Ga0207707_10000111 3300025912 Bacteria 82165
517 Ga0207707_10046161 3300025912 Bacteria 3794
518 Ga0207707_10252456 3300025912 Bacteria 1532
519 Ga0207707_10842167 3300025912 Bacteria 761
520 Ga0207695_10000051 3300025913 Bacteria 399641
521 Ga0207695_10000445 3300025913 Bacteria 90509
522 Ga0207695_10003973 3300025913 Bacteria 20423
523 Ga0207695_10008615 3300025913 Bacteria 12742
524 Ga0207695_10033063 3300025913 Bacteria 5649
525 Ga0207695_10034499 3300025913 Bacteria 5501
526 Ga0207695_10035604 3300025913 Bacteria 5395
527 Ga0207695_10037199 3300025913 Bacteria 5253
528 Ga0207695_10041787 3300025913 Bacteria 4905
529 Ga0207671_10001466 3300025914 Bacteria 27257
530 Ga0207671_10001776 3300025914 Bacteria 24234
531 Ga0207671_10001778 3300025914 Bacteria 24205
532 Ga0207671_10009206 3300025914 Bacteria 8283
533 Ga0207671_10047175 3300025914 Unclassified 3188
534 Ga0207671_10062520 3300025914 Bacteria 2765
535 Ga0207671_10066698 3300025914 Bacteria 2679
536 Ga0207671_10210864 3300025914 Bacteria 1519
537 Ga0207671_10297693 3300025914 Bacteria 1274
538 Ga0207671_10708656 3300025914 Bacteria 800
539 Ga0207663_10272622 3300025916 Bacteria 1254
540 Ga0207660_10001012 3300025917 Bacteria 18631
541 Ga0207660_10008720 3300025917 Bacteria 6557
542 Ga0207662_10007855 3300025918 Bacteria 5812
543 Ga0207657_10056435 3300025919 Bacteria 3388
544 Ga0207657_10142361 3300025919 Bacteria 1959
545 Ga0207657_10527838 3300025919 Bacteria 924
546 Ga0207649_10494043 3300025920 Bacteria 930
547 Ga0207649_10611983 3300025920 Bacteria 839
548 Ga0207649_10708614 3300025920 Bacteria 781
549 Ga0207652_10000538 3300025921 Bacteria 38475
550 Ga0207652_10000960 3300025921 Bacteria 26943
551 Ga0207681_10009782 3300025923 Bacteria 5865
552 Ga0207681_10100892 3300025923 Bacteria 2081
553 Ga0207681_10284840 3300025923 Bacteria 1302
554 Ga0207694_10019774 3300025924 Bacteria 5094
555 Ga0207694_10166674 3300025924 Bacteria 1782
556 Ga0207694_10177615 3300025924 Bacteria 1725
557 Ga0207694_10208658 3300025924 Bacteria 1591
558 Ga0207650_10122178 3300025925 Bacteria 2029
559 Ga0207650_10487853 3300025925 Bacteria 1029
560 Ga0207650_10523741 3300025925 Bacteria 992
561 Ga0207659_10050963 3300025926 Bacteria 2942
562 Ga0207659_10181728 3300025926 Bacteria 1667
563 Ga0207659_10305760 3300025926 Bacteria 1308
564 Ga0207659_10337561 3300025926 Bacteria 1247
565 Ga0207659_10954483 3300025926 Unclassified 737
566 Ga0207700_10666820 3300025928 Bacteria 928
567 Ga0207644_10024795 3300025931 Unclassified 4120
568 Ga0207644_10344197 3300025931 Bacteria 1210
569 Ga0207644_10451404 3300025931 Unclassified 1056
570 Ga0207644_10453883 3300025931 Bacteria 1053
571 Ga0207690_10014400 3300025932 Bacteria 4777
572 Ga0207690_10581579 3300025932 Unclassified 913
573 Ga0207686_10000715 3300025934 Bacteria 20597
574 Ga0207686_10017723 3300025934 Bacteria 4017
575 Ga0207709_10425454 3300025935 Bacteria 1021
576 Ga0207709_10516807 3300025935 Unclassified 934
577 Ga0207670_10114999 3300025936 Bacteria 1945
578 Ga0207670_10335349 3300025936 Bacteria 1194
579 Ga0207670_10480635 3300025936 Bacteria 1006
580 Ga0207669_10532252 3300025937 Bacteria 945
581 Ga0207669_10801201 3300025937 Unclassified 781
582 Ga0207704_10008049 3300025938 Bacteria 5016
583 Ga0207704_10011913 3300025938 Unclassified 4300
584 Ga0207704_10354387 3300025938 Bacteria 1143
585 Ga0207691_10004949 3300025940 Bacteria 12848
586 Ga0207691_10022643 3300025940 Bacteria 5925
587 Ga0207691_10062073 3300025940 Bacteria 3393
588 Ga0207691_10087508 3300025940 Bacteria 2795
589 Ga0207691_10445948 3300025940 Bacteria 1102
590 Ga0207691_10451683 3300025940 Bacteria 1094
591 Ga0207691_10893658 3300025940 Bacteria 744
592 Ga0207711_10035102 3300025941 Bacteria 4249
593 Ga0207711_10428060 3300025941 Bacteria 1231
594 Ga0207689_10002959 3300025942 Bacteria 15685
595 Ga0207689_10005262 3300025942 Bacteria 11600
596 Ga0207689_10021377 3300025942 Bacteria 5441
597 Ga0207689_10049862 3300025942 Bacteria 3454
598 Ga0207689_10074987 3300025942 Bacteria 2780
599 Ga0207689_10137046 3300025942 Bacteria 2015
600 Ga0207689_10501790 3300025942 Bacteria 1017
601 Ga0207661_10048009 3300025944 Bacteria 3391
602 Ga0207661_10563327 3300025944 Bacteria 1044
603 Ga0207667_10000100 3300025949 Bacteria 138482
604 Ga0207667_10004308 3300025949 Bacteria 17437
605 Ga0207667_10010209 3300025949 Bacteria 10997
606 Ga0207667_10080669 3300025949 Bacteria 3371
607 Ga0207667_11044148 3300025949 Bacteria 803
608 Ga0207651_10040147 3300025960 Bacteria 3093
609 Ga0207651_10145062 3300025960 Bacteria 1839
610 Ga0207651_10276251 3300025960 Bacteria 1386
611 Ga0207651_10551469 3300025960 Bacteria 1002
612 Ga0207651_10679689 3300025960 Bacteria 905
613 Ga0207712_10001156 3300025961 Bacteria 18384
614 Ga0207712_10024733 3300025961 Bacteria 3982
615 Ga0207712_10066027 3300025961 Unclassified 2585
616 Ga0207712_10125385 3300025961 Bacteria 1949
617 Ga0207712_10455434 3300025961 Unclassified 1086
618 Ga0207712_10536775 3300025961 Unclassified 1004
619 Ga0207712_11091321 3300025961 Bacteria 710
620 Ga0207668_10026438 3300025972 Bacteria 3768
621 Ga0207668_10151729 3300025972 Bacteria 1795
622 Ga0207668_10156325 3300025972 Unclassified 1772
623 Ga0207640_10027653 3300025981 Bacteria 3458
624 Ga0207640_10033995 3300025981 Bacteria 3178
625 Ga0207640_10059835 3300025981 Bacteria 2515
626 Ga0207640_10108050 3300025981 Bacteria 1965
627 Ga0207640_10130167 3300025981 Bacteria 1818
628 Ga0207640_10204918 3300025981 Bacteria 1498
629 Ga0207658_10005017 3300025986 Bacteria 9121
630 Ga0207658_10115803 3300025986 Bacteria 2128
631 Ga0207658_10206859 3300025986 Bacteria 1642
632 Ga0207658_10592578 3300025986 Bacteria 995
633 Ga0207658_11129000 3300025986 Bacteria 716
634 Ga0207677_10005993 3300026023 Bacteria 6623
635 Ga0207677_10056615 3300026023 Bacteria 2687
636 Ga0207677_10081379 3300026023 Bacteria 2324
637 Ga0207677_10188221 3300026023 Bacteria 1630
638 Ga0207677_10403403 3300026023 Bacteria 1160
639 Ga0207703_10017680 3300026035 Bacteria 5567
640 Ga0207703_10116123 3300026035 Unclassified 2291
641 Ga0207703_10395002 3300026035 Bacteria 1282
642 Ga0207703_10423639 3300026035 Bacteria 1239
643 Ga0207639_10070159 3300026041 Bacteria 2736
644 Ga0207639_10073596 3300026041 Bacteria 2679
645 Ga0207639_10249225 3300026041 Bacteria 1548
646 Ga0207639_10293226 3300026041 Bacteria 1435
647 Ga0207639_10522781 3300026041 Bacteria 1087
648 Ga0207639_10814362 3300026041 Bacteria 870
649 Ga0207678_10025947 3300026067 Bacteria 5112
650 Ga0207678_10145829 3300026067 Bacteria 2020
651 Ga0207678_10195723 3300026067 Bacteria 1728
652 Ga0207708_10193239 3300026075 Bacteria 1621
653 Ga0207708_10560726 3300026075 Bacteria 964
654 Ga0207702_10068314 3300026078 Bacteria 3053
655 Ga0207702_10075567 3300026078 Bacteria 2911
656 Ga0207702_10241282 3300026078 Bacteria 1693
657 Ga0207641_10000090 3300026088 Bacteria 127735
658 Ga0207641_10000213 3300026088 Bacteria 75051
659 Ga0207641_10008579 3300026088 Bacteria 8440
660 Ga0207641_10018040 3300026088 Bacteria 5784
661 Ga0207641_10175968 3300026088 Bacteria 1957
662 Ga0207648_10000653 3300026089 Bacteria 38843
663 Ga0207648_10029361 3300026089 Bacteria 4876
664 Ga0207648_10039157 3300026089 Bacteria 4168
665 Ga0207648_10129072 3300026089 Bacteria 2225
666 Ga0207648_10304164 3300026089 Unclassified 1430
667 Ga0207648_10377254 3300026089 Bacteria 1282
668 Ga0207648_10430457 3300026089 Bacteria 1199
669 Ga0207676_10547419 3300026095 Bacteria 1105
670 Ga0207676_11347755 3300026095 Bacteria 709
671 Ga0207674_10003443 3300026116 Bacteria 19359
672 Ga0207674_10060763 3300026116 Bacteria 3821
673 Ga0207674_10065745 3300026116 Bacteria 3654
674 Ga0207674_10165009 3300026116 Bacteria 2169
675 Ga0207675_100007715 3300026118 Bacteria 10158
676 Ga0207675_100008836 3300026118 Bacteria 9455
677 Ga0207675_100081577 3300026118 Bacteria 3032
678 Ga0207675_100120696 3300026118 Bacteria 2480
679 Ga0207675_100172010 3300026118 Bacteria 2071
680 Ga0207675_100288819 3300026118 Bacteria 1595
681 Ga0207675_100879105 3300026118 Bacteria 912
682 Ga0207675_101038578 3300026118 Bacteria 838
683 Ga0207683_10048943 3300026121 Bacteria 3699
684 Ga0207683_10076782 3300026121 Bacteria 2958
685 Ga0207683_10093220 3300026121 Bacteria 2684
686 Ga0207683_10269701 3300026121 Bacteria 1555
687 Ga0207683_10326373 3300026121 Bacteria 1406
688 Ga0207698_10000108 3300026142 Bacteria 51893
689 Ga0207698_10011126 3300026142 Bacteria 5817
690 Ga0207698_10373847 3300026142 Bacteria 1354
691 Ga0268266_10000016 3300028379 Bacteria 629101
692 Ga0268266_10295182 3300028379 Unclassified 1510
693 Ga0268265_10060552 3300028380 Bacteria 2902
694 Ga0268265_10166956 3300028380 Bacteria 1877
695 Ga0268264_10000072 3300028381 Bacteria 260791
696 Ga0268264_10002720 3300028381 Bacteria 15431
697 Ga0268264_10007598 3300028381 Bacteria 9037
698 Ga0268264_10033282 3300028381 Bacteria 4233
699 Ga0268264_10063504 3300028381 Bacteria 3104
700 Ga0268264_10065820 3300028381 Bacteria 3054
701 Ga0268264_10102717 3300028381 Bacteria 2488
702 Ga0268264_10157870 3300028381 Unclassified 2040
703 Ga0268264_10487970 3300028381 Bacteria 1199
704 Ga0268264_10603980 3300028381 Bacteria 1081
705 Ga0265336_10120897 3300028666 Bacteria 780
706 Ga0307517_10000697 3300028786 Bacteria 57970
707 Ga0307515_10000078 3300028794 Bacteria 227988
708 Ga0307511_10001896 3300030521 Bacteria 21954
709 Ga0265325_10249205 3300031241 Bacteria 805
710 Ga0265327_10045037 3300031251 Bacteria 2347
711 Ga0307509_10036817 3300031507 Bacteria 5354
712 Ga0307509_10123147 3300031507 Bacteria 2566
713 Ga0265313_10153091 3300031595 Bacteria 984
714 Ga0307508_10266838 3300031616 Bacteria 1306
715 Ga0307508_10346038 3300031616 Bacteria 1078
716 Ga0307516_10265817 3300031730 Bacteria 1404
717 Ga0307413_10292765 3300031824 Bacteria 1231
718 Ga0307413_10356087 3300031824 Bacteria 1131
719 Ga0307410_10490665 3300031852 Bacteria 1009
720 Ga0307406_10642526 3300031901 Bacteria 880
721 Ga0307407_10388672 3300031903 Bacteria 998
722 Ga0307412_10466060 3300031911 Bacteria 1044
723 Ga0307416_100672015 3300032002 Bacteria 1122
724 Ga0307414_10374474 3300032004 Bacteria 1229
725 Ga0307414_10870488 3300032004 Bacteria 825
726 Ga0307411_10050097 3300032005 Bacteria 2718
727 Ga0307411_11275172 3300032005 Bacteria 669
728 Ga0307415_100132561 3300032126 Bacteria 1889
729 Ga0307510_10001712 3300033180 Bacteria 24371
730 Ga0307510_10362291 3300033180 Bacteria 898
731 Ga0373955_0241292 3300035172 Bacteria 1082
732 Ga0373927_0100179 3300035695 Bacteria 1884
733 Ga0373933_0136478 3300035724 Bacteria 1546
734 Ga0373937_0139076 3300036401 Unclassified 2271
735 Ga0373937_0459222 3300036401 Bacteria 1210
736 Ga0395899_0014889 3300037312 Bacteria 5935
737 Ga0395900_0016890 3300037418 Bacteria 7450
738 Ga0395900_0182795 3300037418 Bacteria 2130
739 Ga0395900_0525978 3300037418 Bacteria 1130
740 Ga0395900_0550511 3300037418 Bacteria 1098
741 Ga0395898_0112161 3300037466 Unclassified 2613
742 Ga0395905_0001861 3300037471 Bacteria 24297
743 Ga0395905_0065531 3300037471 Bacteria 3401
744 Ga0395901_0089556 3300038443 Bacteria 3220
745 Ga0395901_0103349 3300038443 Bacteria 2990
746 Ga0436365_0289942 3300039437 Bacteria 1350
747 Ga0439436_0006955 3300041404 Bacteria 3479
748 Ga0439436_0048147 3300041404 Bacteria 1210
749 Ga0439439_0005738 3300041406 Bacteria 2847
750 Ga0439439_0051855 3300041406 Bacteria 1076
751 Ga0451787_202726 3300041441 Bacteria 607
752 Ga0451802_1082803 3300041460 Bacteria 1150
753 Ga0451804_0420865 3300041463 Bacteria 1398
754 Ga0451807_2236118 3300041486 Bacteria 852
755 Ga0451849_0258145 3300041505 Bacteria 706
756 Ga0451853_0569222 3300041512 Bacteria 749
757 Ga0451853_1768614 3300041512 Bacteria 1577
758 Ga0451853_3831587 3300041512 Bacteria 834
759 Ga0439431_0017465 3300041997 Bacteria 1688
760 Ga0439449_0004710 3300042007 Bacteria 5267
761 Ga0439449_0138673 3300042007 Bacteria 905
762 Ga0439449_0185269 3300042007 Bacteria 778
763 Ga0439457_009584 3300042014 Bacteria 2250
764 Ga0439457_023623 3300042014 Bacteria 1360
765 Ga0439457_037992 3300042014 Bacteria 1072
766 Ga0439457_091971 3300042014 Bacteria 702
767 Ga0439462_0011206 3300042015 Bacteria 2280
768 Ga0450923_006726 3300042125 Bacteria 1917
769 Ga0451577_0025828 3300042876 Bacteria 5326
770 Ga0466969_0000754 3300044656 Bacteria 17561
771 Ga0466972_0004958 3300044658 Bacteria 6683
772 Ga0466972_0008365 3300044658 Bacteria 5184
773 Ga0466966_0000030 3300044684 Bacteria 103300
774 Ga0466966_0346352 3300044684 Bacteria 893
775 Ga0466961_0134492 3300044693 Bacteria 1549
776 Ga0466971_0009829 3300044719 Bacteria 4177
777 Ga0466971_0053325 3300044719 Bacteria 1822
778 Ga0466971_0078081 3300044719 Bacteria 1508
779 Ga0466968_0080577 3300044735 Bacteria 1430
780 Ga0466968_0081931 3300044735 Bacteria 1419
781 Ga0466968_0193259 3300044735 Bacteria 950
782 Ga0466968_0458851 3300044735 Bacteria 631
783 Ga0466957_0009182 3300044842 Bacteria 5640
784 Ga0466957_0011478 3300044842 Bacteria 5113
785 Ga0466957_0111966 3300044842 Bacteria 1732
786 Ga0466960_0406241 3300044901 Bacteria 785
787 Ga0466959_0000269 3300045049 Bacteria 31896
788 Ga0466959_0002150 3300045049 Bacteria 12505
789 Ga0466959_0045485 3300045049 Bacteria 3232
790 Ga0466958_0110840 3300045836 Bacteria 1713
791 Ga0495627_013864 3300046453 Bacteria 2828
792 Ga0495638_0017086 3300046460 Bacteria 4846
793 Ga0495638_0154815 3300046460 Bacteria 1327
794 Ga0495651_0130068 3300046462 Bacteria 1839
795 Ga0495650_0115811 3300046471 Bacteria 990
796 Ga0495580_0038332 3300046472 Bacteria 3433
797 Ga0495580_0112467 3300046472 Bacteria 1891
798 Ga0495582_0088992 3300046473 Unclassified 1720
799 Ga0495664_0341061 3300046477 Bacteria 903
800 Ga0495606_0004456 3300046507 Bacteria 13980
801 Ga0495630_0247352 3300046517 Bacteria 1362
802 Ga0495630_0252397 3300046517 Bacteria 1348
803 Ga0495632_0157321 3300046519 Bacteria 1048
804 Ga0495648_0011969 3300046524 Bacteria 6504
805 Ga0495665_0187618 3300046531 Bacteria 1073
806 Ga0495586_0145441 3300046535 Bacteria 1332
807 Ga0495587_0260229 3300046536 Bacteria 975
808 Ga0495621_0015348 3300046539 Unclassified 2442
809 Ga0495622_0374054 3300046557 Bacteria 615
810 Ga0495633_0000175 3300046558 Bacteria 83653
811 Ga0495668_0000108 3300046616 Bacteria 132593
812 Ga0495668_0005589 3300046616 Bacteria 8454
813 Ga0495634_0115218 3300046642 Unclassified 1725
814 Ga0495611_0000011 3300046648 Bacteria 146643
815 Ga0495611_0104811 3300046648 Unclassified 1315
816 Ga0495625_0475451 3300046660 Bacteria 768
817 Ga0495623_0264615 3300046679 Bacteria 962
818 Ga0495647_0237843 3300046681 Bacteria 808
819 Ga0495658_0042870 3300046683 Bacteria 2528
820 Ga0495624_0610335 3300046690 Bacteria 650
821 Ga0495670_0309935 3300046691 Bacteria 847
822 Ga0495604_0220578 3300047317 Bacteria 1305
823 Ga0495672_0014438 3300047320 Bacteria 5408
824 Ga0495672_0041053 3300047320 Bacteria 2801
825 Ga0495676_0262431 3300047321 Bacteria 1175
826 Ga0495676_0387687 3300047321 Bacteria 929
827 Ga0495687_000004 3300047443 Bacteria 779298
828 Ga0495677_0194934 3300047445 Bacteria 787
829 Ga0495686_0000165 3300047472 Bacteria 125611
830 Ga0496101_0546953 3300048904 Bacteria 915
831 Ga0496105_0099960 3300048908 Bacteria 2396
832 Ga0496115_0132318 3300048918 Bacteria 2056
833 Ga0496115_0906618 3300048918 Bacteria 679
834 Ga0496118_0278248 3300048921 Bacteria 933
835 Ga0496121_0000030 3300048924 Bacteria 412079
836 Ga0496126_0047240 3300048929 Bacteria 3942
837 Ga0496126_1017685 3300048929 Bacteria 621
838 Ga0501298_000289 3300049521 Bacteria 6655
839 Ga0501299_032352 3300049522 Bacteria 1015
840 Ga0501031_0142009 3300049568 Bacteria 1569
841 Ga0501032_0761224 3300049569 Bacteria 612
842 Ga0501034_0305168 3300049571 Bacteria 1527
843 Ga0501034_0455430 3300049571 Bacteria 1197
844 Ga0501034_0710319 3300049571 Bacteria 903
845 Ga0501036_0003520 3300049572 Bacteria 12524
846 Ga0501037_0008893 3300049573 Bacteria 7355
847 Ga0501037_0214124 3300049573 Bacteria 1358
848 Ga0501038_0009081 3300049574 Bacteria 9125
849 Ga0501038_0655038 3300049574 Bacteria 790
850 Ga0501039_0011833 3300049575 Bacteria 6644
851 Ga0501039_0600173 3300049575 Bacteria 863
852 Ga0501043_0018866 3300049579 Bacteria 5414
853 Ga0501046_0026580 3300049580 Bacteria 4727
854 Ga0501047_0030087 3300049581 Bacteria 5235
855 Ga0501047_0687940 3300049581 Bacteria 841
856 Ga0501048_0079968 3300049582 Bacteria 2307
857 Ga0501067_0149864 3300049583 Bacteria 1299
858 Ga0501068_0028446 3300049584 Bacteria 3306
859 Ga0501070_0057509 3300049586 Bacteria 3223
860 Ga0501071_0107006 3300049587 Bacteria 2065
861 Ga0501073_0054158 3300049589 Bacteria 2809
862 Ga0501073_0736801 3300049589 Bacteria 680
863 Ga0501074_0024502 3300049590 Unclassified 4386
864 Ga0501198_021314 3300049649 Bacteria 1032
865 Ga0501201_021143 3300049651 Bacteria 691
866 Ga0501202_000865 3300049652 Bacteria 4607
867 Ga0501202_006743 3300049652 Bacteria 2063
868 Ga0501202_051768 3300049652 Bacteria 911
869 Ga0501207_002781 3300049654 Bacteria 2283
870 Ga0501207_021214 3300049654 Bacteria 1042
871 Ga0501208_008248 3300049655 Bacteria 1399
872 Ga0501217_002224 3300049661 Bacteria 3785
873 Ga0501217_032587 3300049661 Bacteria 1290
874 Ga0501222_000982 3300049662 Bacteria 4085
875 Ga0501223_000157 3300049663 Bacteria 17995
876 Ga0501224_000664 3300049664 Bacteria 4275
877 Ga0501228_010121 3300049666 Bacteria 932
878 Ga0501233_000669 3300049668 Bacteria 5619
879 Ga0501235_000828 3300049669 Bacteria 6342
880 Ga0501240_002622 3300049673 Bacteria 1927
881 Ga0501242_005934 3300049674 Bacteria 1386
882 Ga0501243_000215 3300049675 Bacteria 7095
883 Ga0501250_006524 3300049680 Bacteria 1237
884 Ga0501250_007292 3300049680 Bacteria 1191
885 Ga0501252_000578 3300049682 Bacteria 2891
886 Ga0501253_000895 3300049683 Bacteria 2811
887 Ga0501257_004810 3300049686 Bacteria 2957
888 Ga0501259_000181 3300049688 Bacteria 9543
889 Ga0501259_002966 3300049688 Bacteria 2721
890 Ga0501259_071355 3300049688 Bacteria 745
891 Ga0501261_005649 3300049690 Bacteria 1579
892 Ga0501261_050559 3300049690 Bacteria 680
893 Ga0501219_000812 3300049703 Bacteria 4068
894 Ga0501221_000080 3300049704 Bacteria 10925
895 Ga0501225_0001083 3300049705 Bacteria 8547
896 Ga0501225_0002530 3300049705 Bacteria 5650
897 Ga0501225_0007474 3300049705 Bacteria 3165
898 Ga0501234_000581 3300049707 Bacteria 5611
899 Ga0501245_000311 3300049708 Bacteria 5731
900 Ga0501245_003557 3300049708 Bacteria 2119
901 Ga0501079_0076381 3300049741 Bacteria 2591
902 Ga0501080_0039984 3300049742 Bacteria 4376
903 Ga0501080_0513414 3300049742 Bacteria 1070
904 Ga0501083_0174751 3300049744 Bacteria 1403
905 Ga0501232_010289 3300049757 Bacteria 1051
906 Ga0501241_001105 3300049758 Bacteria 5686
907 Ga0501241_004302 3300049758 Bacteria 2674
908 Ga0501241_043990 3300049758 Bacteria 871
909 Ga0501266_005705 3300049763 Bacteria 1547
910 Ga0501268_052523 3300049765 Bacteria 792
911 Ga0501269_013559 3300049766 Bacteria 998
912 Ga0501271_012917 3300049768 Bacteria 910
913 Ga0501278_009862 3300049774 Bacteria 755
914 Ga0501044_0006136 3300049823 Bacteria 13269
915 Ga0501044_0019334 3300049823 Bacteria 7288
916 Ga0501044_0038980 3300049823 Bacteria 4960
917 Ga0501044_0099172 3300049823 Bacteria 2932
918 Ga0501044_0398168 3300049823 Bacteria 1290
919 Ga0501044_0512092 3300049823 Bacteria 1100
920 Ga0501045_0375742 3300049824 Bacteria 1058
921 Ga0501212_036903 3300049851 Bacteria 800
922 Ga0501284_00105 3300050005 Bacteria 17011
923 nmdc:mga0k408_11997_c1 3300050493 Bacteria 4728
924 nmdc:mga0k408_162047_c1 3300050493 Bacteria 1333
925 nmdc:mga0k408_40690_c1 3300050493 Bacteria 2675
926 nmdc:mga05p37_1130996_c1 3300050507 Bacteria 817
927 nmdc:mga05p37_194882_c1 3300050507 Unclassified 2457
928 nmdc:mga09592_12177_c1 3300050508 Bacteria 7001
929 nmdc:mga09592_14034_c1 3300050508 Bacteria 6541
930 nmdc:mga09592_553442_c1 3300050508 Bacteria 988
931 nmdc:mga0qj67_51192_c1 3300050509 Bacteria 3265
932 nmdc:mga0qj67_61545_c1 3300050509 Unclassified 2981
933 nmdc:mga08y16_260978_c1 3300050511 Bacteria 1789
934 nmdc:mga0a205_923055_c1 3300050515 Bacteria 720
935 Ga0495619_0125939 3300053085 Bacteria 1758
936 Ga0500578_0000120 3300053086 Bacteria 95463
937 Ga0500644_0129574 3300053088 Bacteria 992
938 Ga0500644_0230791 3300053088 Bacteria 775
939 Ga0500646_0010270 3300053090 Bacteria 2402
940 Ga0500583_0000120 3300053092 Bacteria 37819
941 Ga0500583_0006739 3300053092 Bacteria 3981
942 Ga0500583_0012437 3300053092 Bacteria 3246
943 Ga0500583_0064385 3300053092 Bacteria 1739
944 Ga0500651_0047942 3300053093 Bacteria 2685
945 Ga0500651_0438006 3300053093 Bacteria 729
946 Ga0500651_0467566 3300053093 Bacteria 699
947 Ga0500650_0078790 3300053098 Bacteria 1540
948 Ga0500556_0124325 3300053104 Bacteria 1008
949 Ga0500569_000517 3300053109 Bacteria 6437
950 Ga0500594_0053167 3300053118 Bacteria 1147
951 Ga0500594_0147661 3300053118 Bacteria 754
952 Ga0500642_0003619 3300053130 Bacteria 4702
953 Ga0500642_0074754 3300053130 Unclassified 1547
954 Ga0500652_006848 3300053131 Bacteria 3695
955 Ga0500652_083867 3300053131 Bacteria 1328
956 Ga0500655_013508 3300053133 Unclassified 1491
957 Ga0500655_016309 3300053133 Bacteria 1368
958 Ga0500559_0003554 3300053136 Bacteria 7625
959 Ga0500568_0083274 3300053139 Unclassified 1212
960 Ga0500568_0175869 3300053139 Bacteria 787
961 Ga0500573_0126264 3300053140 Bacteria 1420
962 Ga0500573_0171265 3300053140 Unclassified 1174
963 Ga0500577_0005167 3300053142 Bacteria 3498
964 Ga0500579_145570 3300053143 Bacteria 1053
965 Ga0500589_053266 3300053147 Bacteria 1873
966 Ga0500604_0002303 3300053151 Bacteria 5221
967 Ga0500616_0003236 3300053153 Bacteria 12618
968 Ga0500616_0004758 3300053153 Bacteria 9542
969 Ga0500616_0025280 3300053153 Bacteria 3294
970 Ga0500622_0001475 3300053156 Bacteria 18735
971 Ga0500622_0002131 3300053156 Bacteria 14740
972 Ga0500627_0194614 3300053158 Bacteria 910
973 Ga0500633_0043943 3300053160 Bacteria 1514
974 Ga0500634_0090702 3300053161 Bacteria 1552
975 Ga0500636_0007397 3300053177 Bacteria 6354
976 Ga0500611_067885 3300053727 Bacteria 861
977 Ga0500661_016479 3300055283 Bacteria 1321
978 Ga0500661_034890 3300055283 Bacteria 889
979 Ga0501082_0099557 3300060353 Bacteria 2513
980 Ga0466962_0004595 3300061719 Bacteria 6624
981 2738731491 2738541278 Bacteria 9755573
982 2819573238 2818991442 Bacteria 8318214
983 2819681930 2818991460 Bacteria 7595395
984 2821136658 2821136567 Bacteria 8080116
985 2881958640 2881955468 Bacteria 3545609
986 2884795977 2884791551 Bacteria 8511252
987 2904468597 2904467357 Bacteria 8057758
988 2929178514 2929177148 Bacteria 7883697
989 2929240847 2929239360 Bacteria 7745570
990 2929922888 2929921140 Bacteria 8649150
991 2945980915 2945977869 Bacteria 7777518
992 2946019684 2946013367 Bacteria 7766675
993 8003154714 8003151029 Bacteria 8187759
994 Ga0105237_10541274
995 JGI24740J21852_10013829
996 JGI24739J22299_10018562
997 JGI25158J39367_1005868
998 JGI25153J46596_10000209
999 JGI25153J46596_10023975
1000 rootH2_10011602
1001 rootH2_10087314
1002 rootH2_10090059
1003 rootH2_10137001
1004 rootH1_10043692
1005 rootH1_10137701
1006 rootH1_10203057
1007 JGI25160J50197_1001403
1008 JGI25160J50197_1003289
1009 JGI25160J50197_1009333
1010 Ga0055542_1005560
1011 Ga0055526_1021827
1012 Ga0055526_1038025
1013 Ga0055528_1000308
1014 Ga0055528_1000809
1015 Ga0055530_10000385
1016 Ga0055531_10000027
1017 Ga0065165_1000053
1018 Ga0065165_1004556
1019 Ga0065165_1046879
1020 Ga0065714_10214071
1021 Ga0065704_10029955
1022 Ga0065704_10244930
1023 Ga0065712_10014379
1024 Ga0065712_10019139
1025 Ga0065712_10029565
1026 Ga0065712_10208997
1027 Ga0065712_10263719
1028 Ga0065707_10166336
1029 Ga0065707_10385028
1030 Ga0070676_10389108
1031 Ga0070676_10780897
1032 Ga0070683_100030331
1033 Ga0070670_100018081
1034 Ga0070670_100068080
1035 Ga0070670_100092898
1036 Ga0070670_100150457
1037 Ga0070670_100219101
1038 Ga0070670_100231408
1039 Ga0070670_100490162
1040 Ga0070677_10013451
1041 Ga0070677_10063065
1042 Ga0070677_10142571
1043 Ga0068869_100006542
1044 Ga0068869_100007079
1045 Ga0068869_100092954
1046 Ga0068869_100161706
1047 Ga0068869_100167040
1048 Ga0068869_100274879
1049 Ga0070666_10000536
1050 Ga0070666_10076765
1051 Ga0070666_10211835
1052 Ga0070682_100000628
1053 Ga0070682_100627674
1054 Ga0068868_100006435
1055 Ga0068868_100221867
1056 Ga0068868_100238903
1057 Ga0068868_100452219
1058 Ga0068868_100564460
1059 Ga0070660_100044390
1060 Ga0070660_100181694
1061 Ga0070660_100275914
1062 Ga0070660_100858708
1063 Ga0070691_10415273
1064 Ga0070687_100011322
1065 Ga0070687_100031401
1066 Ga0070687_100105272
1067 Ga0070687_100367826
1068 Ga0070661_100592694
1069 Ga0070661_101133903
1070 Ga0070668_100030711
1071 Ga0070668_100078394
1072 Ga0070668_100222169
1073 Ga0070668_100391018
1074 Ga0070669_100169400
1075 Ga0070669_100185767
1076 Ga0070669_100264686
1077 Ga0070675_100017651
1078 Ga0070675_100123475
1079 Ga0070675_100129986
1080 Ga0070675_100290018
1081 Ga0070675_100770431
1082 Ga0070671_100100262
1083 Ga0070671_100184160
1084 Ga0070671_101091380
1085 Ga0070674_100100564
1086 Ga0070674_100122851
1087 Ga0070674_100178240
1088 Ga0070674_100304792
1089 Ga0070673_100004723
1090 Ga0070673_100006253
1091 Ga0070673_100013324
1092 Ga0070673_100276452
1093 Ga0070673_100276840
1094 Ga0070673_100668681
1095 Ga0070688_100344574
1096 Ga0070688_100570944
1097 Ga0070688_100645700
1098 Ga0070659_100003227
1099 Ga0070659_100088075
1100 Ga0070667_100005388
1101 Ga0070667_100015282
1102 Ga0070667_100059103
1103 Ga0070667_100457465
1104 Ga0070667_100460105
1105 Ga0070667_100466195
1106 Ga0070667_100575414
1107 Ga0070709_10625398
1108 Ga0070713_100837017
1109 Ga0070701_10195924
1110 Ga0070700_100010950
1111 Ga0070700_100280319
1112 Ga0070700_100577515
1113 Ga0070694_100129554
1114 Ga0070708_100620020
1115 Ga0070663_100019412
1116 Ga0070663_100321602
1117 Ga0070678_100056590
1118 Ga0070678_100068026
1119 Ga0070678_100227551
1120 Ga0070681_10008396
1121 Ga0070681_10024676
1122 Ga0070681_10042169
1123 Ga0068867_100017763
1124 Ga0068867_100019000
1125 Ga0068867_100023075
1126 Ga0068867_100075165
1127 Ga0068867_100117576
1128 Ga0068867_100133111
1129 Ga0068867_100451034
1130 Ga0068867_100517768
1131 Ga0068867_100688958
1132 Ga0068867_101344111
1133 Ga0070685_10020796
1134 Ga0070685_10078569
1135 Ga0070685_10093120
1136 Ga0070685_10150879
1137 Ga0070685_10285159
1138 Ga0070698_100000661
1139 Ga0070698_100005764
1140 Ga0070679_100018252
1141 Ga0070679_100155055
1142 Ga0070684_100001895
1143 Ga0070684_100803610
1144 Ga0068853_100008728
1145 Ga0068853_100014820
1146 Ga0068853_100088156
1147 Ga0068853_100239648
1148 Ga0068853_100360163
1149 Ga0068853_100626989
1150 Ga0068853_101435349
1151 Ga0070672_100023427
1152 Ga0070672_100025969
1153 Ga0070672_100047689
1154 Ga0070672_100054432
1155 Ga0070672_100242480
1156 Ga0070672_100263024
1157 Ga0070672_100313140
1158 Ga0070672_100314732
1159 Ga0070672_100475207
1160 Ga0070672_100509640
1161 Ga0070672_100961930
1162 Ga0070686_100019526
1163 Ga0070686_100361632
1164 Ga0070696_100133873
1165 Ga0070693_100008596
1166 Ga0070665_100000008
1167 Ga0070665_100019926
1168 Ga0070665_100890085
1169 Ga0068855_100001250
1170 Ga0068855_100001274
1171 Ga0068855_100025826
1172 Ga0068855_100091452
1173 Ga0068855_100139770
1174 Ga0068855_100644205
1175 Ga0070664_100108824
1176 Ga0070664_100124998
1177 Ga0070664_100138162
1178 Ga0068857_100151517
1179 Ga0068857_100281164
1180 Ga0068857_100523938
1181 Ga0068857_100747755
1182 Ga0068854_100014234
1183 Ga0068854_100014439
1184 Ga0068854_100193632
1185 Ga0068854_100201852
1186 Ga0068854_100416099
1187 Ga0068854_100454151
1188 Ga0068856_100093229
1189 Ga0068856_100379535
1190 Ga0070702_100022492
1191 Ga0070702_100216324
1192 Ga0068852_100000180
1193 Ga0068852_100001996
1194 Ga0068852_100303661
1195 Ga0068852_101335593
1196 Ga0068859_100000007
1197 Ga0068859_100001403
1198 Ga0068859_100029222
1199 Ga0068859_100083124
1200 Ga0068859_100093110
1201 Ga0068859_100384798
1202 Ga0068859_100614679
1203 Ga0068859_100780385
1204 Ga0068864_100001316
1205 Ga0068864_100145703
1206 Ga0068864_101165821
1207 Ga0068866_10103285
1208 Ga0068861_100080332
1209 Ga0068861_100964043
1210 Ga0068851_10070919
1211 Ga0068851_10090465
1212 Ga0068851_10321220
1213 Ga0068870_10025539
1214 Ga0068870_10197145
1215 Ga0068863_100000444
1216 Ga0068863_100007099
1217 Ga0068863_100024194
1218 Ga0068863_100215718
1219 Ga0068863_100226590
1220 Ga0068863_100306485
1221 Ga0068863_100503435
1222 Ga0068863_100650341
1223 Ga0068863_101267734
1224 Ga0068863_101291900
1225 Ga0068858_100000829
1226 Ga0068858_100351746
1227 Ga0068858_100482081
1228 Ga0068858_100530908
1229 Ga0068858_100822543
1230 Ga0068860_100000029
1231 Ga0068860_100005394
1232 Ga0068860_100010234
1233 Ga0068860_100024948
1234 Ga0068860_100061290
1235 Ga0068860_100121471
1236 Ga0068860_100130163
1237 Ga0068860_100351346
1238 Ga0068862_100236663
1239 Ga0081540_1074941
1240 Ga0075366_10007240
1241 Ga0075366_10209743
1242 Ga0075366_10313920
1243 Ga0097621_100000711
1244 Ga0097621_100012629
1245 Ga0097621_100077083
1246 Ga0097621_100092526
1247 Ga0097621_100126956
1248 Ga0097621_100158266
1249 Ga0097621_100428706
1250 Ga0097621_100627510
1251 Ga0097621_100840136
1252 Ga0075370_10159619
1253 Ga0068871_100000351
1254 Ga0068871_100018089
1255 Ga0068871_100020023
1256 Ga0068871_100075432
1257 Ga0068871_100165258
1258 Ga0068871_100414105
1259 Ga0068871_100614016
1260 Ga0068871_100643525
1261 Ga0068871_101066465
1262 Ga0075428_100025171
1263 Ga0075428_100059396
1264 Ga0075430_100021698
1265 Ga0075430_100030675
1266 Ga0075433_10519812
1267 Ga0075429_100005315
1268 Ga0075429_100081239
1269 Ga0068865_100020694
1270 Ga0068865_100186132
1271 Ga0068865_100316585
1272 Ga0068865_100516213
1273 Ga0097620_100000007
1274 Ga0097620_100001403
1275 Ga0097620_100029222
1276 Ga0097620_100083124
1277 Ga0097620_100093114
1278 Ga0097620_100384790
1279 Ga0097620_100614642
1280 Ga0097620_100780398
1281 Ga0097620_101262741
1282 Ga0105240_10001800
1283 Ga0105240_10003960
1284 Ga0105240_10003982
1285 Ga0105240_10008182
1286 Ga0105240_10010900
1287 Ga0105240_10050422
1288 Ga0105240_10099692
1289 Ga0105240_10117609
1290 Ga0105240_10791516
1291 Ga0111539_10125769
1292 Ga0105247_10001984
1293 Ga0105247_10165240
1294 Ga0105247_10262399
1295 Ga0114129_10153798
1296 Ga0114129_10208548
1297 Ga0105243_10387332
1298 Ga0105243_10459542
1299 Ga0105243_10520306
1300 Ga0105241_10000206
1301 Ga0105241_10001098
1302 Ga0105241_10142957
1303 Ga0105241_10275092
1304 Ga0105241_10515071
1305 Ga0105242_10030077
1306 Ga0105242_10162697
1307 Ga0105242_10350443
1308 Ga0105242_10382148
1309 Ga0105242_10936432
1310 Ga0105248_10046848
1311 Ga0105248_10241525
1312 Ga0105248_10417121
1313 Ga0105248_10790839
1314 Ga0105237_10000780
1315 Ga0105237_10003152
1316 Ga0105237_10009612
1317 Ga0105237_10012022
1318 Ga0105237_10013020
1319 Ga0105237_10026858
1320 Ga0105237_10080975
1321 Ga0105237_10135210
1322 Ga0105237_10200736
1323 Ga0105237_10346499
1324 Ga0105237_11104143
1325 Ga0105238_10032669
1326 Ga0105238_10037294
1327 Ga0105238_10045389
1328 Ga0105238_10056683
1329 Ga0105238_10291713
1330 Ga0105249_10008328
1331 Ga0105249_10009665
1332 Ga0105249_10042329
1333 Ga0105249_10197991
1334 Ga0105249_10497010
1335 Ga0105249_10598379
1336 Ga0105239_10000135
1337 Ga0105239_10000337
1338 Ga0105239_10007270
1339 Ga0105239_10009606
1340 Ga0105239_10011821
1341 Ga0105239_10066192
1342 Ga0105239_10224526
1343 Ga0105239_10237019
1344 Ga0105239_10278360
1345 Ga0105239_10390573
1346 Ga0105239_10701481
1347 Ga0105246_10432029
1348 Ga0157373_10048519
1349 Ga0157373_10171891
1350 Ga0157373_10588544
1351 Ga0157371_10036310
1352 Ga0157371_10069202
1353 Ga0157371_10072834
1354 Ga0157371_10095188
1355 Ga0157371_10107422
1356 Ga0157371_10172210
1357 Ga0157371_10524499
1358 Ga0157370_10000426
1359 Ga0157370_10004831
1360 Ga0157370_10029393
1361 Ga0157370_10030890
1362 Ga0157370_10150085
1363 Ga0157370_10219831
1364 Ga0157370_10620046
1365 Ga0157370_10981652
1366 Ga0157369_10014091
1367 Ga0157369_10019728
1368 Ga0157369_10040395
1369 Ga0157369_10044422
1370 Ga0157369_10061816
1371 Ga0157369_10178489
1372 Ga0157369_10224634
1373 Ga0157369_10252953
1374 Ga0157369_10628330
1375 Ga0157369_10780015
1376 Ga0157374_10000009
1377 Ga0157374_10045471
1378 Ga0157374_10067126
1379 Ga0157374_10087081
1380 Ga0157374_10213072
1381 Ga0157374_10360574
1382 Ga0157374_10480758
1383 Ga0157378_10000837
1384 Ga0157378_10002924
1385 Ga0157378_10025999
1386 Ga0157378_11033314
1387 Ga0163162_10000795
1388 Ga0163162_10000833
1389 Ga0163162_10008664
1390 Ga0163162_10041885
1391 Ga0163162_10050448
1392 Ga0163162_10069707
1393 Ga0163162_10453531
1394 Ga0163162_10924282
1395 Ga0163162_12497444
1396 Ga0157372_10000258
1397 Ga0157372_10002260
1398 Ga0157372_10002978
1399 Ga0157372_10011005
1400 Ga0157372_10023612
1401 Ga0157372_10051584
1402 Ga0157372_10073608
1403 Ga0157372_10092182
1404 Ga0157372_10144797
1405 Ga0157372_10147167
1406 Ga0157372_10201517
1407 Ga0157372_10239550
1408 Ga0157372_10305136
1409 Ga0157372_10388125
1410 Ga0157372_10482550
1411 Ga0157372_10714512
1412 Ga0157372_10777371
1413 Ga0157372_10902539
1414 Ga0157375_10000073
1415 Ga0157375_10020587
1416 Ga0157375_10057461
1417 Ga0157375_10131910
1418 Ga0157375_10243220
1419 Ga0157375_10322028
1420 Ga0157375_10748546
1421 Ga0157375_10759834
1422 Ga0157375_10789262
1423 Ga0163163_10052456
1424 Ga0163163_10166806
1425 Ga0163163_10308727
1426 Ga0163163_10396844
1427 Ga0163163_11112991
1428 Ga0163163_11144436
1429 Ga0163163_11808531
1430 Ga0157380_10030099
1431 Ga0157380_10053087
1432 Ga0157380_10357361
1433 Ga0157380_10437181
1434 Ga0157380_10809469
1435 Ga0157377_10044754
1436 Ga0157377_10137773
1437 Ga0157379_10070073
1438 Ga0157379_10119948
1439 Ga0157379_10185442
1440 Ga0157379_10186973
1441 Ga0157379_10213085
1442 Ga0157379_10356112
1443 Ga0157379_10778880
1444 Ga0157379_11162181
1445 Ga0157376_10001803
1446 Ga0157376_10001988
1447 Ga0157376_10006687
1448 Ga0157376_10144472
1449 Ga0157376_10282659
1450 Ga0157376_10378279
1451 Ga0182005_1000081
1452 Ga0163161_10019399
1453 Ga0163161_10358962
1454 Ga0209436_100566
1455 Ga0209436_102659
1456 Ga0209258_100041
1457 Ga0207425_1015563
1458 Ga0209646_1000002
1459 Ga0209026_1000233
1460 Ga0209148_1000090
1461 Ga0207666_1004090
1462 Ga0209673_1000034
1463 Ga0209130_1001027
1464 Ga0209564_1040205
1465 Ga0209564_1043670
1466 Ga0209758_1000419
1467 Ga0209758_1061714
1468 Ga0209050_1000353
1469 Ga0207426_1000002
1470 Ga0207426_1000177
1471 Ga0207426_1000324
1472 Ga0207426_1000592
1473 Ga0209257_1000001
1474 Ga0209257_1002086
1475 Ga0207656_10046417
1476 Ga0207656_10064710
1477 Ga0207656_10405269
1478 Ga0207682_10038675
1479 Ga0207682_10069708
1480 Ga0207682_10086730
1481 Ga0207682_10109391
1482 Ga0207642_10040607
1483 Ga0207710_10001075
1484 Ga0207688_10033901
1485 Ga0207688_10165903
1486 Ga0207680_10000067
1487 Ga0207680_10063588
1488 Ga0207680_10348173
1489 Ga0207647_10000962
1490 Ga0207647_10005595
1491 Ga0207647_10070519
1492 Ga0207647_10395305
1493 Ga0207645_10001205
1494 Ga0207645_10022729
1495 Ga0207645_10123146
1496 Ga0207645_10412634
1497 Ga0207645_10655112
1498 Ga0207643_10038079
1499 Ga0207643_10133312
1500 Ga0207643_10332560
1501 Ga0207705_10001654
1502 Ga0207705_10087634
1503 Ga0207705_10598273
1504 Ga0207654_10000661
1505 Ga0207654_10000842
1506 Ga0207654_10045682
1507 Ga0207654_10061375
1508 Ga0207654_10269864
1509 Ga0207707_10000111
1510 Ga0207707_10046161
1511 Ga0207707_10252456
1512 Ga0207707_10842167
1513 Ga0207695_10000051
1514 Ga0207695_10000445
1515 Ga0207695_10003973
1516 Ga0207695_10008615
1517 Ga0207695_10033063
1518 Ga0207695_10034499
1519 Ga0207695_10035604
1520 Ga0207695_10037199
1521 Ga0207695_10041787
1522 Ga0207671_10001466
1523 Ga0207671_10001776
1524 Ga0207671_10001778
1525 Ga0207671_10009206
1526 Ga0207671_10047175
1527 Ga0207671_10062520
1528 Ga0207671_10066698
1529 Ga0207671_10210864
1530 Ga0207671_10297693
1531 Ga0207671_10708656
1532 Ga0207663_10272622
1533 Ga0207660_10001012
1534 Ga0207660_10008720
1535 Ga0207662_10007855
1536 Ga0207657_10056435
1537 Ga0207657_10142361
1538 Ga0207657_10527838
1539 Ga0207649_10494043
1540 Ga0207649_10611983
1541 Ga0207649_10708614
1542 Ga0207652_10000538
1543 Ga0207652_10000960
1544 Ga0207681_10009782
1545 Ga0207681_10100892
1546 Ga0207681_10284840
1547 Ga0207694_10019774
1548 Ga0207694_10166674
1549 Ga0207694_10177615
1550 Ga0207694_10208658
1551 Ga0207650_10122178
1552 Ga0207650_10487853
1553 Ga0207650_10523741
1554 Ga0207659_10050963
1555 Ga0207659_10181728
1556 Ga0207659_10305760
1557 Ga0207659_10337561
1558 Ga0207659_10954483
1559 Ga0207700_10666820
1560 Ga0207644_10024795
1561 Ga0207644_10344197
1562 Ga0207644_10451404
1563 Ga0207644_10453883
1564 Ga0207690_10014400
1565 Ga0207690_10581579
1566 Ga0207686_10000715
1567 Ga0207686_10017723
1568 Ga0207709_10425454
1569 Ga0207709_10516807
1570 Ga0207670_10114999
1571 Ga0207670_10335349
1572 Ga0207670_10480635
1573 Ga0207669_10532252
1574 Ga0207669_10801201
1575 Ga0207704_10008049
1576 Ga0207704_10011913
1577 Ga0207704_10354387
1578 Ga0207691_10004949
1579 Ga0207691_10022643
1580 Ga0207691_10062073
1581 Ga0207691_10087508
1582 Ga0207691_10445948
1583 Ga0207691_10451683
1584 Ga0207691_10893658
1585 Ga0207711_10035102
1586 Ga0207711_10428060
1587 Ga0207689_10002959
1588 Ga0207689_10005262
1589 Ga0207689_10021377
1590 Ga0207689_10049862
1591 Ga0207689_10074987
1592 Ga0207689_10137046
1593 Ga0207689_10501790
1594 Ga0207661_10048009
1595 Ga0207661_10563327
1596 Ga0207667_10000100
1597 Ga0207667_10004308
1598 Ga0207667_10010209
1599 Ga0207667_10080669
1600 Ga0207667_11044148
1601 Ga0207651_10040147
1602 Ga0207651_10145062
1603 Ga0207651_10276251
1604 Ga0207651_10551469
1605 Ga0207651_10679689
1606 Ga0207712_10001156
1607 Ga0207712_10024733
1608 Ga0207712_10066027
1609 Ga0207712_10125385
1610 Ga0207712_10455434
1611 Ga0207712_10536775
1612 Ga0207712_11091321
1613 Ga0207668_10026438
1614 Ga0207668_10151729
1615 Ga0207668_10156325
1616 Ga0207640_10027653
1617 Ga0207640_10033995
1618 Ga0207640_10059835
1619 Ga0207640_10108050
1620 Ga0207640_10130167
1621 Ga0207640_10204918
1622 Ga0207658_10005017
1623 Ga0207658_10115803
1624 Ga0207658_10206859
1625 Ga0207658_10592578
1626 Ga0207658_11129000
1627 Ga0207677_10005993
1628 Ga0207677_10056615
1629 Ga0207677_10081379
1630 Ga0207677_10188221
1631 Ga0207677_10403403
1632 Ga0207703_10017680
1633 Ga0207703_10116123
1634 Ga0207703_10395002
1635 Ga0207703_10423639
1636 Ga0207639_10070159
1637 Ga0207639_10073596
1638 Ga0207639_10249225
1639 Ga0207639_10293226
1640 Ga0207639_10522781
1641 Ga0207639_10814362
1642 Ga0207678_10025947
1643 Ga0207678_10145829
1644 Ga0207678_10195723
1645 Ga0207708_10193239
1646 Ga0207708_10560726
1647 Ga0207702_10068314
1648 Ga0207702_10075567
1649 Ga0207702_10241282
1650 Ga0207641_10000090
1651 Ga0207641_10000213
1652 Ga0207641_10008579
1653 Ga0207641_10018040
1654 Ga0207641_10175968
1655 Ga0207648_10000653
1656 Ga0207648_10029361
1657 Ga0207648_10039157
1658 Ga0207648_10129072
1659 Ga0207648_10304164
1660 Ga0207648_10377254
1661 Ga0207648_10430457
1662 Ga0207676_10547419
1663 Ga0207676_11347755
1664 Ga0207674_10003443
1665 Ga0207674_10060763
1666 Ga0207674_10065745
1667 Ga0207674_10165009
1668 Ga0207675_100007715
1669 Ga0207675_100008836
1670 Ga0207675_100081577
1671 Ga0207675_100120696
1672 Ga0207675_100172010
1673 Ga0207675_100288819
1674 Ga0207675_100879105
1675 Ga0207675_101038578
1676 Ga0207683_10048943
1677 Ga0207683_10076782
1678 Ga0207683_10093220
1679 Ga0207683_10269701
1680 Ga0207683_10326373
1681 Ga0207698_10000108
1682 Ga0207698_10011126
1683 Ga0207698_10373847
1684 Ga0268266_10000016
1685 Ga0268266_10295182
1686 Ga0268265_10060552
1687 Ga0268265_10166956
1688 Ga0268264_10000072
1689 Ga0268264_10002720
1690 Ga0268264_10007598
1691 Ga0268264_10033282
1692 Ga0268264_10063504
1693 Ga0268264_10065820
1694 Ga0268264_10102717
1695 Ga0268264_10157870
1696 Ga0268264_10487970
1697 Ga0268264_10603980
1698 Ga0265336_10120897
1699 Ga0307517_10000697
1700 Ga0307515_10000078
1701 Ga0307511_10001896
1702 Ga0265325_10249205
1703 Ga0265327_10045037
1704 Ga0307509_10036817
1705 Ga0307509_10123147
1706 Ga0265313_10153091
1707 Ga0307508_10266838
1708 Ga0307508_10346038
1709 Ga0307516_10265817
1710 Ga0307413_10292765
1711 Ga0307413_10356087
1712 Ga0307410_10490665
1713 Ga0307406_10642526
1714 Ga0307407_10388672
1715 Ga0307412_10466060
1716 Ga0307416_100672015
1717 Ga0307414_10374474
1718 Ga0307414_10870488
1719 Ga0307411_10050097
1720 Ga0307411_11275172
1721 Ga0307415_100132561
1722 Ga0307510_10001712
1723 Ga0307510_10362291
1724 Ga0373955_0241292
1725 Ga0373927_0100179
1726 Ga0373933_0136478
1727 Ga0373937_0139076
1728 Ga0373937_0459222
1729 Ga0395899_0014889
1730 Ga0395900_0016890
1731 Ga0395900_0182795
1732 Ga0395900_0525978
1733 Ga0395900_0550511
1734 Ga0395898_0112161
1735 Ga0395905_0001861
1736 Ga0395905_0065531
1737 Ga0395901_0089556
1738 Ga0395901_0103349
1739 Ga0436365_0289942
1740 Ga0439436_0006955
1741 Ga0439436_0048147
1742 Ga0439439_0005738
1743 Ga0439439_0051855
1744 Ga0451787_202726
1745 Ga0451802_1082803
1746 Ga0451804_0420865
1747 Ga0451807_2236118
1748 Ga0451849_0258145
1749 Ga0451853_0569222
1750 Ga0451853_1768614
1751 Ga0451853_3831587
1752 Ga0439431_0017465
1753 Ga0439449_0004710
1754 Ga0439449_0138673
1755 Ga0439449_0185269
1756 Ga0439457_009584
1757 Ga0439457_023623
1758 Ga0439457_037992
1759 Ga0439457_091971
1760 Ga0439462_0011206
1761 Ga0450923_006726
1762 Ga0451577_0025828
1763 Ga0466969_0000754
1764 Ga0466972_0004958
1765 Ga0466972_0008365
1766 Ga0466966_0000030
1767 Ga0466966_0346352
1768 Ga0466961_0134492
1769 Ga0466971_0009829
1770 Ga0466971_0053325
1771 Ga0466971_0078081
1772 Ga0466968_0080577
1773 Ga0466968_0081931
1774 Ga0466968_0193259
1775 Ga0466968_0458851
1776 Ga0466957_0009182
1777 Ga0466957_0011478
1778 Ga0466957_0111966
1779 Ga0466960_0406241
1780 Ga0466959_0000269
1781 Ga0466959_0002150
1782 Ga0466959_0045485
1783 Ga0466958_0110840
1784 Ga0495627_013864
1785 Ga0495638_0017086
1786 Ga0495638_0154815
1787 Ga0495651_0130068
1788 Ga0495650_0115811
1789 Ga0495580_0038332
1790 Ga0495580_0112467
1791 Ga0495582_0088992
1792 Ga0495664_0341061
1793 Ga0495606_0004456
1794 Ga0495630_0247352
1795 Ga0495630_0252397
1796 Ga0495632_0157321
1797 Ga0495648_0011969
1798 Ga0495665_0187618
1799 Ga0495586_0145441
1800 Ga0495587_0260229
1801 Ga0495621_0015348
1802 Ga0495622_0374054
1803 Ga0495633_0000175
1804 Ga0495668_0000108
1805 Ga0495668_0005589
1806 Ga0495634_0115218
1807 Ga0495611_0000011
1808 Ga0495611_0104811
1809 Ga0495625_0475451
1810 Ga0495623_0264615
1811 Ga0495647_0237843
1812 Ga0495658_0042870
1813 Ga0495624_0610335
1814 Ga0495670_0309935
1815 Ga0495604_0220578
1816 Ga0495672_0014438
1817 Ga0495672_0041053
1818 Ga0495676_0262431
1819 Ga0495676_0387687
1820 Ga0495687_000004
1821 Ga0495677_0194934
1822 Ga0495686_0000165
1823 Ga0496101_0546953
1824 Ga0496105_0099960
1825 Ga0496115_0132318
1826 Ga0496115_0906618
1827 Ga0496118_0278248
1828 Ga0496121_0000030
1829 Ga0496126_0047240
1830 Ga0496126_1017685
1831 Ga0501298_000289
1832 Ga0501299_032352
1833 Ga0501031_0142009
1834 Ga0501032_0761224
1835 Ga0501034_0305168
1836 Ga0501034_0455430
1837 Ga0501034_0710319
1838 Ga0501036_0003520
1839 Ga0501037_0008893
1840 Ga0501037_0214124
1841 Ga0501038_0009081
1842 Ga0501038_0655038
1843 Ga0501039_0011833
1844 Ga0501039_0600173
1845 Ga0501043_0018866
1846 Ga0501046_0026580
1847 Ga0501047_0030087
1848 Ga0501047_0687940
1849 Ga0501048_0079968
1850 Ga0501067_0149864
1851 Ga0501068_0028446
1852 Ga0501070_0057509
1853 Ga0501071_0107006
1854 Ga0501073_0054158
1855 Ga0501073_0736801
1856 Ga0501074_0024502
1857 Ga0501198_021314
1858 Ga0501201_021143
1859 Ga0501202_000865
1860 Ga0501202_006743
1861 Ga0501202_051768
1862 Ga0501207_002781
1863 Ga0501207_021214
1864 Ga0501208_008248
1865 Ga0501217_002224
1866 Ga0501217_032587
1867 Ga0501222_000982
1868 Ga0501223_000157
1869 Ga0501224_000664
1870 Ga0501228_010121
1871 Ga0501233_000669
1872 Ga0501235_000828
1873 Ga0501240_002622
1874 Ga0501242_005934
1875 Ga0501243_000215
1876 Ga0501250_006524
1877 Ga0501250_007292
1878 Ga0501252_000578
1879 Ga0501253_000895
1880 Ga0501257_004810
1881 Ga0501259_000181
1882 Ga0501259_002966
1883 Ga0501259_071355
1884 Ga0501261_005649
1885 Ga0501261_050559
1886 Ga0501219_000812
1887 Ga0501221_000080
1888 Ga0501225_0001083
1889 Ga0501225_0002530
1890 Ga0501225_0007474
1891 Ga0501234_000581
1892 Ga0501245_000311
1893 Ga0501245_003557
1894 Ga0501079_0076381
1895 Ga0501080_0039984
1896 Ga0501080_0513414
1897 Ga0501083_0174751
1898 Ga0501232_010289
1899 Ga0501241_001105
1900 Ga0501241_004302
1901 Ga0501241_043990
1902 Ga0501266_005705
1903 Ga0501268_052523
1904 Ga0501269_013559
1905 Ga0501271_012917
1906 Ga0501278_009862
1907 Ga0501044_0006136
1908 Ga0501044_0019334
1909 Ga0501044_0038980
1910 Ga0501044_0099172
1911 Ga0501044_0398168
1912 Ga0501044_0512092
1913 Ga0501045_0375742
1914 Ga0501212_036903
1915 Ga0501284_00105
1916 nmdc:mga0k408_11997_c1
1917 nmdc:mga0k408_162047_c1
1918 nmdc:mga0k408_40690_c1
1919 nmdc:mga05p37_1130996_c1
1920 nmdc:mga05p37_194882_c1
1921 nmdc:mga09592_12177_c1
1922 nmdc:mga09592_14034_c1
1923 nmdc:mga09592_553442_c1
1924 nmdc:mga0qj67_51192_c1
1925 nmdc:mga0qj67_61545_c1
1926 nmdc:mga08y16_260978_c1
1927 nmdc:mga0a205_923055_c1
1928 Ga0495619_0125939
1929 Ga0500578_0000120
1930 Ga0500644_0129574
1931 Ga0500644_0230791
1932 Ga0500646_0010270
1933 Ga0500583_0000120
1934 Ga0500583_0006739
1935 Ga0500583_0012437
1936 Ga0500583_0064385
1937 Ga0500651_0047942
1938 Ga0500651_0438006
1939 Ga0500651_0467566
1940 Ga0500650_0078790
1941 Ga0500556_0124325
1942 Ga0500569_000517
1943 Ga0500594_0053167
1944 Ga0500594_0147661
1945 Ga0500642_0003619
1946 Ga0500642_0074754
1947 Ga0500652_006848
1948 Ga0500652_083867
1949 Ga0500655_013508
1950 Ga0500655_016309
1951 Ga0500559_0003554
1952 Ga0500568_0083274
1953 Ga0500568_0175869
1954 Ga0500573_0126264
1955 Ga0500573_0171265
1956 Ga0500577_0005167
1957 Ga0500579_145570
1958 Ga0500589_053266
1959 Ga0500604_0002303
1960 Ga0500616_0003236
1961 Ga0500616_0004758
1962 Ga0500616_0025280
1963 Ga0500622_0001475
1964 Ga0500622_0002131
1965 Ga0500627_0194614
1966 Ga0500633_0043943
1967 Ga0500634_0090702
1968 Ga0500636_0007397
1969 Ga0500611_067885
1970 Ga0500661_016479
1971 Ga0500661_034890
1972 Ga0501082_0099557
1973 Ga0466962_0004595
1974 2738731491
1975 2819573238
1976 2819681930
1977 2821136658
1978 2881958640
1979 2884795977
1980 2904468597
1981 2929178514
1982 2929240847
1983 2929922888
1984 2945980915
1985 2946019684
1986 8003154714

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00265

TK

Thymidine kinase

43

215

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpo-assembly1.cif.gz_D thermotoga maritima thymidine kinase in the apo form 0.8788 13 189
2qpo-assembly1.cif.gz_D thermotoga maritima thymidine kinase in the apo form 0.8678 13 189
2orw-assembly1.cif.gz_A-2 thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a 0.8596 13 189
1w4r-assembly2.cif.gz_E structure of a type ii thymidine kinase with bound dttp 0.8579 12 186
1xbt-assembly2.cif.gz_H crystal structure of human thymidine kinase 1 0.8565 12 186
ID Description Score Start End Superfamily
2wvjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9618 12 145 3.40.50.300
2wvjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.954 12 145 3.40.50.300
af_P27158_18_121_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9491 12 117 3.40.50.300
af_P27158_18_121_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9404 12 117 3.40.50.300
2qpoC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9335 13 144 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Y2T0V1-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9644 11 150 GO:0004797
GO:0005524
GO:0046104
GO:0071897
AF-X1JNW3-F1-model_v4 thymidine kinase (EC 2.7.1.21) 0.9565 29 140 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A2M8KSR6-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9497 12 145 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-K1V128-F1-model_v4 thymidine kinase (EC 2.7.1.21) 0.9456 5 158 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A357HGB1-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9435 8 157 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897

Map