F487700

General Info

Members Datasets Scaffolds Average Seq Length
993 532 835 255

Family's Representative Sequence

Representative Sequence 3300049129|Ga0501309_000486|Ga0501309_000486_77_973
Length 298
Sequence VDAVTWRVTDDSRSDEEAIAAHGLRTPHRQWPSSYVHHVKEAGSPMTTTKAQKSNDGKASGRFLLKLSGEAFAGGGSLGVDPDVVHKIAREIAAVVRDGAEIAVVIGGGNFFRGAELQVRGMDRARSDYMGMLGTVMNCLALQDFLEKEGIDSRVQTAITMGQVAEPYIPLRAVRHLEKGRVVIFGAGMGMPYFSTDTTAAQRALEIDAEALLMGKNGVDGVYDSDPKTNPEAVKFDALGYGEVITRDLKVADMTAITLCRDNKLPILVFELLVEGNIARAVKGEKIGTLVSDQGTRA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
5 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
6 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
7 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
8 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
9 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
10 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
11 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
12 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
13 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
14 2643221548 Streptomyces sp. Root55 Isolate Unclassified
15 2643221578 Streptomyces sp. Root63 Isolate Unclassified
16 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
17 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
18 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
19 2643221647 Streptomyces sp. Root369 Isolate Unclassified
20 2643221670 Streptomyces sp. Root431 Isolate Unclassified
21 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
22 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
23 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
24 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
25 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
26 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
27 2643221714 Streptomyces sp. Root264 Isolate Unclassified
28 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
29 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
30 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
31 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
32 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
33 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
34 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
35 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
36 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
37 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
38 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
39 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
40 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
41 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
42 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
43 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
44 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
45 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
46 2808606394 Promicromonospora sp. C35 Isolate Unclassified
47 2808606448 Streptomyces sp. 193411 Isolate Unclassified
48 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
49 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
50 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
51 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
52 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
53 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
54 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
55 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
56 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
57 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
58 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
59 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
60 2855683550 Micromonospora sp. RP3T Isolate Unclassified
61 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
62 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
63 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
64 2858868258 Micromonospora sp. MH33 Isolate Unclassified
65 2858882152 Micromonospora noduli MED15 Isolate Nodule
66 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
67 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
68 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
69 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
70 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
71 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
72 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
73 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
74 2862574272 Streptomyces sp. AcE210 Isolate Nodule
75 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
76 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
77 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
78 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
79 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
80 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
81 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
82 2867369537 Streptomyces sp. Z26 Isolate Unclassified
83 2867428634 Streptomyces sp. RP5T Isolate Unclassified
84 2867475112 Streptomyces sp. TM32 Isolate Unclassified
85 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
86 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
87 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
88 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
89 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
90 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
91 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
92 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
93 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
94 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
95 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
96 2902582711 Micromonospora sp. AP08 Isolate Unclassified
97 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
98 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
99 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
100 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
101 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
102 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
103 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
104 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
105 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
106 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
107 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
108 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
109 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
110 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
111 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
112 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
113 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
114 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
115 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
116 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
117 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
118 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
119 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
120 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
121 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
122 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
123 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
124 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
125 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
126 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
127 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
128 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
129 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
130 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
131 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
132 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
133 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
134 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
135 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
136 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
137 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
138 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
139 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
140 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
141 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
142 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
143 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
144 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
145 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
146 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
147 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
148 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
149 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
150 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
151 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
152 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
153 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
154 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
155 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
156 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
157 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
158 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
159 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
160 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
161 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
162 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
163 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
164 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
165 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
166 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
167 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
168 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
169 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
170 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
171 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
172 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
173 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
174 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
175 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
176 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
177 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
178 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
179 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
180 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
181 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
182 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
183 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
184 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
185 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
186 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
187 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
188 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
189 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
190 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
191 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
192 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
193 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
195 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
196 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
197 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
198 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
199 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
200 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
201 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
202 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
203 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
204 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
205 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
206 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
207 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
208 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
209 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
247 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
248 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
251 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
252 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
253 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
254 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
255 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
258 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
259 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
271 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
272 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
282 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
283 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
284 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
285 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
289 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
290 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
291 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
292 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
293 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
294 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
295 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
296 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
297 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
298 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
299 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
300 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
301 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
302 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
303 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
304 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
305 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
306 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
307 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
308 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
309 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
310 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
311 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
312 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
313 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
314 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
315 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
316 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
317 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
318 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
321 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
322 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
323 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
324 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
325 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
326 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
327 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
328 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
329 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
330 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
331 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
332 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
333 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
334 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
335 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
336 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
337 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
338 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
339 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
340 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
341 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
342 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
343 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
344 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
345 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
349 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
350 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
351 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
352 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
353 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
354 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
355 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
356 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
357 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
358 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
359 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
360 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
361 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
362 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
363 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
364 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
365 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
373 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
374 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
375 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
376 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
377 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
378 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
379 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
380 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
381 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
382 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
383 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
384 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
385 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
388 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
391 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
392 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
393 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
394 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
395 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
396 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
397 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
398 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
399 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
400 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
401 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
402 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
403 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
404 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
405 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
406 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
407 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
408 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
409 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
413 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
414 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
415 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
416 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
417 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
418 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
422 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
423 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
424 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
430 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
448 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
449 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
450 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
451 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
452 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
453 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
454 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
455 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
456 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
457 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
458 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
459 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
460 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
461 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
462 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
463 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
464 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
467 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
468 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
469 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
472 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
473 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
474 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
475 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
476 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
477 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
478 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
479 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
480 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
481 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
482 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
483 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
484 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
485 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
486 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
487 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
488 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
489 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
490 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
491 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
492 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
493 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
494 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
495 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
496 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
497 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
498 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
499 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
500 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
501 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
502 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
505 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
506 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
507 649633069 Micromonospora sp. L5 Isolate Unclassified
508 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
509 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
510 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
511 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
512 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
513 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
514 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
515 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
516 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
517 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
518 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
519 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
520 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
521 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
522 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
523 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
524 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
525 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
526 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
527 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
528 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
529 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
530 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
531 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
532 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.08
Metatranscriptomes 1.01
Isolates 15.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0.91
Rhizoplane 1.91
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 14.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1008627 3300000549 Bacteria 1237
2 JGI24739J22299_10012724 3300001989 Bacteria 3085
3 JGI24737J22298_10015604 3300001990 Bacteria 2458
4 JGI24033J26618_1002865 3300002155 Bacteria 1791
5 JGI25406J46586_10020172 3300003203 Bacteria 2701
6 JGI25153J46596_10036081 3300003215 Bacteria 1591
7 JGI25160J50197_1032677 3300003354 Bacteria 1319
8 Ga0070683_100181510 3300005329 Bacteria 1998
9 Ga0070683_100264882 3300005329 Bacteria 1635
10 Ga0070683_100294495 3300005329 Bacteria 1543
11 Ga0070680_100118493 3300005336 Bacteria 2208
12 Ga0070661_100175893 3300005344 Bacteria 1627
13 Ga0070692_10040530 3300005345 Bacteria 2382
14 Ga0070668_100358606 3300005347 Bacteria 1236
15 Ga0070668_100496493 3300005347 Bacteria 1056
16 Ga0070673_100395436 3300005364 Bacteria 1235
17 Ga0070667_100259542 3300005367 Bacteria 1555
18 Ga0070709_10427343 3300005434 Bacteria 994
19 Ga0070714_100525509 3300005435 Bacteria 1131
20 Ga0070710_10047395 3300005437 Bacteria 2397
21 Ga0070701_10032590 3300005438 Bacteria 2597
22 Ga0070705_100070253 3300005440 Bacteria 2114
23 Ga0070705_100110886 3300005440 Bacteria 1753
24 Ga0070700_100114999 3300005441 Bacteria 1794
25 Ga0070663_100284069 3300005455 Bacteria 1320
26 Ga0070678_100028635 3300005456 Bacteria 3803
27 Ga0068867_100223156 3300005459 Bacteria 1520
28 Ga0070685_10148396 3300005466 Bacteria 1484
29 Ga0070684_100514227 3300005535 Bacteria 1109
30 Ga0070696_100136822 3300005546 Bacteria 1786
31 Ga0070693_100327398 3300005547 Bacteria 1041
32 Ga0070704_100248071 3300005549 Bacteria 1461
33 Ga0068855_100284016 3300005563 Bacteria 1837
34 Ga0068857_100004499 3300005577 Bacteria 11782
35 Ga0068857_100247785 3300005577 Bacteria 1633
36 Ga0068854_100038111 3300005578 Bacteria 3379
37 Ga0068854_100325524 3300005578 Bacteria 1251
38 Ga0068854_100523217 3300005578 Bacteria 1002
39 Ga0068856_100274909 3300005614 Bacteria 1701
40 Ga0068856_100716689 3300005614 Bacteria 1021
41 Ga0070702_100000206 3300005615 Bacteria 19426
42 Ga0068852_100137531 3300005616 Bacteria 2257
43 Ga0068852_100543192 3300005616 Bacteria 1162
44 Ga0068859_100019694 3300005617 Bacteria 6777
45 Ga0068859_100042613 3300005617 Bacteria 4560
46 Ga0068864_100144856 3300005618 Bacteria 2147
47 Ga0068866_10103594 3300005718 Bacteria 1574
48 Ga0068870_10016569 3300005840 Bacteria 3525
49 Ga0068863_100209541 3300005841 Bacteria 1877
50 Ga0068858_100006333 3300005842 Bacteria 11524
51 Ga0068858_100097696 3300005842 Bacteria 2737
52 Ga0068860_100522767 3300005843 Bacteria 1187
53 Ga0068860_100693871 3300005843 Bacteria 1027
54 Ga0068862_100051084 3300005844 Bacteria 3535
55 Ga0068862_100169007 3300005844 Bacteria 1956
56 Ga0068862_100232648 3300005844 Bacteria 1673
57 Ga0081455_10003702 3300005937 Bacteria 17507
58 Ga0081455_10084092 3300005937 Bacteria 2598
59 Ga0081455_10099280 3300005937 Bacteria 2342
60 Ga0081538_10000136 3300005981 Bacteria 76141
61 Ga0081538_10006490 3300005981 Bacteria 10291
62 Ga0081538_10014059 3300005981 Bacteria 6291
63 Ga0081539_10000357 3300005985 Bacteria 100714
64 Ga0081539_10000420 3300005985 Bacteria 90166
65 Ga0081539_10001106 3300005985 Bacteria 48943
66 Ga0081539_10004121 3300005985 Bacteria 16553
67 Ga0081539_10005819 3300005985 Bacteria 12249
68 Ga0070717_10084531 3300006028 Bacteria 2669
69 Ga0075363_100015415 3300006048 Bacteria 3756
70 Ga0075363_100321325 3300006048 Bacteria 901
71 Ga0075367_10018582 3300006178 Bacteria 3839
72 Ga0075367_10055576 3300006178 Bacteria 2350
73 Ga0097621_100620510 3300006237 Bacteria 990
74 Ga0075428_100038789 3300006844 Bacteria 5242
75 Ga0075428_100040339 3300006844 Bacteria 5137
76 Ga0075428_100084482 3300006844 Bacteria 3463
77 Ga0075430_100085218 3300006846 Bacteria 2646
78 Ga0075430_100121002 3300006846 Bacteria 2182
79 Ga0075431_100068771 3300006847 Bacteria 3654
80 Ga0075431_100287076 3300006847 Bacteria 1665
81 Ga0075429_100013670 3300006880 Bacteria 7038
82 Ga0075429_100057723 3300006880 Bacteria 3379
83 Ga0068865_100234717 3300006881 Bacteria 1441
84 Ga0068865_100241467 3300006881 Bacteria 1422
85 Ga0097620_100019694 3300006931 Bacteria 6777
86 Ga0097620_100042613 3300006931 Bacteria 4560
87 Ga0105240_10184424 3300009093 Bacteria 2459
88 Ga0111539_10004030 3300009094 Bacteria 19288
89 Ga0111539_10006384 3300009094 Bacteria 15204
90 Ga0111539_10216884 3300009094 Bacteria 2228
91 Ga0105245_10115187 3300009098 Bacteria 2505
92 Ga0105247_10042151 3300009101 Bacteria 2794
93 Ga0105247_10085049 3300009101 Bacteria 1999
94 Ga0114129_10000959 3300009147 Bacteria 37691
95 Ga0114129_10062927 3300009147 Bacteria 5183
96 Ga0114129_10074244 3300009147 Bacteria 4737
97 Ga0114129_10278566 3300009147 Bacteria 2235
98 Ga0105243_10006412 3300009148 Bacteria 9092
99 Ga0105243_10100989 3300009148 Bacteria 2395
100 Ga0105243_10110902 3300009148 Bacteria 2295
101 Ga0105248_10388518 3300009177 Bacteria 1571
102 Ga0105249_10030610 3300009553 Bacteria 4866
103 Ga0105249_10140054 3300009553 Bacteria 2319
104 Ga0105239_10034294 3300010375 Bacteria 5572
105 Ga0105239_10207467 3300010375 Bacteria 2196
106 Ga0105246_10024519 3300011119 Bacteria 3920
107 Ga0105246_10026470 3300011119 Bacteria 3790
108 Ga0157369_10248855 3300013105 Bacteria 1855
109 Ga0157378_10039679 3300013297 Bacteria 4176
110 Ga0157378_10345462 3300013297 Bacteria 1452
111 Ga0163162_10174404 3300013306 Bacteria 2275
112 Ga0157375_10008491 3300013308 Bacteria 8995
113 Ga0157375_10068159 3300013308 Bacteria 3559
114 Ga0163163_10140598 3300014325 Bacteria 2456
115 Ga0163163_10157782 3300014325 Bacteria 2313
116 Ga0157380_10077644 3300014326 Bacteria 2707
117 Ga0182008_10000192 3300014497 Bacteria 48269
118 Ga0157379_10305339 3300014968 Bacteria 1451
119 Ga0157379_10404902 3300014968 Bacteria 1255
120 Ga0182007_10000449 3300015262 Bacteria 24937
121 Ga0183367_1013 3300015688 Bacteria 334176
122 Ga0256743_117949 3300023436 Bacteria 1063
123 Ga0209758_1008233 3300025297 Bacteria 6828
124 Ga0207426_1002577 3300025302 Bacteria 11294
125 Ga0207426_1010853 3300025302 Bacteria 3508
126 Ga0207426_1012936 3300025302 Bacteria 3114
127 Ga0207692_10038904 3300025898 Bacteria 2336
128 Ga0207642_10108303 3300025899 Bacteria 1409
129 Ga0207710_10018571 3300025900 Bacteria 2959
130 Ga0207710_10201149 3300025900 Bacteria 984
131 Ga0207647_10018288 3300025904 Bacteria 4745
132 Ga0207671_10174417 3300025914 Bacteria 1671
133 Ga0207663_10308449 3300025916 Bacteria 1185
134 Ga0207687_10136803 3300025927 Bacteria 1854
135 Ga0207687_10214684 3300025927 Bacteria 1511
136 Ga0207687_10218138 3300025927 Bacteria 1500
137 Ga0207700_10328719 3300025928 Bacteria 1326
138 Ga0207644_10066402 3300025931 Bacteria 2627
139 Ga0207690_10189439 3300025932 Bacteria 1555
140 Ga0207706_10013802 3300025933 Bacteria 7332
141 Ga0207706_10071661 3300025933 Bacteria 3048
142 Ga0207706_10419721 3300025933 Bacteria 1159
143 Ga0207709_10094481 3300025935 Bacteria 1963
144 Ga0207711_10075784 3300025941 Bacteria 2928
145 Ga0207711_10222508 3300025941 Bacteria 1727
146 Ga0207661_10074710 3300025944 Bacteria 2779
147 Ga0207661_10128943 3300025944 Bacteria 2164
148 Ga0207661_10545189 3300025944 Bacteria 1062
149 Ga0207667_10077006 3300025949 Bacteria 3460
150 Ga0207712_10100603 3300025961 Bacteria 2148
151 Ga0207668_10004765 3300025972 Bacteria 7982
152 Ga0207640_10129826 3300025981 Bacteria 1820
153 Ga0207658_10039649 3300025986 Bacteria 3399
154 Ga0207677_10032237 3300026023 Bacteria 3366
155 Ga0207703_10024649 3300026035 Bacteria 4733
156 Ga0207678_10514235 3300026067 Bacteria 1044
157 Ga0207708_10007293 3300026075 Bacteria 8177
158 Ga0207708_10082761 3300026075 Bacteria 2467
159 Ga0207702_10314145 3300026078 Bacteria 1491
160 Ga0207641_10117850 3300026088 Bacteria 2365
161 Ga0207648_10512844 3300026089 Bacteria 1098
162 Ga0207676_10067759 3300026095 Bacteria 2852
163 Ga0207674_10002093 3300026116 Bacteria 25273
164 Ga0207674_10144115 3300026116 Bacteria 2341
165 Ga0207674_10522234 3300026116 Bacteria 1147
166 Ga0207675_100307960 3300026118 Bacteria 1544
167 Ga0207683_10038481 3300026121 Bacteria 4169
168 Ga0207698_10305604 3300026142 Bacteria 1483
169 Ga0268265_10010581 3300028380 Bacteria 6231
170 Ga0268264_10008659 3300028381 Bacteria 8453
171 Ga0307517_10013060 3300028786 Bacteria 11322
172 Ga0307517_10016670 3300028786 Bacteria 9637
173 Ga0307515_10000045 3300028794 Bacteria 301029
174 Ga0307515_10052796 3300028794 Bacteria 6016
175 Ga0307515_10108038 3300028794 Bacteria 3282
176 Ga0307515_10298560 3300028794 Bacteria 1298
177 Ga0307511_10001435 3300030521 Bacteria 25149
178 Ga0307511_10078834 3300030521 Bacteria 2333
179 Ga0307512_10002986 3300030522 Bacteria 20400
180 Ga0307512_10029915 3300030522 Bacteria 4746
181 Ga0307512_10082717 3300030522 Bacteria 2294
182 Ga0307512_10082851 3300030522 Bacteria 2291
183 Ga0307512_10103148 3300030522 Bacteria 1921
184 Ga0314311_1151442 3300030733 Bacteria 3391
185 Ga0265327_10000154 3300031251 Bacteria 148866
186 Ga0307513_10010933 3300031456 Bacteria 11330
187 Ga0307513_10124337 3300031456 Bacteria 2539
188 Ga0307513_10195918 3300031456 Bacteria 1866
189 Ga0307509_10020244 3300031507 Bacteria 7555
190 Ga0307509_10034088 3300031507 Bacteria 5597
191 Ga0307408_100023257 3300031548 Bacteria 4219
192 Ga0307408_100103878 3300031548 Bacteria 2170
193 Ga0307408_100185655 3300031548 Bacteria 1671
194 Ga0307508_10001514 3300031616 Bacteria 25941
195 Ga0307508_10005717 3300031616 Bacteria 11773
196 Ga0307508_10027731 3300031616 Bacteria 5125
197 Ga0307508_10049648 3300031616 Bacteria 3737
198 Ga0307508_10062760 3300031616 Bacteria 3278
199 Ga0307508_10082547 3300031616 Bacteria 2796
200 Ga0307514_10003971 3300031649 Bacteria 13818
201 Ga0307514_10076048 3300031649 Bacteria 2502
202 Ga0307514_10136963 3300031649 Bacteria 1673
203 Ga0307514_10251391 3300031649 Bacteria 1046
204 Ga0307516_10002608 3300031730 Bacteria 23942
205 Ga0307516_10008621 3300031730 Bacteria 11503
206 Ga0307516_10039054 3300031730 Bacteria 4733
207 Ga0307516_10046419 3300031730 Bacteria 4286
208 Ga0307516_10047355 3300031730 Bacteria 4236
209 Ga0307516_10124303 3300031730 Bacteria 2366
210 Ga0307405_10048752 3300031731 Bacteria 2614
211 Ga0307405_10347032 3300031731 Bacteria 1143
212 Ga0307405_10349468 3300031731 Bacteria 1140
213 Ga0307413_10009249 3300031824 Bacteria 4707
214 Ga0307413_10106511 3300031824 Bacteria 1866
215 Ga0307413_10106691 3300031824 Bacteria 1865
216 Ga0307413_10392897 3300031824 Bacteria 1084
217 Ga0307518_10241147 3300031838 Bacteria 1159
218 Ga0307410_10061864 3300031852 Bacteria 2563
219 Ga0307410_10124993 3300031852 Bacteria 1881
220 Ga0307410_10164366 3300031852 Bacteria 1666
221 Ga0307410_10232142 3300031852 Bacteria 1425
222 Ga0307406_10053277 3300031901 Bacteria 2576
223 Ga0307406_10055824 3300031901 Bacteria 2526
224 Ga0307406_10060524 3300031901 Bacteria 2442
225 Ga0307406_10073419 3300031901 Bacteria 2249
226 Ga0307406_10268643 3300031901 Bacteria 1294
227 Ga0307406_10304865 3300031901 Bacteria 1225
228 Ga0307407_10077267 3300031903 Bacteria 2002
229 Ga0307407_10095416 3300031903 Bacteria 1833
230 Ga0307407_10118884 3300031903 Bacteria 1672
231 Ga0307407_10137627 3300031903 Bacteria 1571
232 Ga0307412_10354291 3300031911 Bacteria 1179
233 Ga0307409_100011803 3300031995 Bacteria 5531
234 Ga0307409_100014786 3300031995 Bacteria 5092
235 Ga0307409_100020946 3300031995 Bacteria 4471
236 Ga0307409_100038809 3300031995 Bacteria 3526
237 Ga0307409_100060901 3300031995 Bacteria 2946
238 Ga0307409_100069355 3300031995 Bacteria 2793
239 Ga0307409_100133126 3300031995 Bacteria 2128
240 Ga0307409_100263053 3300031995 Bacteria 1584
241 Ga0307409_100305097 3300031995 Bacteria 1483
242 Ga0307409_100314467 3300031995 Bacteria 1463
243 Ga0307409_100639544 3300031995 Bacteria 1056
244 Ga0307409_100657928 3300031995 Bacteria 1042
245 Ga0307416_100006529 3300032002 Bacteria 7309
246 Ga0307416_100028486 3300032002 Bacteria 4154
247 Ga0307416_100133491 3300032002 Bacteria 2240
248 Ga0307416_100188162 3300032002 Bacteria 1943
249 Ga0307416_100267892 3300032002 Bacteria 1675
250 Ga0307416_100488972 3300032002 Bacteria 1292
251 Ga0307414_10121022 3300032004 Bacteria 2012
252 Ga0307411_10156781 3300032005 Bacteria 1699
253 Ga0307411_10349817 3300032005 Bacteria 1204
254 Ga0307411_10654423 3300032005 Bacteria 910
255 Ga0307415_100000048 3300032126 Bacteria 51694
256 Ga0307415_100012878 3300032126 Bacteria 4856
257 Ga0307415_100018602 3300032126 Bacteria 4200
258 Ga0307415_100031159 3300032126 Bacteria 3431
259 Ga0307415_100092379 3300032126 Bacteria 2194
260 Ga0307415_100135208 3300032126 Bacteria 1874
261 Ga0307415_100183066 3300032126 Bacteria 1646
262 Ga0307415_100311496 3300032126 Bacteria 1308
263 Ga0307507_10012883 3300033179 Bacteria 10256
264 Ga0307507_10056142 3300033179 Bacteria 3724
265 Ga0307507_10208777 3300033179 Bacteria 1336
266 Ga0307510_10074586 3300033180 Bacteria 3350
267 Ga0307510_10103011 3300033180 Bacteria 2633
268 Ga0307510_10225825 3300033180 Bacteria 1379
269 Ga0307510_10311842 3300033180 Bacteria 1032
270 Ga0373948_0024112 3300034817 Bacteria 1185
271 Ga0373962_0005092 3300035242 Bacteria 3176
272 Ga0373935_0010076 3300035692 Bacteria 5661
273 Ga0373937_0148022 3300036401 Bacteria 2199
274 Ga0395899_0001267 3300037312 Bacteria 21969
275 Ga0395899_0004240 3300037312 Bacteria 11227
276 Ga0395899_0010571 3300037312 Bacteria 7072
277 Ga0395899_0130701 3300037312 Bacteria 1793
278 Ga0395900_0003489 3300037418 Bacteria 16973
279 Ga0395900_0021539 3300037418 Bacteria 6590
280 Ga0395900_0070245 3300037418 Bacteria 3600
281 Ga0395898_0001276 3300037466 Bacteria 37111
282 Ga0395898_0008267 3300037466 Bacteria 11005
283 Ga0395898_0013768 3300037466 Bacteria 8317
284 Ga0395898_0017125 3300037466 Bacteria 7402
285 Ga0395898_0018786 3300037466 Bacteria 7044
286 Ga0395898_0312915 3300037466 Bacteria 1498
287 Ga0395905_0001281 3300037471 Bacteria 31019
288 Ga0395905_0064766 3300037471 Bacteria 3421
289 Ga0395905_0142852 3300037471 Bacteria 2251
290 Ga0395901_0001957 3300038443 Bacteria 21190
291 Ga0395901_0050065 3300038443 Bacteria 4341
292 Ga0395901_0222063 3300038443 Bacteria 1975
293 Ga0395901_0374395 3300038443 Bacteria 1466
294 Ga0395901_0498892 3300038443 Bacteria 1239
295 Ga0242420_016285 3300038996 Bacteria 1294
296 Ga0436365_0038748 3300039437 Bacteria 1511
297 Ga0439436_0011347 3300041404 Bacteria 2706
298 Ga0439436_0023689 3300041404 Bacteria 1815
299 Ga0439439_0038114 3300041406 Bacteria 1240
300 Ga0451789_0337061 3300041443 Bacteria 1684
301 Ga0451791_0820044 3300041451 Bacteria 1615
302 Ga0451837_1578301 3300041494 Bacteria 4370
303 Ga0451853_0792760 3300041512 Bacteria 2296
304 Ga0439431_0027020 3300041997 Bacteria 1409
305 Ga0439433_0000155 3300041999 Bacteria 10576
306 Ga0439442_018925 3300042002 Bacteria 1424
307 Ga0439448_0036914 3300042005 Bacteria 1568
308 Ga0439448_0040261 3300042005 Bacteria 1509
309 Ga0439432_052632 3300042006 Bacteria 1267
310 Ga0439449_0003789 3300042007 Bacteria 5851
311 Ga0439449_0014267 3300042007 Bacteria 2986
312 Ga0439454_008338 3300042011 Bacteria 1322
313 Ga0439456_039928 3300042013 Bacteria 1016
314 Ga0439457_005828 3300042014 Bacteria 3058
315 Ga0439457_012835 3300042014 Bacteria 1885
316 Ga0439462_0001709 3300042015 Bacteria 4960
317 Ga0450890_005177 3300042127 Bacteria 1681
318 Ga0450894_000143 3300042131 Bacteria 12616
319 Ga0450896_000403 3300042133 Bacteria 4352
320 Ga0450898_008444 3300042134 Bacteria 1625
321 Ga0450899_000010 3300042135 Bacteria 14467
322 Ga0450903_001506 3300042138 Bacteria 4347
323 Ga0450903_001798 3300042138 Bacteria 3920
324 Ga0450906_004688 3300042145 Bacteria 2850
325 Ga0450908_004116 3300042184 Bacteria 2810
326 Ga0451577_0199827 3300042876 Bacteria 1805
327 Ga0466969_0000370 3300044656 Bacteria 24636
328 Ga0466969_0006463 3300044656 Bacteria 6239
329 Ga0466969_0096666 3300044656 Bacteria 1394
330 Ga0466972_0006455 3300044658 Bacteria 5891
331 Ga0466972_0050772 3300044658 Bacteria 2001
332 Ga0466972_0053572 3300044658 Bacteria 1942
333 Ga0466965_0025338 3300044683 Bacteria 2870
334 Ga0466965_0121905 3300044683 Bacteria 1347
335 Ga0466966_0016593 3300044684 Bacteria 4864
336 Ga0466966_0019527 3300044684 Bacteria 4458
337 Ga0466966_0029700 3300044684 Bacteria 3554
338 Ga0466966_0117343 3300044684 Bacteria 1637
339 Ga0466966_0139761 3300044684 Bacteria 1480
340 Ga0466966_0200000 3300044684 Bacteria 1209
341 Ga0466966_0283682 3300044684 Bacteria 996
342 Ga0466961_0005082 3300044693 Bacteria 8277
343 Ga0466961_0022807 3300044693 Bacteria 4026
344 Ga0466961_0031877 3300044693 Bacteria 3388
345 Ga0466961_0102214 3300044693 Bacteria 1805
346 Ga0466961_0147629 3300044693 Bacteria 1470
347 Ga0466963_0017382 3300044694 Bacteria 4483
348 Ga0466963_0022628 3300044694 Bacteria 3982
349 Ga0466964_0067625 3300044706 Bacteria 1502
350 Ga0466964_0120805 3300044706 Bacteria 1181
351 Ga0466971_0000315 3300044719 Bacteria 18663
352 Ga0466971_0004202 3300044719 Bacteria 6206
353 Ga0466970_0053168 3300044765 Bacteria 2163
354 Ga0466970_0061396 3300044765 Bacteria 2013
355 Ga0466970_0098560 3300044765 Bacteria 1590
356 Ga0466970_0166558 3300044765 Bacteria 1220
357 Ga0466970_0195766 3300044765 Bacteria 1124
358 Ga0466957_0010923 3300044842 Bacteria 5222
359 Ga0466957_0058790 3300044842 Bacteria 2355
360 Ga0466957_0114486 3300044842 Bacteria 1713
361 Ga0466960_0004092 3300044901 Bacteria 5669
362 Ga0466960_0009167 3300044901 Bacteria 4071
363 Ga0466960_0152198 3300044901 Bacteria 1236
364 Ga0466960_0193376 3300044901 Bacteria 1108
365 Ga0466960_0284999 3300044901 Bacteria 927
366 Ga0466959_0003681 3300045049 Bacteria 10108
367 Ga0466959_0013084 3300045049 Bacteria 6008
368 Ga0466959_0027194 3300045049 Bacteria 4243
369 Ga0466959_0044261 3300045049 Bacteria 3280
370 Ga0466958_0001227 3300045836 Bacteria 12000
371 Ga0466967_0094233 3300045976 Bacteria 2726
372 Ga0466967_0180790 3300045976 Bacteria 1989
373 Ga0466967_0246816 3300045976 Bacteria 1704
374 Ga0466967_0291314 3300045976 Bacteria 1568
375 Ga0466967_0372686 3300045976 Bacteria 1385
376 Ga0495617_003061 3300046452 Bacteria 6363
377 Ga0495627_014138 3300046453 Bacteria 2794
378 Ga0495627_064729 3300046453 Bacteria 1075
379 Ga0495592_0004769 3300046454 Bacteria 9954
380 Ga0495592_0007933 3300046454 Bacteria 7963
381 Ga0495592_0042740 3300046454 Bacteria 3393
382 Ga0495603_0001314 3300046455 Bacteria 14437
383 Ga0495603_0002392 3300046455 Bacteria 11031
384 Ga0495603_0092888 3300046455 Bacteria 1764
385 Ga0495603_0132408 3300046455 Bacteria 1451
386 Ga0495591_026417 3300046458 Bacteria 1804
387 Ga0495629_0009911 3300046459 Bacteria 6954
388 Ga0495629_0029215 3300046459 Bacteria 3911
389 Ga0495629_0047019 3300046459 Bacteria 3026
390 Ga0495629_0050973 3300046459 Bacteria 2897
391 Ga0495629_0071995 3300046459 Bacteria 2412
392 Ga0495638_0024771 3300046460 Bacteria 3906
393 Ga0495638_0031950 3300046460 Bacteria 3380
394 Ga0495638_0096043 3300046460 Bacteria 1779
395 Ga0495651_0005450 3300046462 Bacteria 9708
396 Ga0495651_0014060 3300046462 Bacteria 6190
397 Ga0495651_0016661 3300046462 Bacteria 5691
398 Ga0495653_0002328 3300046463 Bacteria 15072
399 Ga0495580_0058285 3300046472 Bacteria 2716
400 Ga0495580_0141025 3300046472 Bacteria 1670
401 Ga0495582_0123751 3300046473 Bacteria 1459
402 Ga0495605_0018566 3300046474 Bacteria 3726
403 Ga0495639_0037671 3300046475 Bacteria 2168
404 Ga0495662_0006205 3300046476 Bacteria 5977
405 Ga0495662_0009374 3300046476 Bacteria 4803
406 Ga0495662_0019023 3300046476 Bacteria 3323
407 Ga0495662_0149450 3300046476 Bacteria 1150
408 Ga0495664_0002191 3300046477 Bacteria 10462
409 Ga0495664_0005789 3300046477 Bacteria 6803
410 Ga0495664_0021670 3300046477 Bacteria 3712
411 Ga0495585_0010195 3300046492 Bacteria 5610
412 Ga0495585_0038740 3300046492 Bacteria 2682
413 Ga0495594_0003850 3300046499 Bacteria 7710
414 Ga0495594_0037464 3300046499 Bacteria 2645
415 Ga0495594_0198855 3300046499 Bacteria 1142
416 Ga0495594_0363750 3300046499 Bacteria 824
417 Ga0495596_0009731 3300046500 Bacteria 4218
418 Ga0495596_0076899 3300046500 Bacteria 1296
419 Ga0495607_0071225 3300046501 Bacteria 1938
420 Ga0495607_0072549 3300046501 Bacteria 1916
421 Ga0495583_0073647 3300046506 Bacteria 1497
422 Ga0495583_0087058 3300046506 Bacteria 1350
423 Ga0495606_0012438 3300046507 Bacteria 6823
424 Ga0495608_0109066 3300046511 Bacteria 1780
425 Ga0495610_0035874 3300046512 Bacteria 2540
426 Ga0495616_0004457 3300046513 Bacteria 8819
427 Ga0495618_0031865 3300046514 Bacteria 3301
428 Ga0495618_0042215 3300046514 Bacteria 2874
429 Ga0495620_0052174 3300046515 Bacteria 1737
430 Ga0495628_0000938 3300046516 Bacteria 26718
431 Ga0495628_0052598 3300046516 Bacteria 3217
432 Ga0495628_0064657 3300046516 Bacteria 2863
433 Ga0495630_0007585 3300046517 Bacteria 7755
434 Ga0495630_0063176 3300046517 Bacteria 2781
435 Ga0495630_0464021 3300046517 Bacteria 970
436 Ga0495631_0001249 3300046518 Bacteria 15708
437 Ga0495632_0054356 3300046519 Bacteria 1963
438 Ga0495632_0179338 3300046519 Bacteria 971
439 Ga0495637_0020761 3300046520 Bacteria 3016
440 Ga0495637_0039510 3300046520 Bacteria 2036
441 Ga0495643_0019979 3300046522 Bacteria 3869
442 Ga0495643_0129877 3300046522 Bacteria 1266
443 Ga0495648_0040688 3300046524 Bacteria 2944
444 Ga0495666_0009175 3300046526 Bacteria 4947
445 Ga0495666_0055878 3300046526 Bacteria 1891
446 Ga0495642_0056270 3300046528 Bacteria 1624
447 Ga0495652_0014739 3300046529 Bacteria 7009
448 Ga0495652_0037238 3300046529 Bacteria 4221
449 Ga0495652_0037994 3300046529 Bacteria 4173
450 Ga0495665_0002842 3300046531 Bacteria 9353
451 Ga0495640_0002611 3300046533 Bacteria 14486
452 Ga0495640_0021614 3300046533 Bacteria 4718
453 Ga0495640_0050705 3300046533 Bacteria 2857
454 Ga0495640_0092007 3300046533 Bacteria 2001
455 Ga0495586_0018407 3300046535 Bacteria 3719
456 Ga0495587_0001074 3300046536 Bacteria 17963
457 Ga0495587_0013037 3300046536 Bacteria 5229
458 Ga0495609_0010159 3300046538 Bacteria 4526
459 Ga0495597_0078649 3300046542 Bacteria 1412
460 Ga0495597_0081153 3300046542 Bacteria 1387
461 Ga0495645_0007385 3300046543 Bacteria 7645
462 Ga0495622_0002792 3300046557 Bacteria 8334
463 Ga0495622_0012292 3300046557 Bacteria 3959
464 Ga0495633_0015709 3300046558 Bacteria 3923
465 Ga0495633_0020844 3300046558 Bacteria 3289
466 Ga0495633_0058987 3300046558 Bacteria 1801
467 Ga0495667_0001343 3300046559 Bacteria 16149
468 Ga0495667_0101261 3300046559 Bacteria 1864
469 Ga0495656_0034974 3300046615 Bacteria 2061
470 Ga0495668_0035008 3300046616 Bacteria 2814
471 Ga0495634_0006470 3300046642 Bacteria 8900
472 Ga0495634_0007476 3300046642 Bacteria 8204
473 Ga0495634_0039714 3300046642 Bacteria 3203
474 Ga0495634_0055670 3300046642 Bacteria 2644
475 Ga0495634_0353305 3300046642 Bacteria 880
476 Ga0495611_0014088 3300046648 Bacteria 3411
477 Ga0495611_0025741 3300046648 Bacteria 2566
478 Ga0495611_0044189 3300046648 Bacteria 1992
479 Ga0495625_0008236 3300046660 Bacteria 8916
480 Ga0495625_0023042 3300046660 Bacteria 4761
481 Ga0495635_0006847 3300046663 Bacteria 7965
482 Ga0495635_0056943 3300046663 Bacteria 2690
483 Ga0495635_0059060 3300046663 Bacteria 2637
484 Ga0495635_0332570 3300046663 Bacteria 1015
485 Ga0495659_0062665 3300046664 Bacteria 1377
486 Ga0495661_0023038 3300046665 Bacteria 4047
487 Ga0495661_0110815 3300046665 Bacteria 1530
488 Ga0495588_0022405 3300046674 Bacteria 3122
489 Ga0495588_0043702 3300046674 Bacteria 2293
490 Ga0495588_0055475 3300046674 Bacteria 2044
491 Ga0495657_0001181 3300046675 Bacteria 22901
492 Ga0495657_0006084 3300046675 Bacteria 9469
493 Ga0495657_0021312 3300046675 Bacteria 4650
494 Ga0495657_0073052 3300046675 Bacteria 2235
495 Ga0495657_0090308 3300046675 Bacteria 1966
496 Ga0495599_0010033 3300046678 Bacteria 5798
497 Ga0495599_0021283 3300046678 Bacteria 4045
498 Ga0495623_0018012 3300046679 Bacteria 4560
499 Ga0495623_0056451 3300046679 Bacteria 2472
500 Ga0495623_0062647 3300046679 Bacteria 2330
501 Ga0495623_0089463 3300046679 Bacteria 1892
502 Ga0495646_0000250 3300046680 Bacteria 27112
503 Ga0495646_0001026 3300046680 Bacteria 16141
504 Ga0495658_0018341 3300046683 Bacteria 3637
505 Ga0495613_0007591 3300046689 Bacteria 8062
506 Ga0495613_0008120 3300046689 Bacteria 7806
507 Ga0495613_0010412 3300046689 Bacteria 6905
508 Ga0495613_0066011 3300046689 Bacteria 2643
509 Ga0495613_0084475 3300046689 Bacteria 2304
510 Ga0495613_0131993 3300046689 Bacteria 1788
511 Ga0495624_0035600 3300046690 Bacteria 3214
512 Ga0495624_0067786 3300046690 Bacteria 2225
513 Ga0495670_0012222 3300046691 Bacteria 4221
514 Ga0495670_0101844 3300046691 Bacteria 1479
515 Ga0495670_0207589 3300046691 Bacteria 1038
516 Ga0495671_0180778 3300046692 Bacteria 1024
517 Ga0495649_0052260 3300046694 Bacteria 2214
518 Ga0495589_0002240 3300046794 Bacteria 10867
519 Ga0495589_0011849 3300046794 Bacteria 4524
520 Ga0495589_0041781 3300046794 Bacteria 2286
521 Ga0495589_0048782 3300046794 Bacteria 2095
522 Ga0495589_0051949 3300046794 Bacteria 2025
523 Ga0495589_0159944 3300046794 Bacteria 1073
524 Ga0495600_0007937 3300046809 Bacteria 6505
525 Ga0495600_0008654 3300046809 Bacteria 6262
526 Ga0495600_0025856 3300046809 Bacteria 3784
527 Ga0495600_0065112 3300046809 Bacteria 2382
528 Ga0495660_0010493 3300046810 Bacteria 5389
529 Ga0495581_0019208 3300047315 Bacteria 3966
530 Ga0495581_0038922 3300047315 Bacteria 2753
531 Ga0495581_0096738 3300047315 Bacteria 1714
532 Ga0495581_0136650 3300047315 Bacteria 1429
533 Ga0495604_0001060 3300047317 Bacteria 22796
534 Ga0495604_0006467 3300047317 Bacteria 9294
535 Ga0495604_0034158 3300047317 Bacteria 4025
536 Ga0495604_0062418 3300047317 Bacteria 2847
537 Ga0495636_0001884 3300047318 Bacteria 8014
538 Ga0495636_0024020 3300047318 Bacteria 2470
539 Ga0495636_0024543 3300047318 Bacteria 2446
540 Ga0495674_0007676 3300047319 Bacteria 10302
541 Ga0495676_0005722 3300047321 Bacteria 11401
542 Ga0495676_0024945 3300047321 Bacteria 5166
543 Ga0495676_0031666 3300047321 Bacteria 4469
544 Ga0495676_0035244 3300047321 Bacteria 4187
545 Ga0495676_0068733 3300047321 Bacteria 2735
546 Ga0495676_0186429 3300047321 Bacteria 1450
547 Ga0495680_0007609 3300047322 Bacteria 9901
548 Ga0495683_0013695 3300047323 Bacteria 4235
549 Ga0495683_0068198 3300047323 Bacteria 1750
550 Ga0495687_003771 3300047443 Bacteria 10712
551 Ga0495675_0031161 3300047444 Bacteria 3404
552 Ga0495675_0033734 3300047444 Bacteria 3266
553 Ga0495675_0041250 3300047444 Bacteria 2942
554 Ga0495675_0129152 3300047444 Bacteria 1571
555 Ga0495675_0274263 3300047444 Bacteria 1007
556 Ga0495677_0052849 3300047445 Bacteria 1497
557 Ga0495679_037038 3300047446 Bacteria 1537
558 Ga0495685_000822 3300047447 Bacteria 9473
559 Ga0495685_011579 3300047447 Bacteria 2979
560 Ga0495685_012832 3300047447 Bacteria 2839
561 Ga0495685_039045 3300047447 Bacteria 1625
562 Ga0495685_054236 3300047447 Bacteria 1356
563 Ga0495673_0086767 3300047469 Bacteria 1286
564 Ga0495681_0003360 3300047470 Bacteria 11138
565 Ga0495681_0013269 3300047470 Bacteria 4791
566 Ga0495684_0074908 3300047471 Bacteria 2572
567 Ga0495684_0078439 3300047471 Bacteria 2506
568 Ga0495684_0231616 3300047471 Bacteria 1351
569 Ga0495593_0007985 3300047673 Bacteria 6162
570 Ga0495593_0031130 3300047673 Bacteria 2916
571 Ga0495602_0027338 3300048088 Bacteria 5483
572 Ga0495614_0010362 3300048089 Bacteria 4110
573 Ga0495614_0033645 3300048089 Bacteria 2204
574 Ga0495614_0184013 3300048089 Bacteria 940
575 Ga0495615_0019631 3300048090 Bacteria 1504
576 Ga0495626_0063224 3300048091 Bacteria 1679
577 Ga0496102_0001496 3300048905 Bacteria 20647
578 Ga0496102_0151679 3300048905 Bacteria 2178
579 Ga0496103_0001461 3300048906 Bacteria 15822
580 Ga0496105_0227627 3300048908 Bacteria 1516
581 Ga0496106_0103348 3300048909 Bacteria 2211
582 Ga0496106_0133229 3300048909 Bacteria 1950
583 Ga0496108_0000048 3300048911 Bacteria 133539
584 Ga0496108_0014451 3300048911 Bacteria 6447
585 Ga0496108_0091741 3300048911 Bacteria 2582
586 Ga0496109_0000991 3300048912 Bacteria 23430
587 Ga0496109_0040035 3300048912 Bacteria 4244
588 Ga0496110_0001407 3300048913 Bacteria 17382
589 Ga0496111_0000429 3300048914 Bacteria 21251
590 Ga0496112_0391674 3300048915 Bacteria 1330
591 Ga0496113_0190271 3300048916 Bacteria 1629
592 Ga0496115_0106708 3300048918 Bacteria 2300
593 Ga0496118_0075513 3300048921 Bacteria 2403
594 Ga0496118_0092478 3300048921 Bacteria 2075
595 Ga0496119_0040227 3300048922 Bacteria 2993
596 Ga0496119_0052850 3300048922 Bacteria 2486
597 Ga0496119_0090643 3300048922 Bacteria 1738
598 Ga0496121_0008171 3300048924 Bacteria 12425
599 Ga0496122_0001777 3300048925 Bacteria 33035
600 Ga0496122_0004513 3300048925 Bacteria 17191
601 Ga0496123_0001160 3300048926 Bacteria 39065
602 Ga0496124_0027394 3300048927 Bacteria 5115
603 Ga0496124_0053226 3300048927 Bacteria 3433
604 Ga0496125_0003000 3300048928 Bacteria 21125
605 Ga0496125_0115848 3300048928 Bacteria 1926
606 Ga0496126_0000006 3300048929 Bacteria 798804
607 Ga0496126_0062083 3300048929 Bacteria 3354
608 Ga0496126_0228288 3300048929 Bacteria 1561
609 Ga0501306_000830 3300049127 Bacteria 2626
610 Ga0501309_000486 3300049129 Bacteria 3223
611 Ga0501298_024281 3300049521 Bacteria 1155
612 Ga0501318_000559 3300049534 Bacteria 2456
613 Ga0501323_000528 3300049539 Bacteria 2872
614 Ga0501323_000529 3300049539 Bacteria 2872
615 Ga0501323_002625 3300049539 Bacteria 1763
616 Ga0501323_021596 3300049539 Bacteria 852
617 Ga0501031_0005807 3300049568 Bacteria 8042
618 Ga0501031_0016112 3300049568 Bacteria 4853
619 Ga0501031_0017675 3300049568 Bacteria 4637
620 Ga0501031_0030349 3300049568 Bacteria 3525
621 Ga0501031_0094914 3300049568 Bacteria 1946
622 Ga0501031_0205590 3300049568 Bacteria 1284
623 Ga0501032_0000992 3300049569 Bacteria 22851
624 Ga0501032_0002668 3300049569 Bacteria 13926
625 Ga0501032_0023250 3300049569 Bacteria 4288
626 Ga0501032_0059760 3300049569 Bacteria 2557
627 Ga0501032_0115109 3300049569 Bacteria 1778
628 Ga0501032_0148982 3300049569 Bacteria 1539
629 Ga0501033_0001734 3300049570 Bacteria 19066
630 Ga0501033_0005054 3300049570 Bacteria 10507
631 Ga0501033_0011384 3300049570 Bacteria 6807
632 Ga0501033_0026497 3300049570 Bacteria 4362
633 Ga0501033_0035846 3300049570 Bacteria 3718
634 Ga0501033_0039712 3300049570 Bacteria 3515
635 Ga0501033_0110626 3300049570 Bacteria 1999
636 Ga0501034_0001415 3300049571 Bacteria 32122
637 Ga0501034_0007242 3300049571 Bacteria 11840
638 Ga0501034_0029729 3300049571 Bacteria 5554
639 Ga0501034_0033067 3300049571 Bacteria 5251
640 Ga0501034_0072120 3300049571 Bacteria 3462
641 Ga0501034_0075250 3300049571 Bacteria 3384
642 Ga0501034_0095381 3300049571 Bacteria 2971
643 Ga0501034_0365085 3300049571 Bacteria 1370
644 Ga0501036_0000693 3300049572 Bacteria 24868
645 Ga0501036_0004483 3300049572 Bacteria 11291
646 Ga0501036_0004651 3300049572 Bacteria 11091
647 Ga0501036_0012654 3300049572 Bacteria 6999
648 Ga0501036_0051039 3300049572 Bacteria 3502
649 Ga0501036_0071951 3300049572 Bacteria 2923
650 Ga0501037_0000989 3300049573 Bacteria 21064
651 Ga0501037_0024000 3300049573 Bacteria 4508
652 Ga0501037_0024893 3300049573 Bacteria 4424
653 Ga0501037_0035533 3300049573 Bacteria 3674
654 Ga0501037_0040290 3300049573 Bacteria 3437
655 Ga0501037_0092676 3300049573 Bacteria 2185
656 Ga0501037_0101417 3300049573 Bacteria 2077
657 Ga0501037_0106660 3300049573 Bacteria 2019
658 Ga0501038_0000548 3300049574 Bacteria 33027
659 Ga0501038_0020033 3300049574 Bacteria 6021
660 Ga0501038_0027217 3300049574 Bacteria 5089
661 Ga0501038_0057117 3300049574 Bacteria 3351
662 Ga0501039_0000176 3300049575 Bacteria 45277
663 Ga0501039_0004489 3300049575 Bacteria 10535
664 Ga0501039_0010476 3300049575 Bacteria 7064
665 Ga0501039_0036876 3300049575 Bacteria 3772
666 Ga0501039_0052106 3300049575 Bacteria 3166
667 Ga0501040_0000992 3300049576 Bacteria 17948
668 Ga0501040_0005177 3300049576 Bacteria 8430
669 Ga0501040_0011804 3300049576 Bacteria 5715
670 Ga0501041_0000022 3300049577 Bacteria 52719
671 Ga0501041_0018272 3300049577 Bacteria 4176
672 Ga0501041_0022644 3300049577 Bacteria 3762
673 Ga0501041_0112204 3300049577 Bacteria 1691
674 Ga0501042_0000092 3300049578 Bacteria 35165
675 Ga0501042_0000116 3300049578 Bacteria 33871
676 Ga0501042_0006221 3300049578 Bacteria 7749
677 Ga0501042_0032416 3300049578 Bacteria 3700
678 Ga0501043_0002379 3300049579 Bacteria 15929
679 Ga0501043_0008893 3300049579 Bacteria 7905
680 Ga0501043_0009566 3300049579 Bacteria 7599
681 Ga0501043_0037789 3300049579 Bacteria 3797
682 Ga0501043_0094988 3300049579 Bacteria 2343
683 Ga0501043_0134946 3300049579 Bacteria 1933
684 Ga0501046_0006232 3300049580 Bacteria 10588
685 Ga0501046_0012145 3300049580 Bacteria 7340
686 Ga0501047_0000208 3300049581 Bacteria 71122
687 Ga0501047_0000826 3300049581 Bacteria 32127
688 Ga0501047_0001408 3300049581 Bacteria 23584
689 Ga0501047_0010177 3300049581 Bacteria 8894
690 Ga0501047_0034790 3300049581 Bacteria 4864
691 Ga0501047_0058387 3300049581 Bacteria 3727
692 Ga0501047_0153822 3300049581 Bacteria 2174
693 Ga0501047_0162173 3300049581 Bacteria 2107
694 Ga0501047_0275862 3300049581 Bacteria 1527
695 Ga0501048_0001223 3300049582 Bacteria 19432
696 Ga0501048_0002836 3300049582 Bacteria 13235
697 Ga0501048_0003265 3300049582 Bacteria 12350
698 Ga0501048_0008489 3300049582 Bacteria 7766
699 Ga0501067_0012647 3300049583 Bacteria 4681
700 Ga0501067_0045158 3300049583 Bacteria 2447
701 Ga0501067_0051974 3300049583 Bacteria 2270
702 Ga0501068_0000554 3300049584 Bacteria 18987
703 Ga0501068_0007032 3300049584 Bacteria 6227
704 Ga0501068_0010233 3300049584 Bacteria 5265
705 Ga0501068_0064134 3300049584 Bacteria 2235
706 Ga0501069_0003487 3300049585 Bacteria 8100
707 Ga0501069_0004761 3300049585 Bacteria 7022
708 Ga0501069_0005499 3300049585 Bacteria 6594
709 Ga0501069_0013055 3300049585 Bacteria 4427
710 Ga0501070_0007681 3300049586 Bacteria 9148
711 Ga0501070_0008506 3300049586 Bacteria 8673
712 Ga0501070_0019772 3300049586 Bacteria 5647
713 Ga0501070_0034042 3300049586 Bacteria 4261
714 Ga0501070_0040192 3300049586 Bacteria 3900
715 Ga0501071_0001692 3300049587 Bacteria 12934
716 Ga0501071_0001793 3300049587 Bacteria 12676
717 Ga0501071_0015826 3300049587 Bacteria 5182
718 Ga0501072_0002777 3300049588 Bacteria 13162
719 Ga0501072_0003510 3300049588 Bacteria 11812
720 Ga0501072_0024735 3300049588 Bacteria 4673
721 Ga0501072_0139768 3300049588 Bacteria 1931
722 Ga0501073_0016876 3300049589 Bacteria 5288
723 Ga0501073_0056284 3300049589 Bacteria 2751
724 Ga0501074_0002118 3300049590 Bacteria 13705
725 Ga0501074_0004639 3300049590 Bacteria 9842
726 Ga0501074_0047815 3300049590 Bacteria 3091
727 Ga0501075_0000040 3300049591 Bacteria 52221
728 Ga0501075_0003487 3300049591 Bacteria 10517
729 Ga0501075_0011446 3300049591 Bacteria 6278
730 Ga0501076_0000389 3300049592 Bacteria 27457
731 Ga0501076_0000462 3300049592 Bacteria 25816
732 Ga0501076_0067249 3300049592 Bacteria 2861
733 Ga0501076_0371470 3300049592 Bacteria 1175
734 Ga0501077_0002796 3300049593 Bacteria 10472
735 Ga0501077_0002948 3300049593 Bacteria 10210
736 Ga0501077_0004601 3300049593 Bacteria 8377
737 Ga0501077_0131028 3300049593 Bacteria 1590
738 Ga0501217_073485 3300049661 Bacteria 935
739 Ga0501235_009842 3300049669 Bacteria 2091
740 Ga0501079_0000221 3300049741 Bacteria 33871
741 Ga0501079_0004632 3300049741 Bacteria 10184
742 Ga0501079_0026729 3300049741 Bacteria 4424
743 Ga0501079_0038108 3300049741 Bacteria 3707
744 Ga0501079_0385983 3300049741 Bacteria 1098
745 Ga0501080_0020495 3300049742 Bacteria 6121
746 Ga0501080_0076027 3300049742 Bacteria 3123
747 Ga0501080_0118518 3300049742 Bacteria 2454
748 Ga0501081_0000040 3300049743 Bacteria 48110
749 Ga0501083_0000928 3300049744 Bacteria 19450
750 Ga0501083_0005593 3300049744 Bacteria 8897
751 Ga0501083_0025547 3300049744 Bacteria 4089
752 Ga0501035_0002456 3300049822 Bacteria 18091
753 Ga0501035_0003339 3300049822 Bacteria 15375
754 Ga0501035_0006640 3300049822 Bacteria 10827
755 Ga0501035_0017516 3300049822 Bacteria 6609
756 Ga0501035_0051344 3300049822 Bacteria 3692
757 Ga0501035_0060331 3300049822 Bacteria 3376
758 Ga0501035_0100173 3300049822 Bacteria 2543
759 Ga0501035_0130552 3300049822 Bacteria 2190
760 Ga0501035_0219613 3300049822 Bacteria 1623
761 Ga0501035_0241959 3300049822 Bacteria 1534
762 Ga0501044_0002530 3300049823 Bacteria 20819
763 Ga0501044_0006326 3300049823 Bacteria 13093
764 Ga0501044_0073821 3300049823 Bacteria 3466
765 Ga0501044_0085043 3300049823 Bacteria 3196
766 Ga0501044_0089148 3300049823 Bacteria 3113
767 Ga0501044_0120708 3300049823 Bacteria 2622
768 Ga0501044_0122874 3300049823 Bacteria 2595
769 Ga0501044_0166744 3300049823 Bacteria 2176
770 Ga0501044_0200418 3300049823 Bacteria 1954
771 Ga0501044_0359329 3300049823 Bacteria 1374
772 Ga0501045_0000098 3300049824 Bacteria 42917
773 Ga0501045_0002356 3300049824 Bacteria 12832
774 Ga0501045_0003655 3300049824 Bacteria 10576
775 Ga0501045_0166089 3300049824 Bacteria 1644
776 nmdc:mga03n38_6891_c1 3300050490 Bacteria 3987
777 nmdc:mga06z11_532_c1 3300050494 Bacteria 14020
778 nmdc:mga04h51_20902_c1 3300050495 Bacteria 1962
779 nmdc:mga05p37_3875_c1 3300050507 Bacteria 17497
780 nmdc:mga05p37_68128_c1 3300050507 Bacteria 4377
781 nmdc:mga09592_132774_c1 3300050508 Bacteria 2143
782 nmdc:mga09592_5576_c1 3300050508 Bacteria 10250
783 nmdc:mga0qj67_70686_c1 3300050509 Bacteria 2784
784 nmdc:mga06r32_74469_c1 3300050510 Bacteria 3292
785 nmdc:mga08y16_23786_c1 3300050511 Bacteria 6469
786 Ga0495601_0033866 3300053077 Bacteria 3183
787 Ga0500610_0075020 3300053079 Bacteria 1764
788 Ga0495655_0018863 3300053083 Bacteria 1523
789 Ga0495655_0022606 3300053083 Bacteria 1439
790 Ga0495619_0020492 3300053085 Bacteria 4212
791 Ga0495619_0074608 3300053085 Bacteria 2275
792 Ga0500578_0068206 3300053086 Bacteria 2267
793 Ga0500644_0039186 3300053088 Bacteria 1560
794 Ga0500644_0110756 3300053088 Bacteria 1057
795 Ga0500566_0163335 3300053094 Bacteria 1158
796 Ga0500640_001478 3300053095 Bacteria 7169
797 Ga0500654_022817 3300053099 Bacteria 3960
798 Ga0500660_052204 3300053100 Bacteria 2016
799 Ga0500553_027280 3300053101 Bacteria 2870
800 Ga0500569_011885 3300053109 Bacteria 2091
801 Ga0500572_003088 3300053111 Bacteria 3869
802 Ga0500614_059138 3300053123 Bacteria 1026
803 Ga0500621_063974 3300053126 Bacteria 1486
804 Ga0500628_001446 3300053129 Bacteria 4064
805 Ga0500652_001865 3300053131 Bacteria 6350
806 Ga0500658_0133373 3300053134 Bacteria 1109
807 Ga0500579_023333 3300053143 Bacteria 4004
808 Ga0500600_0027810 3300053149 Bacteria 3349
809 Ga0500600_0160951 3300053149 Bacteria 1104
810 Ga0500616_0006712 3300053153 Bacteria 7470
811 Ga0500624_001192 3300053157 Bacteria 4721
812 Ga0500633_0035278 3300053160 Bacteria 1646
813 Ga0500634_0021167 3300053161 Bacteria 3521
814 Ga0500656_000062 3300053732 Bacteria 6200
815 Ga0500587_002988 3300053739 Bacteria 2394
816 Ga0501084_0000228 3300054114 Bacteria 42475
817 Ga0501084_0000955 3300054114 Bacteria 22375
818 Ga0501084_0051910 3300054114 Bacteria 3431
819 Ga0501084_0579896 3300054114 Bacteria 948
820 Ga0587084_003095 3300059477 Bacteria 1799
821 Ga0587128_027308 3300059630 Bacteria 922
822 Ga0501082_0000313 3300060353 Bacteria 43217
823 Ga0501082_0001912 3300060353 Bacteria 18307
824 Ga0501082_0009457 3300060353 Bacteria 8392
825 Ga0501082_0384503 3300060353 Bacteria 1225
826 Ga0466962_0007506 3300061719 Bacteria 5230
827 Ga0466962_0023083 3300061719 Bacteria 2990
828 Ga0466962_0037246 3300061719 Bacteria 2329
829 Ga0466962_0053301 3300061719 Bacteria 1933
830 Ga0466962_0091265 3300061719 Bacteria 1460
831 Ga0466962_0152958 3300061719 Bacteria 1119
832 Ga0530510_0000233 3300061734 Bacteria 34858
833 Ga0530510_0002808 3300061734 Bacteria 11975
834 Ga0530510_0058431 3300061734 Bacteria 2789
835 Ga0530510_0451617 3300061734 Bacteria 972

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046794 Ga0495589_0159944 Ga0495589_0159944_292_1035 211
2 3300046455 Ga0495603_0001314 Ga0495603_0001314_12212_12988 230
3 3300046455 Ga0495603_0002392 Ga0495603_0002392_1948_2724 230
4 3300046459 Ga0495629_0009911 Ga0495629_0009911_4237_5013 230
5 3300046459 Ga0495629_0050973 Ga0495629_0050973_713_1489 230
6 3300046499 Ga0495594_0003850 Ga0495594_0003850_6051_6827 230
7 3300046557 Ga0495622_0002792 Ga0495622_0002792_720_1496 230
8 3300046648 Ga0495611_0025741 Ga0495611_0025741_256_1032 230
9 3300046689 Ga0495613_0008120 Ga0495613_0008120_5207_5983 230
10 3300047318 Ga0495636_0024543 Ga0495636_0024543_1308_2084 230
11 3300047321 Ga0495676_0024945 Ga0495676_0024945_1438_2214 230
12 3300047321 Ga0495676_0035244 Ga0495676_0035244_1450_2226 230
13 3300048089 Ga0495614_0010362 Ga0495614_0010362_2178_2954 230
14 3300048909 Ga0496106_0133229 Ga0496106_0133229_1023_1799 230
15 3300023436 Ga0256743_117949 Ga0256743_1179491 233
16 3300048922 Ga0496119_0090643 Ga0496119_0090643_960_1721 233
17 iso_pu_bacteria 2767802112 2768647102 233
18 iso_pu_bacteria 2862705112 2862710045 233
19 iso_pu_bacteria 2867346516 2867350899 233
20 iso_pu_bacteria 2867369537 2867374088 233
21 iso_pu_bacteria 2990044586 2990045975 233
22 iso_pu_bacteria 8008485437 8008487231 233
23 iso_pu_bacteria 8025524527 8025526336 233
24 3300005455 Ga0070663_100284069 Ga0070663_1002840691 234
25 3300010375 Ga0105239_10034294 Ga0105239_100342946 234
26 3300025914 Ga0207671_10174417 Ga0207671_101744173 234
27 3300025941 Ga0207711_10222508 Ga0207711_102225081 234
28 3300028786 Ga0307517_10013060 Ga0307517_100130609 234
29 3300030521 Ga0307511_10078834 Ga0307511_100788342 234
30 3300031616 Ga0307508_10027731 Ga0307508_100277313 234
31 3300044693 Ga0466961_0147629 Ga0466961_0147629_622_1368 234
32 3300044765 Ga0466970_0053168 Ga0466970_0053168_480_1226 234
33 3300046460 Ga0495638_0031950 Ga0495638_0031950_867_1601 234
34 3300046499 Ga0495594_0037464 Ga0495594_0037464_1346_2080 234
35 3300046519 Ga0495632_0054356 Ga0495632_0054356_663_1397 234
36 3300046522 Ga0495643_0019979 Ga0495643_0019979_175_909 234
37 3300046558 Ga0495633_0020844 Ga0495633_0020844_623_1357 234
38 3300046642 Ga0495634_0353305 Ga0495634_0353305_22_756 234
39 3300046691 Ga0495670_0012222 Ga0495670_0012222_3027_3761 234
40 3300046794 Ga0495589_0011849 Ga0495589_0011849_3392_4126 234
41 3300046810 Ga0495660_0010493 Ga0495660_0010493_2583_3317 234
42 3300047315 Ga0495581_0136650 Ga0495581_0136650_69_803 234
43 3300047323 Ga0495683_0068198 Ga0495683_0068198_237_971 234
44 3300047444 Ga0495675_0274263 Ga0495675_0274263_107_856 234
45 3300047447 Ga0495685_000822 Ga0495685_000822_7393_8127 234
46 3300047470 Ga0495681_0013269 Ga0495681_0013269_1991_2725 234
47 3300053083 Ga0495655_0022606 Ga0495655_0022606_275_1009 234
48 3300053086 Ga0500578_0068206 Ga0500578_0068206_1253_1987 234
49 3300053094 Ga0500566_0163335 Ga0500566_0163335_128_862 234
50 3300053099 Ga0500654_022817 Ga0500654_022817_817_1551 234
51 3300053100 Ga0500660_052204 Ga0500660_052204_979_1713 234
52 3300053101 Ga0500553_027280 Ga0500553_027280_1432_2166 234
53 3300053109 Ga0500569_011885 Ga0500569_011885_408_1142 234
54 3300053126 Ga0500621_063974 Ga0500621_063974_685_1419 234
55 3300053129 Ga0500628_001446 Ga0500628_001446_480_1214 234
56 3300053131 Ga0500652_001865 Ga0500652_001865_3006_3740 234
57 3300053134 Ga0500658_0133373 Ga0500658_0133373_52_786 234
58 3300053143 Ga0500579_023333 Ga0500579_023333_2077_2811 234
59 3300053149 Ga0500600_0027810 Ga0500600_0027810_1991_2725 234
60 3300053153 Ga0500616_0006712 Ga0500616_0006712_3415_4149 234
61 3300053161 Ga0500634_0021167 Ga0500634_0021167_409_1143 234
62 3300053732 Ga0500656_000062 Ga0500656_000062_2178_2912 234
63 3300053739 Ga0500587_002988 Ga0500587_002988_1347_2081 234
64 3300006178 Ga0075367_10055576 Ga0075367_100555762 235
65 3300038996 Ga0242420_016285 Ga0242420_016285_68_811 235
66 iso_pu_bacteria 2995463766 2995466939 235
67 3300042876 Ga0451577_0199827 Ga0451577_0199827_292_1014 236
68 3300032002 Ga0307416_100133491 Ga0307416_1001334912 237
69 3300046511 Ga0495608_0109066 Ga0495608_0109066_112_846 237
70 3300049539 Ga0501323_002625 Ga0501323_002625_792_1568 237
71 iso_pu_bacteria 2582581312 2585297437 237
72 iso_pu_bacteria 2616644941 2616903763 237
73 iso_pu_bacteria 2643221548 2643761529 237
74 iso_pu_bacteria 2643221578 2643899388 237
75 iso_pu_bacteria 2643221673 2644406876 237
76 iso_pu_bacteria 2643221682 2644458769 237
77 iso_pu_bacteria 2818991463 2819698943 237
78 iso_pu_bacteria 2875391855 2875396994 237
79 iso_pu_bacteria 2946045630 2946047563 237
80 iso_pu_bacteria 2966598605 2966600599 237
81 iso_pu_bacteria 2990088156 2990093889 237
82 3300003354 JGI25160J50197_1032677 JGI25160J50197_10326772 238
83 3300025302 Ga0207426_1010853 Ga0207426_10108534 238
84 3300031616 Ga0307508_10005717 Ga0307508_100057174 238
85 3300033180 Ga0307510_10074586 Ga0307510_100745864 238
86 3300049669 Ga0501235_009842 Ga0501235_009842_632_1396 238
87 iso_pu_bacteria 2643221601 2644015875 238
88 iso_pu_bacteria 2643221631 2644176444 238
89 iso_pu_bacteria 2811994917 2812478517 238
90 iso_pu_bacteria 2818991472 2819740458 238
91 iso_pu_bacteria 2862290372 2862292283 238
92 iso_pu_bacteria 2873151551 2873153815 238
93 iso_pu_bacteria 2887443736 2887447471 238
94 iso_pu_bacteria 8025478263 8025484204 238
95 iso_pu_bacteria 8056447290 8056447822 238
96 iso_pu_bacteria 8056667051 8056670782 238
97 3300001989 JGI24739J22299_10012724 JGI24739J22299_100127243 239
98 3300001990 JGI24737J22298_10015604 JGI24737J22298_100156043 239
99 3300003215 JGI25153J46596_10036081 JGI25153J46596_100360812 239
100 3300005563 Ga0068855_100284016 Ga0068855_1002840162 239
101 3300005614 Ga0068856_100274909 Ga0068856_1002749091 239
102 3300006048 Ga0075363_100015415 Ga0075363_1000154153 239
103 3300006048 Ga0075363_100321325 Ga0075363_1003213251 239
104 3300006178 Ga0075367_10018582 Ga0075367_100185822 239
105 3300009177 Ga0105248_10388518 Ga0105248_103885182 239
106 3300014497 Ga0182008_10000192 Ga0182008_1000019213 239
107 3300015262 Ga0182007_10000449 Ga0182007_1000044916 239
108 3300015688 Ga0183367_1013 Ga0183367_101395 239
109 3300025297 Ga0209758_1008233 Ga0209758_10082333 239
110 3300025302 Ga0207426_1012936 Ga0207426_10129363 239
111 3300025904 Ga0207647_10018288 Ga0207647_100182884 239
112 3300025949 Ga0207667_10077006 Ga0207667_100770063 239
113 3300025981 Ga0207640_10129826 Ga0207640_101298263 239
114 3300028786 Ga0307517_10016670 Ga0307517_100166703 239
115 3300028794 Ga0307515_10052796 Ga0307515_100527967 239
116 3300028794 Ga0307515_10108038 Ga0307515_101080382 239
117 3300028794 Ga0307515_10298560 Ga0307515_102985602 239
118 3300030521 Ga0307511_10001435 Ga0307511_1000143525 239
119 3300030522 Ga0307512_10002986 Ga0307512_1000298620 239
120 3300030522 Ga0307512_10082717 Ga0307512_100827172 239
121 3300030522 Ga0307512_10082851 Ga0307512_100828513 239
122 3300031456 Ga0307513_10010933 Ga0307513_100109334 239
123 3300031456 Ga0307513_10124337 Ga0307513_101243373 239
124 3300031507 Ga0307509_10034088 Ga0307509_100340885 239
125 3300031616 Ga0307508_10049648 Ga0307508_100496483 239
126 3300031616 Ga0307508_10062760 Ga0307508_100627602 239
127 3300031649 Ga0307514_10003971 Ga0307514_100039715 239
128 3300031649 Ga0307514_10076048 Ga0307514_100760481 239
129 3300031649 Ga0307514_10136963 Ga0307514_101369632 239
130 3300031649 Ga0307514_10251391 Ga0307514_102513911 239
131 3300031730 Ga0307516_10039054 Ga0307516_100390544 239
132 3300031730 Ga0307516_10046419 Ga0307516_100464193 239
133 3300031838 Ga0307518_10241147 Ga0307518_102411472 239
134 3300033179 Ga0307507_10056142 Ga0307507_100561423 239
135 3300033179 Ga0307507_10208777 Ga0307507_102087771 239
136 3300033180 Ga0307510_10225825 Ga0307510_102258252 239
137 3300033180 Ga0307510_10311842 Ga0307510_103118422 239
138 3300037312 Ga0395899_0130701 Ga0395899_0130701_762_1520 239
139 3300037466 Ga0395898_0013768 Ga0395898_0013768_5570_6328 239
140 3300037466 Ga0395898_0018786 Ga0395898_0018786_5724_6482 239
141 3300038443 Ga0395901_0498892 Ga0395901_0498892_16_774 239
142 3300041404 Ga0439436_0011347 Ga0439436_0011347_219_977 239
143 3300041404 Ga0439436_0023689 Ga0439436_0023689_931_1689 239
144 3300041443 Ga0451789_0337061 Ga0451789_0337061_903_1661 239
145 3300041494 Ga0451837_1578301 Ga0451837_1578301_2266_3039 239
146 3300041999 Ga0439433_0000155 Ga0439433_0000155_8719_9477 239
147 3300042002 Ga0439442_018925 Ga0439442_018925_588_1346 239
148 3300042005 Ga0439448_0036914 Ga0439448_0036914_789_1547 239
149 3300042006 Ga0439432_052632 Ga0439432_052632_64_822 239
150 3300042007 Ga0439449_0003789 Ga0439449_0003789_338_1096 239
151 3300042007 Ga0439449_0014267 Ga0439449_0014267_242_1000 239
152 3300042014 Ga0439457_005828 Ga0439457_005828_293_1051 239
153 3300042014 Ga0439457_012835 Ga0439457_012835_400_1158 239
154 3300042015 Ga0439462_0001709 Ga0439462_0001709_1122_1880 239
155 3300042127 Ga0450890_005177 Ga0450890_005177_787_1545 239
156 3300042138 Ga0450903_001506 Ga0450903_001506_3302_4060 239
157 3300042138 Ga0450903_001798 Ga0450903_001798_357_1160 239
158 3300044656 Ga0466969_0000370 Ga0466969_0000370_16257_17063 239
159 3300044656 Ga0466969_0096666 Ga0466969_0096666_196_954 239
160 3300044658 Ga0466972_0006455 Ga0466972_0006455_973_1731 239
161 3300044658 Ga0466972_0050772 Ga0466972_0050772_263_1021 239
162 3300044658 Ga0466972_0053572 Ga0466972_0053572_919_1677 239
163 3300044683 Ga0466965_0025338 Ga0466965_0025338_191_949 239
164 3300044683 Ga0466965_0121905 Ga0466965_0121905_227_985 239
165 3300044684 Ga0466966_0019527 Ga0466966_0019527_2153_2911 239
166 3300044684 Ga0466966_0029700 Ga0466966_0029700_2291_3097 239
167 3300044684 Ga0466966_0139761 Ga0466966_0139761_257_1015 239
168 3300044693 Ga0466961_0005082 Ga0466961_0005082_2530_3288 239
169 3300044693 Ga0466961_0031877 Ga0466961_0031877_825_1631 239
170 3300044693 Ga0466961_0102214 Ga0466961_0102214_236_994 239
171 3300044694 Ga0466963_0017382 Ga0466963_0017382_1932_2693 239
172 3300044694 Ga0466963_0022628 Ga0466963_0022628_1457_2215 239
173 3300044706 Ga0466964_0067625 Ga0466964_0067625_409_1167 239
174 3300044719 Ga0466971_0000315 Ga0466971_0000315_2393_3151 239
175 3300044765 Ga0466970_0061396 Ga0466970_0061396_214_972 239
176 3300044765 Ga0466970_0098560 Ga0466970_0098560_549_1307 239
177 3300044765 Ga0466970_0195766 Ga0466970_0195766_12_770 239
178 3300044842 Ga0466957_0010923 Ga0466957_0010923_1645_2403 239
179 3300044901 Ga0466960_0009167 Ga0466960_0009167_697_1455 239
180 3300045049 Ga0466959_0013084 Ga0466959_0013084_2694_3500 239
181 3300045049 Ga0466959_0044261 Ga0466959_0044261_973_1731 239
182 3300045836 Ga0466958_0001227 Ga0466958_0001227_3305_4063 239
183 3300045976 Ga0466967_0246816 Ga0466967_0246816_682_1443 239
184 3300045976 Ga0466967_0291314 Ga0466967_0291314_475_1233 239
185 3300046452 Ga0495617_003061 Ga0495617_003061_2126_2896 239
186 3300046454 Ga0495592_0007933 Ga0495592_0007933_6261_7031 239
187 3300046454 Ga0495592_0042740 Ga0495592_0042740_1205_1972 239
188 3300046455 Ga0495603_0092888 Ga0495603_0092888_784_1593 239
189 3300046455 Ga0495603_0132408 Ga0495603_0132408_263_1141 239
190 3300046459 Ga0495629_0047019 Ga0495629_0047019_647_1405 239
191 3300046459 Ga0495629_0071995 Ga0495629_0071995_695_1465 239
192 3300046460 Ga0495638_0024771 Ga0495638_0024771_274_1044 239
193 3300046460 Ga0495638_0096043 Ga0495638_0096043_227_997 239
194 3300046462 Ga0495651_0005450 Ga0495651_0005450_1673_2431 239
195 3300046462 Ga0495651_0014060 Ga0495651_0014060_4402_5172 239
196 3300046462 Ga0495651_0016661 Ga0495651_0016661_1088_1855 239
197 3300046463 Ga0495653_0002328 Ga0495653_0002328_5490_6257 239
198 3300046472 Ga0495580_0058285 Ga0495580_0058285_1059_1826 239
199 3300046472 Ga0495580_0141025 Ga0495580_0141025_32_802 239
200 3300046475 Ga0495639_0037671 Ga0495639_0037671_271_1041 239
201 3300046476 Ga0495662_0006205 Ga0495662_0006205_3376_4134 239
202 3300046476 Ga0495662_0009374 Ga0495662_0009374_2089_2856 239
203 3300046476 Ga0495662_0149450 Ga0495662_0149450_233_1111 239
204 3300046477 Ga0495664_0002191 Ga0495664_0002191_5571_6338 239
205 3300046477 Ga0495664_0005789 Ga0495664_0005789_2612_3370 239
206 3300046477 Ga0495664_0021670 Ga0495664_0021670_1417_2187 239
207 3300046492 Ga0495585_0038740 Ga0495585_0038740_804_1574 239
208 3300046499 Ga0495594_0198855 Ga0495594_0198855_232_1110 239
209 3300046499 Ga0495594_0363750 Ga0495594_0363750_27_797 239
210 3300046500 Ga0495596_0009731 Ga0495596_0009731_1948_2718 239
211 3300046501 Ga0495607_0071225 Ga0495607_0071225_1019_1789 239
212 3300046501 Ga0495607_0072549 Ga0495607_0072549_194_964 239
213 3300046506 Ga0495583_0087058 Ga0495583_0087058_366_1136 239
214 3300046507 Ga0495606_0012438 Ga0495606_0012438_1270_2040 239
215 3300046512 Ga0495610_0035874 Ga0495610_0035874_1361_2131 239
216 3300046513 Ga0495616_0004457 Ga0495616_0004457_5234_6004 239
217 3300046514 Ga0495618_0042215 Ga0495618_0042215_697_1467 239
218 3300046515 Ga0495620_0052174 Ga0495620_0052174_443_1213 239
219 3300046516 Ga0495628_0000938 Ga0495628_0000938_9457_10224 239
220 3300046516 Ga0495628_0064657 Ga0495628_0064657_725_1495 239
221 3300046517 Ga0495630_0007585 Ga0495630_0007585_5695_6462 239
222 3300046517 Ga0495630_0063176 Ga0495630_0063176_1742_2500 239
223 3300046517 Ga0495630_0464021 Ga0495630_0464021_65_835 239
224 3300046518 Ga0495631_0001249 Ga0495631_0001249_7763_8533 239
225 3300046519 Ga0495632_0179338 Ga0495632_0179338_192_950 239
226 3300046520 Ga0495637_0039510 Ga0495637_0039510_140_910 239
227 3300046524 Ga0495648_0040688 Ga0495648_0040688_1605_2375 239
228 3300046526 Ga0495666_0009175 Ga0495666_0009175_3019_3786 239
229 3300046526 Ga0495666_0055878 Ga0495666_0055878_269_1027 239
230 3300046528 Ga0495642_0056270 Ga0495642_0056270_226_996 239
231 3300046529 Ga0495652_0014739 Ga0495652_0014739_1700_2458 239
232 3300046529 Ga0495652_0037238 Ga0495652_0037238_2513_3283 239
233 3300046529 Ga0495652_0037994 Ga0495652_0037994_1360_2127 239
234 3300046531 Ga0495665_0002842 Ga0495665_0002842_1889_2656 239
235 3300046533 Ga0495640_0002611 Ga0495640_0002611_3456_4223 239
236 3300046533 Ga0495640_0021614 Ga0495640_0021614_1923_2732 239
237 3300046533 Ga0495640_0050705 Ga0495640_0050705_891_1661 239
238 3300046533 Ga0495640_0092007 Ga0495640_0092007_1186_1944 239
239 3300046535 Ga0495586_0018407 Ga0495586_0018407_886_1653 239
240 3300046536 Ga0495587_0001074 Ga0495587_0001074_3633_4391 239
241 3300046536 Ga0495587_0013037 Ga0495587_0013037_3683_4450 239
242 3300046538 Ga0495609_0010159 Ga0495609_0010159_2538_3308 239
243 3300046542 Ga0495597_0078649 Ga0495597_0078649_595_1365 239
244 3300046543 Ga0495645_0007385 Ga0495645_0007385_5348_6115 239
245 3300046557 Ga0495622_0012292 Ga0495622_0012292_2299_3069 239
246 3300046558 Ga0495633_0015709 Ga0495633_0015709_34_804 239
247 3300046559 Ga0495667_0001343 Ga0495667_0001343_7924_8691 239
248 3300046559 Ga0495667_0101261 Ga0495667_0101261_254_1012 239
249 3300046616 Ga0495668_0035008 Ga0495668_0035008_1019_1789 239
250 3300046642 Ga0495634_0007476 Ga0495634_0007476_3926_4693 239
251 3300046642 Ga0495634_0039714 Ga0495634_0039714_1162_1920 239
252 3300046642 Ga0495634_0055670 Ga0495634_0055670_880_1650 239
253 3300046648 Ga0495611_0044189 Ga0495611_0044189_1133_1903 239
254 3300046660 Ga0495625_0008236 Ga0495625_0008236_526_1284 239
255 3300046660 Ga0495625_0023042 Ga0495625_0023042_3467_4237 239
256 3300046663 Ga0495635_0006847 Ga0495635_0006847_1972_2730 239
257 3300046663 Ga0495635_0056943 Ga0495635_0056943_712_1482 239
258 3300046663 Ga0495635_0059060 Ga0495635_0059060_1035_1802 239
259 3300046663 Ga0495635_0332570 Ga0495635_0332570_71_841 239
260 3300046664 Ga0495659_0062665 Ga0495659_0062665_29_799 239
261 3300046665 Ga0495661_0023038 Ga0495661_0023038_1263_2033 239
262 3300046674 Ga0495588_0022405 Ga0495588_0022405_2109_2867 239
263 3300046674 Ga0495588_0043702 Ga0495588_0043702_631_1401 239
264 3300046674 Ga0495588_0055475 Ga0495588_0055475_390_1268 239
265 3300046675 Ga0495657_0001181 Ga0495657_0001181_2813_3571 239
266 3300046675 Ga0495657_0006084 Ga0495657_0006084_6308_7075 239
267 3300046675 Ga0495657_0073052 Ga0495657_0073052_365_1135 239
268 3300046675 Ga0495657_0090308 Ga0495657_0090308_235_1005 239
269 3300046678 Ga0495599_0010033 Ga0495599_0010033_1035_1802 239
270 3300046678 Ga0495599_0021283 Ga0495599_0021283_3237_4007 239
271 3300046679 Ga0495623_0018012 Ga0495623_0018012_1088_1855 239
272 3300046679 Ga0495623_0056451 Ga0495623_0056451_1171_1929 239
273 3300046679 Ga0495623_0089463 Ga0495623_0089463_1087_1857 239
274 3300046680 Ga0495646_0000250 Ga0495646_0000250_1944_2702 239
275 3300046680 Ga0495646_0001026 Ga0495646_0001026_11452_12219 239
276 3300046683 Ga0495658_0018341 Ga0495658_0018341_1971_2729 239
277 3300046689 Ga0495613_0007591 Ga0495613_0007591_652_1419 239
278 3300046689 Ga0495613_0066011 Ga0495613_0066011_254_1012 239
279 3300046689 Ga0495613_0084475 Ga0495613_0084475_467_1237 239
280 3300046689 Ga0495613_0131993 Ga0495613_0131993_792_1550 239
281 3300046690 Ga0495624_0067786 Ga0495624_0067786_1423_2193 239
282 3300046691 Ga0495670_0207589 Ga0495670_0207589_41_811 239
283 3300046692 Ga0495671_0180778 Ga0495671_0180778_225_983 239
284 3300046694 Ga0495649_0052260 Ga0495649_0052260_1163_1921 239
285 3300046794 Ga0495589_0002240 Ga0495589_0002240_9738_10508 239
286 3300046794 Ga0495589_0041781 Ga0495589_0041781_940_1710 239
287 3300046794 Ga0495589_0051949 Ga0495589_0051949_311_1189 239
288 3300046809 Ga0495600_0007937 Ga0495600_0007937_4714_5472 239
289 3300046809 Ga0495600_0008654 Ga0495600_0008654_4796_5566 239
290 3300046809 Ga0495600_0065112 Ga0495600_0065112_836_1603 239
291 3300047315 Ga0495581_0019208 Ga0495581_0019208_1231_1989 239
292 3300047315 Ga0495581_0096738 Ga0495581_0096738_266_1036 239
293 3300047317 Ga0495604_0001060 Ga0495604_0001060_5695_6462 239
294 3300047317 Ga0495604_0006467 Ga0495604_0006467_1978_2736 239
295 3300047318 Ga0495636_0001884 Ga0495636_0001884_6455_7333 239
296 3300047318 Ga0495636_0024020 Ga0495636_0024020_1529_2299 239
297 3300047319 Ga0495674_0007676 Ga0495674_0007676_8176_8943 239
298 3300047321 Ga0495676_0031666 Ga0495676_0031666_2080_2838 239
299 3300047321 Ga0495676_0068733 Ga0495676_0068733_873_1643 239
300 3300047322 Ga0495680_0007609 Ga0495680_0007609_5259_6029 239
301 3300047323 Ga0495683_0013695 Ga0495683_0013695_2355_3125 239
302 3300047443 Ga0495687_003771 Ga0495687_003771_869_1639 239
303 3300047444 Ga0495675_0033734 Ga0495675_0033734_1664_2431 239
304 3300047444 Ga0495675_0129152 Ga0495675_0129152_496_1254 239
305 3300047445 Ga0495677_0052849 Ga0495677_0052849_246_1016 239
306 3300047447 Ga0495685_011579 Ga0495685_011579_646_1401 239
307 3300047447 Ga0495685_012832 Ga0495685_012832_515_1285 239
308 3300047447 Ga0495685_039045 Ga0495685_039045_17_895 239
309 3300047447 Ga0495685_054236 Ga0495685_054236_360_1130 239
310 3300047469 Ga0495673_0086767 Ga0495673_0086767_444_1214 239
311 3300047470 Ga0495681_0003360 Ga0495681_0003360_2120_2878 239
312 3300047471 Ga0495684_0074908 Ga0495684_0074908_778_1548 239
313 3300047471 Ga0495684_0078439 Ga0495684_0078439_1088_1855 239
314 3300047673 Ga0495593_0007985 Ga0495593_0007985_2248_3006 239
315 3300047673 Ga0495593_0031130 Ga0495593_0031130_1130_1897 239
316 3300048088 Ga0495602_0027338 Ga0495602_0027338_1360_2127 239
317 3300048089 Ga0495614_0033645 Ga0495614_0033645_154_912 239
318 3300048089 Ga0495614_0184013 Ga0495614_0184013_33_803 239
319 3300048090 Ga0495615_0019631 Ga0495615_0019631_26_796 239
320 3300048091 Ga0495626_0063224 Ga0495626_0063224_19_789 239
321 3300048908 Ga0496105_0227627 Ga0496105_0227627_713_1483 239
322 3300048911 Ga0496108_0091741 Ga0496108_0091741_553_1323 239
323 3300048912 Ga0496109_0040035 Ga0496109_0040035_714_1484 239
324 3300048928 Ga0496125_0115848 Ga0496125_0115848_154_924 239
325 3300048929 Ga0496126_0228288 Ga0496126_0228288_353_1123 239
326 3300049129 Ga0501309_000486 Ga0501309_000486_77_973 239
327 3300049534 Ga0501318_000559 Ga0501318_000559_939_1835 239
328 3300049539 Ga0501323_000528 Ga0501323_000528_1524_2420 239
329 3300049539 Ga0501323_000529 Ga0501323_000529_1283_2062 239
330 3300049568 Ga0501031_0030349 Ga0501031_0030349_187_948 239
331 3300049570 Ga0501033_0001734 Ga0501033_0001734_11549_12307 239
332 3300049570 Ga0501033_0110626 Ga0501033_0110626_189_947 239
333 3300049571 Ga0501034_0029729 Ga0501034_0029729_3909_4670 239
334 3300049571 Ga0501034_0072120 Ga0501034_0072120_1219_1977 239
335 3300049571 Ga0501034_0095381 Ga0501034_0095381_1936_2694 239
336 3300049572 Ga0501036_0004651 Ga0501036_0004651_6070_6828 239
337 3300049573 Ga0501037_0035533 Ga0501037_0035533_2635_3396 239
338 3300049573 Ga0501037_0106660 Ga0501037_0106660_218_976 239
339 3300049574 Ga0501038_0020033 Ga0501038_0020033_3018_3779 239
340 3300049575 Ga0501039_0036876 Ga0501039_0036876_1966_2724 239
341 3300049578 Ga0501042_0006221 Ga0501042_0006221_1300_2061 239
342 3300049579 Ga0501043_0009566 Ga0501043_0009566_288_1046 239
343 3300049579 Ga0501043_0037789 Ga0501043_0037789_217_978 239
344 3300049580 Ga0501046_0012145 Ga0501046_0012145_4219_4980 239
345 3300049581 Ga0501047_0058387 Ga0501047_0058387_885_1646 239
346 3300049581 Ga0501047_0153822 Ga0501047_0153822_979_1737 239
347 3300049582 Ga0501048_0008489 Ga0501048_0008489_2127_2888 239
348 3300049586 Ga0501070_0040192 Ga0501070_0040192_1200_1958 239
349 3300049589 Ga0501073_0056284 Ga0501073_0056284_1255_2013 239
350 3300049590 Ga0501074_0047815 Ga0501074_0047815_1214_1972 239
351 3300049822 Ga0501035_0002456 Ga0501035_0002456_12561_13319 239
352 3300049822 Ga0501035_0130552 Ga0501035_0130552_1151_1912 239
353 3300049822 Ga0501035_0219613 Ga0501035_0219613_694_1452 239
354 3300049822 Ga0501035_0241959 Ga0501035_0241959_15_773 239
355 3300049823 Ga0501044_0085043 Ga0501044_0085043_282_1043 239
356 3300049823 Ga0501044_0122874 Ga0501044_0122874_1560_2318 239
357 3300049823 Ga0501044_0166744 Ga0501044_0166744_1203_1961 239
358 3300049823 Ga0501044_0200418 Ga0501044_0200418_927_1685 239
359 3300049823 Ga0501044_0359329 Ga0501044_0359329_14_772 239
360 3300050490 nmdc:mga03n38_6891_c1 nmdc:mga03n38_6891_c1_815_1573 239
361 3300050494 nmdc:mga06z11_532_c1 nmdc:mga06z11_532_c1_12163_12921 239
362 3300050495 nmdc:mga04h51_20902_c1 nmdc:mga04h51_20902_c1_29_787 239
363 3300053077 Ga0495601_0033866 Ga0495601_0033866_1316_2083 239
364 3300053079 Ga0500610_0075020 Ga0500610_0075020_653_1411 239
365 3300053085 Ga0495619_0020492 Ga0495619_0020492_3015_3782 239
366 3300053085 Ga0495619_0074608 Ga0495619_0074608_464_1222 239
367 3300053088 Ga0500644_0039186 Ga0500644_0039186_554_1312 239
368 3300053095 Ga0500640_001478 Ga0500640_001478_3053_3811 239
369 3300053111 Ga0500572_003088 Ga0500572_003088_667_1425 239
370 3300053123 Ga0500614_059138 Ga0500614_059138_56_814 239
371 3300053149 Ga0500600_0160951 Ga0500600_0160951_113_871 239
372 3300053157 Ga0500624_001192 Ga0500624_001192_2910_3668 239
373 3300053160 Ga0500633_0035278 Ga0500633_0035278_389_1147 239
374 3300060353 Ga0501082_0384503 Ga0501082_0384503_96_818 239
375 3300061719 Ga0466962_0023083 Ga0466962_0023083_2023_2781 239
376 3300061719 Ga0466962_0053301 Ga0466962_0053301_946_1704 239
377 3300061719 Ga0466962_0091265 Ga0466962_0091265_32_787 239
378 iso_pu_bacteria 2547132111 2547410578 239
379 iso_pu_bacteria 2554235005 2554256013 239
380 iso_pu_bacteria 2582581313 2585307742 239
381 iso_pu_bacteria 2582581314 2585316757 239
382 iso_pu_bacteria 2616644814 2616700040 239
383 iso_pu_bacteria 2643221587 2643943676 239
384 iso_pu_bacteria 2643221647 2644269590 239
385 iso_pu_bacteria 2643221670 2644387154 239
386 iso_pu_bacteria 2643221677 2644434065 239
387 iso_pu_bacteria 2643221678 2644437766 239
388 iso_pu_bacteria 2643221714 2644629848 239
389 iso_pu_bacteria 2784132148 2784590639 239
390 iso_pu_bacteria 2784746763 2785340946 239
391 iso_pu_bacteria 2784746768 2785371812 239
392 iso_pu_bacteria 2786546132 2786672919 239
393 iso_pu_bacteria 2791355406 2793977157 239
394 iso_pu_bacteria 2802429296 2804848176 239
395 iso_pu_bacteria 2808606359 2808844313 239
396 iso_pu_bacteria 2808606375 2808913887 239
397 iso_pu_bacteria 2808606448 2809234331 239
398 iso_pu_bacteria 2808606982 2811844125 239
399 iso_pu_bacteria 2811994879 2812355697 239
400 iso_pu_bacteria 2852635781 2852639727 239
401 iso_pu_bacteria 2862281513 2862284340 239
402 iso_pu_bacteria 2862507626 2862509056 239
403 iso_pu_bacteria 2862574272 2862577222 239
404 iso_pu_bacteria 2863404153 2863408888 239
405 iso_pu_bacteria 2867428634 2867433946 239
406 iso_pu_bacteria 2877676314 2877678787 239
407 iso_pu_bacteria 2912715099 2912717335 239
408 iso_pu_bacteria 2912723979 2912729914 239
409 iso_pu_bacteria 2912757875 2912763054 239
410 iso_pu_bacteria 2918501144 2918506763 239
411 iso_pu_bacteria 2919468124 2919472497 239
412 iso_pu_bacteria 2935390628 2935392141 239
413 iso_pu_bacteria 2946072368 2946077984 239
414 iso_pu_bacteria 2947224130 2947226681 239
415 iso_pu_bacteria 2954002825 2954005800 239
416 iso_pu_bacteria 2954380949 2954383747 239
417 iso_pu_bacteria 2954673503 2954679225 239
418 iso_pu_bacteria 2954682443 2954684928 239
419 iso_pu_bacteria 2954691527 2954694542 239
420 iso_pu_bacteria 2954701450 2954709747 239
421 iso_pu_bacteria 2954711539 2954714047 239
422 iso_pu_bacteria 2954721474 2954724000 239
423 iso_pu_bacteria 2954731030 2954737840 239
424 iso_pu_bacteria 2954740390 2954742897 239
425 iso_pu_bacteria 2954749733 2954756676 239
426 iso_pu_bacteria 2954759201 2954761854 239
427 iso_pu_bacteria 2990059506 2990062473 239
428 iso_pu_bacteria 2997600082 2997604018 239
429 iso_pu_bacteria 3006393351 3006395885 239
430 iso_pu_bacteria 3006486233 3006487490 239
431 iso_pu_bacteria 3006493962 3006500028 239
432 iso_pu_bacteria 8008574985 8008576897 239
433 iso_pu_bacteria 8023623736 8023625711 239
434 iso_pu_bacteria 8025413630 8025414215 239
435 iso_pu_bacteria 8025530807 8025532672 239
436 iso_pu_bacteria 8047893842 8047895815 239
437 iso_pu_bacteria 8048127548 8048129073 239
438 iso_pu_bacteria 8048356638 8048363119 239
439 iso_pu_bacteria 8048369669 8048372839 239
440 iso_pu_bacteria 8048379754 8048381773 239
441 iso_pu_bacteria 8048406513 8048409792 239
442 iso_pu_bacteria 8056829672 8056831579 239
443 3300002155 JGI24033J26618_1002865 JGI24033J26618_10028652 240
444 3300005844 Ga0068862_100232648 Ga0068862_1002326483 240
445 3300006844 Ga0075428_100038789 Ga0075428_1000387894 240
446 3300006846 Ga0075430_100121002 Ga0075430_1001210023 240
447 3300006847 Ga0075431_100068771 Ga0075431_1000687713 240
448 3300006880 Ga0075429_100057723 Ga0075429_1000577233 240
449 3300009147 Ga0114129_10000959 Ga0114129_1000095923 240
450 3300009147 Ga0114129_10278566 Ga0114129_102785663 240
451 3300034817 Ga0373948_0024112 Ga0373948_0024112_136_885 240
452 3300035242 Ga0373962_0005092 Ga0373962_0005092_2066_2815 240
453 3300041406 Ga0439439_0038114 Ga0439439_0038114_384_1145 240
454 3300042011 Ga0439454_008338 Ga0439454_008338_175_927 240
455 3300042013 Ga0439456_039928 Ga0439456_039928_170_922 240
456 3300042131 Ga0450894_000143 Ga0450894_000143_10563_11324 240
457 3300042133 Ga0450896_000403 Ga0450896_000403_2493_3254 240
458 3300042134 Ga0450898_008444 Ga0450898_008444_74_835 240
459 3300042135 Ga0450899_000010 Ga0450899_000010_10372_11133 240
460 3300042145 Ga0450906_004688 Ga0450906_004688_33_794 240
461 3300042184 Ga0450908_004116 Ga0450908_004116_1641_2402 240
462 3300044656 Ga0466969_0006463 Ga0466969_0006463_2374_3174 240
463 3300044693 Ga0466961_0022807 Ga0466961_0022807_612_1412 240
464 3300044719 Ga0466971_0004202 Ga0466971_0004202_4456_5256 240
465 3300044765 Ga0466970_0166558 Ga0466970_0166558_459_1187 240
466 3300045049 Ga0466959_0003681 Ga0466959_0003681_7207_8007 240
467 3300045976 Ga0466967_0372686 Ga0466967_0372686_145_882 240
468 3300046476 Ga0495662_0019023 Ga0495662_0019023_1539_2321 240
469 3300046679 Ga0495623_0062647 Ga0495623_0062647_881_1663 240
470 3300047317 Ga0495604_0062418 Ga0495604_0062418_1405_2187 240
471 3300047444 Ga0495675_0031161 Ga0495675_0031161_1176_1958 240
472 3300048925 Ga0496122_0004513 Ga0496122_0004513_1919_2641 240
473 3300048926 Ga0496123_0001160 Ga0496123_0001160_33918_34640 240
474 3300048927 Ga0496124_0027394 Ga0496124_0027394_2494_3216 240
475 3300049127 Ga0501306_000830 Ga0501306_000830_905_1777 240
476 3300049539 Ga0501323_021596 Ga0501323_021596_77_841 240
477 3300050507 nmdc:mga05p37_68128_c1 nmdc:mga05p37_68128_c1_2144_2893 240
478 3300050508 nmdc:mga09592_132774_c1 nmdc:mga09592_132774_c1_635_1387 240
479 3300050509 nmdc:mga0qj67_70686_c1 nmdc:mga0qj67_70686_c1_1305_2057 240
480 3300061719 Ga0466962_0007506 Ga0466962_0007506_3415_4215 240
481 iso_pu_bacteria 2862178590 2862181785 240
482 iso_pu_bacteria 2862382967 2862383294 240
483 iso_pu_bacteria 8008558824 8008563056 240
484 3300005617 Ga0068859_100019694 Ga0068859_1000196942 241
485 3300006931 Ga0097620_100019694 Ga0097620_1000196949 241
486 3300009101 Ga0105247_10042151 Ga0105247_100421513 241
487 3300025900 Ga0207710_10018571 Ga0207710_100185713 241
488 3300031251 Ga0265327_10000154 Ga0265327_1000015446 241
489 3300041451 Ga0451791_0820044 Ga0451791_0820044_416_1159 241
490 3300048905 Ga0496102_0001496 Ga0496102_0001496_5274_6014 241
491 3300048906 Ga0496103_0001461 Ga0496103_0001461_14488_15228 241
492 3300048921 Ga0496118_0075513 Ga0496118_0075513_53_793 241
493 3300048922 Ga0496119_0040227 Ga0496119_0040227_22_762 241
494 3300048928 Ga0496125_0003000 Ga0496125_0003000_1938_2678 241
495 3300049569 Ga0501032_0148982 Ga0501032_0148982_281_1126 241
496 3300049571 Ga0501034_0365085 Ga0501034_0365085_208_1053 241
497 3300049581 Ga0501047_0162173 Ga0501047_0162173_1001_1846 241
498 3300049822 Ga0501035_0051344 Ga0501035_0051344_145_990 241
499 3300049823 Ga0501044_0120708 Ga0501044_0120708_1586_2431 241
500 iso_pu_bacteria 2643221690 2644506600 241
501 iso_pu_bacteria 2643221694 2644526489 241
502 iso_pu_bacteria 2643221722 2644671155 241
503 iso_pu_bacteria 2884994152 2884995029 241
504 iso_pu_bacteria 3006425503 3006426525 241
505 3300005440 Ga0070705_100070253 Ga0070705_1000702532 242
506 3300005456 Ga0070678_100028635 Ga0070678_1000286354 242
507 3300005615 Ga0070702_100000206 Ga0070702_10000020613 242
508 3300009148 Ga0105243_10006412 Ga0105243_100064127 242
509 3300011119 Ga0105246_10024519 Ga0105246_100245194 242
510 3300013297 Ga0157378_10039679 Ga0157378_100396792 242
511 3300013308 Ga0157375_10008491 Ga0157375_100084912 242
512 3300014326 Ga0157380_10077644 Ga0157380_100776442 242
513 3300014968 Ga0157379_10404902 Ga0157379_104049022 242
514 3300025935 Ga0207709_10094481 Ga0207709_100944812 242
515 3300026121 Ga0207683_10038481 Ga0207683_100384812 242
516 3300044684 Ga0466966_0016593 Ga0466966_0016593_1442_2236 242
517 3300045049 Ga0466959_0027194 Ga0466959_0027194_2156_2950 242
518 3300047315 Ga0495581_0038922 Ga0495581_0038922_995_1723 242
519 3300048929 Ga0496126_0000006 Ga0496126_0000006_511334_512065 242
520 3300049581 Ga0501047_0275862 Ga0501047_0275862_137_922 242
521 iso_pu_bacteria 8054160619 8054163111 242
522 3300025302 Ga0207426_1002577 Ga0207426_100257710 243
523 3300046459 Ga0495629_0029215 Ga0495629_0029215_1196_1984 243
524 3300048927 Ga0496124_0053226 Ga0496124_0053226_2028_2777 243
525 iso_pu_bacteria 2839986021 2839989397 243
526 iso_pu_bacteria 2867475112 2867480310 243
527 iso_pu_bacteria 2997451912 2997453116 243
528 iso_pu_bacteria 8033684223 8033691061 243
529 3300005466 Ga0070685_10148396 Ga0070685_101483962 244
530 3300005985 Ga0081539_10004121 Ga0081539_1000412119 244
531 3300006028 Ga0070717_10084531 Ga0070717_100845312 244
532 3300047317 Ga0495604_0034158 Ga0495604_0034158_1479_2264 244
533 3300049568 Ga0501031_0205590 Ga0501031_0205590_324_1109 244
534 3300005985 Ga0081539_10005819 Ga0081539_100058197 245
535 3300031616 Ga0307508_10082547 Ga0307508_100825472 245
536 3300037418 Ga0395900_0070245 Ga0395900_0070245_1159_1914 245
537 3300037466 Ga0395898_0017125 Ga0395898_0017125_4072_4827 245
538 3300038443 Ga0395901_0050065 Ga0395901_0050065_230_985 245
539 3300045976 Ga0466967_0094233 Ga0466967_0094233_158_931 245
540 3300048921 Ga0496118_0092478 Ga0496118_0092478_543_1298 245
541 3300048922 Ga0496119_0052850 Ga0496119_0052850_1593_2348 245
542 3300048925 Ga0496122_0001777 Ga0496122_0001777_12855_13610 245
543 3300049568 Ga0501031_0094914 Ga0501031_0094914_468_1238 245
544 3300049570 Ga0501033_0035846 Ga0501033_0035846_2641_3411 245
545 3300049571 Ga0501034_0033067 Ga0501034_0033067_3973_4743 245
546 3300049572 Ga0501036_0051039 Ga0501036_0051039_1755_2525 245
547 3300049573 Ga0501037_0024893 Ga0501037_0024893_1159_1929 245
548 3300049573 Ga0501037_0101417 Ga0501037_0101417_233_1057 245
549 3300049575 Ga0501039_0052106 Ga0501039_0052106_1224_1994 245
550 3300049581 Ga0501047_0000208 Ga0501047_0000208_4485_5309 245
551 3300049581 Ga0501047_0034790 Ga0501047_0034790_2108_2878 245
552 3300049586 Ga0501070_0007681 Ga0501070_0007681_6256_7026 245
553 3300049822 Ga0501035_0100173 Ga0501035_0100173_173_943 245
554 3300049823 Ga0501044_0073821 Ga0501044_0073821_1148_1918 245
555 iso_pu_bacteria 2751185782 2753264693 245
556 iso_pu_bacteria 2848551377 2848551846 245
557 3300005347 Ga0070668_100496493 Ga0070668_1004964931 246
558 3300005367 Ga0070667_100259542 Ga0070667_1002595422 246
559 3300005434 Ga0070709_10427343 Ga0070709_104273431 246
560 3300005437 Ga0070710_10047395 Ga0070710_100473952 246
561 3300005535 Ga0070684_100514227 Ga0070684_1005142271 246
562 3300005578 Ga0068854_100523217 Ga0068854_1005232171 246
563 3300005614 Ga0068856_100716689 Ga0068856_1007166891 246
564 3300005841 Ga0068863_100209541 Ga0068863_1002095413 246
565 3300005842 Ga0068858_100006333 Ga0068858_10000633311 246
566 3300005843 Ga0068860_100693871 Ga0068860_1006938712 246
567 3300005844 Ga0068862_100051084 Ga0068862_1000510842 246
568 3300005937 Ga0081455_10003702 Ga0081455_100037025 246
569 3300005985 Ga0081539_10000357 Ga0081539_1000035769 246
570 3300005985 Ga0081539_10001106 Ga0081539_100011064 246
571 3300006237 Ga0097621_100620510 Ga0097621_1006205102 246
572 3300013105 Ga0157369_10248855 Ga0157369_102488552 246
573 3300014325 Ga0163163_10140598 Ga0163163_101405983 246
574 3300025898 Ga0207692_10038904 Ga0207692_100389043 246
575 3300025900 Ga0207710_10201149 Ga0207710_102011491 246
576 3300025916 Ga0207663_10308449 Ga0207663_103084492 246
577 3300025928 Ga0207700_10328719 Ga0207700_103287192 246
578 3300025931 Ga0207644_10066402 Ga0207644_100664023 246
579 3300025932 Ga0207690_10189439 Ga0207690_101894391 246
580 3300025944 Ga0207661_10545189 Ga0207661_105451891 246
581 3300025972 Ga0207668_10004765 Ga0207668_100047654 246
582 3300025986 Ga0207658_10039649 Ga0207658_100396492 246
583 3300026035 Ga0207703_10024649 Ga0207703_100246494 246
584 3300026067 Ga0207678_10514235 Ga0207678_105142351 246
585 3300028380 Ga0268265_10010581 Ga0268265_100105812 246
586 3300028381 Ga0268264_10008659 Ga0268264_100086597 246
587 3300030522 Ga0307512_10029915 Ga0307512_100299154 246
588 3300030522 Ga0307512_10103148 Ga0307512_101031482 246
589 3300030733 Ga0314311_1151442 Ga0314311_11514423 246
590 3300031507 Ga0307509_10020244 Ga0307509_100202443 246
591 3300031616 Ga0307508_10001514 Ga0307508_100015148 246
592 3300031730 Ga0307516_10002608 Ga0307516_1000260841 246
593 3300031730 Ga0307516_10124303 Ga0307516_101243033 246
594 3300031731 Ga0307405_10048752 Ga0307405_100487523 246
595 3300031824 Ga0307413_10106691 Ga0307413_101066912 246
596 3300031852 Ga0307410_10232142 Ga0307410_102321422 246
597 3300031901 Ga0307406_10055824 Ga0307406_100558241 246
598 3300031903 Ga0307407_10118884 Ga0307407_101188841 246
599 3300031995 Ga0307409_100038809 Ga0307409_1000388094 246
600 3300031995 Ga0307409_100314467 Ga0307409_1003144672 246
601 3300032126 Ga0307415_100018602 Ga0307415_1000186023 246
602 3300032126 Ga0307415_100183066 Ga0307415_1001830663 246
603 3300032126 Ga0307415_100311496 Ga0307415_1003114962 246
604 3300033179 Ga0307507_10012883 Ga0307507_100128834 246
605 3300035692 Ga0373935_0010076 Ga0373935_0010076_998_1759 246
606 3300036401 Ga0373937_0148022 Ga0373937_0148022_552_1418 246
607 3300041512 Ga0451853_0792760 Ga0451853_0792760_1376_2137 246
608 3300041997 Ga0439431_0027020 Ga0439431_0027020_398_1153 246
609 3300044901 Ga0466960_0004092 Ga0466960_0004092_2624_3373 246
610 3300044901 Ga0466960_0152198 Ga0466960_0152198_259_1071 246
611 3300044901 Ga0466960_0193376 Ga0466960_0193376_249_998 246
612 3300045976 Ga0466967_0180790 Ga0466967_0180790_709_1461 246
613 3300046453 Ga0495627_014138 Ga0495627_014138_149_904 246
614 3300047321 Ga0495676_0186429 Ga0495676_0186429_190_1056 246
615 3300048911 Ga0496108_0000048 Ga0496108_0000048_20891_21652 246
616 3300048918 Ga0496115_0106708 Ga0496115_0106708_250_1074 246
617 3300048929 Ga0496126_0062083 Ga0496126_0062083_67_891 246
618 3300059477 Ga0587084_003095 Ga0587084_003095_597_1358 246
619 3300059630 Ga0587128_027308 Ga0587128_027308_16_777 246
620 iso_pu_bacteria 2738541272 2738692482 246
621 iso_pu_bacteria 2738543027 2739323572 246
622 iso_pu_bacteria 2739367654 2739608953 246
623 iso_pu_bacteria 2758568522 2760303597 246
624 iso_pu_bacteria 2758568621 2760622545 246
625 iso_pu_bacteria 2808606394 2809027290 246
626 iso_pu_bacteria 8055412473 8055416074 246
627 iso_pu_bacteria 8056579771 8056584032 246
628 3300028794 Ga0307515_10000045 Ga0307515_10000045261 247
629 3300031730 Ga0307516_10008621 Ga0307516_1000862111 247
630 3300031730 Ga0307516_10047355 Ga0307516_100473553 247
631 3300031824 Ga0307413_10392897 Ga0307413_103928972 247
632 3300031901 Ga0307406_10060524 Ga0307406_100605242 247
633 3300031995 Ga0307409_100657928 Ga0307409_1006579282 247
634 3300033180 Ga0307510_10103011 Ga0307510_101030114 247
635 3300039437 Ga0436365_0038748 Ga0436365_0038748_51_863 247
636 3300046492 Ga0495585_0010195 Ga0495585_0010195_1433_2239 247
637 3300053088 Ga0500644_0110756 Ga0500644_0110756_110_874 247
638 iso_pu_bacteria 2501939600 2501941415 247
639 iso_pu_bacteria 2515154088 2515496009 247
640 iso_pu_bacteria 2515154137 2515757847 247
641 iso_pu_bacteria 2515154203 2516090245 247
642 iso_pu_bacteria 2622736626 2623587235 247
643 iso_pu_bacteria 2772190715 2772642652 247
644 iso_pu_bacteria 2831935698 2831937895 247
645 iso_pu_bacteria 2832004796 2832007505 247
646 iso_pu_bacteria 2855670206 2855671049 247
647 iso_pu_bacteria 2855676851 2855682246 247
648 iso_pu_bacteria 2855683550 2855689292 247
649 iso_pu_bacteria 2856858025 2856861074 247
650 iso_pu_bacteria 2857288857 2857290039 247
651 iso_pu_bacteria 2858848962 2858853001 247
652 iso_pu_bacteria 2858868258 2858872418 247
653 iso_pu_bacteria 2858882152 2858884094 247
654 iso_pu_bacteria 2858888857 2858889752 247
655 iso_pu_bacteria 2858895516 2858896671 247
656 iso_pu_bacteria 2858902515 2858903795 247
657 iso_pu_bacteria 2866065130 2866065265 247
658 iso_pu_bacteria 2867302475 2867304847 247
659 iso_pu_bacteria 2867312974 2867315633 247
660 iso_pu_bacteria 2867319477 2867324402 247
661 iso_pu_bacteria 2867507094 2867507741 247
662 iso_pu_bacteria 2869048445 2869053440 247
663 iso_pu_bacteria 2869061728 2869062103 247
664 iso_pu_bacteria 2869068681 2869073589 247
665 iso_pu_bacteria 2880489317 2880493034 247
666 iso_pu_bacteria 2880495981 2880499269 247
667 iso_pu_bacteria 2902582711 2902588011 247
668 iso_pu_bacteria 2929219909 2929221253 247
669 iso_pu_bacteria 2929226422 2929227868 247
670 iso_pu_bacteria 2996221748 2996226539 247
671 iso_pu_bacteria 3006321560 3006324760 247
672 iso_pu_bacteria 649633069 649811832 247
673 iso_pu_bacteria 8003870546 8003873654 247
674 iso_pu_bacteria 8054704163 8054707551 247
675 iso_pu_bacteria 8054727385 8054731917 247
676 iso_pu_bacteria 8054734606 8054739147 247
677 3300003203 JGI25406J46586_10020172 JGI25406J46586_100201722 248
678 3300005985 Ga0081539_10000420 Ga0081539_1000042069 248
679 3300006846 Ga0075430_100085218 Ga0075430_1000852184 248
680 3300009094 Ga0111539_10216884 Ga0111539_102168843 248
681 3300031456 Ga0307513_10195918 Ga0307513_101959182 248
682 3300046454 Ga0495592_0004769 Ga0495592_0004769_7893_8780 248
683 3300046514 Ga0495618_0031865 Ga0495618_0031865_1165_2052 248
684 3300046516 Ga0495628_0052598 Ga0495628_0052598_1367_2254 248
685 3300046642 Ga0495634_0006470 Ga0495634_0006470_5168_6055 248
686 3300046675 Ga0495657_0021312 Ga0495657_0021312_1166_2053 248
687 3300046689 Ga0495613_0010412 Ga0495613_0010412_3609_4496 248
688 3300046690 Ga0495624_0035600 Ga0495624_0035600_542_1429 248
689 3300046809 Ga0495600_0025856 Ga0495600_0025856_502_1389 248
690 3300047321 Ga0495676_0005722 Ga0495676_0005722_8562_9449 248
691 3300047444 Ga0495675_0041250 Ga0495675_0041250_566_1453 248
692 3300048924 Ga0496121_0008171 Ga0496121_0008171_1080_1913 248
693 3300049569 Ga0501032_0000992 Ga0501032_0000992_12600_13409 248
694 3300049569 Ga0501032_0023250 Ga0501032_0023250_2034_2873 248
695 3300049570 Ga0501033_0026497 Ga0501033_0026497_1287_2096 248
696 3300049570 Ga0501033_0039712 Ga0501033_0039712_1622_2461 248
697 3300049571 Ga0501034_0001415 Ga0501034_0001415_17779_18588 248
698 3300049571 Ga0501034_0075250 Ga0501034_0075250_2071_2910 248
699 3300049572 Ga0501036_0004483 Ga0501036_0004483_407_1216 248
700 3300049572 Ga0501036_0071951 Ga0501036_0071951_479_1318 248
701 3300049573 Ga0501037_0000989 Ga0501037_0000989_17779_18588 248
702 3300049574 Ga0501038_0057117 Ga0501038_0057117_2311_3150 248
703 3300049575 Ga0501039_0010476 Ga0501039_0010476_4358_5167 248
704 3300049576 Ga0501040_0011804 Ga0501040_0011804_130_939 248
705 3300049577 Ga0501041_0018272 Ga0501041_0018272_1912_2721 248
706 3300049578 Ga0501042_0032416 Ga0501042_0032416_1447_2256 248
707 3300049579 Ga0501043_0002379 Ga0501043_0002379_9885_10694 248
708 3300049579 Ga0501043_0094988 Ga0501043_0094988_454_1293 248
709 3300049580 Ga0501046_0006232 Ga0501046_0006232_9393_10202 248
710 3300049581 Ga0501047_0000826 Ga0501047_0000826_13536_14345 248
711 3300049582 Ga0501048_0003265 Ga0501048_0003265_9630_10439 248
712 3300049583 Ga0501067_0012647 Ga0501067_0012647_2284_3093 248
713 3300049584 Ga0501068_0064134 Ga0501068_0064134_1305_2114 248
714 3300049585 Ga0501069_0003487 Ga0501069_0003487_5522_6331 248
715 3300049586 Ga0501070_0019772 Ga0501070_0019772_3552_4361 248
716 3300049587 Ga0501071_0001692 Ga0501071_0001692_9432_10241 248
717 3300049588 Ga0501072_0002777 Ga0501072_0002777_11162_11971 248
718 3300049592 Ga0501076_0067249 Ga0501076_0067249_698_1507 248
719 3300049741 Ga0501079_0026729 Ga0501079_0026729_2404_3213 248
720 3300049744 Ga0501083_0005593 Ga0501083_0005593_1688_2497 248
721 3300049822 Ga0501035_0003339 Ga0501035_0003339_1032_1841 248
722 3300049822 Ga0501035_0060331 Ga0501035_0060331_1240_2079 248
723 3300049823 Ga0501044_0002530 Ga0501044_0002530_2232_3041 248
724 3300049823 Ga0501044_0089148 Ga0501044_0089148_1633_2472 248
725 3300060353 Ga0501082_0009457 Ga0501082_0009457_2062_2871 248
726 iso_pu_bacteria 2675903059 2676485967 248
727 3300005329 Ga0070683_100181510 Ga0070683_1001815102 249
728 3300005329 Ga0070683_100264882 Ga0070683_1002648822 249
729 3300005336 Ga0070680_100118493 Ga0070680_1001184932 249
730 3300005344 Ga0070661_100175893 Ga0070661_1001758932 249
731 3300005345 Ga0070692_10040530 Ga0070692_100405303 249
732 3300005347 Ga0070668_100358606 Ga0070668_1003586062 249
733 3300005364 Ga0070673_100395436 Ga0070673_1003954362 249
734 3300005438 Ga0070701_10032590 Ga0070701_100325902 249
735 3300005440 Ga0070705_100110886 Ga0070705_1001108862 249
736 3300005441 Ga0070700_100114999 Ga0070700_1001149992 249
737 3300005459 Ga0068867_100223156 Ga0068867_1002231561 249
738 3300005546 Ga0070696_100136822 Ga0070696_1001368222 249
739 3300005547 Ga0070693_100327398 Ga0070693_1003273981 249
740 3300005549 Ga0070704_100248071 Ga0070704_1002480712 249
741 3300005577 Ga0068857_100004499 Ga0068857_1000044997 249
742 3300005577 Ga0068857_100247785 Ga0068857_1002477852 249
743 3300005578 Ga0068854_100038111 Ga0068854_1000381114 249
744 3300005578 Ga0068854_100325524 Ga0068854_1003255242 249
745 3300005616 Ga0068852_100137531 Ga0068852_1001375313 249
746 3300005617 Ga0068859_100042613 Ga0068859_1000426134 249
747 3300005618 Ga0068864_100144856 Ga0068864_1001448562 249
748 3300005718 Ga0068866_10103594 Ga0068866_101035942 249
749 3300005840 Ga0068870_10016569 Ga0068870_100165693 249
750 3300005842 Ga0068858_100097696 Ga0068858_1000976964 249
751 3300005843 Ga0068860_100522767 Ga0068860_1005227672 249
752 3300005844 Ga0068862_100169007 Ga0068862_1001690073 249
753 3300005937 Ga0081455_10084092 Ga0081455_100840922 249
754 3300006844 Ga0075428_100040339 Ga0075428_1000403394 249
755 3300006844 Ga0075428_100084482 Ga0075428_1000844824 249
756 3300006847 Ga0075431_100287076 Ga0075431_1002870762 249
757 3300006880 Ga0075429_100013670 Ga0075429_1000136703 249
758 3300006881 Ga0068865_100234717 Ga0068865_1002347172 249
759 3300006881 Ga0068865_100241467 Ga0068865_1002414672 249
760 3300006931 Ga0097620_100042613 Ga0097620_1000426134 249
761 3300009094 Ga0111539_10004030 Ga0111539_100040305 249
762 3300009094 Ga0111539_10006384 Ga0111539_1000638411 249
763 3300009098 Ga0105245_10115187 Ga0105245_101151872 249
764 3300009101 Ga0105247_10085049 Ga0105247_100850493 249
765 3300009147 Ga0114129_10062927 Ga0114129_100629276 249
766 3300009147 Ga0114129_10074244 Ga0114129_100742443 249
767 3300009148 Ga0105243_10100989 Ga0105243_101009893 249
768 3300009148 Ga0105243_10110902 Ga0105243_101109022 249
769 3300009553 Ga0105249_10030610 Ga0105249_100306102 249
770 3300009553 Ga0105249_10140054 Ga0105249_101400542 249
771 3300010375 Ga0105239_10207467 Ga0105239_102074673 249
772 3300011119 Ga0105246_10026470 Ga0105246_100264703 249
773 3300013297 Ga0157378_10345462 Ga0157378_103454622 249
774 3300013306 Ga0163162_10174404 Ga0163162_101744042 249
775 3300013308 Ga0157375_10068159 Ga0157375_100681592 249
776 3300014325 Ga0163163_10157782 Ga0163163_101577823 249
777 3300014968 Ga0157379_10305339 Ga0157379_103053392 249
778 3300025899 Ga0207642_10108303 Ga0207642_101083032 249
779 3300025927 Ga0207687_10136803 Ga0207687_101368033 249
780 3300025927 Ga0207687_10214684 Ga0207687_102146842 249
781 3300025927 Ga0207687_10218138 Ga0207687_102181382 249
782 3300025933 Ga0207706_10013802 Ga0207706_100138026 249
783 3300025933 Ga0207706_10071661 Ga0207706_100716612 249
784 3300025941 Ga0207711_10075784 Ga0207711_100757842 249
785 3300025944 Ga0207661_10074710 Ga0207661_100747103 249
786 3300025961 Ga0207712_10100603 Ga0207712_101006032 249
787 3300026023 Ga0207677_10032237 Ga0207677_100322373 249
788 3300026075 Ga0207708_10007293 Ga0207708_100072934 249
789 3300026075 Ga0207708_10082761 Ga0207708_100827612 249
790 3300026078 Ga0207702_10314145 Ga0207702_103141452 249
791 3300026088 Ga0207641_10117850 Ga0207641_101178503 249
792 3300026089 Ga0207648_10512844 Ga0207648_105128442 249
793 3300026095 Ga0207676_10067759 Ga0207676_100677592 249
794 3300026116 Ga0207674_10002093 Ga0207674_100020937 249
795 3300026116 Ga0207674_10144115 Ga0207674_101441152 249
796 3300026116 Ga0207674_10522234 Ga0207674_105222342 249
797 3300026118 Ga0207675_100307960 Ga0207675_1003079601 249
798 3300026142 Ga0207698_10305604 Ga0207698_103056042 249
799 3300031548 Ga0307408_100023257 Ga0307408_1000232574 249
800 3300031548 Ga0307408_100103878 Ga0307408_1001038782 249
801 3300031824 Ga0307413_10009249 Ga0307413_100092492 249
802 3300031852 Ga0307410_10124993 Ga0307410_101249932 249
803 3300031901 Ga0307406_10268643 Ga0307406_102686432 249
804 3300031903 Ga0307407_10077267 Ga0307407_100772673 249
805 3300031903 Ga0307407_10137627 Ga0307407_101376273 249
806 3300031995 Ga0307409_100014786 Ga0307409_1000147862 249
807 3300032002 Ga0307416_100028486 Ga0307416_1000284862 249
808 3300032126 Ga0307415_100012878 Ga0307415_1000128784 249
809 3300032126 Ga0307415_100135208 Ga0307415_1001352082 249
810 3300042005 Ga0439448_0040261 Ga0439448_0040261_648_1424 249
811 3300046453 Ga0495627_064729 Ga0495627_064729_67_843 249
812 3300046458 Ga0495591_026417 Ga0495591_026417_959_1735 249
813 3300046474 Ga0495605_0018566 Ga0495605_0018566_1186_1962 249
814 3300046500 Ga0495596_0076899 Ga0495596_0076899_212_988 249
815 3300046506 Ga0495583_0073647 Ga0495583_0073647_613_1389 249
816 3300046520 Ga0495637_0020761 Ga0495637_0020761_851_1627 249
817 3300046522 Ga0495643_0129877 Ga0495643_0129877_73_849 249
818 3300046542 Ga0495597_0081153 Ga0495597_0081153_553_1329 249
819 3300046558 Ga0495633_0058987 Ga0495633_0058987_58_834 249
820 3300046615 Ga0495656_0034974 Ga0495656_0034974_203_979 249
821 3300046648 Ga0495611_0014088 Ga0495611_0014088_1593_2369 249
822 3300046665 Ga0495661_0110815 Ga0495661_0110815_687_1463 249
823 3300046691 Ga0495670_0101844 Ga0495670_0101844_619_1395 249
824 3300046794 Ga0495589_0048782 Ga0495589_0048782_493_1269 249
825 3300047446 Ga0495679_037038 Ga0495679_037038_460_1236 249
826 3300047471 Ga0495684_0231616 Ga0495684_0231616_15_764 249
827 3300048905 Ga0496102_0151679 Ga0496102_0151679_70_846 249
828 3300048909 Ga0496106_0103348 Ga0496106_0103348_1222_1998 249
829 3300048911 Ga0496108_0014451 Ga0496108_0014451_2342_3118 249
830 3300048912 Ga0496109_0000991 Ga0496109_0000991_16216_16992 249
831 3300048913 Ga0496110_0001407 Ga0496110_0001407_4704_5480 249
832 3300048914 Ga0496111_0000429 Ga0496111_0000429_11395_12171 249
833 3300048916 Ga0496113_0190271 Ga0496113_0190271_34_810 249
834 3300049583 Ga0501067_0051974 Ga0501067_0051974_561_1337 249
835 3300049584 Ga0501068_0007032 Ga0501068_0007032_2925_3701 249
836 3300049585 Ga0501069_0013055 Ga0501069_0013055_369_1145 249
837 3300049587 Ga0501071_0015826 Ga0501071_0015826_1955_2731 249
838 3300049588 Ga0501072_0139768 Ga0501072_0139768_867_1643 249
839 3300049593 Ga0501077_0131028 Ga0501077_0131028_309_1085 249
840 3300050507 nmdc:mga05p37_3875_c1 nmdc:mga05p37_3875_c1_2176_2949 249
841 3300050508 nmdc:mga09592_5576_c1 nmdc:mga09592_5576_c1_4656_5429 249
842 3300050510 nmdc:mga06r32_74469_c1 nmdc:mga06r32_74469_c1_1713_2486 249
843 3300050511 nmdc:mga08y16_23786_c1 nmdc:mga08y16_23786_c1_605_1381 249
844 3300053083 Ga0495655_0018863 Ga0495655_0018863_498_1274 249
845 3300005616 Ga0068852_100543192 Ga0068852_1005431922 250
846 3300005937 Ga0081455_10099280 Ga0081455_100992803 250
847 3300005981 Ga0081538_10000136 Ga0081538_1000013664 250
848 3300005981 Ga0081538_10006490 Ga0081538_100064905 250
849 3300005981 Ga0081538_10014059 Ga0081538_100140597 250
850 3300009093 Ga0105240_10184424 Ga0105240_101844242 250
851 3300031824 Ga0307413_10106511 Ga0307413_101065112 250
852 3300031852 Ga0307410_10061864 Ga0307410_100618642 250
853 3300031995 Ga0307409_100011803 Ga0307409_1000118037 250
854 3300032002 Ga0307416_100006529 Ga0307416_1000065296 250
855 3300032126 Ga0307415_100000048 Ga0307415_10000004813 250
856 3300037312 Ga0395899_0001267 Ga0395899_0001267_10265_11041 250
857 3300037312 Ga0395899_0004240 Ga0395899_0004240_70_915 250
858 3300037312 Ga0395899_0010571 Ga0395899_0010571_2458_3234 250
859 3300037418 Ga0395900_0003489 Ga0395900_0003489_11010_11786 250
860 3300037418 Ga0395900_0021539 Ga0395900_0021539_569_1345 250
861 3300037466 Ga0395898_0001276 Ga0395898_0001276_9328_10104 250
862 3300037466 Ga0395898_0008267 Ga0395898_0008267_513_1289 250
863 3300037466 Ga0395898_0312915 Ga0395898_0312915_475_1251 250
864 3300037471 Ga0395905_0001281 Ga0395905_0001281_11667_12443 250
865 3300037471 Ga0395905_0064766 Ga0395905_0064766_1707_2483 250
866 3300037471 Ga0395905_0142852 Ga0395905_0142852_149_925 250
867 3300038443 Ga0395901_0001957 Ga0395901_0001957_10105_10881 250
868 3300038443 Ga0395901_0222063 Ga0395901_0222063_1152_1928 250
869 3300038443 Ga0395901_0374395 Ga0395901_0374395_177_953 250
870 3300049568 Ga0501031_0005807 Ga0501031_0005807_44_817 250
871 3300049568 Ga0501031_0016112 Ga0501031_0016112_892_1665 250
872 3300049568 Ga0501031_0017675 Ga0501031_0017675_150_926 250
873 3300049569 Ga0501032_0002668 Ga0501032_0002668_11407_12180 250
874 3300049569 Ga0501032_0059760 Ga0501032_0059760_1744_2517 250
875 3300049569 Ga0501032_0115109 Ga0501032_0115109_523_1299 250
876 3300049570 Ga0501033_0005054 Ga0501033_0005054_2430_3203 250
877 3300049570 Ga0501033_0011384 Ga0501033_0011384_4416_5189 250
878 3300049571 Ga0501034_0007242 Ga0501034_0007242_7388_8161 250
879 3300049572 Ga0501036_0000693 Ga0501036_0000693_812_1585 250
880 3300049572 Ga0501036_0012654 Ga0501036_0012654_892_1665 250
881 3300049573 Ga0501037_0024000 Ga0501037_0024000_127_900 250
882 3300049573 Ga0501037_0040290 Ga0501037_0040290_1684_2457 250
883 3300049573 Ga0501037_0092676 Ga0501037_0092676_609_1385 250
884 3300049574 Ga0501038_0000548 Ga0501038_0000548_17278_18051 250
885 3300049574 Ga0501038_0027217 Ga0501038_0027217_1619_2392 250
886 3300049575 Ga0501039_0000176 Ga0501039_0000176_15686_16459 250
887 3300049575 Ga0501039_0004489 Ga0501039_0004489_9599_10372 250
888 3300049576 Ga0501040_0000992 Ga0501040_0000992_7576_8349 250
889 3300049576 Ga0501040_0005177 Ga0501040_0005177_7596_8369 250
890 3300049577 Ga0501041_0000022 Ga0501041_0000022_48882_49655 250
891 3300049577 Ga0501041_0022644 Ga0501041_0022644_292_1065 250
892 3300049577 Ga0501041_0112204 Ga0501041_0112204_804_1580 250
893 3300049578 Ga0501042_0000092 Ga0501042_0000092_17115_17888 250
894 3300049578 Ga0501042_0000116 Ga0501042_0000116_23500_24273 250
895 3300049579 Ga0501043_0008893 Ga0501043_0008893_50_823 250
896 3300049579 Ga0501043_0134946 Ga0501043_0134946_890_1663 250
897 3300049581 Ga0501047_0001408 Ga0501047_0001408_11283_12056 250
898 3300049581 Ga0501047_0010177 Ga0501047_0010177_883_1656 250
899 3300049582 Ga0501048_0001223 Ga0501048_0001223_11439_12212 250
900 3300049582 Ga0501048_0002836 Ga0501048_0002836_2863_3636 250
901 3300049583 Ga0501067_0045158 Ga0501067_0045158_650_1423 250
902 3300049584 Ga0501068_0000554 Ga0501068_0000554_11429_12202 250
903 3300049584 Ga0501068_0010233 Ga0501068_0010233_2893_3666 250
904 3300049585 Ga0501069_0004761 Ga0501069_0004761_3680_4453 250
905 3300049585 Ga0501069_0005499 Ga0501069_0005499_708_1481 250
906 3300049586 Ga0501070_0008506 Ga0501070_0008506_884_1657 250
907 3300049586 Ga0501070_0034042 Ga0501070_0034042_3188_3961 250
908 3300049587 Ga0501071_0001793 Ga0501071_0001793_892_1665 250
909 3300049588 Ga0501072_0003510 Ga0501072_0003510_7239_8012 250
910 3300049588 Ga0501072_0024735 Ga0501072_0024735_292_1065 250
911 3300049589 Ga0501073_0016876 Ga0501073_0016876_2863_3636 250
912 3300049590 Ga0501074_0002118 Ga0501074_0002118_11417_12190 250
913 3300049590 Ga0501074_0004639 Ga0501074_0004639_6207_6980 250
914 3300049591 Ga0501075_0000040 Ga0501075_0000040_44141_44914 250
915 3300049591 Ga0501075_0003487 Ga0501075_0003487_146_919 250
916 3300049591 Ga0501075_0011446 Ga0501075_0011446_1600_2376 250
917 3300049592 Ga0501076_0000389 Ga0501076_0000389_11885_12658 250
918 3300049592 Ga0501076_0000462 Ga0501076_0000462_3673_4446 250
919 3300049592 Ga0501076_0371470 Ga0501076_0371470_289_1065 250
920 3300049593 Ga0501077_0002796 Ga0501077_0002796_9383_10159 250
921 3300049593 Ga0501077_0002948 Ga0501077_0002948_86_859 250
922 3300049593 Ga0501077_0004601 Ga0501077_0004601_3189_3962 250
923 3300049741 Ga0501079_0000221 Ga0501079_0000221_23500_24273 250
924 3300049741 Ga0501079_0004632 Ga0501079_0004632_62_835 250
925 3300049741 Ga0501079_0038108 Ga0501079_0038108_1370_2146 250
926 3300049741 Ga0501079_0385983 Ga0501079_0385983_310_1086 250
927 3300049742 Ga0501080_0020495 Ga0501080_0020495_3737_4510 250
928 3300049742 Ga0501080_0076027 Ga0501080_0076027_1609_2382 250
929 3300049742 Ga0501080_0118518 Ga0501080_0118518_1205_1981 250
930 3300049743 Ga0501081_0000040 Ga0501081_0000040_22663_23436 250
931 3300049744 Ga0501083_0000928 Ga0501083_0000928_7239_8012 250
932 3300049744 Ga0501083_0025547 Ga0501083_0025547_619_1392 250
933 3300049822 Ga0501035_0006640 Ga0501035_0006640_7239_8012 250
934 3300049822 Ga0501035_0017516 Ga0501035_0017516_1619_2392 250
935 3300049823 Ga0501044_0006326 Ga0501044_0006326_1788_2561 250
936 3300049824 Ga0501045_0000098 Ga0501045_0000098_7223_7996 250
937 3300049824 Ga0501045_0002356 Ga0501045_0002356_1589_2365 250
938 3300049824 Ga0501045_0003655 Ga0501045_0003655_292_1065 250
939 3300049824 Ga0501045_0166089 Ga0501045_0166089_834_1613 250
940 3300054114 Ga0501084_0000228 Ga0501084_0000228_11439_12212 250
941 3300054114 Ga0501084_0000955 Ga0501084_0000955_11899_12672 250
942 3300054114 Ga0501084_0051910 Ga0501084_0051910_1547_2320 250
943 3300054114 Ga0501084_0579896 Ga0501084_0579896_74_850 250
944 3300060353 Ga0501082_0000313 Ga0501082_0000313_18948_19721 250
945 3300060353 Ga0501082_0001912 Ga0501082_0001912_7936_8709 250
946 3300061734 Ga0530510_0000233 Ga0530510_0000233_22663_23436 250
947 3300061734 Ga0530510_0002808 Ga0530510_0002808_891_1664 250
948 3300061734 Ga0530510_0058431 Ga0530510_0058431_1239_2015 250
949 3300061734 Ga0530510_0451617 Ga0530510_0451617_78_839 250
950 iso_pu_bacteria 2622736605 2623502040 251
951 3300044901 Ga0466960_0284999 Ga0466960_0284999_137_904 255
952 3300046473 Ga0495582_0123751 Ga0495582_0123751_461_1240 255
953 3300000549 LJQas_1008627 LJQas_10086272 256
954 3300005329 Ga0070683_100294495 Ga0070683_1002944951 256
955 3300005435 Ga0070714_100525509 Ga0070714_1005255092 256
956 3300025933 Ga0207706_10419721 Ga0207706_104197212 256
957 3300025944 Ga0207661_10128943 Ga0207661_101289432 256
958 3300031548 Ga0307408_100185655 Ga0307408_1001856552 256
959 3300031731 Ga0307405_10347032 Ga0307405_103470322 256
960 3300031731 Ga0307405_10349468 Ga0307405_103494682 256
961 3300031852 Ga0307410_10164366 Ga0307410_101643662 256
962 3300031901 Ga0307406_10053277 Ga0307406_100532773 256
963 3300031901 Ga0307406_10073419 Ga0307406_100734193 256
964 3300031901 Ga0307406_10304865 Ga0307406_103048652 256
965 3300031903 Ga0307407_10095416 Ga0307407_100954162 256
966 3300031911 Ga0307412_10354291 Ga0307412_103542912 256
967 3300031995 Ga0307409_100020946 Ga0307409_1000209462 256
968 3300031995 Ga0307409_100060901 Ga0307409_1000609013 256
969 3300031995 Ga0307409_100069355 Ga0307409_1000693551 256
970 3300031995 Ga0307409_100133126 Ga0307409_1001331262 256
971 3300031995 Ga0307409_100263053 Ga0307409_1002630531 256
972 3300031995 Ga0307409_100305097 Ga0307409_1003050972 256
973 3300031995 Ga0307409_100639544 Ga0307409_1006395442 256
974 3300032002 Ga0307416_100188162 Ga0307416_1001881622 256
975 3300032002 Ga0307416_100267892 Ga0307416_1002678922 256
976 3300032002 Ga0307416_100488972 Ga0307416_1004889722 256
977 3300032004 Ga0307414_10121022 Ga0307414_101210223 256
978 3300032005 Ga0307411_10156781 Ga0307411_101567812 256
979 3300032005 Ga0307411_10349817 Ga0307411_103498172 256
980 3300032005 Ga0307411_10654423 Ga0307411_106544231 256
981 3300032126 Ga0307415_100031159 Ga0307415_1000311594 256
982 3300032126 Ga0307415_100092379 Ga0307415_1000923792 256
983 3300044684 Ga0466966_0117343 Ga0466966_0117343_670_1485 256
984 3300044684 Ga0466966_0200000 Ga0466966_0200000_137_949 256
985 3300044684 Ga0466966_0283682 Ga0466966_0283682_96_881 256
986 3300044706 Ga0466964_0120805 Ga0466964_0120805_303_1073 256
987 3300044842 Ga0466957_0058790 Ga0466957_0058790_1223_1993 256
988 3300044842 Ga0466957_0114486 Ga0466957_0114486_275_1090 256
989 3300048915 Ga0496112_0391674 Ga0496112_0391674_241_1011 256
990 3300049521 Ga0501298_024281 Ga0501298_024281_39_809 256
991 3300049661 Ga0501217_073485 Ga0501217_073485_154_924 256
992 3300061719 Ga0466962_0037246 Ga0466962_0037246_1177_1992 256
993 3300061719 Ga0466962_0152958 Ga0466962_0152958_73_843 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

61

271

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bl7-assembly1.cif.gz_A crystal structure of umpk from m. tuberculosis in complex with udp and utp (p21212 form) 0.9252 21 254
7bix-assembly2.cif.gz_L crystal structure of umpk from m. tuberculosis in complex with udp and utp (c2 form) 0.9235 21 254
2bnf-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with utp 0.9216 22 254
7bix-assembly2.cif.gz_L crystal structure of umpk from m. tuberculosis in complex with udp and utp (c2 form) 0.9196 21 254
2bnd-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with udp 0.9191 22 254
ID Description Score Start End Superfamily
af_P9WHK5_22_261_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9258 17 254 3.40.1160.10
af_P9WHK5_22_261_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9108 17 254 3.40.1160.10
2jjxC00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9092 22 256 3.40.1160.10
af_A0A1D6G3Z5_82_358_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9057 17 256 3.40.1160.10
3ek5B00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8928 22 256 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A7K1AUN4-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9908 165 253 GO:0005524
GO:0006225
GO:0033862
AF-A0A7C0W0S4-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9878 165 255 GO:0005524
GO:0006225
GO:0033862
AF-Q4BV13-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9875 159 253 GO:0005524
GO:0006225
GO:0033862
AF-A0A6B3GNC0-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9846 153 254 GO:0005524
GO:0006225
GO:0033862
AF-A0A7K1AUN4-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9799 165 253 GO:0005524
GO:0006225
GO:0033862

Feature Viewer

pLDDT pTM Quality
83.6 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map