F487700
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 993 | 532 | 835 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300049129|Ga0501309_000486|Ga0501309_000486_77_973 |
| Length | 298 |
| Sequence | VDAVTWRVTDDSRSDEEAIAAHGLRTPHRQWPSSYVHHVKEAGSPMTTTKAQKSNDGKASGRFLLKLSGEAFAGGGSLGVDPDVVHKIAREIAAVVRDGAEIAVVIGGGNFFRGAELQVRGMDRARSDYMGMLGTVMNCLALQDFLEKEGIDSRVQTAITMGQVAEPYIPLRAVRHLEKGRVVIFGAGMGMPYFSTDTTAAQRALEIDAEALLMGKNGVDGVYDSDPKTNPEAVKFDALGYGEVITRDLKVADMTAITLCRDNKLPILVFELLVEGNIARAVKGEKIGTLVSDQGTRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 4 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 5 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 6 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 7 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 8 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 9 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 10 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 11 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 12 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 13 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 14 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 15 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 16 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 17 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 18 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 19 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 20 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 21 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 22 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 23 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 24 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 25 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 26 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 27 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 28 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 29 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 30 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 31 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 32 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 33 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 34 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 35 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 36 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 37 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 38 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 39 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 40 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 41 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 42 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 43 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 44 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 45 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 46 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 47 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 48 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 49 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 50 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 51 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 52 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 53 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 54 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 55 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 56 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 57 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 58 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 59 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 60 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 61 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 62 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 63 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 64 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 65 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 66 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 67 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 68 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 69 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 70 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 71 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 72 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 73 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 74 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 75 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 76 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 77 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 78 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 79 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 80 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 81 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 82 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 83 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 84 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 85 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 86 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 87 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 88 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 89 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 90 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 91 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 92 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 93 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 94 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 95 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 96 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 97 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 98 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 99 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 100 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 101 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 102 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 103 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 104 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 105 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 106 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 107 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 108 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 109 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 110 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 111 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 112 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 113 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 114 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 115 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 116 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 117 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 118 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 119 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 120 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 121 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 122 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 123 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 124 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 125 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 126 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 127 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 128 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 129 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 130 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 131 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 132 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 133 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 134 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 135 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 136 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 137 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 138 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 139 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 140 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 141 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 142 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 144 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 148 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 151 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 153 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 156 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 157 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 158 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 162 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 163 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 164 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 165 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 167 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 168 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 169 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 170 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 171 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 172 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 173 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 174 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 175 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 176 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 177 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 178 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 180 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 181 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 183 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 184 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 185 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 186 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 187 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 205 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 207 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 208 | 3300023436 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 | Metatranscriptome | Rhizosphere |
| 209 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 245 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 246 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 247 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 248 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 249 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 252 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 253 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 254 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 255 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 256 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 258 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 259 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 260 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 261 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 262 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 264 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 265 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 266 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 267 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 268 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 269 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 270 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 276 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 280 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 281 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 282 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 283 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 286 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 287 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 288 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 289 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 290 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 291 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 292 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 293 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 294 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 295 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 296 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 297 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 298 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 299 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 300 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 301 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 302 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 303 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 304 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 305 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 306 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 307 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 308 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 309 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 310 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 311 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 312 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 313 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 314 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 315 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 316 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 317 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 409 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 410 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 411 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 412 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 415 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 416 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 417 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 418 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 419 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 420 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 421 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 422 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 423 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 424 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 425 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 426 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 427 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 430 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 459 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 460 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 469 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 470 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 477 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 480 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 483 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 485 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 486 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 487 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 488 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 489 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 490 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 491 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 492 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 493 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 494 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 495 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 496 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 497 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 498 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 499 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 500 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 501 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 506 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 507 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 508 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 509 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 510 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 511 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 512 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 513 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 514 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 515 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 516 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 517 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 518 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 519 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 520 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 521 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 522 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 523 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 524 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 525 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 526 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 527 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 528 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 529 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 530 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 531 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 532 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.08 |
| Metatranscriptomes | 1.01 |
| Isolates | 15.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.83 |
| Nodule | 0.91 |
| Rhizoplane | 1.91 |
| Rhizosphere | 78.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1008627 | 3300000549 | Bacteria | 1237 |
| 2 | JGI24739J22299_10012724 | 3300001989 | Bacteria | 3085 |
| 3 | JGI24737J22298_10015604 | 3300001990 | Bacteria | 2458 |
| 4 | JGI24033J26618_1002865 | 3300002155 | Bacteria | 1791 |
| 5 | JGI25406J46586_10020172 | 3300003203 | Bacteria | 2701 |
| 6 | JGI25153J46596_10036081 | 3300003215 | Bacteria | 1591 |
| 7 | JGI25160J50197_1032677 | 3300003354 | Bacteria | 1319 |
| 8 | Ga0070683_100181510 | 3300005329 | Bacteria | 1998 |
| 9 | Ga0070683_100264882 | 3300005329 | Bacteria | 1635 |
| 10 | Ga0070683_100294495 | 3300005329 | Bacteria | 1543 |
| 11 | Ga0070680_100118493 | 3300005336 | Bacteria | 2208 |
| 12 | Ga0070661_100175893 | 3300005344 | Bacteria | 1627 |
| 13 | Ga0070692_10040530 | 3300005345 | Bacteria | 2382 |
| 14 | Ga0070668_100358606 | 3300005347 | Bacteria | 1236 |
| 15 | Ga0070668_100496493 | 3300005347 | Bacteria | 1056 |
| 16 | Ga0070673_100395436 | 3300005364 | Bacteria | 1235 |
| 17 | Ga0070667_100259542 | 3300005367 | Bacteria | 1555 |
| 18 | Ga0070709_10427343 | 3300005434 | Bacteria | 994 |
| 19 | Ga0070714_100525509 | 3300005435 | Bacteria | 1131 |
| 20 | Ga0070710_10047395 | 3300005437 | Bacteria | 2397 |
| 21 | Ga0070701_10032590 | 3300005438 | Bacteria | 2597 |
| 22 | Ga0070705_100070253 | 3300005440 | Bacteria | 2114 |
| 23 | Ga0070705_100110886 | 3300005440 | Bacteria | 1753 |
| 24 | Ga0070700_100114999 | 3300005441 | Bacteria | 1794 |
| 25 | Ga0070663_100284069 | 3300005455 | Bacteria | 1320 |
| 26 | Ga0070678_100028635 | 3300005456 | Bacteria | 3803 |
| 27 | Ga0068867_100223156 | 3300005459 | Bacteria | 1520 |
| 28 | Ga0070685_10148396 | 3300005466 | Bacteria | 1484 |
| 29 | Ga0070684_100514227 | 3300005535 | Bacteria | 1109 |
| 30 | Ga0070696_100136822 | 3300005546 | Bacteria | 1786 |
| 31 | Ga0070693_100327398 | 3300005547 | Bacteria | 1041 |
| 32 | Ga0070704_100248071 | 3300005549 | Bacteria | 1461 |
| 33 | Ga0068855_100284016 | 3300005563 | Bacteria | 1837 |
| 34 | Ga0068857_100004499 | 3300005577 | Bacteria | 11782 |
| 35 | Ga0068857_100247785 | 3300005577 | Bacteria | 1633 |
| 36 | Ga0068854_100038111 | 3300005578 | Bacteria | 3379 |
| 37 | Ga0068854_100325524 | 3300005578 | Bacteria | 1251 |
| 38 | Ga0068854_100523217 | 3300005578 | Bacteria | 1002 |
| 39 | Ga0068856_100274909 | 3300005614 | Bacteria | 1701 |
| 40 | Ga0068856_100716689 | 3300005614 | Bacteria | 1021 |
| 41 | Ga0070702_100000206 | 3300005615 | Bacteria | 19426 |
| 42 | Ga0068852_100137531 | 3300005616 | Bacteria | 2257 |
| 43 | Ga0068852_100543192 | 3300005616 | Bacteria | 1162 |
| 44 | Ga0068859_100019694 | 3300005617 | Bacteria | 6777 |
| 45 | Ga0068859_100042613 | 3300005617 | Bacteria | 4560 |
| 46 | Ga0068864_100144856 | 3300005618 | Bacteria | 2147 |
| 47 | Ga0068866_10103594 | 3300005718 | Bacteria | 1574 |
| 48 | Ga0068870_10016569 | 3300005840 | Bacteria | 3525 |
| 49 | Ga0068863_100209541 | 3300005841 | Bacteria | 1877 |
| 50 | Ga0068858_100006333 | 3300005842 | Bacteria | 11524 |
| 51 | Ga0068858_100097696 | 3300005842 | Bacteria | 2737 |
| 52 | Ga0068860_100522767 | 3300005843 | Bacteria | 1187 |
| 53 | Ga0068860_100693871 | 3300005843 | Bacteria | 1027 |
| 54 | Ga0068862_100051084 | 3300005844 | Bacteria | 3535 |
| 55 | Ga0068862_100169007 | 3300005844 | Bacteria | 1956 |
| 56 | Ga0068862_100232648 | 3300005844 | Bacteria | 1673 |
| 57 | Ga0081455_10003702 | 3300005937 | Bacteria | 17507 |
| 58 | Ga0081455_10084092 | 3300005937 | Bacteria | 2598 |
| 59 | Ga0081455_10099280 | 3300005937 | Bacteria | 2342 |
| 60 | Ga0081538_10000136 | 3300005981 | Bacteria | 76141 |
| 61 | Ga0081538_10006490 | 3300005981 | Bacteria | 10291 |
| 62 | Ga0081538_10014059 | 3300005981 | Bacteria | 6291 |
| 63 | Ga0081539_10000357 | 3300005985 | Bacteria | 100714 |
| 64 | Ga0081539_10000420 | 3300005985 | Bacteria | 90166 |
| 65 | Ga0081539_10001106 | 3300005985 | Bacteria | 48943 |
| 66 | Ga0081539_10004121 | 3300005985 | Bacteria | 16553 |
| 67 | Ga0081539_10005819 | 3300005985 | Bacteria | 12249 |
| 68 | Ga0070717_10084531 | 3300006028 | Bacteria | 2669 |
| 69 | Ga0075363_100015415 | 3300006048 | Bacteria | 3756 |
| 70 | Ga0075363_100321325 | 3300006048 | Bacteria | 901 |
| 71 | Ga0075367_10018582 | 3300006178 | Bacteria | 3839 |
| 72 | Ga0075367_10055576 | 3300006178 | Bacteria | 2350 |
| 73 | Ga0097621_100620510 | 3300006237 | Bacteria | 990 |
| 74 | Ga0075428_100038789 | 3300006844 | Bacteria | 5242 |
| 75 | Ga0075428_100040339 | 3300006844 | Bacteria | 5137 |
| 76 | Ga0075428_100084482 | 3300006844 | Bacteria | 3463 |
| 77 | Ga0075430_100085218 | 3300006846 | Bacteria | 2646 |
| 78 | Ga0075430_100121002 | 3300006846 | Bacteria | 2182 |
| 79 | Ga0075431_100068771 | 3300006847 | Bacteria | 3654 |
| 80 | Ga0075431_100287076 | 3300006847 | Bacteria | 1665 |
| 81 | Ga0075429_100013670 | 3300006880 | Bacteria | 7038 |
| 82 | Ga0075429_100057723 | 3300006880 | Bacteria | 3379 |
| 83 | Ga0068865_100234717 | 3300006881 | Bacteria | 1441 |
| 84 | Ga0068865_100241467 | 3300006881 | Bacteria | 1422 |
| 85 | Ga0097620_100019694 | 3300006931 | Bacteria | 6777 |
| 86 | Ga0097620_100042613 | 3300006931 | Bacteria | 4560 |
| 87 | Ga0105240_10184424 | 3300009093 | Bacteria | 2459 |
| 88 | Ga0111539_10004030 | 3300009094 | Bacteria | 19288 |
| 89 | Ga0111539_10006384 | 3300009094 | Bacteria | 15204 |
| 90 | Ga0111539_10216884 | 3300009094 | Bacteria | 2228 |
| 91 | Ga0105245_10115187 | 3300009098 | Bacteria | 2505 |
| 92 | Ga0105247_10042151 | 3300009101 | Bacteria | 2794 |
| 93 | Ga0105247_10085049 | 3300009101 | Bacteria | 1999 |
| 94 | Ga0114129_10000959 | 3300009147 | Bacteria | 37691 |
| 95 | Ga0114129_10062927 | 3300009147 | Bacteria | 5183 |
| 96 | Ga0114129_10074244 | 3300009147 | Bacteria | 4737 |
| 97 | Ga0114129_10278566 | 3300009147 | Bacteria | 2235 |
| 98 | Ga0105243_10006412 | 3300009148 | Bacteria | 9092 |
| 99 | Ga0105243_10100989 | 3300009148 | Bacteria | 2395 |
| 100 | Ga0105243_10110902 | 3300009148 | Bacteria | 2295 |
| 101 | Ga0105248_10388518 | 3300009177 | Bacteria | 1571 |
| 102 | Ga0105249_10030610 | 3300009553 | Bacteria | 4866 |
| 103 | Ga0105249_10140054 | 3300009553 | Bacteria | 2319 |
| 104 | Ga0105239_10034294 | 3300010375 | Bacteria | 5572 |
| 105 | Ga0105239_10207467 | 3300010375 | Bacteria | 2196 |
| 106 | Ga0105246_10024519 | 3300011119 | Bacteria | 3920 |
| 107 | Ga0105246_10026470 | 3300011119 | Bacteria | 3790 |
| 108 | Ga0157369_10248855 | 3300013105 | Bacteria | 1855 |
| 109 | Ga0157378_10039679 | 3300013297 | Bacteria | 4176 |
| 110 | Ga0157378_10345462 | 3300013297 | Bacteria | 1452 |
| 111 | Ga0163162_10174404 | 3300013306 | Bacteria | 2275 |
| 112 | Ga0157375_10008491 | 3300013308 | Bacteria | 8995 |
| 113 | Ga0157375_10068159 | 3300013308 | Bacteria | 3559 |
| 114 | Ga0163163_10140598 | 3300014325 | Bacteria | 2456 |
| 115 | Ga0163163_10157782 | 3300014325 | Bacteria | 2313 |
| 116 | Ga0157380_10077644 | 3300014326 | Bacteria | 2707 |
| 117 | Ga0182008_10000192 | 3300014497 | Bacteria | 48269 |
| 118 | Ga0157379_10305339 | 3300014968 | Bacteria | 1451 |
| 119 | Ga0157379_10404902 | 3300014968 | Bacteria | 1255 |
| 120 | Ga0182007_10000449 | 3300015262 | Bacteria | 24937 |
| 121 | Ga0183367_1013 | 3300015688 | Bacteria | 334176 |
| 122 | Ga0256743_117949 | 3300023436 | Bacteria | 1063 |
| 123 | Ga0209758_1008233 | 3300025297 | Bacteria | 6828 |
| 124 | Ga0207426_1002577 | 3300025302 | Bacteria | 11294 |
| 125 | Ga0207426_1010853 | 3300025302 | Bacteria | 3508 |
| 126 | Ga0207426_1012936 | 3300025302 | Bacteria | 3114 |
| 127 | Ga0207692_10038904 | 3300025898 | Bacteria | 2336 |
| 128 | Ga0207642_10108303 | 3300025899 | Bacteria | 1409 |
| 129 | Ga0207710_10018571 | 3300025900 | Bacteria | 2959 |
| 130 | Ga0207710_10201149 | 3300025900 | Bacteria | 984 |
| 131 | Ga0207647_10018288 | 3300025904 | Bacteria | 4745 |
| 132 | Ga0207671_10174417 | 3300025914 | Bacteria | 1671 |
| 133 | Ga0207663_10308449 | 3300025916 | Bacteria | 1185 |
| 134 | Ga0207687_10136803 | 3300025927 | Bacteria | 1854 |
| 135 | Ga0207687_10214684 | 3300025927 | Bacteria | 1511 |
| 136 | Ga0207687_10218138 | 3300025927 | Bacteria | 1500 |
| 137 | Ga0207700_10328719 | 3300025928 | Bacteria | 1326 |
| 138 | Ga0207644_10066402 | 3300025931 | Bacteria | 2627 |
| 139 | Ga0207690_10189439 | 3300025932 | Bacteria | 1555 |
| 140 | Ga0207706_10013802 | 3300025933 | Bacteria | 7332 |
| 141 | Ga0207706_10071661 | 3300025933 | Bacteria | 3048 |
| 142 | Ga0207706_10419721 | 3300025933 | Bacteria | 1159 |
| 143 | Ga0207709_10094481 | 3300025935 | Bacteria | 1963 |
| 144 | Ga0207711_10075784 | 3300025941 | Bacteria | 2928 |
| 145 | Ga0207711_10222508 | 3300025941 | Bacteria | 1727 |
| 146 | Ga0207661_10074710 | 3300025944 | Bacteria | 2779 |
| 147 | Ga0207661_10128943 | 3300025944 | Bacteria | 2164 |
| 148 | Ga0207661_10545189 | 3300025944 | Bacteria | 1062 |
| 149 | Ga0207667_10077006 | 3300025949 | Bacteria | 3460 |
| 150 | Ga0207712_10100603 | 3300025961 | Bacteria | 2148 |
| 151 | Ga0207668_10004765 | 3300025972 | Bacteria | 7982 |
| 152 | Ga0207640_10129826 | 3300025981 | Bacteria | 1820 |
| 153 | Ga0207658_10039649 | 3300025986 | Bacteria | 3399 |
| 154 | Ga0207677_10032237 | 3300026023 | Bacteria | 3366 |
| 155 | Ga0207703_10024649 | 3300026035 | Bacteria | 4733 |
| 156 | Ga0207678_10514235 | 3300026067 | Bacteria | 1044 |
| 157 | Ga0207708_10007293 | 3300026075 | Bacteria | 8177 |
| 158 | Ga0207708_10082761 | 3300026075 | Bacteria | 2467 |
| 159 | Ga0207702_10314145 | 3300026078 | Bacteria | 1491 |
| 160 | Ga0207641_10117850 | 3300026088 | Bacteria | 2365 |
| 161 | Ga0207648_10512844 | 3300026089 | Bacteria | 1098 |
| 162 | Ga0207676_10067759 | 3300026095 | Bacteria | 2852 |
| 163 | Ga0207674_10002093 | 3300026116 | Bacteria | 25273 |
| 164 | Ga0207674_10144115 | 3300026116 | Bacteria | 2341 |
| 165 | Ga0207674_10522234 | 3300026116 | Bacteria | 1147 |
| 166 | Ga0207675_100307960 | 3300026118 | Bacteria | 1544 |
| 167 | Ga0207683_10038481 | 3300026121 | Bacteria | 4169 |
| 168 | Ga0207698_10305604 | 3300026142 | Bacteria | 1483 |
| 169 | Ga0268265_10010581 | 3300028380 | Bacteria | 6231 |
| 170 | Ga0268264_10008659 | 3300028381 | Bacteria | 8453 |
| 171 | Ga0307517_10013060 | 3300028786 | Bacteria | 11322 |
| 172 | Ga0307517_10016670 | 3300028786 | Bacteria | 9637 |
| 173 | Ga0307515_10000045 | 3300028794 | Bacteria | 301029 |
| 174 | Ga0307515_10052796 | 3300028794 | Bacteria | 6016 |
| 175 | Ga0307515_10108038 | 3300028794 | Bacteria | 3282 |
| 176 | Ga0307515_10298560 | 3300028794 | Bacteria | 1298 |
| 177 | Ga0307511_10001435 | 3300030521 | Bacteria | 25149 |
| 178 | Ga0307511_10078834 | 3300030521 | Bacteria | 2333 |
| 179 | Ga0307512_10002986 | 3300030522 | Bacteria | 20400 |
| 180 | Ga0307512_10029915 | 3300030522 | Bacteria | 4746 |
| 181 | Ga0307512_10082717 | 3300030522 | Bacteria | 2294 |
| 182 | Ga0307512_10082851 | 3300030522 | Bacteria | 2291 |
| 183 | Ga0307512_10103148 | 3300030522 | Bacteria | 1921 |
| 184 | Ga0314311_1151442 | 3300030733 | Bacteria | 3391 |
| 185 | Ga0265327_10000154 | 3300031251 | Bacteria | 148866 |
| 186 | Ga0307513_10010933 | 3300031456 | Bacteria | 11330 |
| 187 | Ga0307513_10124337 | 3300031456 | Bacteria | 2539 |
| 188 | Ga0307513_10195918 | 3300031456 | Bacteria | 1866 |
| 189 | Ga0307509_10020244 | 3300031507 | Bacteria | 7555 |
| 190 | Ga0307509_10034088 | 3300031507 | Bacteria | 5597 |
| 191 | Ga0307408_100023257 | 3300031548 | Bacteria | 4219 |
| 192 | Ga0307408_100103878 | 3300031548 | Bacteria | 2170 |
| 193 | Ga0307408_100185655 | 3300031548 | Bacteria | 1671 |
| 194 | Ga0307508_10001514 | 3300031616 | Bacteria | 25941 |
| 195 | Ga0307508_10005717 | 3300031616 | Bacteria | 11773 |
| 196 | Ga0307508_10027731 | 3300031616 | Bacteria | 5125 |
| 197 | Ga0307508_10049648 | 3300031616 | Bacteria | 3737 |
| 198 | Ga0307508_10062760 | 3300031616 | Bacteria | 3278 |
| 199 | Ga0307508_10082547 | 3300031616 | Bacteria | 2796 |
| 200 | Ga0307514_10003971 | 3300031649 | Bacteria | 13818 |
| 201 | Ga0307514_10076048 | 3300031649 | Bacteria | 2502 |
| 202 | Ga0307514_10136963 | 3300031649 | Bacteria | 1673 |
| 203 | Ga0307514_10251391 | 3300031649 | Bacteria | 1046 |
| 204 | Ga0307516_10002608 | 3300031730 | Bacteria | 23942 |
| 205 | Ga0307516_10008621 | 3300031730 | Bacteria | 11503 |
| 206 | Ga0307516_10039054 | 3300031730 | Bacteria | 4733 |
| 207 | Ga0307516_10046419 | 3300031730 | Bacteria | 4286 |
| 208 | Ga0307516_10047355 | 3300031730 | Bacteria | 4236 |
| 209 | Ga0307516_10124303 | 3300031730 | Bacteria | 2366 |
| 210 | Ga0307405_10048752 | 3300031731 | Bacteria | 2614 |
| 211 | Ga0307405_10347032 | 3300031731 | Bacteria | 1143 |
| 212 | Ga0307405_10349468 | 3300031731 | Bacteria | 1140 |
| 213 | Ga0307413_10009249 | 3300031824 | Bacteria | 4707 |
| 214 | Ga0307413_10106511 | 3300031824 | Bacteria | 1866 |
| 215 | Ga0307413_10106691 | 3300031824 | Bacteria | 1865 |
| 216 | Ga0307413_10392897 | 3300031824 | Bacteria | 1084 |
| 217 | Ga0307518_10241147 | 3300031838 | Bacteria | 1159 |
| 218 | Ga0307410_10061864 | 3300031852 | Bacteria | 2563 |
| 219 | Ga0307410_10124993 | 3300031852 | Bacteria | 1881 |
| 220 | Ga0307410_10164366 | 3300031852 | Bacteria | 1666 |
| 221 | Ga0307410_10232142 | 3300031852 | Bacteria | 1425 |
| 222 | Ga0307406_10053277 | 3300031901 | Bacteria | 2576 |
| 223 | Ga0307406_10055824 | 3300031901 | Bacteria | 2526 |
| 224 | Ga0307406_10060524 | 3300031901 | Bacteria | 2442 |
| 225 | Ga0307406_10073419 | 3300031901 | Bacteria | 2249 |
| 226 | Ga0307406_10268643 | 3300031901 | Bacteria | 1294 |
| 227 | Ga0307406_10304865 | 3300031901 | Bacteria | 1225 |
| 228 | Ga0307407_10077267 | 3300031903 | Bacteria | 2002 |
| 229 | Ga0307407_10095416 | 3300031903 | Bacteria | 1833 |
| 230 | Ga0307407_10118884 | 3300031903 | Bacteria | 1672 |
| 231 | Ga0307407_10137627 | 3300031903 | Bacteria | 1571 |
| 232 | Ga0307412_10354291 | 3300031911 | Bacteria | 1179 |
| 233 | Ga0307409_100011803 | 3300031995 | Bacteria | 5531 |
| 234 | Ga0307409_100014786 | 3300031995 | Bacteria | 5092 |
| 235 | Ga0307409_100020946 | 3300031995 | Bacteria | 4471 |
| 236 | Ga0307409_100038809 | 3300031995 | Bacteria | 3526 |
| 237 | Ga0307409_100060901 | 3300031995 | Bacteria | 2946 |
| 238 | Ga0307409_100069355 | 3300031995 | Bacteria | 2793 |
| 239 | Ga0307409_100133126 | 3300031995 | Bacteria | 2128 |
| 240 | Ga0307409_100263053 | 3300031995 | Bacteria | 1584 |
| 241 | Ga0307409_100305097 | 3300031995 | Bacteria | 1483 |
| 242 | Ga0307409_100314467 | 3300031995 | Bacteria | 1463 |
| 243 | Ga0307409_100639544 | 3300031995 | Bacteria | 1056 |
| 244 | Ga0307409_100657928 | 3300031995 | Bacteria | 1042 |
| 245 | Ga0307416_100006529 | 3300032002 | Bacteria | 7309 |
| 246 | Ga0307416_100028486 | 3300032002 | Bacteria | 4154 |
| 247 | Ga0307416_100133491 | 3300032002 | Bacteria | 2240 |
| 248 | Ga0307416_100188162 | 3300032002 | Bacteria | 1943 |
| 249 | Ga0307416_100267892 | 3300032002 | Bacteria | 1675 |
| 250 | Ga0307416_100488972 | 3300032002 | Bacteria | 1292 |
| 251 | Ga0307414_10121022 | 3300032004 | Bacteria | 2012 |
| 252 | Ga0307411_10156781 | 3300032005 | Bacteria | 1699 |
| 253 | Ga0307411_10349817 | 3300032005 | Bacteria | 1204 |
| 254 | Ga0307411_10654423 | 3300032005 | Bacteria | 910 |
| 255 | Ga0307415_100000048 | 3300032126 | Bacteria | 51694 |
| 256 | Ga0307415_100012878 | 3300032126 | Bacteria | 4856 |
| 257 | Ga0307415_100018602 | 3300032126 | Bacteria | 4200 |
| 258 | Ga0307415_100031159 | 3300032126 | Bacteria | 3431 |
| 259 | Ga0307415_100092379 | 3300032126 | Bacteria | 2194 |
| 260 | Ga0307415_100135208 | 3300032126 | Bacteria | 1874 |
| 261 | Ga0307415_100183066 | 3300032126 | Bacteria | 1646 |
| 262 | Ga0307415_100311496 | 3300032126 | Bacteria | 1308 |
| 263 | Ga0307507_10012883 | 3300033179 | Bacteria | 10256 |
| 264 | Ga0307507_10056142 | 3300033179 | Bacteria | 3724 |
| 265 | Ga0307507_10208777 | 3300033179 | Bacteria | 1336 |
| 266 | Ga0307510_10074586 | 3300033180 | Bacteria | 3350 |
| 267 | Ga0307510_10103011 | 3300033180 | Bacteria | 2633 |
| 268 | Ga0307510_10225825 | 3300033180 | Bacteria | 1379 |
| 269 | Ga0307510_10311842 | 3300033180 | Bacteria | 1032 |
| 270 | Ga0373948_0024112 | 3300034817 | Bacteria | 1185 |
| 271 | Ga0373962_0005092 | 3300035242 | Bacteria | 3176 |
| 272 | Ga0373935_0010076 | 3300035692 | Bacteria | 5661 |
| 273 | Ga0373937_0148022 | 3300036401 | Bacteria | 2199 |
| 274 | Ga0395899_0001267 | 3300037312 | Bacteria | 21969 |
| 275 | Ga0395899_0004240 | 3300037312 | Bacteria | 11227 |
| 276 | Ga0395899_0010571 | 3300037312 | Bacteria | 7072 |
| 277 | Ga0395899_0130701 | 3300037312 | Bacteria | 1793 |
| 278 | Ga0395900_0003489 | 3300037418 | Bacteria | 16973 |
| 279 | Ga0395900_0021539 | 3300037418 | Bacteria | 6590 |
| 280 | Ga0395900_0070245 | 3300037418 | Bacteria | 3600 |
| 281 | Ga0395898_0001276 | 3300037466 | Bacteria | 37111 |
| 282 | Ga0395898_0008267 | 3300037466 | Bacteria | 11005 |
| 283 | Ga0395898_0013768 | 3300037466 | Bacteria | 8317 |
| 284 | Ga0395898_0017125 | 3300037466 | Bacteria | 7402 |
| 285 | Ga0395898_0018786 | 3300037466 | Bacteria | 7044 |
| 286 | Ga0395898_0312915 | 3300037466 | Bacteria | 1498 |
| 287 | Ga0395905_0001281 | 3300037471 | Bacteria | 31019 |
| 288 | Ga0395905_0064766 | 3300037471 | Bacteria | 3421 |
| 289 | Ga0395905_0142852 | 3300037471 | Bacteria | 2251 |
| 290 | Ga0395901_0001957 | 3300038443 | Bacteria | 21190 |
| 291 | Ga0395901_0050065 | 3300038443 | Bacteria | 4341 |
| 292 | Ga0395901_0222063 | 3300038443 | Bacteria | 1975 |
| 293 | Ga0395901_0374395 | 3300038443 | Bacteria | 1466 |
| 294 | Ga0395901_0498892 | 3300038443 | Bacteria | 1239 |
| 295 | Ga0242420_016285 | 3300038996 | Bacteria | 1294 |
| 296 | Ga0436365_0038748 | 3300039437 | Bacteria | 1511 |
| 297 | Ga0439436_0011347 | 3300041404 | Bacteria | 2706 |
| 298 | Ga0439436_0023689 | 3300041404 | Bacteria | 1815 |
| 299 | Ga0439439_0038114 | 3300041406 | Bacteria | 1240 |
| 300 | Ga0451789_0337061 | 3300041443 | Bacteria | 1684 |
| 301 | Ga0451791_0820044 | 3300041451 | Bacteria | 1615 |
| 302 | Ga0451837_1578301 | 3300041494 | Bacteria | 4370 |
| 303 | Ga0451853_0792760 | 3300041512 | Bacteria | 2296 |
| 304 | Ga0439431_0027020 | 3300041997 | Bacteria | 1409 |
| 305 | Ga0439433_0000155 | 3300041999 | Bacteria | 10576 |
| 306 | Ga0439442_018925 | 3300042002 | Bacteria | 1424 |
| 307 | Ga0439448_0036914 | 3300042005 | Bacteria | 1568 |
| 308 | Ga0439448_0040261 | 3300042005 | Bacteria | 1509 |
| 309 | Ga0439432_052632 | 3300042006 | Bacteria | 1267 |
| 310 | Ga0439449_0003789 | 3300042007 | Bacteria | 5851 |
| 311 | Ga0439449_0014267 | 3300042007 | Bacteria | 2986 |
| 312 | Ga0439454_008338 | 3300042011 | Bacteria | 1322 |
| 313 | Ga0439456_039928 | 3300042013 | Bacteria | 1016 |
| 314 | Ga0439457_005828 | 3300042014 | Bacteria | 3058 |
| 315 | Ga0439457_012835 | 3300042014 | Bacteria | 1885 |
| 316 | Ga0439462_0001709 | 3300042015 | Bacteria | 4960 |
| 317 | Ga0450890_005177 | 3300042127 | Bacteria | 1681 |
| 318 | Ga0450894_000143 | 3300042131 | Bacteria | 12616 |
| 319 | Ga0450896_000403 | 3300042133 | Bacteria | 4352 |
| 320 | Ga0450898_008444 | 3300042134 | Bacteria | 1625 |
| 321 | Ga0450899_000010 | 3300042135 | Bacteria | 14467 |
| 322 | Ga0450903_001506 | 3300042138 | Bacteria | 4347 |
| 323 | Ga0450903_001798 | 3300042138 | Bacteria | 3920 |
| 324 | Ga0450906_004688 | 3300042145 | Bacteria | 2850 |
| 325 | Ga0450908_004116 | 3300042184 | Bacteria | 2810 |
| 326 | Ga0451577_0199827 | 3300042876 | Bacteria | 1805 |
| 327 | Ga0466969_0000370 | 3300044656 | Bacteria | 24636 |
| 328 | Ga0466969_0006463 | 3300044656 | Bacteria | 6239 |
| 329 | Ga0466969_0096666 | 3300044656 | Bacteria | 1394 |
| 330 | Ga0466972_0006455 | 3300044658 | Bacteria | 5891 |
| 331 | Ga0466972_0050772 | 3300044658 | Bacteria | 2001 |
| 332 | Ga0466972_0053572 | 3300044658 | Bacteria | 1942 |
| 333 | Ga0466965_0025338 | 3300044683 | Bacteria | 2870 |
| 334 | Ga0466965_0121905 | 3300044683 | Bacteria | 1347 |
| 335 | Ga0466966_0016593 | 3300044684 | Bacteria | 4864 |
| 336 | Ga0466966_0019527 | 3300044684 | Bacteria | 4458 |
| 337 | Ga0466966_0029700 | 3300044684 | Bacteria | 3554 |
| 338 | Ga0466966_0117343 | 3300044684 | Bacteria | 1637 |
| 339 | Ga0466966_0139761 | 3300044684 | Bacteria | 1480 |
| 340 | Ga0466966_0200000 | 3300044684 | Bacteria | 1209 |
| 341 | Ga0466966_0283682 | 3300044684 | Bacteria | 996 |
| 342 | Ga0466961_0005082 | 3300044693 | Bacteria | 8277 |
| 343 | Ga0466961_0022807 | 3300044693 | Bacteria | 4026 |
| 344 | Ga0466961_0031877 | 3300044693 | Bacteria | 3388 |
| 345 | Ga0466961_0102214 | 3300044693 | Bacteria | 1805 |
| 346 | Ga0466961_0147629 | 3300044693 | Bacteria | 1470 |
| 347 | Ga0466963_0017382 | 3300044694 | Bacteria | 4483 |
| 348 | Ga0466963_0022628 | 3300044694 | Bacteria | 3982 |
| 349 | Ga0466964_0067625 | 3300044706 | Bacteria | 1502 |
| 350 | Ga0466964_0120805 | 3300044706 | Bacteria | 1181 |
| 351 | Ga0466971_0000315 | 3300044719 | Bacteria | 18663 |
| 352 | Ga0466971_0004202 | 3300044719 | Bacteria | 6206 |
| 353 | Ga0466970_0053168 | 3300044765 | Bacteria | 2163 |
| 354 | Ga0466970_0061396 | 3300044765 | Bacteria | 2013 |
| 355 | Ga0466970_0098560 | 3300044765 | Bacteria | 1590 |
| 356 | Ga0466970_0166558 | 3300044765 | Bacteria | 1220 |
| 357 | Ga0466970_0195766 | 3300044765 | Bacteria | 1124 |
| 358 | Ga0466957_0010923 | 3300044842 | Bacteria | 5222 |
| 359 | Ga0466957_0058790 | 3300044842 | Bacteria | 2355 |
| 360 | Ga0466957_0114486 | 3300044842 | Bacteria | 1713 |
| 361 | Ga0466960_0004092 | 3300044901 | Bacteria | 5669 |
| 362 | Ga0466960_0009167 | 3300044901 | Bacteria | 4071 |
| 363 | Ga0466960_0152198 | 3300044901 | Bacteria | 1236 |
| 364 | Ga0466960_0193376 | 3300044901 | Bacteria | 1108 |
| 365 | Ga0466960_0284999 | 3300044901 | Bacteria | 927 |
| 366 | Ga0466959_0003681 | 3300045049 | Bacteria | 10108 |
| 367 | Ga0466959_0013084 | 3300045049 | Bacteria | 6008 |
| 368 | Ga0466959_0027194 | 3300045049 | Bacteria | 4243 |
| 369 | Ga0466959_0044261 | 3300045049 | Bacteria | 3280 |
| 370 | Ga0466958_0001227 | 3300045836 | Bacteria | 12000 |
| 371 | Ga0466967_0094233 | 3300045976 | Bacteria | 2726 |
| 372 | Ga0466967_0180790 | 3300045976 | Bacteria | 1989 |
| 373 | Ga0466967_0246816 | 3300045976 | Bacteria | 1704 |
| 374 | Ga0466967_0291314 | 3300045976 | Bacteria | 1568 |
| 375 | Ga0466967_0372686 | 3300045976 | Bacteria | 1385 |
| 376 | Ga0495617_003061 | 3300046452 | Bacteria | 6363 |
| 377 | Ga0495627_014138 | 3300046453 | Bacteria | 2794 |
| 378 | Ga0495627_064729 | 3300046453 | Bacteria | 1075 |
| 379 | Ga0495592_0004769 | 3300046454 | Bacteria | 9954 |
| 380 | Ga0495592_0007933 | 3300046454 | Bacteria | 7963 |
| 381 | Ga0495592_0042740 | 3300046454 | Bacteria | 3393 |
| 382 | Ga0495603_0001314 | 3300046455 | Bacteria | 14437 |
| 383 | Ga0495603_0002392 | 3300046455 | Bacteria | 11031 |
| 384 | Ga0495603_0092888 | 3300046455 | Bacteria | 1764 |
| 385 | Ga0495603_0132408 | 3300046455 | Bacteria | 1451 |
| 386 | Ga0495591_026417 | 3300046458 | Bacteria | 1804 |
| 387 | Ga0495629_0009911 | 3300046459 | Bacteria | 6954 |
| 388 | Ga0495629_0029215 | 3300046459 | Bacteria | 3911 |
| 389 | Ga0495629_0047019 | 3300046459 | Bacteria | 3026 |
| 390 | Ga0495629_0050973 | 3300046459 | Bacteria | 2897 |
| 391 | Ga0495629_0071995 | 3300046459 | Bacteria | 2412 |
| 392 | Ga0495638_0024771 | 3300046460 | Bacteria | 3906 |
| 393 | Ga0495638_0031950 | 3300046460 | Bacteria | 3380 |
| 394 | Ga0495638_0096043 | 3300046460 | Bacteria | 1779 |
| 395 | Ga0495651_0005450 | 3300046462 | Bacteria | 9708 |
| 396 | Ga0495651_0014060 | 3300046462 | Bacteria | 6190 |
| 397 | Ga0495651_0016661 | 3300046462 | Bacteria | 5691 |
| 398 | Ga0495653_0002328 | 3300046463 | Bacteria | 15072 |
| 399 | Ga0495580_0058285 | 3300046472 | Bacteria | 2716 |
| 400 | Ga0495580_0141025 | 3300046472 | Bacteria | 1670 |
| 401 | Ga0495582_0123751 | 3300046473 | Bacteria | 1459 |
| 402 | Ga0495605_0018566 | 3300046474 | Bacteria | 3726 |
| 403 | Ga0495639_0037671 | 3300046475 | Bacteria | 2168 |
| 404 | Ga0495662_0006205 | 3300046476 | Bacteria | 5977 |
| 405 | Ga0495662_0009374 | 3300046476 | Bacteria | 4803 |
| 406 | Ga0495662_0019023 | 3300046476 | Bacteria | 3323 |
| 407 | Ga0495662_0149450 | 3300046476 | Bacteria | 1150 |
| 408 | Ga0495664_0002191 | 3300046477 | Bacteria | 10462 |
| 409 | Ga0495664_0005789 | 3300046477 | Bacteria | 6803 |
| 410 | Ga0495664_0021670 | 3300046477 | Bacteria | 3712 |
| 411 | Ga0495585_0010195 | 3300046492 | Bacteria | 5610 |
| 412 | Ga0495585_0038740 | 3300046492 | Bacteria | 2682 |
| 413 | Ga0495594_0003850 | 3300046499 | Bacteria | 7710 |
| 414 | Ga0495594_0037464 | 3300046499 | Bacteria | 2645 |
| 415 | Ga0495594_0198855 | 3300046499 | Bacteria | 1142 |
| 416 | Ga0495594_0363750 | 3300046499 | Bacteria | 824 |
| 417 | Ga0495596_0009731 | 3300046500 | Bacteria | 4218 |
| 418 | Ga0495596_0076899 | 3300046500 | Bacteria | 1296 |
| 419 | Ga0495607_0071225 | 3300046501 | Bacteria | 1938 |
| 420 | Ga0495607_0072549 | 3300046501 | Bacteria | 1916 |
| 421 | Ga0495583_0073647 | 3300046506 | Bacteria | 1497 |
| 422 | Ga0495583_0087058 | 3300046506 | Bacteria | 1350 |
| 423 | Ga0495606_0012438 | 3300046507 | Bacteria | 6823 |
| 424 | Ga0495608_0109066 | 3300046511 | Bacteria | 1780 |
| 425 | Ga0495610_0035874 | 3300046512 | Bacteria | 2540 |
| 426 | Ga0495616_0004457 | 3300046513 | Bacteria | 8819 |
| 427 | Ga0495618_0031865 | 3300046514 | Bacteria | 3301 |
| 428 | Ga0495618_0042215 | 3300046514 | Bacteria | 2874 |
| 429 | Ga0495620_0052174 | 3300046515 | Bacteria | 1737 |
| 430 | Ga0495628_0000938 | 3300046516 | Bacteria | 26718 |
| 431 | Ga0495628_0052598 | 3300046516 | Bacteria | 3217 |
| 432 | Ga0495628_0064657 | 3300046516 | Bacteria | 2863 |
| 433 | Ga0495630_0007585 | 3300046517 | Bacteria | 7755 |
| 434 | Ga0495630_0063176 | 3300046517 | Bacteria | 2781 |
| 435 | Ga0495630_0464021 | 3300046517 | Bacteria | 970 |
| 436 | Ga0495631_0001249 | 3300046518 | Bacteria | 15708 |
| 437 | Ga0495632_0054356 | 3300046519 | Bacteria | 1963 |
| 438 | Ga0495632_0179338 | 3300046519 | Bacteria | 971 |
| 439 | Ga0495637_0020761 | 3300046520 | Bacteria | 3016 |
| 440 | Ga0495637_0039510 | 3300046520 | Bacteria | 2036 |
| 441 | Ga0495643_0019979 | 3300046522 | Bacteria | 3869 |
| 442 | Ga0495643_0129877 | 3300046522 | Bacteria | 1266 |
| 443 | Ga0495648_0040688 | 3300046524 | Bacteria | 2944 |
| 444 | Ga0495666_0009175 | 3300046526 | Bacteria | 4947 |
| 445 | Ga0495666_0055878 | 3300046526 | Bacteria | 1891 |
| 446 | Ga0495642_0056270 | 3300046528 | Bacteria | 1624 |
| 447 | Ga0495652_0014739 | 3300046529 | Bacteria | 7009 |
| 448 | Ga0495652_0037238 | 3300046529 | Bacteria | 4221 |
| 449 | Ga0495652_0037994 | 3300046529 | Bacteria | 4173 |
| 450 | Ga0495665_0002842 | 3300046531 | Bacteria | 9353 |
| 451 | Ga0495640_0002611 | 3300046533 | Bacteria | 14486 |
| 452 | Ga0495640_0021614 | 3300046533 | Bacteria | 4718 |
| 453 | Ga0495640_0050705 | 3300046533 | Bacteria | 2857 |
| 454 | Ga0495640_0092007 | 3300046533 | Bacteria | 2001 |
| 455 | Ga0495586_0018407 | 3300046535 | Bacteria | 3719 |
| 456 | Ga0495587_0001074 | 3300046536 | Bacteria | 17963 |
| 457 | Ga0495587_0013037 | 3300046536 | Bacteria | 5229 |
| 458 | Ga0495609_0010159 | 3300046538 | Bacteria | 4526 |
| 459 | Ga0495597_0078649 | 3300046542 | Bacteria | 1412 |
| 460 | Ga0495597_0081153 | 3300046542 | Bacteria | 1387 |
| 461 | Ga0495645_0007385 | 3300046543 | Bacteria | 7645 |
| 462 | Ga0495622_0002792 | 3300046557 | Bacteria | 8334 |
| 463 | Ga0495622_0012292 | 3300046557 | Bacteria | 3959 |
| 464 | Ga0495633_0015709 | 3300046558 | Bacteria | 3923 |
| 465 | Ga0495633_0020844 | 3300046558 | Bacteria | 3289 |
| 466 | Ga0495633_0058987 | 3300046558 | Bacteria | 1801 |
| 467 | Ga0495667_0001343 | 3300046559 | Bacteria | 16149 |
| 468 | Ga0495667_0101261 | 3300046559 | Bacteria | 1864 |
| 469 | Ga0495656_0034974 | 3300046615 | Bacteria | 2061 |
| 470 | Ga0495668_0035008 | 3300046616 | Bacteria | 2814 |
| 471 | Ga0495634_0006470 | 3300046642 | Bacteria | 8900 |
| 472 | Ga0495634_0007476 | 3300046642 | Bacteria | 8204 |
| 473 | Ga0495634_0039714 | 3300046642 | Bacteria | 3203 |
| 474 | Ga0495634_0055670 | 3300046642 | Bacteria | 2644 |
| 475 | Ga0495634_0353305 | 3300046642 | Bacteria | 880 |
| 476 | Ga0495611_0014088 | 3300046648 | Bacteria | 3411 |
| 477 | Ga0495611_0025741 | 3300046648 | Bacteria | 2566 |
| 478 | Ga0495611_0044189 | 3300046648 | Bacteria | 1992 |
| 479 | Ga0495625_0008236 | 3300046660 | Bacteria | 8916 |
| 480 | Ga0495625_0023042 | 3300046660 | Bacteria | 4761 |
| 481 | Ga0495635_0006847 | 3300046663 | Bacteria | 7965 |
| 482 | Ga0495635_0056943 | 3300046663 | Bacteria | 2690 |
| 483 | Ga0495635_0059060 | 3300046663 | Bacteria | 2637 |
| 484 | Ga0495635_0332570 | 3300046663 | Bacteria | 1015 |
| 485 | Ga0495659_0062665 | 3300046664 | Bacteria | 1377 |
| 486 | Ga0495661_0023038 | 3300046665 | Bacteria | 4047 |
| 487 | Ga0495661_0110815 | 3300046665 | Bacteria | 1530 |
| 488 | Ga0495588_0022405 | 3300046674 | Bacteria | 3122 |
| 489 | Ga0495588_0043702 | 3300046674 | Bacteria | 2293 |
| 490 | Ga0495588_0055475 | 3300046674 | Bacteria | 2044 |
| 491 | Ga0495657_0001181 | 3300046675 | Bacteria | 22901 |
| 492 | Ga0495657_0006084 | 3300046675 | Bacteria | 9469 |
| 493 | Ga0495657_0021312 | 3300046675 | Bacteria | 4650 |
| 494 | Ga0495657_0073052 | 3300046675 | Bacteria | 2235 |
| 495 | Ga0495657_0090308 | 3300046675 | Bacteria | 1966 |
| 496 | Ga0495599_0010033 | 3300046678 | Bacteria | 5798 |
| 497 | Ga0495599_0021283 | 3300046678 | Bacteria | 4045 |
| 498 | Ga0495623_0018012 | 3300046679 | Bacteria | 4560 |
| 499 | Ga0495623_0056451 | 3300046679 | Bacteria | 2472 |
| 500 | Ga0495623_0062647 | 3300046679 | Bacteria | 2330 |
| 501 | Ga0495623_0089463 | 3300046679 | Bacteria | 1892 |
| 502 | Ga0495646_0000250 | 3300046680 | Bacteria | 27112 |
| 503 | Ga0495646_0001026 | 3300046680 | Bacteria | 16141 |
| 504 | Ga0495658_0018341 | 3300046683 | Bacteria | 3637 |
| 505 | Ga0495613_0007591 | 3300046689 | Bacteria | 8062 |
| 506 | Ga0495613_0008120 | 3300046689 | Bacteria | 7806 |
| 507 | Ga0495613_0010412 | 3300046689 | Bacteria | 6905 |
| 508 | Ga0495613_0066011 | 3300046689 | Bacteria | 2643 |
| 509 | Ga0495613_0084475 | 3300046689 | Bacteria | 2304 |
| 510 | Ga0495613_0131993 | 3300046689 | Bacteria | 1788 |
| 511 | Ga0495624_0035600 | 3300046690 | Bacteria | 3214 |
| 512 | Ga0495624_0067786 | 3300046690 | Bacteria | 2225 |
| 513 | Ga0495670_0012222 | 3300046691 | Bacteria | 4221 |
| 514 | Ga0495670_0101844 | 3300046691 | Bacteria | 1479 |
| 515 | Ga0495670_0207589 | 3300046691 | Bacteria | 1038 |
| 516 | Ga0495671_0180778 | 3300046692 | Bacteria | 1024 |
| 517 | Ga0495649_0052260 | 3300046694 | Bacteria | 2214 |
| 518 | Ga0495589_0002240 | 3300046794 | Bacteria | 10867 |
| 519 | Ga0495589_0011849 | 3300046794 | Bacteria | 4524 |
| 520 | Ga0495589_0041781 | 3300046794 | Bacteria | 2286 |
| 521 | Ga0495589_0048782 | 3300046794 | Bacteria | 2095 |
| 522 | Ga0495589_0051949 | 3300046794 | Bacteria | 2025 |
| 523 | Ga0495589_0159944 | 3300046794 | Bacteria | 1073 |
| 524 | Ga0495600_0007937 | 3300046809 | Bacteria | 6505 |
| 525 | Ga0495600_0008654 | 3300046809 | Bacteria | 6262 |
| 526 | Ga0495600_0025856 | 3300046809 | Bacteria | 3784 |
| 527 | Ga0495600_0065112 | 3300046809 | Bacteria | 2382 |
| 528 | Ga0495660_0010493 | 3300046810 | Bacteria | 5389 |
| 529 | Ga0495581_0019208 | 3300047315 | Bacteria | 3966 |
| 530 | Ga0495581_0038922 | 3300047315 | Bacteria | 2753 |
| 531 | Ga0495581_0096738 | 3300047315 | Bacteria | 1714 |
| 532 | Ga0495581_0136650 | 3300047315 | Bacteria | 1429 |
| 533 | Ga0495604_0001060 | 3300047317 | Bacteria | 22796 |
| 534 | Ga0495604_0006467 | 3300047317 | Bacteria | 9294 |
| 535 | Ga0495604_0034158 | 3300047317 | Bacteria | 4025 |
| 536 | Ga0495604_0062418 | 3300047317 | Bacteria | 2847 |
| 537 | Ga0495636_0001884 | 3300047318 | Bacteria | 8014 |
| 538 | Ga0495636_0024020 | 3300047318 | Bacteria | 2470 |
| 539 | Ga0495636_0024543 | 3300047318 | Bacteria | 2446 |
| 540 | Ga0495674_0007676 | 3300047319 | Bacteria | 10302 |
| 541 | Ga0495676_0005722 | 3300047321 | Bacteria | 11401 |
| 542 | Ga0495676_0024945 | 3300047321 | Bacteria | 5166 |
| 543 | Ga0495676_0031666 | 3300047321 | Bacteria | 4469 |
| 544 | Ga0495676_0035244 | 3300047321 | Bacteria | 4187 |
| 545 | Ga0495676_0068733 | 3300047321 | Bacteria | 2735 |
| 546 | Ga0495676_0186429 | 3300047321 | Bacteria | 1450 |
| 547 | Ga0495680_0007609 | 3300047322 | Bacteria | 9901 |
| 548 | Ga0495683_0013695 | 3300047323 | Bacteria | 4235 |
| 549 | Ga0495683_0068198 | 3300047323 | Bacteria | 1750 |
| 550 | Ga0495687_003771 | 3300047443 | Bacteria | 10712 |
| 551 | Ga0495675_0031161 | 3300047444 | Bacteria | 3404 |
| 552 | Ga0495675_0033734 | 3300047444 | Bacteria | 3266 |
| 553 | Ga0495675_0041250 | 3300047444 | Bacteria | 2942 |
| 554 | Ga0495675_0129152 | 3300047444 | Bacteria | 1571 |
| 555 | Ga0495675_0274263 | 3300047444 | Bacteria | 1007 |
| 556 | Ga0495677_0052849 | 3300047445 | Bacteria | 1497 |
| 557 | Ga0495679_037038 | 3300047446 | Bacteria | 1537 |
| 558 | Ga0495685_000822 | 3300047447 | Bacteria | 9473 |
| 559 | Ga0495685_011579 | 3300047447 | Bacteria | 2979 |
| 560 | Ga0495685_012832 | 3300047447 | Bacteria | 2839 |
| 561 | Ga0495685_039045 | 3300047447 | Bacteria | 1625 |
| 562 | Ga0495685_054236 | 3300047447 | Bacteria | 1356 |
| 563 | Ga0495673_0086767 | 3300047469 | Bacteria | 1286 |
| 564 | Ga0495681_0003360 | 3300047470 | Bacteria | 11138 |
| 565 | Ga0495681_0013269 | 3300047470 | Bacteria | 4791 |
| 566 | Ga0495684_0074908 | 3300047471 | Bacteria | 2572 |
| 567 | Ga0495684_0078439 | 3300047471 | Bacteria | 2506 |
| 568 | Ga0495684_0231616 | 3300047471 | Bacteria | 1351 |
| 569 | Ga0495593_0007985 | 3300047673 | Bacteria | 6162 |
| 570 | Ga0495593_0031130 | 3300047673 | Bacteria | 2916 |
| 571 | Ga0495602_0027338 | 3300048088 | Bacteria | 5483 |
| 572 | Ga0495614_0010362 | 3300048089 | Bacteria | 4110 |
| 573 | Ga0495614_0033645 | 3300048089 | Bacteria | 2204 |
| 574 | Ga0495614_0184013 | 3300048089 | Bacteria | 940 |
| 575 | Ga0495615_0019631 | 3300048090 | Bacteria | 1504 |
| 576 | Ga0495626_0063224 | 3300048091 | Bacteria | 1679 |
| 577 | Ga0496102_0001496 | 3300048905 | Bacteria | 20647 |
| 578 | Ga0496102_0151679 | 3300048905 | Bacteria | 2178 |
| 579 | Ga0496103_0001461 | 3300048906 | Bacteria | 15822 |
| 580 | Ga0496105_0227627 | 3300048908 | Bacteria | 1516 |
| 581 | Ga0496106_0103348 | 3300048909 | Bacteria | 2211 |
| 582 | Ga0496106_0133229 | 3300048909 | Bacteria | 1950 |
| 583 | Ga0496108_0000048 | 3300048911 | Bacteria | 133539 |
| 584 | Ga0496108_0014451 | 3300048911 | Bacteria | 6447 |
| 585 | Ga0496108_0091741 | 3300048911 | Bacteria | 2582 |
| 586 | Ga0496109_0000991 | 3300048912 | Bacteria | 23430 |
| 587 | Ga0496109_0040035 | 3300048912 | Bacteria | 4244 |
| 588 | Ga0496110_0001407 | 3300048913 | Bacteria | 17382 |
| 589 | Ga0496111_0000429 | 3300048914 | Bacteria | 21251 |
| 590 | Ga0496112_0391674 | 3300048915 | Bacteria | 1330 |
| 591 | Ga0496113_0190271 | 3300048916 | Bacteria | 1629 |
| 592 | Ga0496115_0106708 | 3300048918 | Bacteria | 2300 |
| 593 | Ga0496118_0075513 | 3300048921 | Bacteria | 2403 |
| 594 | Ga0496118_0092478 | 3300048921 | Bacteria | 2075 |
| 595 | Ga0496119_0040227 | 3300048922 | Bacteria | 2993 |
| 596 | Ga0496119_0052850 | 3300048922 | Bacteria | 2486 |
| 597 | Ga0496119_0090643 | 3300048922 | Bacteria | 1738 |
| 598 | Ga0496121_0008171 | 3300048924 | Bacteria | 12425 |
| 599 | Ga0496122_0001777 | 3300048925 | Bacteria | 33035 |
| 600 | Ga0496122_0004513 | 3300048925 | Bacteria | 17191 |
| 601 | Ga0496123_0001160 | 3300048926 | Bacteria | 39065 |
| 602 | Ga0496124_0027394 | 3300048927 | Bacteria | 5115 |
| 603 | Ga0496124_0053226 | 3300048927 | Bacteria | 3433 |
| 604 | Ga0496125_0003000 | 3300048928 | Bacteria | 21125 |
| 605 | Ga0496125_0115848 | 3300048928 | Bacteria | 1926 |
| 606 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 607 | Ga0496126_0062083 | 3300048929 | Bacteria | 3354 |
| 608 | Ga0496126_0228288 | 3300048929 | Bacteria | 1561 |
| 609 | Ga0501306_000830 | 3300049127 | Bacteria | 2626 |
| 610 | Ga0501309_000486 | 3300049129 | Bacteria | 3223 |
| 611 | Ga0501298_024281 | 3300049521 | Bacteria | 1155 |
| 612 | Ga0501318_000559 | 3300049534 | Bacteria | 2456 |
| 613 | Ga0501323_000528 | 3300049539 | Bacteria | 2872 |
| 614 | Ga0501323_000529 | 3300049539 | Bacteria | 2872 |
| 615 | Ga0501323_002625 | 3300049539 | Bacteria | 1763 |
| 616 | Ga0501323_021596 | 3300049539 | Bacteria | 852 |
| 617 | Ga0501031_0005807 | 3300049568 | Bacteria | 8042 |
| 618 | Ga0501031_0016112 | 3300049568 | Bacteria | 4853 |
| 619 | Ga0501031_0017675 | 3300049568 | Bacteria | 4637 |
| 620 | Ga0501031_0030349 | 3300049568 | Bacteria | 3525 |
| 621 | Ga0501031_0094914 | 3300049568 | Bacteria | 1946 |
| 622 | Ga0501031_0205590 | 3300049568 | Bacteria | 1284 |
| 623 | Ga0501032_0000992 | 3300049569 | Bacteria | 22851 |
| 624 | Ga0501032_0002668 | 3300049569 | Bacteria | 13926 |
| 625 | Ga0501032_0023250 | 3300049569 | Bacteria | 4288 |
| 626 | Ga0501032_0059760 | 3300049569 | Bacteria | 2557 |
| 627 | Ga0501032_0115109 | 3300049569 | Bacteria | 1778 |
| 628 | Ga0501032_0148982 | 3300049569 | Bacteria | 1539 |
| 629 | Ga0501033_0001734 | 3300049570 | Bacteria | 19066 |
| 630 | Ga0501033_0005054 | 3300049570 | Bacteria | 10507 |
| 631 | Ga0501033_0011384 | 3300049570 | Bacteria | 6807 |
| 632 | Ga0501033_0026497 | 3300049570 | Bacteria | 4362 |
| 633 | Ga0501033_0035846 | 3300049570 | Bacteria | 3718 |
| 634 | Ga0501033_0039712 | 3300049570 | Bacteria | 3515 |
| 635 | Ga0501033_0110626 | 3300049570 | Bacteria | 1999 |
| 636 | Ga0501034_0001415 | 3300049571 | Bacteria | 32122 |
| 637 | Ga0501034_0007242 | 3300049571 | Bacteria | 11840 |
| 638 | Ga0501034_0029729 | 3300049571 | Bacteria | 5554 |
| 639 | Ga0501034_0033067 | 3300049571 | Bacteria | 5251 |
| 640 | Ga0501034_0072120 | 3300049571 | Bacteria | 3462 |
| 641 | Ga0501034_0075250 | 3300049571 | Bacteria | 3384 |
| 642 | Ga0501034_0095381 | 3300049571 | Bacteria | 2971 |
| 643 | Ga0501034_0365085 | 3300049571 | Bacteria | 1370 |
| 644 | Ga0501036_0000693 | 3300049572 | Bacteria | 24868 |
| 645 | Ga0501036_0004483 | 3300049572 | Bacteria | 11291 |
| 646 | Ga0501036_0004651 | 3300049572 | Bacteria | 11091 |
| 647 | Ga0501036_0012654 | 3300049572 | Bacteria | 6999 |
| 648 | Ga0501036_0051039 | 3300049572 | Bacteria | 3502 |
| 649 | Ga0501036_0071951 | 3300049572 | Bacteria | 2923 |
| 650 | Ga0501037_0000989 | 3300049573 | Bacteria | 21064 |
| 651 | Ga0501037_0024000 | 3300049573 | Bacteria | 4508 |
| 652 | Ga0501037_0024893 | 3300049573 | Bacteria | 4424 |
| 653 | Ga0501037_0035533 | 3300049573 | Bacteria | 3674 |
| 654 | Ga0501037_0040290 | 3300049573 | Bacteria | 3437 |
| 655 | Ga0501037_0092676 | 3300049573 | Bacteria | 2185 |
| 656 | Ga0501037_0101417 | 3300049573 | Bacteria | 2077 |
| 657 | Ga0501037_0106660 | 3300049573 | Bacteria | 2019 |
| 658 | Ga0501038_0000548 | 3300049574 | Bacteria | 33027 |
| 659 | Ga0501038_0020033 | 3300049574 | Bacteria | 6021 |
| 660 | Ga0501038_0027217 | 3300049574 | Bacteria | 5089 |
| 661 | Ga0501038_0057117 | 3300049574 | Bacteria | 3351 |
| 662 | Ga0501039_0000176 | 3300049575 | Bacteria | 45277 |
| 663 | Ga0501039_0004489 | 3300049575 | Bacteria | 10535 |
| 664 | Ga0501039_0010476 | 3300049575 | Bacteria | 7064 |
| 665 | Ga0501039_0036876 | 3300049575 | Bacteria | 3772 |
| 666 | Ga0501039_0052106 | 3300049575 | Bacteria | 3166 |
| 667 | Ga0501040_0000992 | 3300049576 | Bacteria | 17948 |
| 668 | Ga0501040_0005177 | 3300049576 | Bacteria | 8430 |
| 669 | Ga0501040_0011804 | 3300049576 | Bacteria | 5715 |
| 670 | Ga0501041_0000022 | 3300049577 | Bacteria | 52719 |
| 671 | Ga0501041_0018272 | 3300049577 | Bacteria | 4176 |
| 672 | Ga0501041_0022644 | 3300049577 | Bacteria | 3762 |
| 673 | Ga0501041_0112204 | 3300049577 | Bacteria | 1691 |
| 674 | Ga0501042_0000092 | 3300049578 | Bacteria | 35165 |
| 675 | Ga0501042_0000116 | 3300049578 | Bacteria | 33871 |
| 676 | Ga0501042_0006221 | 3300049578 | Bacteria | 7749 |
| 677 | Ga0501042_0032416 | 3300049578 | Bacteria | 3700 |
| 678 | Ga0501043_0002379 | 3300049579 | Bacteria | 15929 |
| 679 | Ga0501043_0008893 | 3300049579 | Bacteria | 7905 |
| 680 | Ga0501043_0009566 | 3300049579 | Bacteria | 7599 |
| 681 | Ga0501043_0037789 | 3300049579 | Bacteria | 3797 |
| 682 | Ga0501043_0094988 | 3300049579 | Bacteria | 2343 |
| 683 | Ga0501043_0134946 | 3300049579 | Bacteria | 1933 |
| 684 | Ga0501046_0006232 | 3300049580 | Bacteria | 10588 |
| 685 | Ga0501046_0012145 | 3300049580 | Bacteria | 7340 |
| 686 | Ga0501047_0000208 | 3300049581 | Bacteria | 71122 |
| 687 | Ga0501047_0000826 | 3300049581 | Bacteria | 32127 |
| 688 | Ga0501047_0001408 | 3300049581 | Bacteria | 23584 |
| 689 | Ga0501047_0010177 | 3300049581 | Bacteria | 8894 |
| 690 | Ga0501047_0034790 | 3300049581 | Bacteria | 4864 |
| 691 | Ga0501047_0058387 | 3300049581 | Bacteria | 3727 |
| 692 | Ga0501047_0153822 | 3300049581 | Bacteria | 2174 |
| 693 | Ga0501047_0162173 | 3300049581 | Bacteria | 2107 |
| 694 | Ga0501047_0275862 | 3300049581 | Bacteria | 1527 |
| 695 | Ga0501048_0001223 | 3300049582 | Bacteria | 19432 |
| 696 | Ga0501048_0002836 | 3300049582 | Bacteria | 13235 |
| 697 | Ga0501048_0003265 | 3300049582 | Bacteria | 12350 |
| 698 | Ga0501048_0008489 | 3300049582 | Bacteria | 7766 |
| 699 | Ga0501067_0012647 | 3300049583 | Bacteria | 4681 |
| 700 | Ga0501067_0045158 | 3300049583 | Bacteria | 2447 |
| 701 | Ga0501067_0051974 | 3300049583 | Bacteria | 2270 |
| 702 | Ga0501068_0000554 | 3300049584 | Bacteria | 18987 |
| 703 | Ga0501068_0007032 | 3300049584 | Bacteria | 6227 |
| 704 | Ga0501068_0010233 | 3300049584 | Bacteria | 5265 |
| 705 | Ga0501068_0064134 | 3300049584 | Bacteria | 2235 |
| 706 | Ga0501069_0003487 | 3300049585 | Bacteria | 8100 |
| 707 | Ga0501069_0004761 | 3300049585 | Bacteria | 7022 |
| 708 | Ga0501069_0005499 | 3300049585 | Bacteria | 6594 |
| 709 | Ga0501069_0013055 | 3300049585 | Bacteria | 4427 |
| 710 | Ga0501070_0007681 | 3300049586 | Bacteria | 9148 |
| 711 | Ga0501070_0008506 | 3300049586 | Bacteria | 8673 |
| 712 | Ga0501070_0019772 | 3300049586 | Bacteria | 5647 |
| 713 | Ga0501070_0034042 | 3300049586 | Bacteria | 4261 |
| 714 | Ga0501070_0040192 | 3300049586 | Bacteria | 3900 |
| 715 | Ga0501071_0001692 | 3300049587 | Bacteria | 12934 |
| 716 | Ga0501071_0001793 | 3300049587 | Bacteria | 12676 |
| 717 | Ga0501071_0015826 | 3300049587 | Bacteria | 5182 |
| 718 | Ga0501072_0002777 | 3300049588 | Bacteria | 13162 |
| 719 | Ga0501072_0003510 | 3300049588 | Bacteria | 11812 |
| 720 | Ga0501072_0024735 | 3300049588 | Bacteria | 4673 |
| 721 | Ga0501072_0139768 | 3300049588 | Bacteria | 1931 |
| 722 | Ga0501073_0016876 | 3300049589 | Bacteria | 5288 |
| 723 | Ga0501073_0056284 | 3300049589 | Bacteria | 2751 |
| 724 | Ga0501074_0002118 | 3300049590 | Bacteria | 13705 |
| 725 | Ga0501074_0004639 | 3300049590 | Bacteria | 9842 |
| 726 | Ga0501074_0047815 | 3300049590 | Bacteria | 3091 |
| 727 | Ga0501075_0000040 | 3300049591 | Bacteria | 52221 |
| 728 | Ga0501075_0003487 | 3300049591 | Bacteria | 10517 |
| 729 | Ga0501075_0011446 | 3300049591 | Bacteria | 6278 |
| 730 | Ga0501076_0000389 | 3300049592 | Bacteria | 27457 |
| 731 | Ga0501076_0000462 | 3300049592 | Bacteria | 25816 |
| 732 | Ga0501076_0067249 | 3300049592 | Bacteria | 2861 |
| 733 | Ga0501076_0371470 | 3300049592 | Bacteria | 1175 |
| 734 | Ga0501077_0002796 | 3300049593 | Bacteria | 10472 |
| 735 | Ga0501077_0002948 | 3300049593 | Bacteria | 10210 |
| 736 | Ga0501077_0004601 | 3300049593 | Bacteria | 8377 |
| 737 | Ga0501077_0131028 | 3300049593 | Bacteria | 1590 |
| 738 | Ga0501217_073485 | 3300049661 | Bacteria | 935 |
| 739 | Ga0501235_009842 | 3300049669 | Bacteria | 2091 |
| 740 | Ga0501079_0000221 | 3300049741 | Bacteria | 33871 |
| 741 | Ga0501079_0004632 | 3300049741 | Bacteria | 10184 |
| 742 | Ga0501079_0026729 | 3300049741 | Bacteria | 4424 |
| 743 | Ga0501079_0038108 | 3300049741 | Bacteria | 3707 |
| 744 | Ga0501079_0385983 | 3300049741 | Bacteria | 1098 |
| 745 | Ga0501080_0020495 | 3300049742 | Bacteria | 6121 |
| 746 | Ga0501080_0076027 | 3300049742 | Bacteria | 3123 |
| 747 | Ga0501080_0118518 | 3300049742 | Bacteria | 2454 |
| 748 | Ga0501081_0000040 | 3300049743 | Bacteria | 48110 |
| 749 | Ga0501083_0000928 | 3300049744 | Bacteria | 19450 |
| 750 | Ga0501083_0005593 | 3300049744 | Bacteria | 8897 |
| 751 | Ga0501083_0025547 | 3300049744 | Bacteria | 4089 |
| 752 | Ga0501035_0002456 | 3300049822 | Bacteria | 18091 |
| 753 | Ga0501035_0003339 | 3300049822 | Bacteria | 15375 |
| 754 | Ga0501035_0006640 | 3300049822 | Bacteria | 10827 |
| 755 | Ga0501035_0017516 | 3300049822 | Bacteria | 6609 |
| 756 | Ga0501035_0051344 | 3300049822 | Bacteria | 3692 |
| 757 | Ga0501035_0060331 | 3300049822 | Bacteria | 3376 |
| 758 | Ga0501035_0100173 | 3300049822 | Bacteria | 2543 |
| 759 | Ga0501035_0130552 | 3300049822 | Bacteria | 2190 |
| 760 | Ga0501035_0219613 | 3300049822 | Bacteria | 1623 |
| 761 | Ga0501035_0241959 | 3300049822 | Bacteria | 1534 |
| 762 | Ga0501044_0002530 | 3300049823 | Bacteria | 20819 |
| 763 | Ga0501044_0006326 | 3300049823 | Bacteria | 13093 |
| 764 | Ga0501044_0073821 | 3300049823 | Bacteria | 3466 |
| 765 | Ga0501044_0085043 | 3300049823 | Bacteria | 3196 |
| 766 | Ga0501044_0089148 | 3300049823 | Bacteria | 3113 |
| 767 | Ga0501044_0120708 | 3300049823 | Bacteria | 2622 |
| 768 | Ga0501044_0122874 | 3300049823 | Bacteria | 2595 |
| 769 | Ga0501044_0166744 | 3300049823 | Bacteria | 2176 |
| 770 | Ga0501044_0200418 | 3300049823 | Bacteria | 1954 |
| 771 | Ga0501044_0359329 | 3300049823 | Bacteria | 1374 |
| 772 | Ga0501045_0000098 | 3300049824 | Bacteria | 42917 |
| 773 | Ga0501045_0002356 | 3300049824 | Bacteria | 12832 |
| 774 | Ga0501045_0003655 | 3300049824 | Bacteria | 10576 |
| 775 | Ga0501045_0166089 | 3300049824 | Bacteria | 1644 |
| 776 | nmdc:mga03n38_6891_c1 | 3300050490 | Bacteria | 3987 |
| 777 | nmdc:mga06z11_532_c1 | 3300050494 | Bacteria | 14020 |
| 778 | nmdc:mga04h51_20902_c1 | 3300050495 | Bacteria | 1962 |
| 779 | nmdc:mga05p37_3875_c1 | 3300050507 | Bacteria | 17497 |
| 780 | nmdc:mga05p37_68128_c1 | 3300050507 | Bacteria | 4377 |
| 781 | nmdc:mga09592_132774_c1 | 3300050508 | Bacteria | 2143 |
| 782 | nmdc:mga09592_5576_c1 | 3300050508 | Bacteria | 10250 |
| 783 | nmdc:mga0qj67_70686_c1 | 3300050509 | Bacteria | 2784 |
| 784 | nmdc:mga06r32_74469_c1 | 3300050510 | Bacteria | 3292 |
| 785 | nmdc:mga08y16_23786_c1 | 3300050511 | Bacteria | 6469 |
| 786 | Ga0495601_0033866 | 3300053077 | Bacteria | 3183 |
| 787 | Ga0500610_0075020 | 3300053079 | Bacteria | 1764 |
| 788 | Ga0495655_0018863 | 3300053083 | Bacteria | 1523 |
| 789 | Ga0495655_0022606 | 3300053083 | Bacteria | 1439 |
| 790 | Ga0495619_0020492 | 3300053085 | Bacteria | 4212 |
| 791 | Ga0495619_0074608 | 3300053085 | Bacteria | 2275 |
| 792 | Ga0500578_0068206 | 3300053086 | Bacteria | 2267 |
| 793 | Ga0500644_0039186 | 3300053088 | Bacteria | 1560 |
| 794 | Ga0500644_0110756 | 3300053088 | Bacteria | 1057 |
| 795 | Ga0500566_0163335 | 3300053094 | Bacteria | 1158 |
| 796 | Ga0500640_001478 | 3300053095 | Bacteria | 7169 |
| 797 | Ga0500654_022817 | 3300053099 | Bacteria | 3960 |
| 798 | Ga0500660_052204 | 3300053100 | Bacteria | 2016 |
| 799 | Ga0500553_027280 | 3300053101 | Bacteria | 2870 |
| 800 | Ga0500569_011885 | 3300053109 | Bacteria | 2091 |
| 801 | Ga0500572_003088 | 3300053111 | Bacteria | 3869 |
| 802 | Ga0500614_059138 | 3300053123 | Bacteria | 1026 |
| 803 | Ga0500621_063974 | 3300053126 | Bacteria | 1486 |
| 804 | Ga0500628_001446 | 3300053129 | Bacteria | 4064 |
| 805 | Ga0500652_001865 | 3300053131 | Bacteria | 6350 |
| 806 | Ga0500658_0133373 | 3300053134 | Bacteria | 1109 |
| 807 | Ga0500579_023333 | 3300053143 | Bacteria | 4004 |
| 808 | Ga0500600_0027810 | 3300053149 | Bacteria | 3349 |
| 809 | Ga0500600_0160951 | 3300053149 | Bacteria | 1104 |
| 810 | Ga0500616_0006712 | 3300053153 | Bacteria | 7470 |
| 811 | Ga0500624_001192 | 3300053157 | Bacteria | 4721 |
| 812 | Ga0500633_0035278 | 3300053160 | Bacteria | 1646 |
| 813 | Ga0500634_0021167 | 3300053161 | Bacteria | 3521 |
| 814 | Ga0500656_000062 | 3300053732 | Bacteria | 6200 |
| 815 | Ga0500587_002988 | 3300053739 | Bacteria | 2394 |
| 816 | Ga0501084_0000228 | 3300054114 | Bacteria | 42475 |
| 817 | Ga0501084_0000955 | 3300054114 | Bacteria | 22375 |
| 818 | Ga0501084_0051910 | 3300054114 | Bacteria | 3431 |
| 819 | Ga0501084_0579896 | 3300054114 | Bacteria | 948 |
| 820 | Ga0587084_003095 | 3300059477 | Bacteria | 1799 |
| 821 | Ga0587128_027308 | 3300059630 | Bacteria | 922 |
| 822 | Ga0501082_0000313 | 3300060353 | Bacteria | 43217 |
| 823 | Ga0501082_0001912 | 3300060353 | Bacteria | 18307 |
| 824 | Ga0501082_0009457 | 3300060353 | Bacteria | 8392 |
| 825 | Ga0501082_0384503 | 3300060353 | Bacteria | 1225 |
| 826 | Ga0466962_0007506 | 3300061719 | Bacteria | 5230 |
| 827 | Ga0466962_0023083 | 3300061719 | Bacteria | 2990 |
| 828 | Ga0466962_0037246 | 3300061719 | Bacteria | 2329 |
| 829 | Ga0466962_0053301 | 3300061719 | Bacteria | 1933 |
| 830 | Ga0466962_0091265 | 3300061719 | Bacteria | 1460 |
| 831 | Ga0466962_0152958 | 3300061719 | Bacteria | 1119 |
| 832 | Ga0530510_0000233 | 3300061734 | Bacteria | 34858 |
| 833 | Ga0530510_0002808 | 3300061734 | Bacteria | 11975 |
| 834 | Ga0530510_0058431 | 3300061734 | Bacteria | 2789 |
| 835 | Ga0530510_0451617 | 3300061734 | Bacteria | 972 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046794 | Ga0495589_0159944 | Ga0495589_0159944_292_1035 | 211 |
| 2 | 3300046455 | Ga0495603_0001314 | Ga0495603_0001314_12212_12988 | 230 |
| 3 | 3300046455 | Ga0495603_0002392 | Ga0495603_0002392_1948_2724 | 230 |
| 4 | 3300046459 | Ga0495629_0009911 | Ga0495629_0009911_4237_5013 | 230 |
| 5 | 3300046459 | Ga0495629_0050973 | Ga0495629_0050973_713_1489 | 230 |
| 6 | 3300046499 | Ga0495594_0003850 | Ga0495594_0003850_6051_6827 | 230 |
| 7 | 3300046557 | Ga0495622_0002792 | Ga0495622_0002792_720_1496 | 230 |
| 8 | 3300046648 | Ga0495611_0025741 | Ga0495611_0025741_256_1032 | 230 |
| 9 | 3300046689 | Ga0495613_0008120 | Ga0495613_0008120_5207_5983 | 230 |
| 10 | 3300047318 | Ga0495636_0024543 | Ga0495636_0024543_1308_2084 | 230 |
| 11 | 3300047321 | Ga0495676_0024945 | Ga0495676_0024945_1438_2214 | 230 |
| 12 | 3300047321 | Ga0495676_0035244 | Ga0495676_0035244_1450_2226 | 230 |
| 13 | 3300048089 | Ga0495614_0010362 | Ga0495614_0010362_2178_2954 | 230 |
| 14 | 3300048909 | Ga0496106_0133229 | Ga0496106_0133229_1023_1799 | 230 |
| 15 | 3300023436 | Ga0256743_117949 | Ga0256743_1179491 | 233 |
| 16 | 3300048922 | Ga0496119_0090643 | Ga0496119_0090643_960_1721 | 233 |
| 17 | iso_pu_bacteria | 2767802112 | 2768647102 | 233 |
| 18 | iso_pu_bacteria | 2862705112 | 2862710045 | 233 |
| 19 | iso_pu_bacteria | 2867346516 | 2867350899 | 233 |
| 20 | iso_pu_bacteria | 2867369537 | 2867374088 | 233 |
| 21 | iso_pu_bacteria | 2990044586 | 2990045975 | 233 |
| 22 | iso_pu_bacteria | 8008485437 | 8008487231 | 233 |
| 23 | iso_pu_bacteria | 8025524527 | 8025526336 | 233 |
| 24 | 3300005455 | Ga0070663_100284069 | Ga0070663_1002840691 | 234 |
| 25 | 3300010375 | Ga0105239_10034294 | Ga0105239_100342946 | 234 |
| 26 | 3300025914 | Ga0207671_10174417 | Ga0207671_101744173 | 234 |
| 27 | 3300025941 | Ga0207711_10222508 | Ga0207711_102225081 | 234 |
| 28 | 3300028786 | Ga0307517_10013060 | Ga0307517_100130609 | 234 |
| 29 | 3300030521 | Ga0307511_10078834 | Ga0307511_100788342 | 234 |
| 30 | 3300031616 | Ga0307508_10027731 | Ga0307508_100277313 | 234 |
| 31 | 3300044693 | Ga0466961_0147629 | Ga0466961_0147629_622_1368 | 234 |
| 32 | 3300044765 | Ga0466970_0053168 | Ga0466970_0053168_480_1226 | 234 |
| 33 | 3300046460 | Ga0495638_0031950 | Ga0495638_0031950_867_1601 | 234 |
| 34 | 3300046499 | Ga0495594_0037464 | Ga0495594_0037464_1346_2080 | 234 |
| 35 | 3300046519 | Ga0495632_0054356 | Ga0495632_0054356_663_1397 | 234 |
| 36 | 3300046522 | Ga0495643_0019979 | Ga0495643_0019979_175_909 | 234 |
| 37 | 3300046558 | Ga0495633_0020844 | Ga0495633_0020844_623_1357 | 234 |
| 38 | 3300046642 | Ga0495634_0353305 | Ga0495634_0353305_22_756 | 234 |
| 39 | 3300046691 | Ga0495670_0012222 | Ga0495670_0012222_3027_3761 | 234 |
| 40 | 3300046794 | Ga0495589_0011849 | Ga0495589_0011849_3392_4126 | 234 |
| 41 | 3300046810 | Ga0495660_0010493 | Ga0495660_0010493_2583_3317 | 234 |
| 42 | 3300047315 | Ga0495581_0136650 | Ga0495581_0136650_69_803 | 234 |
| 43 | 3300047323 | Ga0495683_0068198 | Ga0495683_0068198_237_971 | 234 |
| 44 | 3300047444 | Ga0495675_0274263 | Ga0495675_0274263_107_856 | 234 |
| 45 | 3300047447 | Ga0495685_000822 | Ga0495685_000822_7393_8127 | 234 |
| 46 | 3300047470 | Ga0495681_0013269 | Ga0495681_0013269_1991_2725 | 234 |
| 47 | 3300053083 | Ga0495655_0022606 | Ga0495655_0022606_275_1009 | 234 |
| 48 | 3300053086 | Ga0500578_0068206 | Ga0500578_0068206_1253_1987 | 234 |
| 49 | 3300053094 | Ga0500566_0163335 | Ga0500566_0163335_128_862 | 234 |
| 50 | 3300053099 | Ga0500654_022817 | Ga0500654_022817_817_1551 | 234 |
| 51 | 3300053100 | Ga0500660_052204 | Ga0500660_052204_979_1713 | 234 |
| 52 | 3300053101 | Ga0500553_027280 | Ga0500553_027280_1432_2166 | 234 |
| 53 | 3300053109 | Ga0500569_011885 | Ga0500569_011885_408_1142 | 234 |
| 54 | 3300053126 | Ga0500621_063974 | Ga0500621_063974_685_1419 | 234 |
| 55 | 3300053129 | Ga0500628_001446 | Ga0500628_001446_480_1214 | 234 |
| 56 | 3300053131 | Ga0500652_001865 | Ga0500652_001865_3006_3740 | 234 |
| 57 | 3300053134 | Ga0500658_0133373 | Ga0500658_0133373_52_786 | 234 |
| 58 | 3300053143 | Ga0500579_023333 | Ga0500579_023333_2077_2811 | 234 |
| 59 | 3300053149 | Ga0500600_0027810 | Ga0500600_0027810_1991_2725 | 234 |
| 60 | 3300053153 | Ga0500616_0006712 | Ga0500616_0006712_3415_4149 | 234 |
| 61 | 3300053161 | Ga0500634_0021167 | Ga0500634_0021167_409_1143 | 234 |
| 62 | 3300053732 | Ga0500656_000062 | Ga0500656_000062_2178_2912 | 234 |
| 63 | 3300053739 | Ga0500587_002988 | Ga0500587_002988_1347_2081 | 234 |
| 64 | 3300006178 | Ga0075367_10055576 | Ga0075367_100555762 | 235 |
| 65 | 3300038996 | Ga0242420_016285 | Ga0242420_016285_68_811 | 235 |
| 66 | iso_pu_bacteria | 2995463766 | 2995466939 | 235 |
| 67 | 3300042876 | Ga0451577_0199827 | Ga0451577_0199827_292_1014 | 236 |
| 68 | 3300032002 | Ga0307416_100133491 | Ga0307416_1001334912 | 237 |
| 69 | 3300046511 | Ga0495608_0109066 | Ga0495608_0109066_112_846 | 237 |
| 70 | 3300049539 | Ga0501323_002625 | Ga0501323_002625_792_1568 | 237 |
| 71 | iso_pu_bacteria | 2582581312 | 2585297437 | 237 |
| 72 | iso_pu_bacteria | 2616644941 | 2616903763 | 237 |
| 73 | iso_pu_bacteria | 2643221548 | 2643761529 | 237 |
| 74 | iso_pu_bacteria | 2643221578 | 2643899388 | 237 |
| 75 | iso_pu_bacteria | 2643221673 | 2644406876 | 237 |
| 76 | iso_pu_bacteria | 2643221682 | 2644458769 | 237 |
| 77 | iso_pu_bacteria | 2818991463 | 2819698943 | 237 |
| 78 | iso_pu_bacteria | 2875391855 | 2875396994 | 237 |
| 79 | iso_pu_bacteria | 2946045630 | 2946047563 | 237 |
| 80 | iso_pu_bacteria | 2966598605 | 2966600599 | 237 |
| 81 | iso_pu_bacteria | 2990088156 | 2990093889 | 237 |
| 82 | 3300003354 | JGI25160J50197_1032677 | JGI25160J50197_10326772 | 238 |
| 83 | 3300025302 | Ga0207426_1010853 | Ga0207426_10108534 | 238 |
| 84 | 3300031616 | Ga0307508_10005717 | Ga0307508_100057174 | 238 |
| 85 | 3300033180 | Ga0307510_10074586 | Ga0307510_100745864 | 238 |
| 86 | 3300049669 | Ga0501235_009842 | Ga0501235_009842_632_1396 | 238 |
| 87 | iso_pu_bacteria | 2643221601 | 2644015875 | 238 |
| 88 | iso_pu_bacteria | 2643221631 | 2644176444 | 238 |
| 89 | iso_pu_bacteria | 2811994917 | 2812478517 | 238 |
| 90 | iso_pu_bacteria | 2818991472 | 2819740458 | 238 |
| 91 | iso_pu_bacteria | 2862290372 | 2862292283 | 238 |
| 92 | iso_pu_bacteria | 2873151551 | 2873153815 | 238 |
| 93 | iso_pu_bacteria | 2887443736 | 2887447471 | 238 |
| 94 | iso_pu_bacteria | 8025478263 | 8025484204 | 238 |
| 95 | iso_pu_bacteria | 8056447290 | 8056447822 | 238 |
| 96 | iso_pu_bacteria | 8056667051 | 8056670782 | 238 |
| 97 | 3300001989 | JGI24739J22299_10012724 | JGI24739J22299_100127243 | 239 |
| 98 | 3300001990 | JGI24737J22298_10015604 | JGI24737J22298_100156043 | 239 |
| 99 | 3300003215 | JGI25153J46596_10036081 | JGI25153J46596_100360812 | 239 |
| 100 | 3300005563 | Ga0068855_100284016 | Ga0068855_1002840162 | 239 |
| 101 | 3300005614 | Ga0068856_100274909 | Ga0068856_1002749091 | 239 |
| 102 | 3300006048 | Ga0075363_100015415 | Ga0075363_1000154153 | 239 |
| 103 | 3300006048 | Ga0075363_100321325 | Ga0075363_1003213251 | 239 |
| 104 | 3300006178 | Ga0075367_10018582 | Ga0075367_100185822 | 239 |
| 105 | 3300009177 | Ga0105248_10388518 | Ga0105248_103885182 | 239 |
| 106 | 3300014497 | Ga0182008_10000192 | Ga0182008_1000019213 | 239 |
| 107 | 3300015262 | Ga0182007_10000449 | Ga0182007_1000044916 | 239 |
| 108 | 3300015688 | Ga0183367_1013 | Ga0183367_101395 | 239 |
| 109 | 3300025297 | Ga0209758_1008233 | Ga0209758_10082333 | 239 |
| 110 | 3300025302 | Ga0207426_1012936 | Ga0207426_10129363 | 239 |
| 111 | 3300025904 | Ga0207647_10018288 | Ga0207647_100182884 | 239 |
| 112 | 3300025949 | Ga0207667_10077006 | Ga0207667_100770063 | 239 |
| 113 | 3300025981 | Ga0207640_10129826 | Ga0207640_101298263 | 239 |
| 114 | 3300028786 | Ga0307517_10016670 | Ga0307517_100166703 | 239 |
| 115 | 3300028794 | Ga0307515_10052796 | Ga0307515_100527967 | 239 |
| 116 | 3300028794 | Ga0307515_10108038 | Ga0307515_101080382 | 239 |
| 117 | 3300028794 | Ga0307515_10298560 | Ga0307515_102985602 | 239 |
| 118 | 3300030521 | Ga0307511_10001435 | Ga0307511_1000143525 | 239 |
| 119 | 3300030522 | Ga0307512_10002986 | Ga0307512_1000298620 | 239 |
| 120 | 3300030522 | Ga0307512_10082717 | Ga0307512_100827172 | 239 |
| 121 | 3300030522 | Ga0307512_10082851 | Ga0307512_100828513 | 239 |
| 122 | 3300031456 | Ga0307513_10010933 | Ga0307513_100109334 | 239 |
| 123 | 3300031456 | Ga0307513_10124337 | Ga0307513_101243373 | 239 |
| 124 | 3300031507 | Ga0307509_10034088 | Ga0307509_100340885 | 239 |
| 125 | 3300031616 | Ga0307508_10049648 | Ga0307508_100496483 | 239 |
| 126 | 3300031616 | Ga0307508_10062760 | Ga0307508_100627602 | 239 |
| 127 | 3300031649 | Ga0307514_10003971 | Ga0307514_100039715 | 239 |
| 128 | 3300031649 | Ga0307514_10076048 | Ga0307514_100760481 | 239 |
| 129 | 3300031649 | Ga0307514_10136963 | Ga0307514_101369632 | 239 |
| 130 | 3300031649 | Ga0307514_10251391 | Ga0307514_102513911 | 239 |
| 131 | 3300031730 | Ga0307516_10039054 | Ga0307516_100390544 | 239 |
| 132 | 3300031730 | Ga0307516_10046419 | Ga0307516_100464193 | 239 |
| 133 | 3300031838 | Ga0307518_10241147 | Ga0307518_102411472 | 239 |
| 134 | 3300033179 | Ga0307507_10056142 | Ga0307507_100561423 | 239 |
| 135 | 3300033179 | Ga0307507_10208777 | Ga0307507_102087771 | 239 |
| 136 | 3300033180 | Ga0307510_10225825 | Ga0307510_102258252 | 239 |
| 137 | 3300033180 | Ga0307510_10311842 | Ga0307510_103118422 | 239 |
| 138 | 3300037312 | Ga0395899_0130701 | Ga0395899_0130701_762_1520 | 239 |
| 139 | 3300037466 | Ga0395898_0013768 | Ga0395898_0013768_5570_6328 | 239 |
| 140 | 3300037466 | Ga0395898_0018786 | Ga0395898_0018786_5724_6482 | 239 |
| 141 | 3300038443 | Ga0395901_0498892 | Ga0395901_0498892_16_774 | 239 |
| 142 | 3300041404 | Ga0439436_0011347 | Ga0439436_0011347_219_977 | 239 |
| 143 | 3300041404 | Ga0439436_0023689 | Ga0439436_0023689_931_1689 | 239 |
| 144 | 3300041443 | Ga0451789_0337061 | Ga0451789_0337061_903_1661 | 239 |
| 145 | 3300041494 | Ga0451837_1578301 | Ga0451837_1578301_2266_3039 | 239 |
| 146 | 3300041999 | Ga0439433_0000155 | Ga0439433_0000155_8719_9477 | 239 |
| 147 | 3300042002 | Ga0439442_018925 | Ga0439442_018925_588_1346 | 239 |
| 148 | 3300042005 | Ga0439448_0036914 | Ga0439448_0036914_789_1547 | 239 |
| 149 | 3300042006 | Ga0439432_052632 | Ga0439432_052632_64_822 | 239 |
| 150 | 3300042007 | Ga0439449_0003789 | Ga0439449_0003789_338_1096 | 239 |
| 151 | 3300042007 | Ga0439449_0014267 | Ga0439449_0014267_242_1000 | 239 |
| 152 | 3300042014 | Ga0439457_005828 | Ga0439457_005828_293_1051 | 239 |
| 153 | 3300042014 | Ga0439457_012835 | Ga0439457_012835_400_1158 | 239 |
| 154 | 3300042015 | Ga0439462_0001709 | Ga0439462_0001709_1122_1880 | 239 |
| 155 | 3300042127 | Ga0450890_005177 | Ga0450890_005177_787_1545 | 239 |
| 156 | 3300042138 | Ga0450903_001506 | Ga0450903_001506_3302_4060 | 239 |
| 157 | 3300042138 | Ga0450903_001798 | Ga0450903_001798_357_1160 | 239 |
| 158 | 3300044656 | Ga0466969_0000370 | Ga0466969_0000370_16257_17063 | 239 |
| 159 | 3300044656 | Ga0466969_0096666 | Ga0466969_0096666_196_954 | 239 |
| 160 | 3300044658 | Ga0466972_0006455 | Ga0466972_0006455_973_1731 | 239 |
| 161 | 3300044658 | Ga0466972_0050772 | Ga0466972_0050772_263_1021 | 239 |
| 162 | 3300044658 | Ga0466972_0053572 | Ga0466972_0053572_919_1677 | 239 |
| 163 | 3300044683 | Ga0466965_0025338 | Ga0466965_0025338_191_949 | 239 |
| 164 | 3300044683 | Ga0466965_0121905 | Ga0466965_0121905_227_985 | 239 |
| 165 | 3300044684 | Ga0466966_0019527 | Ga0466966_0019527_2153_2911 | 239 |
| 166 | 3300044684 | Ga0466966_0029700 | Ga0466966_0029700_2291_3097 | 239 |
| 167 | 3300044684 | Ga0466966_0139761 | Ga0466966_0139761_257_1015 | 239 |
| 168 | 3300044693 | Ga0466961_0005082 | Ga0466961_0005082_2530_3288 | 239 |
| 169 | 3300044693 | Ga0466961_0031877 | Ga0466961_0031877_825_1631 | 239 |
| 170 | 3300044693 | Ga0466961_0102214 | Ga0466961_0102214_236_994 | 239 |
| 171 | 3300044694 | Ga0466963_0017382 | Ga0466963_0017382_1932_2693 | 239 |
| 172 | 3300044694 | Ga0466963_0022628 | Ga0466963_0022628_1457_2215 | 239 |
| 173 | 3300044706 | Ga0466964_0067625 | Ga0466964_0067625_409_1167 | 239 |
| 174 | 3300044719 | Ga0466971_0000315 | Ga0466971_0000315_2393_3151 | 239 |
| 175 | 3300044765 | Ga0466970_0061396 | Ga0466970_0061396_214_972 | 239 |
| 176 | 3300044765 | Ga0466970_0098560 | Ga0466970_0098560_549_1307 | 239 |
| 177 | 3300044765 | Ga0466970_0195766 | Ga0466970_0195766_12_770 | 239 |
| 178 | 3300044842 | Ga0466957_0010923 | Ga0466957_0010923_1645_2403 | 239 |
| 179 | 3300044901 | Ga0466960_0009167 | Ga0466960_0009167_697_1455 | 239 |
| 180 | 3300045049 | Ga0466959_0013084 | Ga0466959_0013084_2694_3500 | 239 |
| 181 | 3300045049 | Ga0466959_0044261 | Ga0466959_0044261_973_1731 | 239 |
| 182 | 3300045836 | Ga0466958_0001227 | Ga0466958_0001227_3305_4063 | 239 |
| 183 | 3300045976 | Ga0466967_0246816 | Ga0466967_0246816_682_1443 | 239 |
| 184 | 3300045976 | Ga0466967_0291314 | Ga0466967_0291314_475_1233 | 239 |
| 185 | 3300046452 | Ga0495617_003061 | Ga0495617_003061_2126_2896 | 239 |
| 186 | 3300046454 | Ga0495592_0007933 | Ga0495592_0007933_6261_7031 | 239 |
| 187 | 3300046454 | Ga0495592_0042740 | Ga0495592_0042740_1205_1972 | 239 |
| 188 | 3300046455 | Ga0495603_0092888 | Ga0495603_0092888_784_1593 | 239 |
| 189 | 3300046455 | Ga0495603_0132408 | Ga0495603_0132408_263_1141 | 239 |
| 190 | 3300046459 | Ga0495629_0047019 | Ga0495629_0047019_647_1405 | 239 |
| 191 | 3300046459 | Ga0495629_0071995 | Ga0495629_0071995_695_1465 | 239 |
| 192 | 3300046460 | Ga0495638_0024771 | Ga0495638_0024771_274_1044 | 239 |
| 193 | 3300046460 | Ga0495638_0096043 | Ga0495638_0096043_227_997 | 239 |
| 194 | 3300046462 | Ga0495651_0005450 | Ga0495651_0005450_1673_2431 | 239 |
| 195 | 3300046462 | Ga0495651_0014060 | Ga0495651_0014060_4402_5172 | 239 |
| 196 | 3300046462 | Ga0495651_0016661 | Ga0495651_0016661_1088_1855 | 239 |
| 197 | 3300046463 | Ga0495653_0002328 | Ga0495653_0002328_5490_6257 | 239 |
| 198 | 3300046472 | Ga0495580_0058285 | Ga0495580_0058285_1059_1826 | 239 |
| 199 | 3300046472 | Ga0495580_0141025 | Ga0495580_0141025_32_802 | 239 |
| 200 | 3300046475 | Ga0495639_0037671 | Ga0495639_0037671_271_1041 | 239 |
| 201 | 3300046476 | Ga0495662_0006205 | Ga0495662_0006205_3376_4134 | 239 |
| 202 | 3300046476 | Ga0495662_0009374 | Ga0495662_0009374_2089_2856 | 239 |
| 203 | 3300046476 | Ga0495662_0149450 | Ga0495662_0149450_233_1111 | 239 |
| 204 | 3300046477 | Ga0495664_0002191 | Ga0495664_0002191_5571_6338 | 239 |
| 205 | 3300046477 | Ga0495664_0005789 | Ga0495664_0005789_2612_3370 | 239 |
| 206 | 3300046477 | Ga0495664_0021670 | Ga0495664_0021670_1417_2187 | 239 |
| 207 | 3300046492 | Ga0495585_0038740 | Ga0495585_0038740_804_1574 | 239 |
| 208 | 3300046499 | Ga0495594_0198855 | Ga0495594_0198855_232_1110 | 239 |
| 209 | 3300046499 | Ga0495594_0363750 | Ga0495594_0363750_27_797 | 239 |
| 210 | 3300046500 | Ga0495596_0009731 | Ga0495596_0009731_1948_2718 | 239 |
| 211 | 3300046501 | Ga0495607_0071225 | Ga0495607_0071225_1019_1789 | 239 |
| 212 | 3300046501 | Ga0495607_0072549 | Ga0495607_0072549_194_964 | 239 |
| 213 | 3300046506 | Ga0495583_0087058 | Ga0495583_0087058_366_1136 | 239 |
| 214 | 3300046507 | Ga0495606_0012438 | Ga0495606_0012438_1270_2040 | 239 |
| 215 | 3300046512 | Ga0495610_0035874 | Ga0495610_0035874_1361_2131 | 239 |
| 216 | 3300046513 | Ga0495616_0004457 | Ga0495616_0004457_5234_6004 | 239 |
| 217 | 3300046514 | Ga0495618_0042215 | Ga0495618_0042215_697_1467 | 239 |
| 218 | 3300046515 | Ga0495620_0052174 | Ga0495620_0052174_443_1213 | 239 |
| 219 | 3300046516 | Ga0495628_0000938 | Ga0495628_0000938_9457_10224 | 239 |
| 220 | 3300046516 | Ga0495628_0064657 | Ga0495628_0064657_725_1495 | 239 |
| 221 | 3300046517 | Ga0495630_0007585 | Ga0495630_0007585_5695_6462 | 239 |
| 222 | 3300046517 | Ga0495630_0063176 | Ga0495630_0063176_1742_2500 | 239 |
| 223 | 3300046517 | Ga0495630_0464021 | Ga0495630_0464021_65_835 | 239 |
| 224 | 3300046518 | Ga0495631_0001249 | Ga0495631_0001249_7763_8533 | 239 |
| 225 | 3300046519 | Ga0495632_0179338 | Ga0495632_0179338_192_950 | 239 |
| 226 | 3300046520 | Ga0495637_0039510 | Ga0495637_0039510_140_910 | 239 |
| 227 | 3300046524 | Ga0495648_0040688 | Ga0495648_0040688_1605_2375 | 239 |
| 228 | 3300046526 | Ga0495666_0009175 | Ga0495666_0009175_3019_3786 | 239 |
| 229 | 3300046526 | Ga0495666_0055878 | Ga0495666_0055878_269_1027 | 239 |
| 230 | 3300046528 | Ga0495642_0056270 | Ga0495642_0056270_226_996 | 239 |
| 231 | 3300046529 | Ga0495652_0014739 | Ga0495652_0014739_1700_2458 | 239 |
| 232 | 3300046529 | Ga0495652_0037238 | Ga0495652_0037238_2513_3283 | 239 |
| 233 | 3300046529 | Ga0495652_0037994 | Ga0495652_0037994_1360_2127 | 239 |
| 234 | 3300046531 | Ga0495665_0002842 | Ga0495665_0002842_1889_2656 | 239 |
| 235 | 3300046533 | Ga0495640_0002611 | Ga0495640_0002611_3456_4223 | 239 |
| 236 | 3300046533 | Ga0495640_0021614 | Ga0495640_0021614_1923_2732 | 239 |
| 237 | 3300046533 | Ga0495640_0050705 | Ga0495640_0050705_891_1661 | 239 |
| 238 | 3300046533 | Ga0495640_0092007 | Ga0495640_0092007_1186_1944 | 239 |
| 239 | 3300046535 | Ga0495586_0018407 | Ga0495586_0018407_886_1653 | 239 |
| 240 | 3300046536 | Ga0495587_0001074 | Ga0495587_0001074_3633_4391 | 239 |
| 241 | 3300046536 | Ga0495587_0013037 | Ga0495587_0013037_3683_4450 | 239 |
| 242 | 3300046538 | Ga0495609_0010159 | Ga0495609_0010159_2538_3308 | 239 |
| 243 | 3300046542 | Ga0495597_0078649 | Ga0495597_0078649_595_1365 | 239 |
| 244 | 3300046543 | Ga0495645_0007385 | Ga0495645_0007385_5348_6115 | 239 |
| 245 | 3300046557 | Ga0495622_0012292 | Ga0495622_0012292_2299_3069 | 239 |
| 246 | 3300046558 | Ga0495633_0015709 | Ga0495633_0015709_34_804 | 239 |
| 247 | 3300046559 | Ga0495667_0001343 | Ga0495667_0001343_7924_8691 | 239 |
| 248 | 3300046559 | Ga0495667_0101261 | Ga0495667_0101261_254_1012 | 239 |
| 249 | 3300046616 | Ga0495668_0035008 | Ga0495668_0035008_1019_1789 | 239 |
| 250 | 3300046642 | Ga0495634_0007476 | Ga0495634_0007476_3926_4693 | 239 |
| 251 | 3300046642 | Ga0495634_0039714 | Ga0495634_0039714_1162_1920 | 239 |
| 252 | 3300046642 | Ga0495634_0055670 | Ga0495634_0055670_880_1650 | 239 |
| 253 | 3300046648 | Ga0495611_0044189 | Ga0495611_0044189_1133_1903 | 239 |
| 254 | 3300046660 | Ga0495625_0008236 | Ga0495625_0008236_526_1284 | 239 |
| 255 | 3300046660 | Ga0495625_0023042 | Ga0495625_0023042_3467_4237 | 239 |
| 256 | 3300046663 | Ga0495635_0006847 | Ga0495635_0006847_1972_2730 | 239 |
| 257 | 3300046663 | Ga0495635_0056943 | Ga0495635_0056943_712_1482 | 239 |
| 258 | 3300046663 | Ga0495635_0059060 | Ga0495635_0059060_1035_1802 | 239 |
| 259 | 3300046663 | Ga0495635_0332570 | Ga0495635_0332570_71_841 | 239 |
| 260 | 3300046664 | Ga0495659_0062665 | Ga0495659_0062665_29_799 | 239 |
| 261 | 3300046665 | Ga0495661_0023038 | Ga0495661_0023038_1263_2033 | 239 |
| 262 | 3300046674 | Ga0495588_0022405 | Ga0495588_0022405_2109_2867 | 239 |
| 263 | 3300046674 | Ga0495588_0043702 | Ga0495588_0043702_631_1401 | 239 |
| 264 | 3300046674 | Ga0495588_0055475 | Ga0495588_0055475_390_1268 | 239 |
| 265 | 3300046675 | Ga0495657_0001181 | Ga0495657_0001181_2813_3571 | 239 |
| 266 | 3300046675 | Ga0495657_0006084 | Ga0495657_0006084_6308_7075 | 239 |
| 267 | 3300046675 | Ga0495657_0073052 | Ga0495657_0073052_365_1135 | 239 |
| 268 | 3300046675 | Ga0495657_0090308 | Ga0495657_0090308_235_1005 | 239 |
| 269 | 3300046678 | Ga0495599_0010033 | Ga0495599_0010033_1035_1802 | 239 |
| 270 | 3300046678 | Ga0495599_0021283 | Ga0495599_0021283_3237_4007 | 239 |
| 271 | 3300046679 | Ga0495623_0018012 | Ga0495623_0018012_1088_1855 | 239 |
| 272 | 3300046679 | Ga0495623_0056451 | Ga0495623_0056451_1171_1929 | 239 |
| 273 | 3300046679 | Ga0495623_0089463 | Ga0495623_0089463_1087_1857 | 239 |
| 274 | 3300046680 | Ga0495646_0000250 | Ga0495646_0000250_1944_2702 | 239 |
| 275 | 3300046680 | Ga0495646_0001026 | Ga0495646_0001026_11452_12219 | 239 |
| 276 | 3300046683 | Ga0495658_0018341 | Ga0495658_0018341_1971_2729 | 239 |
| 277 | 3300046689 | Ga0495613_0007591 | Ga0495613_0007591_652_1419 | 239 |
| 278 | 3300046689 | Ga0495613_0066011 | Ga0495613_0066011_254_1012 | 239 |
| 279 | 3300046689 | Ga0495613_0084475 | Ga0495613_0084475_467_1237 | 239 |
| 280 | 3300046689 | Ga0495613_0131993 | Ga0495613_0131993_792_1550 | 239 |
| 281 | 3300046690 | Ga0495624_0067786 | Ga0495624_0067786_1423_2193 | 239 |
| 282 | 3300046691 | Ga0495670_0207589 | Ga0495670_0207589_41_811 | 239 |
| 283 | 3300046692 | Ga0495671_0180778 | Ga0495671_0180778_225_983 | 239 |
| 284 | 3300046694 | Ga0495649_0052260 | Ga0495649_0052260_1163_1921 | 239 |
| 285 | 3300046794 | Ga0495589_0002240 | Ga0495589_0002240_9738_10508 | 239 |
| 286 | 3300046794 | Ga0495589_0041781 | Ga0495589_0041781_940_1710 | 239 |
| 287 | 3300046794 | Ga0495589_0051949 | Ga0495589_0051949_311_1189 | 239 |
| 288 | 3300046809 | Ga0495600_0007937 | Ga0495600_0007937_4714_5472 | 239 |
| 289 | 3300046809 | Ga0495600_0008654 | Ga0495600_0008654_4796_5566 | 239 |
| 290 | 3300046809 | Ga0495600_0065112 | Ga0495600_0065112_836_1603 | 239 |
| 291 | 3300047315 | Ga0495581_0019208 | Ga0495581_0019208_1231_1989 | 239 |
| 292 | 3300047315 | Ga0495581_0096738 | Ga0495581_0096738_266_1036 | 239 |
| 293 | 3300047317 | Ga0495604_0001060 | Ga0495604_0001060_5695_6462 | 239 |
| 294 | 3300047317 | Ga0495604_0006467 | Ga0495604_0006467_1978_2736 | 239 |
| 295 | 3300047318 | Ga0495636_0001884 | Ga0495636_0001884_6455_7333 | 239 |
| 296 | 3300047318 | Ga0495636_0024020 | Ga0495636_0024020_1529_2299 | 239 |
| 297 | 3300047319 | Ga0495674_0007676 | Ga0495674_0007676_8176_8943 | 239 |
| 298 | 3300047321 | Ga0495676_0031666 | Ga0495676_0031666_2080_2838 | 239 |
| 299 | 3300047321 | Ga0495676_0068733 | Ga0495676_0068733_873_1643 | 239 |
| 300 | 3300047322 | Ga0495680_0007609 | Ga0495680_0007609_5259_6029 | 239 |
| 301 | 3300047323 | Ga0495683_0013695 | Ga0495683_0013695_2355_3125 | 239 |
| 302 | 3300047443 | Ga0495687_003771 | Ga0495687_003771_869_1639 | 239 |
| 303 | 3300047444 | Ga0495675_0033734 | Ga0495675_0033734_1664_2431 | 239 |
| 304 | 3300047444 | Ga0495675_0129152 | Ga0495675_0129152_496_1254 | 239 |
| 305 | 3300047445 | Ga0495677_0052849 | Ga0495677_0052849_246_1016 | 239 |
| 306 | 3300047447 | Ga0495685_011579 | Ga0495685_011579_646_1401 | 239 |
| 307 | 3300047447 | Ga0495685_012832 | Ga0495685_012832_515_1285 | 239 |
| 308 | 3300047447 | Ga0495685_039045 | Ga0495685_039045_17_895 | 239 |
| 309 | 3300047447 | Ga0495685_054236 | Ga0495685_054236_360_1130 | 239 |
| 310 | 3300047469 | Ga0495673_0086767 | Ga0495673_0086767_444_1214 | 239 |
| 311 | 3300047470 | Ga0495681_0003360 | Ga0495681_0003360_2120_2878 | 239 |
| 312 | 3300047471 | Ga0495684_0074908 | Ga0495684_0074908_778_1548 | 239 |
| 313 | 3300047471 | Ga0495684_0078439 | Ga0495684_0078439_1088_1855 | 239 |
| 314 | 3300047673 | Ga0495593_0007985 | Ga0495593_0007985_2248_3006 | 239 |
| 315 | 3300047673 | Ga0495593_0031130 | Ga0495593_0031130_1130_1897 | 239 |
| 316 | 3300048088 | Ga0495602_0027338 | Ga0495602_0027338_1360_2127 | 239 |
| 317 | 3300048089 | Ga0495614_0033645 | Ga0495614_0033645_154_912 | 239 |
| 318 | 3300048089 | Ga0495614_0184013 | Ga0495614_0184013_33_803 | 239 |
| 319 | 3300048090 | Ga0495615_0019631 | Ga0495615_0019631_26_796 | 239 |
| 320 | 3300048091 | Ga0495626_0063224 | Ga0495626_0063224_19_789 | 239 |
| 321 | 3300048908 | Ga0496105_0227627 | Ga0496105_0227627_713_1483 | 239 |
| 322 | 3300048911 | Ga0496108_0091741 | Ga0496108_0091741_553_1323 | 239 |
| 323 | 3300048912 | Ga0496109_0040035 | Ga0496109_0040035_714_1484 | 239 |
| 324 | 3300048928 | Ga0496125_0115848 | Ga0496125_0115848_154_924 | 239 |
| 325 | 3300048929 | Ga0496126_0228288 | Ga0496126_0228288_353_1123 | 239 |
| 326 | 3300049129 | Ga0501309_000486 | Ga0501309_000486_77_973 | 239 |
| 327 | 3300049534 | Ga0501318_000559 | Ga0501318_000559_939_1835 | 239 |
| 328 | 3300049539 | Ga0501323_000528 | Ga0501323_000528_1524_2420 | 239 |
| 329 | 3300049539 | Ga0501323_000529 | Ga0501323_000529_1283_2062 | 239 |
| 330 | 3300049568 | Ga0501031_0030349 | Ga0501031_0030349_187_948 | 239 |
| 331 | 3300049570 | Ga0501033_0001734 | Ga0501033_0001734_11549_12307 | 239 |
| 332 | 3300049570 | Ga0501033_0110626 | Ga0501033_0110626_189_947 | 239 |
| 333 | 3300049571 | Ga0501034_0029729 | Ga0501034_0029729_3909_4670 | 239 |
| 334 | 3300049571 | Ga0501034_0072120 | Ga0501034_0072120_1219_1977 | 239 |
| 335 | 3300049571 | Ga0501034_0095381 | Ga0501034_0095381_1936_2694 | 239 |
| 336 | 3300049572 | Ga0501036_0004651 | Ga0501036_0004651_6070_6828 | 239 |
| 337 | 3300049573 | Ga0501037_0035533 | Ga0501037_0035533_2635_3396 | 239 |
| 338 | 3300049573 | Ga0501037_0106660 | Ga0501037_0106660_218_976 | 239 |
| 339 | 3300049574 | Ga0501038_0020033 | Ga0501038_0020033_3018_3779 | 239 |
| 340 | 3300049575 | Ga0501039_0036876 | Ga0501039_0036876_1966_2724 | 239 |
| 341 | 3300049578 | Ga0501042_0006221 | Ga0501042_0006221_1300_2061 | 239 |
| 342 | 3300049579 | Ga0501043_0009566 | Ga0501043_0009566_288_1046 | 239 |
| 343 | 3300049579 | Ga0501043_0037789 | Ga0501043_0037789_217_978 | 239 |
| 344 | 3300049580 | Ga0501046_0012145 | Ga0501046_0012145_4219_4980 | 239 |
| 345 | 3300049581 | Ga0501047_0058387 | Ga0501047_0058387_885_1646 | 239 |
| 346 | 3300049581 | Ga0501047_0153822 | Ga0501047_0153822_979_1737 | 239 |
| 347 | 3300049582 | Ga0501048_0008489 | Ga0501048_0008489_2127_2888 | 239 |
| 348 | 3300049586 | Ga0501070_0040192 | Ga0501070_0040192_1200_1958 | 239 |
| 349 | 3300049589 | Ga0501073_0056284 | Ga0501073_0056284_1255_2013 | 239 |
| 350 | 3300049590 | Ga0501074_0047815 | Ga0501074_0047815_1214_1972 | 239 |
| 351 | 3300049822 | Ga0501035_0002456 | Ga0501035_0002456_12561_13319 | 239 |
| 352 | 3300049822 | Ga0501035_0130552 | Ga0501035_0130552_1151_1912 | 239 |
| 353 | 3300049822 | Ga0501035_0219613 | Ga0501035_0219613_694_1452 | 239 |
| 354 | 3300049822 | Ga0501035_0241959 | Ga0501035_0241959_15_773 | 239 |
| 355 | 3300049823 | Ga0501044_0085043 | Ga0501044_0085043_282_1043 | 239 |
| 356 | 3300049823 | Ga0501044_0122874 | Ga0501044_0122874_1560_2318 | 239 |
| 357 | 3300049823 | Ga0501044_0166744 | Ga0501044_0166744_1203_1961 | 239 |
| 358 | 3300049823 | Ga0501044_0200418 | Ga0501044_0200418_927_1685 | 239 |
| 359 | 3300049823 | Ga0501044_0359329 | Ga0501044_0359329_14_772 | 239 |
| 360 | 3300050490 | nmdc:mga03n38_6891_c1 | nmdc:mga03n38_6891_c1_815_1573 | 239 |
| 361 | 3300050494 | nmdc:mga06z11_532_c1 | nmdc:mga06z11_532_c1_12163_12921 | 239 |
| 362 | 3300050495 | nmdc:mga04h51_20902_c1 | nmdc:mga04h51_20902_c1_29_787 | 239 |
| 363 | 3300053077 | Ga0495601_0033866 | Ga0495601_0033866_1316_2083 | 239 |
| 364 | 3300053079 | Ga0500610_0075020 | Ga0500610_0075020_653_1411 | 239 |
| 365 | 3300053085 | Ga0495619_0020492 | Ga0495619_0020492_3015_3782 | 239 |
| 366 | 3300053085 | Ga0495619_0074608 | Ga0495619_0074608_464_1222 | 239 |
| 367 | 3300053088 | Ga0500644_0039186 | Ga0500644_0039186_554_1312 | 239 |
| 368 | 3300053095 | Ga0500640_001478 | Ga0500640_001478_3053_3811 | 239 |
| 369 | 3300053111 | Ga0500572_003088 | Ga0500572_003088_667_1425 | 239 |
| 370 | 3300053123 | Ga0500614_059138 | Ga0500614_059138_56_814 | 239 |
| 371 | 3300053149 | Ga0500600_0160951 | Ga0500600_0160951_113_871 | 239 |
| 372 | 3300053157 | Ga0500624_001192 | Ga0500624_001192_2910_3668 | 239 |
| 373 | 3300053160 | Ga0500633_0035278 | Ga0500633_0035278_389_1147 | 239 |
| 374 | 3300060353 | Ga0501082_0384503 | Ga0501082_0384503_96_818 | 239 |
| 375 | 3300061719 | Ga0466962_0023083 | Ga0466962_0023083_2023_2781 | 239 |
| 376 | 3300061719 | Ga0466962_0053301 | Ga0466962_0053301_946_1704 | 239 |
| 377 | 3300061719 | Ga0466962_0091265 | Ga0466962_0091265_32_787 | 239 |
| 378 | iso_pu_bacteria | 2547132111 | 2547410578 | 239 |
| 379 | iso_pu_bacteria | 2554235005 | 2554256013 | 239 |
| 380 | iso_pu_bacteria | 2582581313 | 2585307742 | 239 |
| 381 | iso_pu_bacteria | 2582581314 | 2585316757 | 239 |
| 382 | iso_pu_bacteria | 2616644814 | 2616700040 | 239 |
| 383 | iso_pu_bacteria | 2643221587 | 2643943676 | 239 |
| 384 | iso_pu_bacteria | 2643221647 | 2644269590 | 239 |
| 385 | iso_pu_bacteria | 2643221670 | 2644387154 | 239 |
| 386 | iso_pu_bacteria | 2643221677 | 2644434065 | 239 |
| 387 | iso_pu_bacteria | 2643221678 | 2644437766 | 239 |
| 388 | iso_pu_bacteria | 2643221714 | 2644629848 | 239 |
| 389 | iso_pu_bacteria | 2784132148 | 2784590639 | 239 |
| 390 | iso_pu_bacteria | 2784746763 | 2785340946 | 239 |
| 391 | iso_pu_bacteria | 2784746768 | 2785371812 | 239 |
| 392 | iso_pu_bacteria | 2786546132 | 2786672919 | 239 |
| 393 | iso_pu_bacteria | 2791355406 | 2793977157 | 239 |
| 394 | iso_pu_bacteria | 2802429296 | 2804848176 | 239 |
| 395 | iso_pu_bacteria | 2808606359 | 2808844313 | 239 |
| 396 | iso_pu_bacteria | 2808606375 | 2808913887 | 239 |
| 397 | iso_pu_bacteria | 2808606448 | 2809234331 | 239 |
| 398 | iso_pu_bacteria | 2808606982 | 2811844125 | 239 |
| 399 | iso_pu_bacteria | 2811994879 | 2812355697 | 239 |
| 400 | iso_pu_bacteria | 2852635781 | 2852639727 | 239 |
| 401 | iso_pu_bacteria | 2862281513 | 2862284340 | 239 |
| 402 | iso_pu_bacteria | 2862507626 | 2862509056 | 239 |
| 403 | iso_pu_bacteria | 2862574272 | 2862577222 | 239 |
| 404 | iso_pu_bacteria | 2863404153 | 2863408888 | 239 |
| 405 | iso_pu_bacteria | 2867428634 | 2867433946 | 239 |
| 406 | iso_pu_bacteria | 2877676314 | 2877678787 | 239 |
| 407 | iso_pu_bacteria | 2912715099 | 2912717335 | 239 |
| 408 | iso_pu_bacteria | 2912723979 | 2912729914 | 239 |
| 409 | iso_pu_bacteria | 2912757875 | 2912763054 | 239 |
| 410 | iso_pu_bacteria | 2918501144 | 2918506763 | 239 |
| 411 | iso_pu_bacteria | 2919468124 | 2919472497 | 239 |
| 412 | iso_pu_bacteria | 2935390628 | 2935392141 | 239 |
| 413 | iso_pu_bacteria | 2946072368 | 2946077984 | 239 |
| 414 | iso_pu_bacteria | 2947224130 | 2947226681 | 239 |
| 415 | iso_pu_bacteria | 2954002825 | 2954005800 | 239 |
| 416 | iso_pu_bacteria | 2954380949 | 2954383747 | 239 |
| 417 | iso_pu_bacteria | 2954673503 | 2954679225 | 239 |
| 418 | iso_pu_bacteria | 2954682443 | 2954684928 | 239 |
| 419 | iso_pu_bacteria | 2954691527 | 2954694542 | 239 |
| 420 | iso_pu_bacteria | 2954701450 | 2954709747 | 239 |
| 421 | iso_pu_bacteria | 2954711539 | 2954714047 | 239 |
| 422 | iso_pu_bacteria | 2954721474 | 2954724000 | 239 |
| 423 | iso_pu_bacteria | 2954731030 | 2954737840 | 239 |
| 424 | iso_pu_bacteria | 2954740390 | 2954742897 | 239 |
| 425 | iso_pu_bacteria | 2954749733 | 2954756676 | 239 |
| 426 | iso_pu_bacteria | 2954759201 | 2954761854 | 239 |
| 427 | iso_pu_bacteria | 2990059506 | 2990062473 | 239 |
| 428 | iso_pu_bacteria | 2997600082 | 2997604018 | 239 |
| 429 | iso_pu_bacteria | 3006393351 | 3006395885 | 239 |
| 430 | iso_pu_bacteria | 3006486233 | 3006487490 | 239 |
| 431 | iso_pu_bacteria | 3006493962 | 3006500028 | 239 |
| 432 | iso_pu_bacteria | 8008574985 | 8008576897 | 239 |
| 433 | iso_pu_bacteria | 8023623736 | 8023625711 | 239 |
| 434 | iso_pu_bacteria | 8025413630 | 8025414215 | 239 |
| 435 | iso_pu_bacteria | 8025530807 | 8025532672 | 239 |
| 436 | iso_pu_bacteria | 8047893842 | 8047895815 | 239 |
| 437 | iso_pu_bacteria | 8048127548 | 8048129073 | 239 |
| 438 | iso_pu_bacteria | 8048356638 | 8048363119 | 239 |
| 439 | iso_pu_bacteria | 8048369669 | 8048372839 | 239 |
| 440 | iso_pu_bacteria | 8048379754 | 8048381773 | 239 |
| 441 | iso_pu_bacteria | 8048406513 | 8048409792 | 239 |
| 442 | iso_pu_bacteria | 8056829672 | 8056831579 | 239 |
| 443 | 3300002155 | JGI24033J26618_1002865 | JGI24033J26618_10028652 | 240 |
| 444 | 3300005844 | Ga0068862_100232648 | Ga0068862_1002326483 | 240 |
| 445 | 3300006844 | Ga0075428_100038789 | Ga0075428_1000387894 | 240 |
| 446 | 3300006846 | Ga0075430_100121002 | Ga0075430_1001210023 | 240 |
| 447 | 3300006847 | Ga0075431_100068771 | Ga0075431_1000687713 | 240 |
| 448 | 3300006880 | Ga0075429_100057723 | Ga0075429_1000577233 | 240 |
| 449 | 3300009147 | Ga0114129_10000959 | Ga0114129_1000095923 | 240 |
| 450 | 3300009147 | Ga0114129_10278566 | Ga0114129_102785663 | 240 |
| 451 | 3300034817 | Ga0373948_0024112 | Ga0373948_0024112_136_885 | 240 |
| 452 | 3300035242 | Ga0373962_0005092 | Ga0373962_0005092_2066_2815 | 240 |
| 453 | 3300041406 | Ga0439439_0038114 | Ga0439439_0038114_384_1145 | 240 |
| 454 | 3300042011 | Ga0439454_008338 | Ga0439454_008338_175_927 | 240 |
| 455 | 3300042013 | Ga0439456_039928 | Ga0439456_039928_170_922 | 240 |
| 456 | 3300042131 | Ga0450894_000143 | Ga0450894_000143_10563_11324 | 240 |
| 457 | 3300042133 | Ga0450896_000403 | Ga0450896_000403_2493_3254 | 240 |
| 458 | 3300042134 | Ga0450898_008444 | Ga0450898_008444_74_835 | 240 |
| 459 | 3300042135 | Ga0450899_000010 | Ga0450899_000010_10372_11133 | 240 |
| 460 | 3300042145 | Ga0450906_004688 | Ga0450906_004688_33_794 | 240 |
| 461 | 3300042184 | Ga0450908_004116 | Ga0450908_004116_1641_2402 | 240 |
| 462 | 3300044656 | Ga0466969_0006463 | Ga0466969_0006463_2374_3174 | 240 |
| 463 | 3300044693 | Ga0466961_0022807 | Ga0466961_0022807_612_1412 | 240 |
| 464 | 3300044719 | Ga0466971_0004202 | Ga0466971_0004202_4456_5256 | 240 |
| 465 | 3300044765 | Ga0466970_0166558 | Ga0466970_0166558_459_1187 | 240 |
| 466 | 3300045049 | Ga0466959_0003681 | Ga0466959_0003681_7207_8007 | 240 |
| 467 | 3300045976 | Ga0466967_0372686 | Ga0466967_0372686_145_882 | 240 |
| 468 | 3300046476 | Ga0495662_0019023 | Ga0495662_0019023_1539_2321 | 240 |
| 469 | 3300046679 | Ga0495623_0062647 | Ga0495623_0062647_881_1663 | 240 |
| 470 | 3300047317 | Ga0495604_0062418 | Ga0495604_0062418_1405_2187 | 240 |
| 471 | 3300047444 | Ga0495675_0031161 | Ga0495675_0031161_1176_1958 | 240 |
| 472 | 3300048925 | Ga0496122_0004513 | Ga0496122_0004513_1919_2641 | 240 |
| 473 | 3300048926 | Ga0496123_0001160 | Ga0496123_0001160_33918_34640 | 240 |
| 474 | 3300048927 | Ga0496124_0027394 | Ga0496124_0027394_2494_3216 | 240 |
| 475 | 3300049127 | Ga0501306_000830 | Ga0501306_000830_905_1777 | 240 |
| 476 | 3300049539 | Ga0501323_021596 | Ga0501323_021596_77_841 | 240 |
| 477 | 3300050507 | nmdc:mga05p37_68128_c1 | nmdc:mga05p37_68128_c1_2144_2893 | 240 |
| 478 | 3300050508 | nmdc:mga09592_132774_c1 | nmdc:mga09592_132774_c1_635_1387 | 240 |
| 479 | 3300050509 | nmdc:mga0qj67_70686_c1 | nmdc:mga0qj67_70686_c1_1305_2057 | 240 |
| 480 | 3300061719 | Ga0466962_0007506 | Ga0466962_0007506_3415_4215 | 240 |
| 481 | iso_pu_bacteria | 2862178590 | 2862181785 | 240 |
| 482 | iso_pu_bacteria | 2862382967 | 2862383294 | 240 |
| 483 | iso_pu_bacteria | 8008558824 | 8008563056 | 240 |
| 484 | 3300005617 | Ga0068859_100019694 | Ga0068859_1000196942 | 241 |
| 485 | 3300006931 | Ga0097620_100019694 | Ga0097620_1000196949 | 241 |
| 486 | 3300009101 | Ga0105247_10042151 | Ga0105247_100421513 | 241 |
| 487 | 3300025900 | Ga0207710_10018571 | Ga0207710_100185713 | 241 |
| 488 | 3300031251 | Ga0265327_10000154 | Ga0265327_1000015446 | 241 |
| 489 | 3300041451 | Ga0451791_0820044 | Ga0451791_0820044_416_1159 | 241 |
| 490 | 3300048905 | Ga0496102_0001496 | Ga0496102_0001496_5274_6014 | 241 |
| 491 | 3300048906 | Ga0496103_0001461 | Ga0496103_0001461_14488_15228 | 241 |
| 492 | 3300048921 | Ga0496118_0075513 | Ga0496118_0075513_53_793 | 241 |
| 493 | 3300048922 | Ga0496119_0040227 | Ga0496119_0040227_22_762 | 241 |
| 494 | 3300048928 | Ga0496125_0003000 | Ga0496125_0003000_1938_2678 | 241 |
| 495 | 3300049569 | Ga0501032_0148982 | Ga0501032_0148982_281_1126 | 241 |
| 496 | 3300049571 | Ga0501034_0365085 | Ga0501034_0365085_208_1053 | 241 |
| 497 | 3300049581 | Ga0501047_0162173 | Ga0501047_0162173_1001_1846 | 241 |
| 498 | 3300049822 | Ga0501035_0051344 | Ga0501035_0051344_145_990 | 241 |
| 499 | 3300049823 | Ga0501044_0120708 | Ga0501044_0120708_1586_2431 | 241 |
| 500 | iso_pu_bacteria | 2643221690 | 2644506600 | 241 |
| 501 | iso_pu_bacteria | 2643221694 | 2644526489 | 241 |
| 502 | iso_pu_bacteria | 2643221722 | 2644671155 | 241 |
| 503 | iso_pu_bacteria | 2884994152 | 2884995029 | 241 |
| 504 | iso_pu_bacteria | 3006425503 | 3006426525 | 241 |
| 505 | 3300005440 | Ga0070705_100070253 | Ga0070705_1000702532 | 242 |
| 506 | 3300005456 | Ga0070678_100028635 | Ga0070678_1000286354 | 242 |
| 507 | 3300005615 | Ga0070702_100000206 | Ga0070702_10000020613 | 242 |
| 508 | 3300009148 | Ga0105243_10006412 | Ga0105243_100064127 | 242 |
| 509 | 3300011119 | Ga0105246_10024519 | Ga0105246_100245194 | 242 |
| 510 | 3300013297 | Ga0157378_10039679 | Ga0157378_100396792 | 242 |
| 511 | 3300013308 | Ga0157375_10008491 | Ga0157375_100084912 | 242 |
| 512 | 3300014326 | Ga0157380_10077644 | Ga0157380_100776442 | 242 |
| 513 | 3300014968 | Ga0157379_10404902 | Ga0157379_104049022 | 242 |
| 514 | 3300025935 | Ga0207709_10094481 | Ga0207709_100944812 | 242 |
| 515 | 3300026121 | Ga0207683_10038481 | Ga0207683_100384812 | 242 |
| 516 | 3300044684 | Ga0466966_0016593 | Ga0466966_0016593_1442_2236 | 242 |
| 517 | 3300045049 | Ga0466959_0027194 | Ga0466959_0027194_2156_2950 | 242 |
| 518 | 3300047315 | Ga0495581_0038922 | Ga0495581_0038922_995_1723 | 242 |
| 519 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_511334_512065 | 242 |
| 520 | 3300049581 | Ga0501047_0275862 | Ga0501047_0275862_137_922 | 242 |
| 521 | iso_pu_bacteria | 8054160619 | 8054163111 | 242 |
| 522 | 3300025302 | Ga0207426_1002577 | Ga0207426_100257710 | 243 |
| 523 | 3300046459 | Ga0495629_0029215 | Ga0495629_0029215_1196_1984 | 243 |
| 524 | 3300048927 | Ga0496124_0053226 | Ga0496124_0053226_2028_2777 | 243 |
| 525 | iso_pu_bacteria | 2839986021 | 2839989397 | 243 |
| 526 | iso_pu_bacteria | 2867475112 | 2867480310 | 243 |
| 527 | iso_pu_bacteria | 2997451912 | 2997453116 | 243 |
| 528 | iso_pu_bacteria | 8033684223 | 8033691061 | 243 |
| 529 | 3300005466 | Ga0070685_10148396 | Ga0070685_101483962 | 244 |
| 530 | 3300005985 | Ga0081539_10004121 | Ga0081539_1000412119 | 244 |
| 531 | 3300006028 | Ga0070717_10084531 | Ga0070717_100845312 | 244 |
| 532 | 3300047317 | Ga0495604_0034158 | Ga0495604_0034158_1479_2264 | 244 |
| 533 | 3300049568 | Ga0501031_0205590 | Ga0501031_0205590_324_1109 | 244 |
| 534 | 3300005985 | Ga0081539_10005819 | Ga0081539_100058197 | 245 |
| 535 | 3300031616 | Ga0307508_10082547 | Ga0307508_100825472 | 245 |
| 536 | 3300037418 | Ga0395900_0070245 | Ga0395900_0070245_1159_1914 | 245 |
| 537 | 3300037466 | Ga0395898_0017125 | Ga0395898_0017125_4072_4827 | 245 |
| 538 | 3300038443 | Ga0395901_0050065 | Ga0395901_0050065_230_985 | 245 |
| 539 | 3300045976 | Ga0466967_0094233 | Ga0466967_0094233_158_931 | 245 |
| 540 | 3300048921 | Ga0496118_0092478 | Ga0496118_0092478_543_1298 | 245 |
| 541 | 3300048922 | Ga0496119_0052850 | Ga0496119_0052850_1593_2348 | 245 |
| 542 | 3300048925 | Ga0496122_0001777 | Ga0496122_0001777_12855_13610 | 245 |
| 543 | 3300049568 | Ga0501031_0094914 | Ga0501031_0094914_468_1238 | 245 |
| 544 | 3300049570 | Ga0501033_0035846 | Ga0501033_0035846_2641_3411 | 245 |
| 545 | 3300049571 | Ga0501034_0033067 | Ga0501034_0033067_3973_4743 | 245 |
| 546 | 3300049572 | Ga0501036_0051039 | Ga0501036_0051039_1755_2525 | 245 |
| 547 | 3300049573 | Ga0501037_0024893 | Ga0501037_0024893_1159_1929 | 245 |
| 548 | 3300049573 | Ga0501037_0101417 | Ga0501037_0101417_233_1057 | 245 |
| 549 | 3300049575 | Ga0501039_0052106 | Ga0501039_0052106_1224_1994 | 245 |
| 550 | 3300049581 | Ga0501047_0000208 | Ga0501047_0000208_4485_5309 | 245 |
| 551 | 3300049581 | Ga0501047_0034790 | Ga0501047_0034790_2108_2878 | 245 |
| 552 | 3300049586 | Ga0501070_0007681 | Ga0501070_0007681_6256_7026 | 245 |
| 553 | 3300049822 | Ga0501035_0100173 | Ga0501035_0100173_173_943 | 245 |
| 554 | 3300049823 | Ga0501044_0073821 | Ga0501044_0073821_1148_1918 | 245 |
| 555 | iso_pu_bacteria | 2751185782 | 2753264693 | 245 |
| 556 | iso_pu_bacteria | 2848551377 | 2848551846 | 245 |
| 557 | 3300005347 | Ga0070668_100496493 | Ga0070668_1004964931 | 246 |
| 558 | 3300005367 | Ga0070667_100259542 | Ga0070667_1002595422 | 246 |
| 559 | 3300005434 | Ga0070709_10427343 | Ga0070709_104273431 | 246 |
| 560 | 3300005437 | Ga0070710_10047395 | Ga0070710_100473952 | 246 |
| 561 | 3300005535 | Ga0070684_100514227 | Ga0070684_1005142271 | 246 |
| 562 | 3300005578 | Ga0068854_100523217 | Ga0068854_1005232171 | 246 |
| 563 | 3300005614 | Ga0068856_100716689 | Ga0068856_1007166891 | 246 |
| 564 | 3300005841 | Ga0068863_100209541 | Ga0068863_1002095413 | 246 |
| 565 | 3300005842 | Ga0068858_100006333 | Ga0068858_10000633311 | 246 |
| 566 | 3300005843 | Ga0068860_100693871 | Ga0068860_1006938712 | 246 |
| 567 | 3300005844 | Ga0068862_100051084 | Ga0068862_1000510842 | 246 |
| 568 | 3300005937 | Ga0081455_10003702 | Ga0081455_100037025 | 246 |
| 569 | 3300005985 | Ga0081539_10000357 | Ga0081539_1000035769 | 246 |
| 570 | 3300005985 | Ga0081539_10001106 | Ga0081539_100011064 | 246 |
| 571 | 3300006237 | Ga0097621_100620510 | Ga0097621_1006205102 | 246 |
| 572 | 3300013105 | Ga0157369_10248855 | Ga0157369_102488552 | 246 |
| 573 | 3300014325 | Ga0163163_10140598 | Ga0163163_101405983 | 246 |
| 574 | 3300025898 | Ga0207692_10038904 | Ga0207692_100389043 | 246 |
| 575 | 3300025900 | Ga0207710_10201149 | Ga0207710_102011491 | 246 |
| 576 | 3300025916 | Ga0207663_10308449 | Ga0207663_103084492 | 246 |
| 577 | 3300025928 | Ga0207700_10328719 | Ga0207700_103287192 | 246 |
| 578 | 3300025931 | Ga0207644_10066402 | Ga0207644_100664023 | 246 |
| 579 | 3300025932 | Ga0207690_10189439 | Ga0207690_101894391 | 246 |
| 580 | 3300025944 | Ga0207661_10545189 | Ga0207661_105451891 | 246 |
| 581 | 3300025972 | Ga0207668_10004765 | Ga0207668_100047654 | 246 |
| 582 | 3300025986 | Ga0207658_10039649 | Ga0207658_100396492 | 246 |
| 583 | 3300026035 | Ga0207703_10024649 | Ga0207703_100246494 | 246 |
| 584 | 3300026067 | Ga0207678_10514235 | Ga0207678_105142351 | 246 |
| 585 | 3300028380 | Ga0268265_10010581 | Ga0268265_100105812 | 246 |
| 586 | 3300028381 | Ga0268264_10008659 | Ga0268264_100086597 | 246 |
| 587 | 3300030522 | Ga0307512_10029915 | Ga0307512_100299154 | 246 |
| 588 | 3300030522 | Ga0307512_10103148 | Ga0307512_101031482 | 246 |
| 589 | 3300030733 | Ga0314311_1151442 | Ga0314311_11514423 | 246 |
| 590 | 3300031507 | Ga0307509_10020244 | Ga0307509_100202443 | 246 |
| 591 | 3300031616 | Ga0307508_10001514 | Ga0307508_100015148 | 246 |
| 592 | 3300031730 | Ga0307516_10002608 | Ga0307516_1000260841 | 246 |
| 593 | 3300031730 | Ga0307516_10124303 | Ga0307516_101243033 | 246 |
| 594 | 3300031731 | Ga0307405_10048752 | Ga0307405_100487523 | 246 |
| 595 | 3300031824 | Ga0307413_10106691 | Ga0307413_101066912 | 246 |
| 596 | 3300031852 | Ga0307410_10232142 | Ga0307410_102321422 | 246 |
| 597 | 3300031901 | Ga0307406_10055824 | Ga0307406_100558241 | 246 |
| 598 | 3300031903 | Ga0307407_10118884 | Ga0307407_101188841 | 246 |
| 599 | 3300031995 | Ga0307409_100038809 | Ga0307409_1000388094 | 246 |
| 600 | 3300031995 | Ga0307409_100314467 | Ga0307409_1003144672 | 246 |
| 601 | 3300032126 | Ga0307415_100018602 | Ga0307415_1000186023 | 246 |
| 602 | 3300032126 | Ga0307415_100183066 | Ga0307415_1001830663 | 246 |
| 603 | 3300032126 | Ga0307415_100311496 | Ga0307415_1003114962 | 246 |
| 604 | 3300033179 | Ga0307507_10012883 | Ga0307507_100128834 | 246 |
| 605 | 3300035692 | Ga0373935_0010076 | Ga0373935_0010076_998_1759 | 246 |
| 606 | 3300036401 | Ga0373937_0148022 | Ga0373937_0148022_552_1418 | 246 |
| 607 | 3300041512 | Ga0451853_0792760 | Ga0451853_0792760_1376_2137 | 246 |
| 608 | 3300041997 | Ga0439431_0027020 | Ga0439431_0027020_398_1153 | 246 |
| 609 | 3300044901 | Ga0466960_0004092 | Ga0466960_0004092_2624_3373 | 246 |
| 610 | 3300044901 | Ga0466960_0152198 | Ga0466960_0152198_259_1071 | 246 |
| 611 | 3300044901 | Ga0466960_0193376 | Ga0466960_0193376_249_998 | 246 |
| 612 | 3300045976 | Ga0466967_0180790 | Ga0466967_0180790_709_1461 | 246 |
| 613 | 3300046453 | Ga0495627_014138 | Ga0495627_014138_149_904 | 246 |
| 614 | 3300047321 | Ga0495676_0186429 | Ga0495676_0186429_190_1056 | 246 |
| 615 | 3300048911 | Ga0496108_0000048 | Ga0496108_0000048_20891_21652 | 246 |
| 616 | 3300048918 | Ga0496115_0106708 | Ga0496115_0106708_250_1074 | 246 |
| 617 | 3300048929 | Ga0496126_0062083 | Ga0496126_0062083_67_891 | 246 |
| 618 | 3300059477 | Ga0587084_003095 | Ga0587084_003095_597_1358 | 246 |
| 619 | 3300059630 | Ga0587128_027308 | Ga0587128_027308_16_777 | 246 |
| 620 | iso_pu_bacteria | 2738541272 | 2738692482 | 246 |
| 621 | iso_pu_bacteria | 2738543027 | 2739323572 | 246 |
| 622 | iso_pu_bacteria | 2739367654 | 2739608953 | 246 |
| 623 | iso_pu_bacteria | 2758568522 | 2760303597 | 246 |
| 624 | iso_pu_bacteria | 2758568621 | 2760622545 | 246 |
| 625 | iso_pu_bacteria | 2808606394 | 2809027290 | 246 |
| 626 | iso_pu_bacteria | 8055412473 | 8055416074 | 246 |
| 627 | iso_pu_bacteria | 8056579771 | 8056584032 | 246 |
| 628 | 3300028794 | Ga0307515_10000045 | Ga0307515_10000045261 | 247 |
| 629 | 3300031730 | Ga0307516_10008621 | Ga0307516_1000862111 | 247 |
| 630 | 3300031730 | Ga0307516_10047355 | Ga0307516_100473553 | 247 |
| 631 | 3300031824 | Ga0307413_10392897 | Ga0307413_103928972 | 247 |
| 632 | 3300031901 | Ga0307406_10060524 | Ga0307406_100605242 | 247 |
| 633 | 3300031995 | Ga0307409_100657928 | Ga0307409_1006579282 | 247 |
| 634 | 3300033180 | Ga0307510_10103011 | Ga0307510_101030114 | 247 |
| 635 | 3300039437 | Ga0436365_0038748 | Ga0436365_0038748_51_863 | 247 |
| 636 | 3300046492 | Ga0495585_0010195 | Ga0495585_0010195_1433_2239 | 247 |
| 637 | 3300053088 | Ga0500644_0110756 | Ga0500644_0110756_110_874 | 247 |
| 638 | iso_pu_bacteria | 2501939600 | 2501941415 | 247 |
| 639 | iso_pu_bacteria | 2515154088 | 2515496009 | 247 |
| 640 | iso_pu_bacteria | 2515154137 | 2515757847 | 247 |
| 641 | iso_pu_bacteria | 2515154203 | 2516090245 | 247 |
| 642 | iso_pu_bacteria | 2622736626 | 2623587235 | 247 |
| 643 | iso_pu_bacteria | 2772190715 | 2772642652 | 247 |
| 644 | iso_pu_bacteria | 2831935698 | 2831937895 | 247 |
| 645 | iso_pu_bacteria | 2832004796 | 2832007505 | 247 |
| 646 | iso_pu_bacteria | 2855670206 | 2855671049 | 247 |
| 647 | iso_pu_bacteria | 2855676851 | 2855682246 | 247 |
| 648 | iso_pu_bacteria | 2855683550 | 2855689292 | 247 |
| 649 | iso_pu_bacteria | 2856858025 | 2856861074 | 247 |
| 650 | iso_pu_bacteria | 2857288857 | 2857290039 | 247 |
| 651 | iso_pu_bacteria | 2858848962 | 2858853001 | 247 |
| 652 | iso_pu_bacteria | 2858868258 | 2858872418 | 247 |
| 653 | iso_pu_bacteria | 2858882152 | 2858884094 | 247 |
| 654 | iso_pu_bacteria | 2858888857 | 2858889752 | 247 |
| 655 | iso_pu_bacteria | 2858895516 | 2858896671 | 247 |
| 656 | iso_pu_bacteria | 2858902515 | 2858903795 | 247 |
| 657 | iso_pu_bacteria | 2866065130 | 2866065265 | 247 |
| 658 | iso_pu_bacteria | 2867302475 | 2867304847 | 247 |
| 659 | iso_pu_bacteria | 2867312974 | 2867315633 | 247 |
| 660 | iso_pu_bacteria | 2867319477 | 2867324402 | 247 |
| 661 | iso_pu_bacteria | 2867507094 | 2867507741 | 247 |
| 662 | iso_pu_bacteria | 2869048445 | 2869053440 | 247 |
| 663 | iso_pu_bacteria | 2869061728 | 2869062103 | 247 |
| 664 | iso_pu_bacteria | 2869068681 | 2869073589 | 247 |
| 665 | iso_pu_bacteria | 2880489317 | 2880493034 | 247 |
| 666 | iso_pu_bacteria | 2880495981 | 2880499269 | 247 |
| 667 | iso_pu_bacteria | 2902582711 | 2902588011 | 247 |
| 668 | iso_pu_bacteria | 2929219909 | 2929221253 | 247 |
| 669 | iso_pu_bacteria | 2929226422 | 2929227868 | 247 |
| 670 | iso_pu_bacteria | 2996221748 | 2996226539 | 247 |
| 671 | iso_pu_bacteria | 3006321560 | 3006324760 | 247 |
| 672 | iso_pu_bacteria | 649633069 | 649811832 | 247 |
| 673 | iso_pu_bacteria | 8003870546 | 8003873654 | 247 |
| 674 | iso_pu_bacteria | 8054704163 | 8054707551 | 247 |
| 675 | iso_pu_bacteria | 8054727385 | 8054731917 | 247 |
| 676 | iso_pu_bacteria | 8054734606 | 8054739147 | 247 |
| 677 | 3300003203 | JGI25406J46586_10020172 | JGI25406J46586_100201722 | 248 |
| 678 | 3300005985 | Ga0081539_10000420 | Ga0081539_1000042069 | 248 |
| 679 | 3300006846 | Ga0075430_100085218 | Ga0075430_1000852184 | 248 |
| 680 | 3300009094 | Ga0111539_10216884 | Ga0111539_102168843 | 248 |
| 681 | 3300031456 | Ga0307513_10195918 | Ga0307513_101959182 | 248 |
| 682 | 3300046454 | Ga0495592_0004769 | Ga0495592_0004769_7893_8780 | 248 |
| 683 | 3300046514 | Ga0495618_0031865 | Ga0495618_0031865_1165_2052 | 248 |
| 684 | 3300046516 | Ga0495628_0052598 | Ga0495628_0052598_1367_2254 | 248 |
| 685 | 3300046642 | Ga0495634_0006470 | Ga0495634_0006470_5168_6055 | 248 |
| 686 | 3300046675 | Ga0495657_0021312 | Ga0495657_0021312_1166_2053 | 248 |
| 687 | 3300046689 | Ga0495613_0010412 | Ga0495613_0010412_3609_4496 | 248 |
| 688 | 3300046690 | Ga0495624_0035600 | Ga0495624_0035600_542_1429 | 248 |
| 689 | 3300046809 | Ga0495600_0025856 | Ga0495600_0025856_502_1389 | 248 |
| 690 | 3300047321 | Ga0495676_0005722 | Ga0495676_0005722_8562_9449 | 248 |
| 691 | 3300047444 | Ga0495675_0041250 | Ga0495675_0041250_566_1453 | 248 |
| 692 | 3300048924 | Ga0496121_0008171 | Ga0496121_0008171_1080_1913 | 248 |
| 693 | 3300049569 | Ga0501032_0000992 | Ga0501032_0000992_12600_13409 | 248 |
| 694 | 3300049569 | Ga0501032_0023250 | Ga0501032_0023250_2034_2873 | 248 |
| 695 | 3300049570 | Ga0501033_0026497 | Ga0501033_0026497_1287_2096 | 248 |
| 696 | 3300049570 | Ga0501033_0039712 | Ga0501033_0039712_1622_2461 | 248 |
| 697 | 3300049571 | Ga0501034_0001415 | Ga0501034_0001415_17779_18588 | 248 |
| 698 | 3300049571 | Ga0501034_0075250 | Ga0501034_0075250_2071_2910 | 248 |
| 699 | 3300049572 | Ga0501036_0004483 | Ga0501036_0004483_407_1216 | 248 |
| 700 | 3300049572 | Ga0501036_0071951 | Ga0501036_0071951_479_1318 | 248 |
| 701 | 3300049573 | Ga0501037_0000989 | Ga0501037_0000989_17779_18588 | 248 |
| 702 | 3300049574 | Ga0501038_0057117 | Ga0501038_0057117_2311_3150 | 248 |
| 703 | 3300049575 | Ga0501039_0010476 | Ga0501039_0010476_4358_5167 | 248 |
| 704 | 3300049576 | Ga0501040_0011804 | Ga0501040_0011804_130_939 | 248 |
| 705 | 3300049577 | Ga0501041_0018272 | Ga0501041_0018272_1912_2721 | 248 |
| 706 | 3300049578 | Ga0501042_0032416 | Ga0501042_0032416_1447_2256 | 248 |
| 707 | 3300049579 | Ga0501043_0002379 | Ga0501043_0002379_9885_10694 | 248 |
| 708 | 3300049579 | Ga0501043_0094988 | Ga0501043_0094988_454_1293 | 248 |
| 709 | 3300049580 | Ga0501046_0006232 | Ga0501046_0006232_9393_10202 | 248 |
| 710 | 3300049581 | Ga0501047_0000826 | Ga0501047_0000826_13536_14345 | 248 |
| 711 | 3300049582 | Ga0501048_0003265 | Ga0501048_0003265_9630_10439 | 248 |
| 712 | 3300049583 | Ga0501067_0012647 | Ga0501067_0012647_2284_3093 | 248 |
| 713 | 3300049584 | Ga0501068_0064134 | Ga0501068_0064134_1305_2114 | 248 |
| 714 | 3300049585 | Ga0501069_0003487 | Ga0501069_0003487_5522_6331 | 248 |
| 715 | 3300049586 | Ga0501070_0019772 | Ga0501070_0019772_3552_4361 | 248 |
| 716 | 3300049587 | Ga0501071_0001692 | Ga0501071_0001692_9432_10241 | 248 |
| 717 | 3300049588 | Ga0501072_0002777 | Ga0501072_0002777_11162_11971 | 248 |
| 718 | 3300049592 | Ga0501076_0067249 | Ga0501076_0067249_698_1507 | 248 |
| 719 | 3300049741 | Ga0501079_0026729 | Ga0501079_0026729_2404_3213 | 248 |
| 720 | 3300049744 | Ga0501083_0005593 | Ga0501083_0005593_1688_2497 | 248 |
| 721 | 3300049822 | Ga0501035_0003339 | Ga0501035_0003339_1032_1841 | 248 |
| 722 | 3300049822 | Ga0501035_0060331 | Ga0501035_0060331_1240_2079 | 248 |
| 723 | 3300049823 | Ga0501044_0002530 | Ga0501044_0002530_2232_3041 | 248 |
| 724 | 3300049823 | Ga0501044_0089148 | Ga0501044_0089148_1633_2472 | 248 |
| 725 | 3300060353 | Ga0501082_0009457 | Ga0501082_0009457_2062_2871 | 248 |
| 726 | iso_pu_bacteria | 2675903059 | 2676485967 | 248 |
| 727 | 3300005329 | Ga0070683_100181510 | Ga0070683_1001815102 | 249 |
| 728 | 3300005329 | Ga0070683_100264882 | Ga0070683_1002648822 | 249 |
| 729 | 3300005336 | Ga0070680_100118493 | Ga0070680_1001184932 | 249 |
| 730 | 3300005344 | Ga0070661_100175893 | Ga0070661_1001758932 | 249 |
| 731 | 3300005345 | Ga0070692_10040530 | Ga0070692_100405303 | 249 |
| 732 | 3300005347 | Ga0070668_100358606 | Ga0070668_1003586062 | 249 |
| 733 | 3300005364 | Ga0070673_100395436 | Ga0070673_1003954362 | 249 |
| 734 | 3300005438 | Ga0070701_10032590 | Ga0070701_100325902 | 249 |
| 735 | 3300005440 | Ga0070705_100110886 | Ga0070705_1001108862 | 249 |
| 736 | 3300005441 | Ga0070700_100114999 | Ga0070700_1001149992 | 249 |
| 737 | 3300005459 | Ga0068867_100223156 | Ga0068867_1002231561 | 249 |
| 738 | 3300005546 | Ga0070696_100136822 | Ga0070696_1001368222 | 249 |
| 739 | 3300005547 | Ga0070693_100327398 | Ga0070693_1003273981 | 249 |
| 740 | 3300005549 | Ga0070704_100248071 | Ga0070704_1002480712 | 249 |
| 741 | 3300005577 | Ga0068857_100004499 | Ga0068857_1000044997 | 249 |
| 742 | 3300005577 | Ga0068857_100247785 | Ga0068857_1002477852 | 249 |
| 743 | 3300005578 | Ga0068854_100038111 | Ga0068854_1000381114 | 249 |
| 744 | 3300005578 | Ga0068854_100325524 | Ga0068854_1003255242 | 249 |
| 745 | 3300005616 | Ga0068852_100137531 | Ga0068852_1001375313 | 249 |
| 746 | 3300005617 | Ga0068859_100042613 | Ga0068859_1000426134 | 249 |
| 747 | 3300005618 | Ga0068864_100144856 | Ga0068864_1001448562 | 249 |
| 748 | 3300005718 | Ga0068866_10103594 | Ga0068866_101035942 | 249 |
| 749 | 3300005840 | Ga0068870_10016569 | Ga0068870_100165693 | 249 |
| 750 | 3300005842 | Ga0068858_100097696 | Ga0068858_1000976964 | 249 |
| 751 | 3300005843 | Ga0068860_100522767 | Ga0068860_1005227672 | 249 |
| 752 | 3300005844 | Ga0068862_100169007 | Ga0068862_1001690073 | 249 |
| 753 | 3300005937 | Ga0081455_10084092 | Ga0081455_100840922 | 249 |
| 754 | 3300006844 | Ga0075428_100040339 | Ga0075428_1000403394 | 249 |
| 755 | 3300006844 | Ga0075428_100084482 | Ga0075428_1000844824 | 249 |
| 756 | 3300006847 | Ga0075431_100287076 | Ga0075431_1002870762 | 249 |
| 757 | 3300006880 | Ga0075429_100013670 | Ga0075429_1000136703 | 249 |
| 758 | 3300006881 | Ga0068865_100234717 | Ga0068865_1002347172 | 249 |
| 759 | 3300006881 | Ga0068865_100241467 | Ga0068865_1002414672 | 249 |
| 760 | 3300006931 | Ga0097620_100042613 | Ga0097620_1000426134 | 249 |
| 761 | 3300009094 | Ga0111539_10004030 | Ga0111539_100040305 | 249 |
| 762 | 3300009094 | Ga0111539_10006384 | Ga0111539_1000638411 | 249 |
| 763 | 3300009098 | Ga0105245_10115187 | Ga0105245_101151872 | 249 |
| 764 | 3300009101 | Ga0105247_10085049 | Ga0105247_100850493 | 249 |
| 765 | 3300009147 | Ga0114129_10062927 | Ga0114129_100629276 | 249 |
| 766 | 3300009147 | Ga0114129_10074244 | Ga0114129_100742443 | 249 |
| 767 | 3300009148 | Ga0105243_10100989 | Ga0105243_101009893 | 249 |
| 768 | 3300009148 | Ga0105243_10110902 | Ga0105243_101109022 | 249 |
| 769 | 3300009553 | Ga0105249_10030610 | Ga0105249_100306102 | 249 |
| 770 | 3300009553 | Ga0105249_10140054 | Ga0105249_101400542 | 249 |
| 771 | 3300010375 | Ga0105239_10207467 | Ga0105239_102074673 | 249 |
| 772 | 3300011119 | Ga0105246_10026470 | Ga0105246_100264703 | 249 |
| 773 | 3300013297 | Ga0157378_10345462 | Ga0157378_103454622 | 249 |
| 774 | 3300013306 | Ga0163162_10174404 | Ga0163162_101744042 | 249 |
| 775 | 3300013308 | Ga0157375_10068159 | Ga0157375_100681592 | 249 |
| 776 | 3300014325 | Ga0163163_10157782 | Ga0163163_101577823 | 249 |
| 777 | 3300014968 | Ga0157379_10305339 | Ga0157379_103053392 | 249 |
| 778 | 3300025899 | Ga0207642_10108303 | Ga0207642_101083032 | 249 |
| 779 | 3300025927 | Ga0207687_10136803 | Ga0207687_101368033 | 249 |
| 780 | 3300025927 | Ga0207687_10214684 | Ga0207687_102146842 | 249 |
| 781 | 3300025927 | Ga0207687_10218138 | Ga0207687_102181382 | 249 |
| 782 | 3300025933 | Ga0207706_10013802 | Ga0207706_100138026 | 249 |
| 783 | 3300025933 | Ga0207706_10071661 | Ga0207706_100716612 | 249 |
| 784 | 3300025941 | Ga0207711_10075784 | Ga0207711_100757842 | 249 |
| 785 | 3300025944 | Ga0207661_10074710 | Ga0207661_100747103 | 249 |
| 786 | 3300025961 | Ga0207712_10100603 | Ga0207712_101006032 | 249 |
| 787 | 3300026023 | Ga0207677_10032237 | Ga0207677_100322373 | 249 |
| 788 | 3300026075 | Ga0207708_10007293 | Ga0207708_100072934 | 249 |
| 789 | 3300026075 | Ga0207708_10082761 | Ga0207708_100827612 | 249 |
| 790 | 3300026078 | Ga0207702_10314145 | Ga0207702_103141452 | 249 |
| 791 | 3300026088 | Ga0207641_10117850 | Ga0207641_101178503 | 249 |
| 792 | 3300026089 | Ga0207648_10512844 | Ga0207648_105128442 | 249 |
| 793 | 3300026095 | Ga0207676_10067759 | Ga0207676_100677592 | 249 |
| 794 | 3300026116 | Ga0207674_10002093 | Ga0207674_100020937 | 249 |
| 795 | 3300026116 | Ga0207674_10144115 | Ga0207674_101441152 | 249 |
| 796 | 3300026116 | Ga0207674_10522234 | Ga0207674_105222342 | 249 |
| 797 | 3300026118 | Ga0207675_100307960 | Ga0207675_1003079601 | 249 |
| 798 | 3300026142 | Ga0207698_10305604 | Ga0207698_103056042 | 249 |
| 799 | 3300031548 | Ga0307408_100023257 | Ga0307408_1000232574 | 249 |
| 800 | 3300031548 | Ga0307408_100103878 | Ga0307408_1001038782 | 249 |
| 801 | 3300031824 | Ga0307413_10009249 | Ga0307413_100092492 | 249 |
| 802 | 3300031852 | Ga0307410_10124993 | Ga0307410_101249932 | 249 |
| 803 | 3300031901 | Ga0307406_10268643 | Ga0307406_102686432 | 249 |
| 804 | 3300031903 | Ga0307407_10077267 | Ga0307407_100772673 | 249 |
| 805 | 3300031903 | Ga0307407_10137627 | Ga0307407_101376273 | 249 |
| 806 | 3300031995 | Ga0307409_100014786 | Ga0307409_1000147862 | 249 |
| 807 | 3300032002 | Ga0307416_100028486 | Ga0307416_1000284862 | 249 |
| 808 | 3300032126 | Ga0307415_100012878 | Ga0307415_1000128784 | 249 |
| 809 | 3300032126 | Ga0307415_100135208 | Ga0307415_1001352082 | 249 |
| 810 | 3300042005 | Ga0439448_0040261 | Ga0439448_0040261_648_1424 | 249 |
| 811 | 3300046453 | Ga0495627_064729 | Ga0495627_064729_67_843 | 249 |
| 812 | 3300046458 | Ga0495591_026417 | Ga0495591_026417_959_1735 | 249 |
| 813 | 3300046474 | Ga0495605_0018566 | Ga0495605_0018566_1186_1962 | 249 |
| 814 | 3300046500 | Ga0495596_0076899 | Ga0495596_0076899_212_988 | 249 |
| 815 | 3300046506 | Ga0495583_0073647 | Ga0495583_0073647_613_1389 | 249 |
| 816 | 3300046520 | Ga0495637_0020761 | Ga0495637_0020761_851_1627 | 249 |
| 817 | 3300046522 | Ga0495643_0129877 | Ga0495643_0129877_73_849 | 249 |
| 818 | 3300046542 | Ga0495597_0081153 | Ga0495597_0081153_553_1329 | 249 |
| 819 | 3300046558 | Ga0495633_0058987 | Ga0495633_0058987_58_834 | 249 |
| 820 | 3300046615 | Ga0495656_0034974 | Ga0495656_0034974_203_979 | 249 |
| 821 | 3300046648 | Ga0495611_0014088 | Ga0495611_0014088_1593_2369 | 249 |
| 822 | 3300046665 | Ga0495661_0110815 | Ga0495661_0110815_687_1463 | 249 |
| 823 | 3300046691 | Ga0495670_0101844 | Ga0495670_0101844_619_1395 | 249 |
| 824 | 3300046794 | Ga0495589_0048782 | Ga0495589_0048782_493_1269 | 249 |
| 825 | 3300047446 | Ga0495679_037038 | Ga0495679_037038_460_1236 | 249 |
| 826 | 3300047471 | Ga0495684_0231616 | Ga0495684_0231616_15_764 | 249 |
| 827 | 3300048905 | Ga0496102_0151679 | Ga0496102_0151679_70_846 | 249 |
| 828 | 3300048909 | Ga0496106_0103348 | Ga0496106_0103348_1222_1998 | 249 |
| 829 | 3300048911 | Ga0496108_0014451 | Ga0496108_0014451_2342_3118 | 249 |
| 830 | 3300048912 | Ga0496109_0000991 | Ga0496109_0000991_16216_16992 | 249 |
| 831 | 3300048913 | Ga0496110_0001407 | Ga0496110_0001407_4704_5480 | 249 |
| 832 | 3300048914 | Ga0496111_0000429 | Ga0496111_0000429_11395_12171 | 249 |
| 833 | 3300048916 | Ga0496113_0190271 | Ga0496113_0190271_34_810 | 249 |
| 834 | 3300049583 | Ga0501067_0051974 | Ga0501067_0051974_561_1337 | 249 |
| 835 | 3300049584 | Ga0501068_0007032 | Ga0501068_0007032_2925_3701 | 249 |
| 836 | 3300049585 | Ga0501069_0013055 | Ga0501069_0013055_369_1145 | 249 |
| 837 | 3300049587 | Ga0501071_0015826 | Ga0501071_0015826_1955_2731 | 249 |
| 838 | 3300049588 | Ga0501072_0139768 | Ga0501072_0139768_867_1643 | 249 |
| 839 | 3300049593 | Ga0501077_0131028 | Ga0501077_0131028_309_1085 | 249 |
| 840 | 3300050507 | nmdc:mga05p37_3875_c1 | nmdc:mga05p37_3875_c1_2176_2949 | 249 |
| 841 | 3300050508 | nmdc:mga09592_5576_c1 | nmdc:mga09592_5576_c1_4656_5429 | 249 |
| 842 | 3300050510 | nmdc:mga06r32_74469_c1 | nmdc:mga06r32_74469_c1_1713_2486 | 249 |
| 843 | 3300050511 | nmdc:mga08y16_23786_c1 | nmdc:mga08y16_23786_c1_605_1381 | 249 |
| 844 | 3300053083 | Ga0495655_0018863 | Ga0495655_0018863_498_1274 | 249 |
| 845 | 3300005616 | Ga0068852_100543192 | Ga0068852_1005431922 | 250 |
| 846 | 3300005937 | Ga0081455_10099280 | Ga0081455_100992803 | 250 |
| 847 | 3300005981 | Ga0081538_10000136 | Ga0081538_1000013664 | 250 |
| 848 | 3300005981 | Ga0081538_10006490 | Ga0081538_100064905 | 250 |
| 849 | 3300005981 | Ga0081538_10014059 | Ga0081538_100140597 | 250 |
| 850 | 3300009093 | Ga0105240_10184424 | Ga0105240_101844242 | 250 |
| 851 | 3300031824 | Ga0307413_10106511 | Ga0307413_101065112 | 250 |
| 852 | 3300031852 | Ga0307410_10061864 | Ga0307410_100618642 | 250 |
| 853 | 3300031995 | Ga0307409_100011803 | Ga0307409_1000118037 | 250 |
| 854 | 3300032002 | Ga0307416_100006529 | Ga0307416_1000065296 | 250 |
| 855 | 3300032126 | Ga0307415_100000048 | Ga0307415_10000004813 | 250 |
| 856 | 3300037312 | Ga0395899_0001267 | Ga0395899_0001267_10265_11041 | 250 |
| 857 | 3300037312 | Ga0395899_0004240 | Ga0395899_0004240_70_915 | 250 |
| 858 | 3300037312 | Ga0395899_0010571 | Ga0395899_0010571_2458_3234 | 250 |
| 859 | 3300037418 | Ga0395900_0003489 | Ga0395900_0003489_11010_11786 | 250 |
| 860 | 3300037418 | Ga0395900_0021539 | Ga0395900_0021539_569_1345 | 250 |
| 861 | 3300037466 | Ga0395898_0001276 | Ga0395898_0001276_9328_10104 | 250 |
| 862 | 3300037466 | Ga0395898_0008267 | Ga0395898_0008267_513_1289 | 250 |
| 863 | 3300037466 | Ga0395898_0312915 | Ga0395898_0312915_475_1251 | 250 |
| 864 | 3300037471 | Ga0395905_0001281 | Ga0395905_0001281_11667_12443 | 250 |
| 865 | 3300037471 | Ga0395905_0064766 | Ga0395905_0064766_1707_2483 | 250 |
| 866 | 3300037471 | Ga0395905_0142852 | Ga0395905_0142852_149_925 | 250 |
| 867 | 3300038443 | Ga0395901_0001957 | Ga0395901_0001957_10105_10881 | 250 |
| 868 | 3300038443 | Ga0395901_0222063 | Ga0395901_0222063_1152_1928 | 250 |
| 869 | 3300038443 | Ga0395901_0374395 | Ga0395901_0374395_177_953 | 250 |
| 870 | 3300049568 | Ga0501031_0005807 | Ga0501031_0005807_44_817 | 250 |
| 871 | 3300049568 | Ga0501031_0016112 | Ga0501031_0016112_892_1665 | 250 |
| 872 | 3300049568 | Ga0501031_0017675 | Ga0501031_0017675_150_926 | 250 |
| 873 | 3300049569 | Ga0501032_0002668 | Ga0501032_0002668_11407_12180 | 250 |
| 874 | 3300049569 | Ga0501032_0059760 | Ga0501032_0059760_1744_2517 | 250 |
| 875 | 3300049569 | Ga0501032_0115109 | Ga0501032_0115109_523_1299 | 250 |
| 876 | 3300049570 | Ga0501033_0005054 | Ga0501033_0005054_2430_3203 | 250 |
| 877 | 3300049570 | Ga0501033_0011384 | Ga0501033_0011384_4416_5189 | 250 |
| 878 | 3300049571 | Ga0501034_0007242 | Ga0501034_0007242_7388_8161 | 250 |
| 879 | 3300049572 | Ga0501036_0000693 | Ga0501036_0000693_812_1585 | 250 |
| 880 | 3300049572 | Ga0501036_0012654 | Ga0501036_0012654_892_1665 | 250 |
| 881 | 3300049573 | Ga0501037_0024000 | Ga0501037_0024000_127_900 | 250 |
| 882 | 3300049573 | Ga0501037_0040290 | Ga0501037_0040290_1684_2457 | 250 |
| 883 | 3300049573 | Ga0501037_0092676 | Ga0501037_0092676_609_1385 | 250 |
| 884 | 3300049574 | Ga0501038_0000548 | Ga0501038_0000548_17278_18051 | 250 |
| 885 | 3300049574 | Ga0501038_0027217 | Ga0501038_0027217_1619_2392 | 250 |
| 886 | 3300049575 | Ga0501039_0000176 | Ga0501039_0000176_15686_16459 | 250 |
| 887 | 3300049575 | Ga0501039_0004489 | Ga0501039_0004489_9599_10372 | 250 |
| 888 | 3300049576 | Ga0501040_0000992 | Ga0501040_0000992_7576_8349 | 250 |
| 889 | 3300049576 | Ga0501040_0005177 | Ga0501040_0005177_7596_8369 | 250 |
| 890 | 3300049577 | Ga0501041_0000022 | Ga0501041_0000022_48882_49655 | 250 |
| 891 | 3300049577 | Ga0501041_0022644 | Ga0501041_0022644_292_1065 | 250 |
| 892 | 3300049577 | Ga0501041_0112204 | Ga0501041_0112204_804_1580 | 250 |
| 893 | 3300049578 | Ga0501042_0000092 | Ga0501042_0000092_17115_17888 | 250 |
| 894 | 3300049578 | Ga0501042_0000116 | Ga0501042_0000116_23500_24273 | 250 |
| 895 | 3300049579 | Ga0501043_0008893 | Ga0501043_0008893_50_823 | 250 |
| 896 | 3300049579 | Ga0501043_0134946 | Ga0501043_0134946_890_1663 | 250 |
| 897 | 3300049581 | Ga0501047_0001408 | Ga0501047_0001408_11283_12056 | 250 |
| 898 | 3300049581 | Ga0501047_0010177 | Ga0501047_0010177_883_1656 | 250 |
| 899 | 3300049582 | Ga0501048_0001223 | Ga0501048_0001223_11439_12212 | 250 |
| 900 | 3300049582 | Ga0501048_0002836 | Ga0501048_0002836_2863_3636 | 250 |
| 901 | 3300049583 | Ga0501067_0045158 | Ga0501067_0045158_650_1423 | 250 |
| 902 | 3300049584 | Ga0501068_0000554 | Ga0501068_0000554_11429_12202 | 250 |
| 903 | 3300049584 | Ga0501068_0010233 | Ga0501068_0010233_2893_3666 | 250 |
| 904 | 3300049585 | Ga0501069_0004761 | Ga0501069_0004761_3680_4453 | 250 |
| 905 | 3300049585 | Ga0501069_0005499 | Ga0501069_0005499_708_1481 | 250 |
| 906 | 3300049586 | Ga0501070_0008506 | Ga0501070_0008506_884_1657 | 250 |
| 907 | 3300049586 | Ga0501070_0034042 | Ga0501070_0034042_3188_3961 | 250 |
| 908 | 3300049587 | Ga0501071_0001793 | Ga0501071_0001793_892_1665 | 250 |
| 909 | 3300049588 | Ga0501072_0003510 | Ga0501072_0003510_7239_8012 | 250 |
| 910 | 3300049588 | Ga0501072_0024735 | Ga0501072_0024735_292_1065 | 250 |
| 911 | 3300049589 | Ga0501073_0016876 | Ga0501073_0016876_2863_3636 | 250 |
| 912 | 3300049590 | Ga0501074_0002118 | Ga0501074_0002118_11417_12190 | 250 |
| 913 | 3300049590 | Ga0501074_0004639 | Ga0501074_0004639_6207_6980 | 250 |
| 914 | 3300049591 | Ga0501075_0000040 | Ga0501075_0000040_44141_44914 | 250 |
| 915 | 3300049591 | Ga0501075_0003487 | Ga0501075_0003487_146_919 | 250 |
| 916 | 3300049591 | Ga0501075_0011446 | Ga0501075_0011446_1600_2376 | 250 |
| 917 | 3300049592 | Ga0501076_0000389 | Ga0501076_0000389_11885_12658 | 250 |
| 918 | 3300049592 | Ga0501076_0000462 | Ga0501076_0000462_3673_4446 | 250 |
| 919 | 3300049592 | Ga0501076_0371470 | Ga0501076_0371470_289_1065 | 250 |
| 920 | 3300049593 | Ga0501077_0002796 | Ga0501077_0002796_9383_10159 | 250 |
| 921 | 3300049593 | Ga0501077_0002948 | Ga0501077_0002948_86_859 | 250 |
| 922 | 3300049593 | Ga0501077_0004601 | Ga0501077_0004601_3189_3962 | 250 |
| 923 | 3300049741 | Ga0501079_0000221 | Ga0501079_0000221_23500_24273 | 250 |
| 924 | 3300049741 | Ga0501079_0004632 | Ga0501079_0004632_62_835 | 250 |
| 925 | 3300049741 | Ga0501079_0038108 | Ga0501079_0038108_1370_2146 | 250 |
| 926 | 3300049741 | Ga0501079_0385983 | Ga0501079_0385983_310_1086 | 250 |
| 927 | 3300049742 | Ga0501080_0020495 | Ga0501080_0020495_3737_4510 | 250 |
| 928 | 3300049742 | Ga0501080_0076027 | Ga0501080_0076027_1609_2382 | 250 |
| 929 | 3300049742 | Ga0501080_0118518 | Ga0501080_0118518_1205_1981 | 250 |
| 930 | 3300049743 | Ga0501081_0000040 | Ga0501081_0000040_22663_23436 | 250 |
| 931 | 3300049744 | Ga0501083_0000928 | Ga0501083_0000928_7239_8012 | 250 |
| 932 | 3300049744 | Ga0501083_0025547 | Ga0501083_0025547_619_1392 | 250 |
| 933 | 3300049822 | Ga0501035_0006640 | Ga0501035_0006640_7239_8012 | 250 |
| 934 | 3300049822 | Ga0501035_0017516 | Ga0501035_0017516_1619_2392 | 250 |
| 935 | 3300049823 | Ga0501044_0006326 | Ga0501044_0006326_1788_2561 | 250 |
| 936 | 3300049824 | Ga0501045_0000098 | Ga0501045_0000098_7223_7996 | 250 |
| 937 | 3300049824 | Ga0501045_0002356 | Ga0501045_0002356_1589_2365 | 250 |
| 938 | 3300049824 | Ga0501045_0003655 | Ga0501045_0003655_292_1065 | 250 |
| 939 | 3300049824 | Ga0501045_0166089 | Ga0501045_0166089_834_1613 | 250 |
| 940 | 3300054114 | Ga0501084_0000228 | Ga0501084_0000228_11439_12212 | 250 |
| 941 | 3300054114 | Ga0501084_0000955 | Ga0501084_0000955_11899_12672 | 250 |
| 942 | 3300054114 | Ga0501084_0051910 | Ga0501084_0051910_1547_2320 | 250 |
| 943 | 3300054114 | Ga0501084_0579896 | Ga0501084_0579896_74_850 | 250 |
| 944 | 3300060353 | Ga0501082_0000313 | Ga0501082_0000313_18948_19721 | 250 |
| 945 | 3300060353 | Ga0501082_0001912 | Ga0501082_0001912_7936_8709 | 250 |
| 946 | 3300061734 | Ga0530510_0000233 | Ga0530510_0000233_22663_23436 | 250 |
| 947 | 3300061734 | Ga0530510_0002808 | Ga0530510_0002808_891_1664 | 250 |
| 948 | 3300061734 | Ga0530510_0058431 | Ga0530510_0058431_1239_2015 | 250 |
| 949 | 3300061734 | Ga0530510_0451617 | Ga0530510_0451617_78_839 | 250 |
| 950 | iso_pu_bacteria | 2622736605 | 2623502040 | 251 |
| 951 | 3300044901 | Ga0466960_0284999 | Ga0466960_0284999_137_904 | 255 |
| 952 | 3300046473 | Ga0495582_0123751 | Ga0495582_0123751_461_1240 | 255 |
| 953 | 3300000549 | LJQas_1008627 | LJQas_10086272 | 256 |
| 954 | 3300005329 | Ga0070683_100294495 | Ga0070683_1002944951 | 256 |
| 955 | 3300005435 | Ga0070714_100525509 | Ga0070714_1005255092 | 256 |
| 956 | 3300025933 | Ga0207706_10419721 | Ga0207706_104197212 | 256 |
| 957 | 3300025944 | Ga0207661_10128943 | Ga0207661_101289432 | 256 |
| 958 | 3300031548 | Ga0307408_100185655 | Ga0307408_1001856552 | 256 |
| 959 | 3300031731 | Ga0307405_10347032 | Ga0307405_103470322 | 256 |
| 960 | 3300031731 | Ga0307405_10349468 | Ga0307405_103494682 | 256 |
| 961 | 3300031852 | Ga0307410_10164366 | Ga0307410_101643662 | 256 |
| 962 | 3300031901 | Ga0307406_10053277 | Ga0307406_100532773 | 256 |
| 963 | 3300031901 | Ga0307406_10073419 | Ga0307406_100734193 | 256 |
| 964 | 3300031901 | Ga0307406_10304865 | Ga0307406_103048652 | 256 |
| 965 | 3300031903 | Ga0307407_10095416 | Ga0307407_100954162 | 256 |
| 966 | 3300031911 | Ga0307412_10354291 | Ga0307412_103542912 | 256 |
| 967 | 3300031995 | Ga0307409_100020946 | Ga0307409_1000209462 | 256 |
| 968 | 3300031995 | Ga0307409_100060901 | Ga0307409_1000609013 | 256 |
| 969 | 3300031995 | Ga0307409_100069355 | Ga0307409_1000693551 | 256 |
| 970 | 3300031995 | Ga0307409_100133126 | Ga0307409_1001331262 | 256 |
| 971 | 3300031995 | Ga0307409_100263053 | Ga0307409_1002630531 | 256 |
| 972 | 3300031995 | Ga0307409_100305097 | Ga0307409_1003050972 | 256 |
| 973 | 3300031995 | Ga0307409_100639544 | Ga0307409_1006395442 | 256 |
| 974 | 3300032002 | Ga0307416_100188162 | Ga0307416_1001881622 | 256 |
| 975 | 3300032002 | Ga0307416_100267892 | Ga0307416_1002678922 | 256 |
| 976 | 3300032002 | Ga0307416_100488972 | Ga0307416_1004889722 | 256 |
| 977 | 3300032004 | Ga0307414_10121022 | Ga0307414_101210223 | 256 |
| 978 | 3300032005 | Ga0307411_10156781 | Ga0307411_101567812 | 256 |
| 979 | 3300032005 | Ga0307411_10349817 | Ga0307411_103498172 | 256 |
| 980 | 3300032005 | Ga0307411_10654423 | Ga0307411_106544231 | 256 |
| 981 | 3300032126 | Ga0307415_100031159 | Ga0307415_1000311594 | 256 |
| 982 | 3300032126 | Ga0307415_100092379 | Ga0307415_1000923792 | 256 |
| 983 | 3300044684 | Ga0466966_0117343 | Ga0466966_0117343_670_1485 | 256 |
| 984 | 3300044684 | Ga0466966_0200000 | Ga0466966_0200000_137_949 | 256 |
| 985 | 3300044684 | Ga0466966_0283682 | Ga0466966_0283682_96_881 | 256 |
| 986 | 3300044706 | Ga0466964_0120805 | Ga0466964_0120805_303_1073 | 256 |
| 987 | 3300044842 | Ga0466957_0058790 | Ga0466957_0058790_1223_1993 | 256 |
| 988 | 3300044842 | Ga0466957_0114486 | Ga0466957_0114486_275_1090 | 256 |
| 989 | 3300048915 | Ga0496112_0391674 | Ga0496112_0391674_241_1011 | 256 |
| 990 | 3300049521 | Ga0501298_024281 | Ga0501298_024281_39_809 | 256 |
| 991 | 3300049661 | Ga0501217_073485 | Ga0501217_073485_154_924 | 256 |
| 992 | 3300061719 | Ga0466962_0037246 | Ga0466962_0037246_1177_1992 | 256 |
| 993 | 3300061719 | Ga0466962_0152958 | Ga0466962_0152958_73_843 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bl7-assembly1.cif.gz_A | crystal structure of umpk from m. tuberculosis in complex with udp and utp (p21212 form) | 0.9252 | 21 | 254 |
| 7bix-assembly2.cif.gz_L | crystal structure of umpk from m. tuberculosis in complex with udp and utp (c2 form) | 0.9235 | 21 | 254 |
| 2bnf-assembly1.cif.gz_A | the structure of e. coli ump kinase in complex with utp | 0.9216 | 22 | 254 |
| 7bix-assembly2.cif.gz_L | crystal structure of umpk from m. tuberculosis in complex with udp and utp (c2 form) | 0.9196 | 21 | 254 |
| 2bnd-assembly1.cif.gz_A | the structure of e. coli ump kinase in complex with udp | 0.9191 | 22 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHK5_22_261_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9258 | 17 | 254 | 3.40.1160.10 |
| af_P9WHK5_22_261_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9108 | 17 | 254 | 3.40.1160.10 |
| 2jjxC00 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9092 | 22 | 256 | 3.40.1160.10 |
| af_A0A1D6G3Z5_82_358_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9057 | 17 | 256 | 3.40.1160.10 |
| 3ek5B00 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.8928 | 22 | 256 | 3.40.1160.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K1AUN4-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9908 | 165 | 253 |
GO:0005524
GO:0006225 GO:0033862 |
| AF-A0A7C0W0S4-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9878 | 165 | 255 |
GO:0005524
GO:0006225 GO:0033862 |
| AF-Q4BV13-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9875 | 159 | 253 |
GO:0005524
GO:0006225 GO:0033862 |
| AF-A0A6B3GNC0-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9846 | 153 | 254 |
GO:0005524
GO:0006225 GO:0033862 |
| AF-A0A7K1AUN4-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9799 | 165 | 253 |
GO:0005524
GO:0006225 GO:0033862 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar