F487702

General Info

Members Datasets Scaffolds Average Seq Length
993 573 1987 330

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_33851_c1|nmdc:mga03n38_33851_c1_61_1209
Length 382
Sequence MARHGGKRIQIGKIEFSHCLYFRTSCTDHDGLSHIAPGPILPAQRTTETIMKQRQLGKNGPKTSAIGLGAMGMSGMYGPADRAESIATIHAALEAGVTLIDTGDFYGMGHNEMLIGEALKGVPRDRFQISVKFGALRDPAGNWLGYDARPVAVKSALAYTLQRLGLDHIDIYRPSRLDPNVPIEDTVGAVAEMVKAGYVRHIGLSEIGAETIRRAAAVHPISDLQIEYSLISRGIEEQILPTLRELGIGVTAYGVLSRGLISGHWQAGTALAKGDFRGMSPRFQAENAARNLALVEALRAVAEARGASVAQVAIAWVAAQGADIVPLVGARRRDRLAEALGALDLELSTDDLAAIERAVPKGAASGSRYPERAMADLDSERT

Samples

Sample ID Description Type Environment
1 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
150 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
159 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
227 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
228 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
229 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
230 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
231 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
242 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
243 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
244 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
245 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
246 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
253 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
267 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
272 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
273 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
274 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
275 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
276 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
277 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
278 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
279 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
280 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
281 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
282 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
285 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
286 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
287 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
294 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
301 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
302 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
303 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
304 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
305 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
306 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
307 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
308 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
309 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
310 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
323 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
324 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
325 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
326 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
327 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
328 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
329 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
330 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
331 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
344 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
345 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
346 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
347 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
350 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
351 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
352 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
353 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
357 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
360 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
361 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
362 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
371 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
372 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
373 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
374 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
375 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
376 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
377 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
378 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
379 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
380 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
381 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
382 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
383 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
384 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
389 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
395 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
396 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
397 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
402 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
403 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
416 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
420 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
421 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
422 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
423 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
424 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
425 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
426 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
429 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
430 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
431 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
432 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
433 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
434 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
435 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
436 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
437 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
438 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
439 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
440 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
441 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
442 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
443 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
444 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
445 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
446 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
447 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
448 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
449 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
450 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
451 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
452 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
453 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
454 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
455 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
456 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
457 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
458 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
459 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
460 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
461 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
462 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
463 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
464 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
465 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
466 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
467 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
468 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
469 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
470 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
471 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
472 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
473 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
474 2509276019 Ensifer aridi TW10 Isolate Nodule
475 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
476 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
477 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
478 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
479 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
480 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
481 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
482 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
483 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
484 2619618881 Frankia sp. ACN1ag Isolate Unclassified
485 2619619003 Frankia sp. CpI1-P Isolate Nodule
486 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
487 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
488 2643221629 Devosia sp. Root105 Isolate Unclassified
489 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
490 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
491 2643221647 Streptomyces sp. Root369 Isolate Unclassified
492 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
493 2643221662 Devosia sp. Root413D1 Isolate Unclassified
494 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
495 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
496 2643221714 Streptomyces sp. Root264 Isolate Unclassified
497 2643221718 Rhizobium sp. Root268 Isolate Unclassified
498 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
499 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
500 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
501 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
502 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
503 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
504 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
505 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
506 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
507 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
508 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
509 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
510 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
511 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
512 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
513 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
514 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
515 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
516 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
517 2842694124 Methylopila sp. R-72369 Isolate Unclassified
518 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
519 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
520 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
521 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
522 2849560528 Caulobacter zeae 410 Isolate Unclassified
523 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
524 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
525 2851153111 Caulobacter radicis 736 Isolate Unclassified
526 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
527 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
528 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
529 2867428634 Streptomyces sp. RP5T Isolate Unclassified
530 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
531 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
532 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
533 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
534 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
535 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
536 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
537 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
538 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
539 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
540 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
541 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
542 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
543 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
544 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
545 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
546 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
547 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
548 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
549 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
550 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
551 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
552 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
553 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
554 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
555 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
556 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
557 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
558 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
559 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
560 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
561 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
562 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
563 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
564 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
565 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
566 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
567 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
568 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
569 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
570 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
571 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
572 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
573 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.43
Metatranscriptomes 0.4
Isolates 10.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.57
Nodule 2.42
Rhizoplane 3.42
Rhizosphere 75.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03n38_33851_c1 3300050490 Bacteria 2177
2 JGI24737J22298_10051184 3300001990 Bacteria 1254
3 JGI24735J21928_10001861 3300002067 Bacteria 7399
4 JGI24738J21930_10002057 3300002075 Bacteria 5393
5 JGI24744J21845_10020508 3300002077 Bacteria 1303
6 JGI25151J46595_10003611 3300003187 Bacteria 8460
7 JGI25406J46586_10003682 3300003203 Bacteria 7184
8 JGI25153J46596_10000059 3300003215 Bacteria 131871
9 JGI25153J46596_10000347 3300003215 Bacteria 32342
10 JGI25153J46596_10045284 3300003215 Bacteria 1314
11 rootH1_10039975 3300003316 Bacteria 4505
12 rootH1_10039975 3300003323 Bacteria 3576
13 rootL2_10042670 3300003322 Bacteria 2560
14 rootL2_10244431 3300003322 Bacteria 4542
15 rootH1_10244174 3300003323 Bacteria 1338
16 JGI25160J50197_1019999 3300003354 Bacteria 2034
17 Ga0006562J51391_1039231 3300003578 Bacteria 1955
18 Ga0006562J51391_1097249 3300003578 Bacteria 3250
19 Ga0006562J51391_1097250 3300003578 Bacteria 4360
20 Ga0055538_1000002 3300003751 Bacteria 999437
21 Ga0055539_1000002 3300003752 Bacteria 999437
22 Ga0055533_1000004 3300003756 Bacteria 999437
23 Ga0055525_1000002 3300003759 Bacteria 999437
24 Ga0055524_1003285 3300003775 Bacteria 7912
25 Ga0055536_1002443 3300003781 Bacteria 10433
26 Ga0055528_1003718 3300003790 Bacteria 7540
27 Ga0055530_10000180 3300003791 Bacteria 57095
28 Ga0055530_10000371 3300003791 Bacteria 40721
29 Ga0055531_10000844 3300003794 Bacteria 25295
30 Ga0055531_10020550 3300003794 Bacteria 2605
31 Ga0055541_1000002 3300003841 Bacteria 896405
32 Ga0065165_1000041 3300005262 Bacteria 203876
33 Ga0065704_10001157 3300005289 Bacteria 9708
34 Ga0070658_10023456 3300005327 Bacteria 4952
35 Ga0070658_10486722 3300005327 Bacteria 1065
36 Ga0070676_10005433 3300005328 Bacteria 6788
37 Ga0070683_100044156 3300005329 Bacteria 4109
38 Ga0070683_100543434 3300005329 Bacteria 1111
39 Ga0070690_100000353 3300005330 Bacteria 23608
40 Ga0070670_100022096 3300005331 Bacteria 5476
41 Ga0070680_100040786 3300005336 Bacteria 3761
42 Ga0070682_100002246 3300005337 Bacteria 10707
43 Ga0068868_100016065 3300005338 Bacteria 5551
44 Ga0070660_100001656 3300005339 Bacteria 15309
45 Ga0070689_100001225 3300005340 Bacteria 16291
46 Ga0070691_10000400 3300005341 Bacteria 15742
47 Ga0070687_100000797 3300005343 Bacteria 10479
48 Ga0070687_100033026 3300005343 Bacteria 2551
49 Ga0070661_100000384 3300005344 Bacteria 34636
50 Ga0070661_100036544 3300005344 Bacteria 3571
51 Ga0070692_10005510 3300005345 Bacteria 5406
52 Ga0070668_100000244 3300005347 Bacteria 35854
53 Ga0070669_100005644 3300005353 Bacteria 9039
54 Ga0070675_100010071 3300005354 Bacteria 7370
55 Ga0070671_100015311 3300005355 Bacteria 6193
56 Ga0070671_100148165 3300005355 Bacteria 1981
57 Ga0070671_100156542 3300005355 Bacteria 1925
58 Ga0070671_100355568 3300005355 Bacteria 1250
59 Ga0070674_100004514 3300005356 Bacteria 7945
60 Ga0070674_100058420 3300005356 Bacteria 2681
61 Ga0070674_100151898 3300005356 Bacteria 1748
62 Ga0070673_100001304 3300005364 Bacteria 14521
63 Ga0070673_100043152 3300005364 Bacteria 3482
64 Ga0070659_100001838 3300005366 Bacteria 15239
65 Ga0070667_100000032 3300005367 Bacteria 176783
66 Ga0070667_100038589 3300005367 Bacteria 4004
67 Ga0070703_10074344 3300005406 Bacteria 1142
68 Ga0070709_10002721 3300005434 Bacteria 9553
69 Ga0070714_100011159 3300005435 Bacteria 7121
70 Ga0070714_100034133 3300005435 Bacteria 4259
71 Ga0070713_100014713 3300005436 Bacteria 5821
72 Ga0070713_100177568 3300005436 Bacteria 1912
73 Ga0070710_10000631 3300005437 Bacteria 16763
74 Ga0070701_10000411 3300005438 Bacteria 14521
75 Ga0070711_100012991 3300005439 Bacteria 5219
76 Ga0070705_100003021 3300005440 Bacteria 8314
77 Ga0070700_100006086 3300005441 Bacteria 6426
78 Ga0070694_100009526 3300005444 Bacteria 5958
79 Ga0070708_100001636 3300005445 Bacteria 17177
80 Ga0070663_100000213 3300005455 Bacteria 29048
81 Ga0070663_100002295 3300005455 Bacteria 10732
82 Ga0070663_100114797 3300005455 Bacteria 2028
83 Ga0070678_100001330 3300005456 Bacteria 13125
84 Ga0070678_100067356 3300005456 Bacteria 2665
85 Ga0070662_100001264 3300005457 Bacteria 15537
86 Ga0070681_10087479 3300005458 Bacteria 3069
87 Ga0068867_100009543 3300005459 Bacteria 6840
88 Ga0070706_100078965 3300005467 Bacteria 3046
89 Ga0070699_100108834 3300005518 Bacteria 2432
90 Ga0070684_100006348 3300005535 Bacteria 9137
91 Ga0070697_100000600 3300005536 Bacteria 27338
92 Ga0070697_100018903 3300005536 Bacteria 5437
93 Ga0068853_100002094 3300005539 Bacteria 14803
94 Ga0068853_100003586 3300005539 Bacteria 11884
95 Ga0070672_100000593 3300005543 Bacteria 21257
96 Ga0070686_100008356 3300005544 Bacteria 5796
97 Ga0070695_100019548 3300005545 Bacteria 4124
98 Ga0070696_100009212 3300005546 Bacteria 6608
99 Ga0070693_100002402 3300005547 Bacteria 8618
100 Ga0070665_100010157 3300005548 Bacteria 9520
101 Ga0070665_100193817 3300005548 Bacteria 2033
102 Ga0070665_100279887 3300005548 Bacteria 1670
103 Ga0070704_100001660 3300005549 Bacteria 12063
104 Ga0068855_100000893 3300005563 Bacteria 37029
105 Ga0070664_100001131 3300005564 Bacteria 21074
106 Ga0068857_100004274 3300005577 Bacteria 12044
107 Ga0068854_100004366 3300005578 Bacteria 8918
108 Ga0068856_100002475 3300005614 Bacteria 19007
109 Ga0068856_100070159 3300005614 Bacteria 3466
110 Ga0070702_100002170 3300005615 Bacteria 8355
111 Ga0068852_100001835 3300005616 Bacteria 14449
112 Ga0068859_100039295 3300005617 Bacteria 4747
113 Ga0068864_100009139 3300005618 Bacteria 8170
114 Ga0068866_10000716 3300005718 Bacteria 15063
115 Ga0068861_100002260 3300005719 Bacteria 12517
116 Ga0068861_100011313 3300005719 Bacteria 6196
117 Ga0068851_10110910 3300005834 Bacteria 1464
118 Ga0068870_10027496 3300005840 Bacteria 2846
119 Ga0068863_100006545 3300005841 Bacteria 11431
120 Ga0068863_100052519 3300005841 Bacteria 3862
121 Ga0068858_100002708 3300005842 Bacteria 17868
122 Ga0068860_100001510 3300005843 Bacteria 25075
123 Ga0068862_100001549 3300005844 Bacteria 21017
124 Ga0068862_100037119 3300005844 Bacteria 4129
125 Ga0068862_100055189 3300005844 Bacteria 3403
126 Ga0081455_10160346 3300005937 Bacteria 1725
127 Ga0081538_10009878 3300005981 Bacteria 7890
128 Ga0081540_1063568 3300005983 Bacteria 1746
129 Ga0081539_10000260 3300005985 Bacteria 121685
130 Ga0081539_10002379 3300005985 Bacteria 26904
131 Ga0081539_10004993 3300005985 Bacteria 14028
132 Ga0075365_10020608 3300006038 Bacteria 4091
133 Ga0075365_10027832 3300006038 Bacteria 3601
134 Ga0075365_10090639 3300006038 Bacteria 2082
135 Ga0075368_10007337 3300006042 Bacteria 3887
136 Ga0075368_10017684 3300006042 Bacteria 2671
137 Ga0075363_100044516 3300006048 Bacteria 2351
138 Ga0075364_10060179 3300006051 Bacteria 2491
139 Ga0075364_10273090 3300006051 Bacteria 1150
140 Ga0070715_10001549 3300006163 Bacteria 6735
141 Ga0070716_100003352 3300006173 Bacteria 7530
142 Ga0070712_100010677 3300006175 Bacteria 5799
143 Ga0075367_10203416 3300006178 Bacteria 1237
144 Ga0097621_100140530 3300006237 Bacteria 2063
145 Ga0075370_10144723 3300006353 Bacteria 1391
146 Ga0068871_100029996 3300006358 Bacteria 4279
147 Ga0075428_100060512 3300006844 Bacteria 4147
148 Ga0075430_100255262 3300006846 Bacteria 1452
149 Ga0075431_100211576 3300006847 Bacteria 1980
150 Ga0075433_10016953 3300006852 Bacteria 6020
151 Ga0075433_10043589 3300006852 Bacteria 3895
152 Ga0075429_100019359 3300006880 Bacteria 5895
153 Ga0068865_100000336 3300006881 Bacteria 25976
154 Ga0075436_100034897 3300006914 Bacteria 3469
155 Ga0097620_100039295 3300006931 Bacteria 4747
156 Ga0099826_10058826 3300006948 Bacteria 2517
157 Ga0075435_100029485 3300007076 Bacteria 4306
158 Ga0075435_100499820 3300007076 Bacteria 1051
159 Ga0105244_10063203 3300009036 Bacteria 1859
160 Ga0105240_10103548 3300009093 Bacteria 3458
161 Ga0105240_10458571 3300009093 Bacteria 1425
162 Ga0111539_10155560 3300009094 Bacteria 2675
163 Ga0111539_10701496 3300009094 Bacteria 1178
164 Ga0105245_10000688 3300009098 Bacteria 30513
165 Ga0105245_10154098 3300009098 Bacteria 2175
166 Ga0105247_10009820 3300009101 Bacteria 5798
167 Ga0105247_10016880 3300009101 Bacteria 4377
168 Ga0114129_10058018 3300009147 Bacteria 5416
169 Ga0105243_10000473 3300009148 Bacteria 41355
170 Ga0105243_10106287 3300009148 Bacteria 2339
171 Ga0105241_10002593 3300009174 Bacteria 13553
172 Ga0105242_10000217 3300009176 Bacteria 45033
173 Ga0105248_10000143 3300009177 Bacteria 82037
174 Ga0105248_10000487 3300009177 Bacteria 45265
175 Ga0105237_10000638 3300009545 Bacteria 48948
176 Ga0105237_10007897 3300009545 Bacteria 11593
177 Ga0105238_10000015 3300009551 Bacteria 241590
178 Ga0105238_10008427 3300009551 Bacteria 10321
179 Ga0105238_10219096 3300009551 Bacteria 1879
180 Ga0105249_10000211 3300009553 Bacteria 66931
181 Ga0105249_10001143 3300009553 Bacteria 23484
182 Ga0105249_10152251 3300009553 Bacteria 2228
183 Ga0099796_10003661 3300010159 Bacteria 3603
184 Ga0105239_10004376 3300010375 Bacteria 16914
185 Ga0105239_10531243 3300010375 Bacteria 1339
186 Ga0105239_10576996 3300010375 Bacteria 1282
187 Ga0105246_10000451 3300011119 Bacteria 22023
188 Ga0157373_10027812 3300013100 Bacteria 4080
189 Ga0157369_10001385 3300013105 Bacteria 29863
190 Ga0157369_10134064 3300013105 Bacteria 2623
191 Ga0157374_10001745 3300013296 Bacteria 18248
192 Ga0157374_10004977 3300013296 Bacteria 11148
193 Ga0157374_10027795 3300013296 Bacteria 5107
194 Ga0157378_10001026 3300013297 Bacteria 25538
195 Ga0163162_10000935 3300013306 Bacteria 27140
196 Ga0163162_10037798 3300013306 Bacteria 4818
197 Ga0163162_10063999 3300013306 Bacteria 3722
198 Ga0157372_10003142 3300013307 Bacteria 17807
199 Ga0157375_10012343 3300013308 Bacteria 7575
200 Ga0157375_10042148 3300013308 Bacteria 4415
201 Ga0163163_10040262 3300014325 Bacteria 4563
202 Ga0163163_10098993 3300014325 Bacteria 2937
203 Ga0157380_10001124 3300014326 Bacteria 17252
204 Ga0157380_10045986 3300014326 Bacteria 3427
205 Ga0157377_10000791 3300014745 Bacteria 13068
206 Ga0157379_10006054 3300014968 Bacteria 10419
207 Ga0157376_10000510 3300014969 Bacteria 25116
208 Ga0183367_1009 3300015688 Bacteria 484598
209 Ga0163161_10025207 3300017792 Bacteria 4208
210 Ga0163161_10068801 3300017792 Bacteria 2587
211 Ga0163161_10268631 3300017792 Bacteria 1334
212 Ga0206353_10718303 3300020082 Bacteria 2749
213 Ga0214542_1018224 3300021321 Bacteria 6020
214 Ga0214543_1000134 3300021327 Bacteria 102056
215 Ga0213872_10100302 3300021361 Bacteria 1291
216 Ga0213872_10110791 3300021361 Bacteria 1219
217 Ga0213874_10046082 3300021377 Bacteria 1322
218 Ga0213876_10009202 3300021384 Bacteria 5320
219 Ga0209784_100002 3300025224 Bacteria 1753105
220 Ga0209566_100003 3300025225 Bacteria 1753105
221 Ga0209674_100004 3300025226 Bacteria 1753105
222 Ga0209563_100006 3300025230 Bacteria 1753105
223 Ga0209026_1001674 3300025250 Bacteria 9321
224 Ga0209677_100003 3300025253 Bacteria 1753105
225 Ga0209129_1000689 3300025258 Bacteria 22147
226 Ga0209673_1000010 3300025273 Bacteria 596656
227 Ga0209673_1040467 3300025273 Bacteria 1333
228 Ga0209130_1000399 3300025284 Bacteria 47530
229 Ga0209676_1000547 3300025292 Bacteria 57868
230 Ga0209025_1001742 3300025294 Bacteria 26127
231 Ga0209025_1024299 3300025294 Bacteria 3132
232 Ga0209564_1007507 3300025295 Bacteria 5617
233 Ga0209758_1000095 3300025297 Bacteria 237870
234 Ga0209758_1030482 3300025297 Bacteria 2233
235 Ga0209050_1000034 3300025298 Bacteria 433906
236 Ga0209050_1004401 3300025298 Bacteria 9540
237 Ga0209050_1014984 3300025298 Bacteria 3292
238 Ga0209256_1001682 3300025299 Bacteria 21428
239 Ga0209256_1009580 3300025299 Bacteria 4220
240 Ga0207426_1000046 3300025302 Bacteria 422271
241 Ga0209051_1015616 3300025303 Bacteria 3482
242 Ga0209051_1024871 3300025303 Bacteria 2452
243 Ga0209257_1000052 3300025304 Bacteria 430947
244 Ga0209257_1000477 3300025304 Bacteria 72873
245 Ga0209257_1004227 3300025304 Bacteria 11372
246 Ga0209257_1019432 3300025304 Bacteria 2559
247 Ga0207656_10078840 3300025321 Bacteria 1477
248 Ga0207710_10006089 3300025900 Bacteria 5166
249 Ga0207680_10006249 3300025903 Bacteria 5749
250 Ga0207647_10003873 3300025904 Bacteria 11188
251 Ga0207647_10043088 3300025904 Bacteria 2825
252 Ga0207699_10010704 3300025906 Bacteria 4612
253 Ga0207645_10001040 3300025907 Bacteria 22925
254 Ga0207643_10009053 3300025908 Bacteria 5347
255 Ga0207705_10018281 3300025909 Bacteria 5013
256 Ga0207684_10174360 3300025910 Bacteria 1854
257 Ga0207707_10054439 3300025912 Bacteria 3483
258 Ga0207695_10188223 3300025913 Bacteria 1982
259 Ga0207695_10236318 3300025913 Bacteria 1730
260 Ga0207671_10046382 3300025914 Bacteria 3215
261 Ga0207671_10048751 3300025914 Bacteria 3135
262 Ga0207693_10000278 3300025915 Bacteria 47482
263 Ga0207663_10002954 3300025916 Bacteria 8216
264 Ga0207660_10042397 3300025917 Bacteria 3194
265 Ga0207662_10005916 3300025918 Bacteria 6566
266 Ga0207662_10023054 3300025918 Bacteria 3573
267 Ga0207657_10000047 3300025919 Bacteria 111686
268 Ga0207681_10006557 3300025923 Bacteria 7144
269 Ga0207681_10153398 3300025923 Bacteria 1729
270 Ga0207694_10000017 3300025924 Bacteria 342100
271 Ga0207694_10036175 3300025924 Bacteria 3789
272 Ga0207664_10015644 3300025929 Bacteria 5514
273 Ga0207644_10034679 3300025931 Bacteria 3532
274 Ga0207644_10204472 3300025931 Bacteria 1559
275 Ga0207706_10000079 3300025933 Bacteria 100592
276 Ga0207686_10016824 3300025934 Bacteria 4107
277 Ga0207709_10023947 3300025935 Bacteria 3481
278 Ga0207669_10009273 3300025937 Bacteria 4676
279 Ga0207669_10079995 3300025937 Bacteria 2089
280 Ga0207704_10016264 3300025938 Bacteria 3819
281 Ga0207704_10127593 3300025938 Bacteria 1755
282 Ga0207665_10000432 3300025939 Bacteria 28864
283 Ga0207691_10007711 3300025940 Bacteria 10359
284 Ga0207691_10027134 3300025940 Bacteria 5373
285 Ga0207711_10001415 3300025941 Bacteria 22473
286 Ga0207711_10051163 3300025941 Bacteria 3537
287 Ga0207661_10030887 3300025944 Bacteria 4131
288 Ga0207651_10019716 3300025960 Bacteria 4050
289 Ga0207712_10004820 3300025961 Bacteria 8521
290 Ga0207668_10004345 3300025972 Bacteria 8322
291 Ga0207640_10007564 3300025981 Bacteria 5999
292 Ga0207658_10000048 3300025986 Bacteria 130723
293 Ga0207658_10445490 3300025986 Bacteria 1145
294 Ga0207639_10005055 3300026041 Bacteria 8886
295 Ga0207678_10000111 3300026067 Bacteria 67188
296 Ga0207678_10000877 3300026067 Bacteria 27644
297 Ga0207708_10000526 3300026075 Bacteria 29587
298 Ga0207702_10075114 3300026078 Bacteria 2919
299 Ga0207641_10019105 3300026088 Bacteria 5621
300 Ga0207641_10428767 3300026088 Bacteria 1274
301 Ga0207648_10011260 3300026089 Bacteria 8434
302 Ga0207648_10069754 3300026089 Bacteria 3063
303 Ga0207676_10060990 3300026095 Bacteria 2985
304 Ga0207674_10001475 3300026116 Bacteria 30401
305 Ga0207675_100007188 3300026118 Bacteria 10521
306 Ga0207675_100018149 3300026118 Bacteria 6559
307 Ga0207683_10000026 3300026121 Bacteria 111890
308 Ga0207683_10069410 3300026121 Bacteria 3112
309 Ga0209813_10011864 3300027866 Bacteria 2288
310 Ga0207428_10000668 3300027907 Bacteria 40081
311 Ga0207428_10097474 3300027907 Bacteria 2276
312 Ga0268266_10021536 3300028379 Bacteria 5492
313 Ga0268266_10073294 3300028379 Bacteria 2971
314 Ga0268266_10345624 3300028379 Bacteria 1397
315 Ga0268265_10000876 3300028380 Bacteria 28172
316 Ga0268265_10001620 3300028380 Bacteria 18546
317 Ga0268265_10056529 3300028380 Bacteria 2986
318 Ga0268264_10018500 3300028381 Bacteria 5698
319 Ga0268264_10070350 3300028381 Bacteria 2962
320 Ga0268264_10229146 3300028381 Bacteria 1715
321 Ga0265336_10000664 3300028666 Bacteria 18678
322 Ga0307517_10131954 3300028786 Bacteria 1794
323 Ga0307515_10015071 3300028794 Bacteria 14277
324 Ga0307515_10123046 3300028794 Bacteria 2921
325 Ga0307515_10324832 3300028794 Bacteria 1202
326 Ga0265338_10083232 3300028800 Bacteria 2677
327 Ga0307511_10012485 3300030521 Bacteria 8334
328 Ga0307512_10010397 3300030522 Bacteria 8877
329 Ga0265332_10010400 3300031238 Bacteria 4141
330 Ga0265328_10021119 3300031239 Bacteria 2488
331 Ga0265328_10029163 3300031239 Bacteria 2062
332 Ga0265320_10056299 3300031240 Bacteria 1890
333 Ga0265325_10016843 3300031241 Bacteria 4076
334 Ga0265340_10000024 3300031247 Bacteria 77206
335 Ga0265340_10011864 3300031247 Bacteria 4616
336 Ga0265340_10011993 3300031247 Bacteria 4584
337 Ga0265340_10015861 3300031247 Bacteria 3908
338 Ga0265340_10079455 3300031247 Bacteria 1546
339 Ga0265339_10001398 3300031249 Bacteria 17958
340 Ga0265316_10010461 3300031344 Bacteria 8449
341 Ga0265316_10048376 3300031344 Bacteria 3357
342 Ga0265316_10053576 3300031344 Bacteria 3160
343 Ga0265316_10115896 3300031344 Bacteria 2025
344 Ga0265316_10223758 3300031344 Bacteria 1387
345 Ga0307513_10029898 3300031456 Bacteria 6197
346 Ga0307513_10058751 3300031456 Bacteria 4085
347 Ga0307513_10174035 3300031456 Bacteria 2026
348 Ga0307513_10200611 3300031456 Bacteria 1836
349 Ga0307513_10343730 3300031456 Bacteria 1242
350 Ga0307509_10047478 3300031507 Bacteria 4618
351 Ga0307509_10263464 3300031507 Bacteria 1497
352 Ga0265313_10009270 3300031595 Bacteria 6406
353 Ga0307508_10052441 3300031616 Bacteria 3623
354 Ga0307508_10055097 3300031616 Bacteria 3523
355 Ga0307514_10037737 3300031649 Bacteria 3827
356 Ga0307514_10070308 3300031649 Bacteria 2629
357 Ga0265314_10029466 3300031711 Bacteria 4079
358 Ga0265342_10065193 3300031712 Bacteria 2135
359 Ga0307516_10014197 3300031730 Bacteria 8438
360 Ga0307405_10033749 3300031731 Bacteria 3039
361 Ga0307518_10056055 3300031838 Bacteria 2863
362 Ga0307410_10059722 3300031852 Bacteria 2604
363 Ga0307407_10200845 3300031903 Bacteria 1336
364 Ga0307409_100013759 3300031995 Bacteria 5227
365 Ga0307409_100145715 3300031995 Bacteria 2048
366 Ga0307409_100268444 3300031995 Bacteria 1570
367 Ga0307416_100077246 3300032002 Bacteria 2796
368 Ga0307416_100200071 3300032002 Bacteria 1895
369 Ga0307414_10239282 3300032004 Bacteria 1502
370 Ga0307415_100074593 3300032126 Bacteria 2398
371 Ga0307415_100204657 3300032126 Bacteria 1569
372 Ga0307510_10096719 3300033180 Bacteria 2766
373 Ga0373953_0004923 3300035117 Bacteria 4295
374 Ga0373954_0018234 3300035118 Bacteria 3157
375 Ga0373956_0063556 3300035119 Bacteria 1674
376 Ga0373957_0014754 3300035120 Bacteria 2676
377 Ga0373960_0066121 3300035121 Bacteria 1107
378 Ga0373924_0049670 3300035410 Bacteria 1736
379 Ga0373931_0004176 3300035691 Bacteria 6568
380 Ga0373933_0140324 3300035724 Bacteria 1525
381 Ga0316582_0062309 3300036647 Bacteria 2394
382 Ga0316584_0104569 3300036712 Bacteria 2119
383 Ga0316584_0106033 3300036712 Bacteria 2103
384 Ga0395899_0000016 3300037312 Bacteria 468322
385 Ga0395899_0000197 3300037312 Bacteria 88596
386 Ga0395899_0032059 3300037312 Bacteria 3947
387 Ga0395899_0034053 3300037312 Bacteria 3824
388 Ga0395899_0227247 3300037312 Bacteria 1290
389 Ga0395900_0000006 3300037418 Bacteria 495364
390 Ga0395900_0093038 3300037418 Bacteria 3097
391 Ga0395898_0020812 3300037466 Bacteria 6658
392 Ga0395898_0174874 3300037466 Bacteria 2052
393 Ga0395905_0004212 3300037471 Bacteria 15041
394 Ga0395905_0018788 3300037471 Bacteria 6557
395 Ga0395905_0030180 3300037471 Bacteria 5110
396 Ga0395905_0073489 3300037471 Bacteria 3205
397 Ga0395905_0123707 3300037471 Bacteria 2432
398 Ga0395905_0279365 3300037471 Bacteria 1556
399 Ga0436364_1558329 3300037853 Bacteria 8309
400 Ga0395901_0000001 3300038443 Bacteria 800383
401 Ga0395901_0000683 3300038443 Bacteria 38895
402 Ga0395901_0165847 3300038443 Bacteria 2319
403 Ga0395901_0356948 3300038443 Bacteria 1508
404 Ga0395901_0472259 3300038443 Bacteria 1280
405 Ga0436365_0968347 3300039437 Bacteria 4671
406 Ga0436365_1738300 3300039437 Bacteria 3334
407 Ga0436365_1805460 3300039437 Bacteria 13545
408 Ga0436360_0359615 3300039438 Bacteria 2164
409 Ga0436361_0647556 3300039447 Bacteria 5610
410 Ga0436361_0745464 3300039447 Bacteria 2337
411 Ga0436361_0794720 3300039447 Bacteria 1062
412 Ga0436361_0914477 3300039447 Bacteria 3776
413 Ga0436363_0338474 3300039450 Bacteria 1477
414 Ga0436363_0394091 3300039450 Bacteria 1209
415 Ga0436363_0614601 3300039450 Bacteria 3836
416 Ga0436363_1644309 3300039450 Bacteria 3908
417 Ga0439436_0001143 3300041404 Bacteria 7528
418 Ga0439447_023052 3300041407 Bacteria 1625
419 Ga0439465_0003975 3300041413 Bacteria 4822
420 Ga0451851_0679826 3300041507 Bacteria 1162
421 Ga0439448_0007409 3300042005 Bacteria 3181
422 Ga0439449_0001376 3300042007 Bacteria 9507
423 Ga0439449_0071515 3300042007 Bacteria 1278
424 Ga0439455_0006090 3300042012 Bacteria 2485
425 Ga0439457_000207 3300042014 Bacteria 15627
426 Ga0450903_000278 3300042138 Bacteria 11255
427 Ga0450901_008779 3300042533 Bacteria 1043
428 Ga0466969_0016382 3300044656 Bacteria 3877
429 Ga0466961_0013455 3300044693 Bacteria 5241
430 Ga0466961_0027628 3300044693 Bacteria 3650
431 Ga0466961_0051398 3300044693 Bacteria 2632
432 Ga0466963_0052875 3300044694 Bacteria 2696
433 Ga0466964_0019589 3300044706 Bacteria 2602
434 Ga0466964_0039741 3300044706 Bacteria 1897
435 Ga0466968_0004993 3300044735 Bacteria 4970
436 Ga0466970_0006844 3300044765 Bacteria 5707
437 Ga0466970_0079792 3300044765 Bacteria 1767
438 Ga0466957_0040230 3300044842 Bacteria 2823
439 Ga0466960_0059672 3300044901 Bacteria 1867
440 Ga0466959_0003297 3300045049 Bacteria 10531
441 Ga0466958_0010420 3300045836 Bacteria 5206
442 Ga0466958_0151544 3300045836 Bacteria 1463
443 Ga0466967_0040191 3300045976 Bacteria 4026
444 Ga0466967_0053848 3300045976 Bacteria 3538
445 Ga0495617_017169 3300046452 Bacteria 2443
446 Ga0495627_002901 3300046453 Bacteria 7891
447 Ga0495627_020006 3300046453 Bacteria 2236
448 Ga0495592_0000576 3300046454 Bacteria 26018
449 Ga0495592_0036867 3300046454 Bacteria 3681
450 Ga0495603_0029320 3300046455 Bacteria 3318
451 Ga0495590_0000056 3300046457 Bacteria 96913
452 Ga0495590_0000181 3300046457 Bacteria 36847
453 Ga0495590_0005479 3300046457 Bacteria 5031
454 Ga0495629_0024815 3300046459 Bacteria 4266
455 Ga0495629_0037690 3300046459 Bacteria 3407
456 Ga0495629_0051449 3300046459 Bacteria 2883
457 Ga0495638_0000170 3300046460 Bacteria 101629
458 Ga0495638_0070621 3300046460 Bacteria 2138
459 Ga0495638_0108248 3300046460 Bacteria 1653
460 Ga0495651_0001088 3300046462 Bacteria 20919
461 Ga0495651_0146244 3300046462 Bacteria 1708
462 Ga0495653_0014171 3300046463 Bacteria 6499
463 Ga0495653_0023047 3300046463 Bacteria 5035
464 Ga0495653_0044531 3300046463 Bacteria 3444
465 Ga0495653_0058615 3300046463 Bacteria 2926
466 Ga0495650_0001692 3300046471 Bacteria 20320
467 Ga0495580_0017736 3300046472 Bacteria 5314
468 Ga0495582_0003999 3300046473 Bacteria 8278
469 Ga0495582_0183515 3300046473 Bacteria 1192
470 Ga0495605_0013096 3300046474 Bacteria 4582
471 Ga0495605_0020407 3300046474 Bacteria 3521
472 Ga0495605_0024308 3300046474 Bacteria 3172
473 Ga0495605_0031139 3300046474 Bacteria 2727
474 Ga0495605_0040953 3300046474 Bacteria 2309
475 Ga0495639_0027004 3300046475 Bacteria 2540
476 Ga0495662_0002860 3300046476 Bacteria 8730
477 Ga0495662_0003653 3300046476 Bacteria 7757
478 Ga0495662_0098107 3300046476 Bacteria 1433
479 Ga0495664_0003663 3300046477 Bacteria 8372
480 Ga0495664_0030585 3300046477 Bacteria 3154
481 Ga0495584_0000781 3300046491 Bacteria 20991
482 Ga0495584_0004084 3300046491 Bacteria 7881
483 Ga0495584_0012951 3300046491 Bacteria 4257
484 Ga0495584_0018413 3300046491 Bacteria 3549
485 Ga0495584_0018992 3300046491 Bacteria 3492
486 Ga0495584_0028938 3300046491 Bacteria 2808
487 Ga0495584_0055763 3300046491 Bacteria 1988
488 Ga0495585_0001585 3300046492 Bacteria 17617
489 Ga0495585_0003957 3300046492 Bacteria 9781
490 Ga0495585_0007730 3300046492 Bacteria 6552
491 Ga0495585_0073955 3300046492 Bacteria 1854
492 Ga0495594_0005242 3300046499 Bacteria 6664
493 Ga0495594_0057786 3300046499 Bacteria 2142
494 Ga0495594_0088101 3300046499 Bacteria 1737
495 Ga0495596_0005730 3300046500 Bacteria 5831
496 Ga0495596_0005838 3300046500 Bacteria 5759
497 Ga0495596_0009329 3300046500 Bacteria 4318
498 Ga0495596_0011210 3300046500 Bacteria 3873
499 Ga0495596_0021074 3300046500 Bacteria 2662
500 Ga0495596_0063786 3300046500 Bacteria 1433
501 Ga0495607_0000876 3300046501 Bacteria 28090
502 Ga0495607_0008486 3300046501 Bacteria 7020
503 Ga0495607_0023261 3300046501 Bacteria 3879
504 Ga0495607_0024504 3300046501 Bacteria 3761
505 Ga0495607_0031397 3300046501 Bacteria 3252
506 Ga0495607_0047494 3300046501 Bacteria 2515
507 Ga0495607_0055921 3300046501 Bacteria 2267
508 Ga0495583_0000417 3300046506 Bacteria 64786
509 Ga0495583_0000679 3300046506 Bacteria 44179
510 Ga0495583_0001028 3300046506 Bacteria 31717
511 Ga0495583_0015368 3300046506 Bacteria 4166
512 Ga0495583_0022229 3300046506 Bacteria 3242
513 Ga0495606_0000149 3300046507 Bacteria 120165
514 Ga0495608_0019764 3300046511 Bacteria 4632
515 Ga0495610_0014805 3300046512 Bacteria 4564
516 Ga0495616_0011077 3300046513 Bacteria 5182
517 Ga0495616_0012884 3300046513 Bacteria 4729
518 Ga0495616_0015409 3300046513 Bacteria 4252
519 Ga0495616_0088451 3300046513 Bacteria 1470
520 Ga0495616_0090757 3300046513 Bacteria 1446
521 Ga0495618_0012897 3300046514 Bacteria 5080
522 Ga0495618_0159371 3300046514 Bacteria 1439
523 Ga0495628_0010616 3300046516 Bacteria 7812
524 Ga0495628_0031356 3300046516 Bacteria 4300
525 Ga0495628_0195200 3300046516 Bacteria 1527
526 Ga0495630_0012548 3300046517 Bacteria 6156
527 Ga0495630_0111574 3300046517 Bacteria 2071
528 Ga0495631_0009289 3300046518 Bacteria 4916
529 Ga0495631_0012663 3300046518 Bacteria 4112
530 Ga0495631_0110644 3300046518 Bacteria 1181
531 Ga0495632_0000253 3300046519 Bacteria 53145
532 Ga0495632_0000311 3300046519 Bacteria 47116
533 Ga0495632_0000365 3300046519 Bacteria 43021
534 Ga0495632_0030056 3300046519 Bacteria 2823
535 Ga0495637_0024388 3300046520 Bacteria 2737
536 Ga0495643_0000302 3300046522 Bacteria 68932
537 Ga0495643_0000729 3300046522 Bacteria 37503
538 Ga0495643_0026408 3300046522 Bacteria 3277
539 Ga0495644_0005947 3300046523 Bacteria 4757
540 Ga0495644_0006899 3300046523 Bacteria 4397
541 Ga0495644_0010053 3300046523 Bacteria 3645
542 Ga0495648_0000119 3300046524 Bacteria 95682
543 Ga0495648_0011121 3300046524 Bacteria 6809
544 Ga0495648_0030554 3300046524 Bacteria 3560
545 Ga0495648_0104808 3300046524 Bacteria 1552
546 Ga0495666_0001696 3300046526 Bacteria 10883
547 Ga0495666_0003516 3300046526 Bacteria 7907
548 Ga0495642_0001135 3300046528 Bacteria 12239
549 Ga0495642_0025039 3300046528 Bacteria 2363
550 Ga0495642_0036493 3300046528 Bacteria 1986
551 Ga0495652_0001055 3300046529 Bacteria 31311
552 Ga0495652_0017628 3300046529 Bacteria 6371
553 Ga0495652_0071737 3300046529 Bacteria 2889
554 Ga0495654_0005778 3300046530 Bacteria 7130
555 Ga0495665_0005387 3300046531 Bacteria 6894
556 Ga0495640_0004953 3300046533 Bacteria 10586
557 Ga0495640_0033080 3300046533 Bacteria 3676
558 Ga0495586_0001960 3300046535 Bacteria 11233
559 Ga0495586_0004758 3300046535 Bacteria 7260
560 Ga0495586_0026453 3300046535 Bacteria 3104
561 Ga0495587_0001673 3300046536 Bacteria 14794
562 Ga0495609_0001674 3300046538 Bacteria 14400
563 Ga0495609_0038896 3300046538 Bacteria 2143
564 Ga0495597_0000123 3300046542 Bacteria 70236
565 Ga0495597_0000127 3300046542 Bacteria 69108
566 Ga0495597_0000439 3300046542 Bacteria 35464
567 Ga0495597_0002383 3300046542 Bacteria 11993
568 Ga0495597_0003217 3300046542 Bacteria 9714
569 Ga0495597_0004061 3300046542 Bacteria 8189
570 Ga0495645_0046359 3300046543 Bacteria 3168
571 Ga0495622_0000480 3300046557 Bacteria 25158
572 Ga0495622_0023694 3300046557 Bacteria 2863
573 Ga0495622_0059605 3300046557 Bacteria 1767
574 Ga0495622_0121009 3300046557 Bacteria 1195
575 Ga0495633_0000088 3300046558 Bacteria 124193
576 Ga0495633_0003948 3300046558 Bacteria 9651
577 Ga0495633_0004308 3300046558 Bacteria 9087
578 Ga0495633_0004365 3300046558 Bacteria 9026
579 Ga0495667_0022019 3300046559 Bacteria 4297
580 Ga0495668_0000460 3300046616 Bacteria 52158
581 Ga0495668_0001529 3300046616 Bacteria 21962
582 Ga0495668_0025601 3300046616 Bacteria 3351
583 Ga0495668_0025818 3300046616 Bacteria 3336
584 Ga0495668_0052708 3300046616 Bacteria 2250
585 Ga0495668_0076011 3300046616 Bacteria 1844
586 Ga0495668_0090919 3300046616 Bacteria 1672
587 Ga0495668_0110950 3300046616 Bacteria 1500
588 Ga0495668_0140030 3300046616 Bacteria 1324
589 Ga0495634_0001729 3300046642 Bacteria 18914
590 Ga0495634_0003826 3300046642 Bacteria 11953
591 Ga0495634_0029265 3300046642 Bacteria 3814
592 Ga0495634_0076175 3300046642 Bacteria 2202
593 Ga0495611_0000793 3300046648 Bacteria 17555
594 Ga0495611_0015713 3300046648 Bacteria 3234
595 Ga0495611_0055740 3300046648 Bacteria 1788
596 Ga0495625_0002200 3300046660 Bacteria 21593
597 Ga0495625_0002701 3300046660 Bacteria 18852
598 Ga0495625_0084561 3300046660 Bacteria 2203
599 Ga0495635_0024224 3300046663 Bacteria 4231
600 Ga0495635_0039975 3300046663 Bacteria 3242
601 Ga0495661_0000923 3300046665 Bacteria 26835
602 Ga0495661_0001513 3300046665 Bacteria 19348
603 Ga0495661_0010130 3300046665 Bacteria 6442
604 Ga0495661_0125823 3300046665 Bacteria 1410
605 Ga0495661_0181494 3300046665 Bacteria 1115
606 Ga0495588_0082701 3300046674 Bacteria 1677
607 Ga0495657_0010913 3300046675 Bacteria 6815
608 Ga0495657_0100431 3300046675 Bacteria 1844
609 Ga0495657_0173736 3300046675 Bacteria 1325
610 Ga0495599_0008650 3300046678 Bacteria 6195
611 Ga0495599_0105256 3300046678 Bacteria 1758
612 Ga0495623_0028591 3300046679 Bacteria 3586
613 Ga0495646_0005821 3300046680 Bacteria 7817
614 Ga0495646_0096780 3300046680 Bacteria 1697
615 Ga0495669_0000479 3300046684 Bacteria 18564
616 Ga0495669_0004096 3300046684 Bacteria 5996
617 Ga0495613_0001087 3300046689 Bacteria 20759
618 Ga0495613_0002547 3300046689 Bacteria 13719
619 Ga0495613_0006343 3300046689 Bacteria 8846
620 Ga0495613_0014884 3300046689 Bacteria 5774
621 Ga0495613_0018858 3300046689 Bacteria 5140
622 Ga0495613_0036156 3300046689 Bacteria 3662
623 Ga0495670_0000229 3300046691 Bacteria 25517
624 Ga0495670_0013404 3300046691 Bacteria 4033
625 Ga0495670_0014792 3300046691 Bacteria 3841
626 Ga0495649_0001723 3300046694 Bacteria 16178
627 Ga0495649_0028444 3300046694 Bacteria 3098
628 Ga0495649_0127220 3300046694 Bacteria 1345
629 Ga0495589_0000610 3300046794 Bacteria 24076
630 Ga0495589_0005398 3300046794 Bacteria 6744
631 Ga0495589_0014904 3300046794 Bacteria 4000
632 Ga0495589_0015410 3300046794 Bacteria 3935
633 Ga0495589_0043427 3300046794 Bacteria 2237
634 Ga0495600_0027751 3300046809 Bacteria 3659
635 Ga0495660_0002813 3300046810 Bacteria 10948
636 Ga0495660_0008510 3300046810 Bacteria 6007
637 Ga0495581_0013715 3300047315 Bacteria 4699
638 Ga0495581_0015281 3300047315 Bacteria 4456
639 Ga0495581_0116140 3300047315 Bacteria 1556
640 Ga0495604_0002334 3300047317 Bacteria 15210
641 Ga0495604_0009084 3300047317 Bacteria 7864
642 Ga0495604_0023674 3300047317 Bacteria 4901
643 Ga0495604_0029760 3300047317 Bacteria 4343
644 Ga0495604_0039198 3300047317 Bacteria 3724
645 Ga0495604_0061766 3300047317 Bacteria 2864
646 Ga0495636_0008434 3300047318 Bacteria 4066
647 Ga0495636_0043068 3300047318 Bacteria 1877
648 Ga0495636_0070873 3300047318 Bacteria 1487
649 Ga0495674_0002692 3300047319 Bacteria 17298
650 Ga0495674_0023200 3300047319 Bacteria 5720
651 Ga0495672_0001319 3300047320 Bacteria 24677
652 Ga0495672_0001582 3300047320 Bacteria 22235
653 Ga0495672_0020626 3300047320 Bacteria 4312
654 Ga0495672_0025826 3300047320 Bacteria 3755
655 Ga0495676_0000031 3300047321 Bacteria 132364
656 Ga0495676_0000862 3300047321 Bacteria 25339
657 Ga0495676_0005345 3300047321 Bacteria 11760
658 Ga0495680_0019816 3300047322 Bacteria 5672
659 Ga0495683_0005694 3300047323 Bacteria 6883
660 Ga0495683_0018019 3300047323 Bacteria 3655
661 Ga0495683_0029973 3300047323 Bacteria 2778
662 Ga0495683_0043978 3300047323 Bacteria 2246
663 Ga0495687_001468 3300047443 Bacteria 21616
664 Ga0495687_005116 3300047443 Bacteria 8494
665 Ga0495675_0002328 3300047444 Bacteria 11351
666 Ga0495675_0010257 3300047444 Bacteria 5849
667 Ga0495675_0023769 3300047444 Bacteria 3905
668 Ga0495675_0033535 3300047444 Bacteria 3277
669 Ga0495675_0071558 3300047444 Bacteria 2188
670 Ga0495675_0119798 3300047444 Bacteria 1639
671 Ga0495677_0006349 3300047445 Bacteria 4463
672 Ga0495677_0008672 3300047445 Bacteria 3773
673 Ga0495679_009108 3300047446 Bacteria 3997
674 Ga0495685_079380 3300047447 Bacteria 1094
675 Ga0495673_0000223 3300047469 Bacteria 84150
676 Ga0495681_0000939 3300047470 Bacteria 22463
677 Ga0495681_0018579 3300047470 Bacteria 3827
678 Ga0495681_0019049 3300047470 Bacteria 3759
679 Ga0495681_0040434 3300047470 Bacteria 2270
680 Ga0495684_0064158 3300047471 Bacteria 2791
681 Ga0495684_0067687 3300047471 Bacteria 2716
682 Ga0495684_0311681 3300047471 Bacteria 1128
683 Ga0495686_0000021 3300047472 Bacteria 426560
684 Ga0495686_0002134 3300047472 Bacteria 19329
685 Ga0495686_0008657 3300047472 Bacteria 7432
686 Ga0495686_0013091 3300047472 Bacteria 5775
687 Ga0495686_0050582 3300047472 Bacteria 2611
688 Ga0495593_0004669 3300047673 Bacteria 8148
689 Ga0495593_0007232 3300047673 Bacteria 6507
690 Ga0495593_0024924 3300047673 Bacteria 3310
691 Ga0495593_0028589 3300047673 Bacteria 3062
692 Ga0495593_0060351 3300047673 Bacteria 1986
693 Ga0495602_0016473 3300048088 Bacteria 7433
694 Ga0495602_0028276 3300048088 Bacteria 5368
695 Ga0495602_0031172 3300048088 Bacteria 5045
696 Ga0495602_0086198 3300048088 Bacteria 2622
697 Ga0495614_0005393 3300048089 Bacteria 5769
698 Ga0495614_0011401 3300048089 Bacteria 3912
699 Ga0495626_0000005 3300048091 Bacteria 337534
700 Ga0495626_0015821 3300048091 Bacteria 3851
701 Ga0495626_0019890 3300048091 Bacteria 3350
702 Ga0495626_0024308 3300048091 Bacteria 2971
703 Ga0495626_0035489 3300048091 Bacteria 2380
704 Ga0495626_0040297 3300048091 Bacteria 2207
705 Ga0495626_0043398 3300048091 Bacteria 2109
706 Ga0495626_0050528 3300048091 Bacteria 1920
707 Ga0495626_0071295 3300048091 Bacteria 1562
708 Ga0496100_0011314 3300048903 Bacteria 5076
709 Ga0496100_0385481 3300048903 Bacteria 1065
710 Ga0496101_0005155 3300048904 Bacteria 8311
711 Ga0496102_0044010 3300048905 Bacteria 4049
712 Ga0496102_0093031 3300048905 Bacteria 2793
713 Ga0496102_0179800 3300048905 Bacteria 1993
714 Ga0496103_0042347 3300048906 Bacteria 2801
715 Ga0496105_0023140 3300048908 Bacteria 5038
716 Ga0496105_0102242 3300048908 Bacteria 2366
717 Ga0496106_0041301 3300048909 Bacteria 3455
718 Ga0496106_0141499 3300048909 Bacteria 1893
719 Ga0496107_0017244 3300048910 Bacteria 5078
720 Ga0496107_0050519 3300048910 Bacteria 2997
721 Ga0496108_0010303 3300048911 Bacteria 7589
722 Ga0496108_0185860 3300048911 Bacteria 1800
723 Ga0496109_0037831 3300048912 Bacteria 4361
724 Ga0496109_0326562 3300048912 Bacteria 1448
725 Ga0496109_0377124 3300048912 Bacteria 1340
726 Ga0496109_0559946 3300048912 Bacteria 1078
727 Ga0496110_0014313 3300048913 Bacteria 6582
728 Ga0496110_0035014 3300048913 Bacteria 4353
729 Ga0496110_0049348 3300048913 Bacteria 3692
730 Ga0496111_0001836 3300048914 Bacteria 12505
731 Ga0496111_0085602 3300048914 Bacteria 2305
732 Ga0496112_0001267 3300048915 Bacteria 19165
733 Ga0496112_0016434 3300048915 Bacteria 6933
734 Ga0496112_0016818 3300048915 Bacteria 6861
735 Ga0496112_0260013 3300048915 Bacteria 1685
736 Ga0496114_0045732 3300048917 Bacteria 3637
737 Ga0496115_0002726 3300048918 Bacteria 12689
738 Ga0496115_0020967 3300048918 Bacteria 5042
739 Ga0496115_0046019 3300048918 Bacteria 3485
740 Ga0496115_0064859 3300048918 Bacteria 2949
741 Ga0496117_0094846 3300048920 Bacteria 1908
742 Ga0496122_0000142 3300048925 Bacteria 168391
743 Ga0496122_0089925 3300048925 Bacteria 2097
744 Ga0496122_0155793 3300048925 Bacteria 1402
745 Ga0496123_0000148 3300048926 Bacteria 143265
746 Ga0496123_0027358 3300048926 Bacteria 4249
747 Ga0496124_0000046 3300048927 Bacteria 287043
748 Ga0496124_0381154 3300048927 Bacteria 986
749 Ga0496125_0022904 3300048928 Bacteria 5786
750 Ga0496126_0000050 3300048929 Bacteria 316466
751 Ga0495678_000256 3300049459 Bacteria 59602
752 Ga0495678_000524 3300049459 Bacteria 37449
753 Ga0495678_000732 3300049459 Bacteria 29802
754 Ga0495678_004011 3300049459 Bacteria 8782
755 Ga0495678_016975 3300049459 Bacteria 3310
756 Ga0495682_0000308 3300049460 Bacteria 36905
757 Ga0501032_0057205 3300049569 Bacteria 2620
758 Ga0501032_0090200 3300049569 Bacteria 2034
759 Ga0501033_0086063 3300049570 Bacteria 2301
760 Ga0501033_0209419 3300049570 Bacteria 1391
761 Ga0501034_0131914 3300049571 Bacteria 2481
762 Ga0501034_0178180 3300049571 Bacteria 2091
763 Ga0501034_0280811 3300049571 Bacteria 1604
764 Ga0501034_0393725 3300049571 Bacteria 1309
765 Ga0501034_0464770 3300049571 Bacteria 1182
766 Ga0501036_0013938 3300049572 Bacteria 6685
767 Ga0501036_0092149 3300049572 Bacteria 2560
768 Ga0501037_0156139 3300049573 Bacteria 1628
769 Ga0501038_0017722 3300049574 Bacteria 6436
770 Ga0501038_0060781 3300049574 Bacteria 3233
771 Ga0501038_0264471 3300049574 Bacteria 1358
772 Ga0501039_0059260 3300049575 Bacteria 2966
773 Ga0501039_0095671 3300049575 Bacteria 2315
774 Ga0501039_0110515 3300049575 Bacteria 2149
775 Ga0501042_0032063 3300049578 Bacteria 3719
776 Ga0501042_0337865 3300049578 Bacteria 1089
777 Ga0501043_0020490 3300049579 Bacteria 5188
778 Ga0501043_0051843 3300049579 Bacteria 3224
779 Ga0501043_0054164 3300049579 Bacteria 3150
780 Ga0501043_0095690 3300049579 Bacteria 2334
781 Ga0501043_0259348 3300049579 Bacteria 1337
782 Ga0501046_0071329 3300049580 Bacteria 2699
783 Ga0501046_0150064 3300049580 Bacteria 1759
784 Ga0501046_0195387 3300049580 Bacteria 1507
785 Ga0501047_0058832 3300049581 Bacteria 3712
786 Ga0501047_0061667 3300049581 Bacteria 3618
787 Ga0501047_0070748 3300049581 Bacteria 3359
788 Ga0501047_0242493 3300049581 Bacteria 1652
789 Ga0501047_0275166 3300049581 Bacteria 1529
790 Ga0501048_0100173 3300049582 Bacteria 2044
791 Ga0501048_0319774 3300049582 Bacteria 1105
792 Ga0501070_0045431 3300049586 Bacteria 3653
793 Ga0501070_0046624 3300049586 Bacteria 3604
794 Ga0501070_0050448 3300049586 Bacteria 3455
795 Ga0501070_0070803 3300049586 Bacteria 2887
796 Ga0501070_0090627 3300049586 Bacteria 2530
797 Ga0501070_0091701 3300049586 Bacteria 2514
798 Ga0501070_0163330 3300049586 Bacteria 1836
799 Ga0501072_0017620 3300049588 Bacteria 5492
800 Ga0501073_0004147 3300049589 Bacteria 10867
801 Ga0501073_0019004 3300049589 Bacteria 4965
802 Ga0501073_0023396 3300049589 Bacteria 4436
803 Ga0501074_0006780 3300049590 Bacteria 8267
804 Ga0501074_0077661 3300049590 Bacteria 2383
805 Ga0501074_0083528 3300049590 Bacteria 2290
806 Ga0501076_0245766 3300049592 Bacteria 1464
807 Ga0501257_014512 3300049686 Bacteria 1813
808 Ga0501079_0375806 3300049741 Bacteria 1114
809 Ga0501080_0029055 3300049742 Bacteria 5146
810 Ga0501080_0046968 3300049742 Bacteria 4019
811 Ga0501080_0064652 3300049742 Bacteria 3403
812 Ga0501080_0069187 3300049742 Bacteria 3283
813 Ga0501080_0111887 3300049742 Bacteria 2531
814 Ga0501080_0247844 3300049742 Bacteria 1624
815 Ga0501080_0551761 3300049742 Bacteria 1026
816 Ga0501081_0034541 3300049743 Bacteria 3441
817 Ga0501083_0000749 3300049744 Bacteria 21218
818 Ga0501083_0020618 3300049744 Bacteria 4584
819 Ga0501083_0052792 3300049744 Bacteria 2730
820 Ga0501083_0141683 3300049744 Bacteria 1574
821 Ga0501083_0149104 3300049744 Bacteria 1531
822 Ga0501269_003107 3300049766 Bacteria 2015
823 Ga0501035_0124124 3300049822 Bacteria 2255
824 Ga0501035_0173768 3300049822 Bacteria 1860
825 Ga0501044_0017691 3300049823 Bacteria 7645
826 Ga0501044_0043682 3300049823 Bacteria 4655
827 Ga0501044_0081620 3300049823 Bacteria 3272
828 Ga0501044_0101410 3300049823 Bacteria 2896
829 Ga0501044_0256423 3300049823 Bacteria 1688
830 Ga0501044_0325707 3300049823 Bacteria 1460
831 Ga0501045_0128594 3300049824 Bacteria 1883
832 Ga0501045_0148648 3300049824 Bacteria 1743
833 nmdc:mga0yw44_282764_c1 3300050492 Bacteria 1109
834 nmdc:mga06z11_21838_c1 3300050494 Bacteria 2980
835 nmdc:mga05p37_321116_c1 3300050507 Bacteria 1833
836 nmdc:mga05p37_96330_c1 3300050507 Bacteria 3645
837 nmdc:mga09592_26300_c1 3300050508 Bacteria 4820
838 nmdc:mga0qj67_86337_c1 3300050509 Bacteria 2517
839 nmdc:mga06r32_35609_c1 3300050510 Bacteria 4697
840 nmdc:mga08y16_339701_c1 3300050511 Bacteria 1544
841 nmdc:mga08y16_456_c1 3300050511 Bacteria 38036
842 nmdc:mga0n895_152409_c1 3300050512 Bacteria 2342
843 nmdc:mga0n895_73236_c1 3300050512 Bacteria 3401
844 nmdc:mga0rr50_21985_c1 3300050513 Bacteria 4368
845 nmdc:mga08x19_209840_c1 3300050514 Bacteria 1337
846 nmdc:mga0a205_20785_c1 3300050515 Bacteria 5619
847 nmdc:mga0a205_227048_c1 3300050515 Bacteria 1752
848 Ga0495655_0027280 3300053083 Bacteria 1353
849 Ga0495655_0028742 3300053083 Bacteria 1331
850 Ga0495595_0094900 3300053084 Bacteria 1434
851 Ga0495619_0037869 3300053085 Bacteria 3145
852 Ga0495619_0203014 3300053085 Bacteria 1372
853 Ga0500578_0073503 3300053086 Bacteria 2178
854 Ga0500643_002974 3300053087 Bacteria 8394
855 Ga0500644_0009720 3300053088 Bacteria 2582
856 Ga0500566_0000273 3300053094 Bacteria 27887
857 Ga0500641_0009865 3300053096 Bacteria 3439
858 Ga0500641_0012929 3300053096 Bacteria 3058
859 Ga0500650_0003353 3300053098 Bacteria 5553
860 Ga0500553_015652 3300053101 Bacteria 3851
861 Ga0500555_012647 3300053103 Bacteria 2430
862 Ga0500556_0094566 3300053104 Bacteria 1145
863 Ga0500595_000050 3300053119 Bacteria 88696
864 Ga0500597_000191 3300053120 Bacteria 12574
865 Ga0500608_004458 3300053122 Bacteria 5428
866 Ga0500608_032876 3300053122 Bacteria 2466
867 Ga0500608_068534 3300053122 Bacteria 1689
868 Ga0500642_0001500 3300053130 Bacteria 6725
869 Ga0500652_000390 3300053131 Bacteria 15731
870 Ga0500652_086027 3300053131 Bacteria 1311
871 Ga0500658_0047555 3300053134 Bacteria 1742
872 Ga0500559_0000106 3300053136 Bacteria 65670
873 Ga0500568_0002649 3300053139 Bacteria 10390
874 Ga0500568_0002674 3300053139 Bacteria 10335
875 Ga0500588_0000462 3300053146 Bacteria 6441
876 Ga0500588_0062086 3300053146 Bacteria 1200
877 Ga0500590_022922 3300053148 Bacteria 3244
878 Ga0500604_0002621 3300053151 Bacteria 4898
879 Ga0500604_0024172 3300053151 Bacteria 1737
880 Ga0500616_0001247 3300053153 Bacteria 25504
881 Ga0500622_0000697 3300053156 Bacteria 29561
882 Ga0500622_0015301 3300053156 Bacteria 4109
883 Ga0500634_0078887 3300053161 Bacteria 1702
884 Ga0500636_0012147 3300053177 Bacteria 5043
885 Ga0500625_072208 3300053729 Bacteria 1532
886 Ga0500645_021809 3300053730 Bacteria 1974
887 Ga0500596_000127 3300053735 Bacteria 11097
888 Ga0500599_013765 3300053736 Bacteria 1097
889 Ga0501084_0250232 3300054114 Bacteria 1496
890 Ga0501084_0291171 3300054114 Bacteria 1379
891 Ga0501082_0046358 3300060353 Bacteria 3747
892 Ga0501082_0100104 3300060353 Bacteria 2507
893 Ga0501082_0152946 3300060353 Bacteria 2004
894 2509107642 2508501122 Bacteria 6292184
895 2509375980 2509276019 Bacteria 6802256
896 2510839595 2510461069 Bacteria 5505000
897 2513719835 2513237104 Bacteria 10034502
898 2513997787 2513237159 Bacteria 6810126
899 2558868253 2558860100 Bacteria 8458965
900 2579858254 2579778521 Bacteria 7624758
901 2585304958 2582581313 Bacteria 10042643
902 2585318881 2582581314 Bacteria 11452267
903 2585395537 2582581866 Bacteria 6859583
904 2599100367 2597490356 Bacteria 7030811
905 2619855430 2619618881 Bacteria 7521104
906 2620354027 2619619003 Bacteria 7619552
907 2644019731 2643221601 Bacteria 7493239
908 2644088757 2643221614 Bacteria 4260023
909 2644166185 2643221629 Bacteria 5850260
910 2644180379 2643221631 Bacteria 8168043
911 2644208884 2643221637 Bacteria 5345260
912 2644269136 2643221647 Bacteria 10741251
913 2644343992 2643221661 Bacteria 4267604
914 2644346810 2643221662 Bacteria 5851492
915 2644368529 2643221666 Bacteria 4265935
916 2644436256 2643221678 Bacteria 9540101
917 2644625873 2643221714 Bacteria 9015452
918 2644652414 2643221718 Bacteria 5345506
919 2676487635 2675903060 Bacteria 10051191
920 2738947905 2738541317 Bacteria 5340176
921 2753036247 2751185725 Bacteria 5740550
922 2753324118 2751185792 Bacteria 5739090
923 2768647398 2767802112 Bacteria 6465194
924 2770198959 2767802442 Bacteria 5747986
925 2776270219 2775506902 Bacteria 6208009
926 2776285054 2775506904 Bacteria 5954060
927 2786669470 2786546132 Bacteria 10419719
928 2792461237 2791355048 Bacteria 5832535
929 2792639545 2791355094 Bacteria 7011481
930 2808841149 2808606359 Bacteria 9866990
931 2808919658 2808606375 Bacteria 9466072
932 2812483263 2811994917 Bacteria 7761064
933 2819739343 2818991472 Bacteria 10089953
934 2821447131 2821443989 Bacteria 7658172
935 2837271229 2837268691 Bacteria 7850704
936 2840765932 2840764183 Bacteria 6358399
937 2842521964 2842521101 Bacteria 6569494
938 2842697673 2842694124 Bacteria 4063419
939 2843745306 2843744320 Bacteria 5659202
940 2844537245 2844533157 Bacteria 7517899
941 2846956405 2846952575 Bacteria 6587527
942 2848862041 2848858292 Bacteria 7391279
943 2849564583 2849560528 Bacteria 5393480
944 2849577694 2849573788 Bacteria 5421256
945 2850081901 2850079185 Bacteria 6848280
946 2851155680 2851153111 Bacteria 5542585
947 2857547099 2857542790 Bacteria 5326616
948 2862288264 2862281513 Bacteria 9621493
949 2862297197 2862290372 Bacteria 7471434
950 2867430126 2867428634 Bacteria 9590268
951 2873318468 2873314349 Bacteria 8512634
952 2877682067 2877676314 Bacteria 9512378
953 2883295599 2883291878 Bacteria 5894118
954 2883358453 2883354860 Bacteria 5865246
955 2893067222 2893066018 Bacteria 6158120
956 2894654983 2894652903 Bacteria 4587256
957 2899360395 2899359706 Bacteria 10940472
958 2899804258 2899803654 Bacteria 5577784
959 2908756360 2908756301 Bacteria 8864324
960 2912721029 2912715099 Bacteria 9460473
961 2913312887 2913308742 Bacteria 5350706
962 2919468552 2919468124 Bacteria 9133025
963 2935782269 2935777560 Bacteria 8077691
964 2946075111 2946072368 Bacteria 8999607
965 2954387193 2954380949 Bacteria 10050426
966 2954675959 2954673503 Bacteria 9685905
967 2954688207 2954682443 Bacteria 9862841
968 2954698029 2954691527 Bacteria 10720516
969 2954704186 2954701450 Bacteria 10834262
970 2954717138 2954711539 Bacteria 10867210
971 2954727106 2954721474 Bacteria 10456478
972 2954734695 2954731030 Bacteria 10243860
973 2954746011 2954740390 Bacteria 10229294
974 2954753582 2954749733 Bacteria 10366972
975 2954764981 2954759201 Bacteria 9358192
976 2989775759 2989771324 Bacteria 5605128
977 3002142490 3002141150 Bacteria 5254435
978 3006489064 3006486233 Bacteria 8157040
979 3006501053 3006493962 Bacteria 8825450
980 8001786643 8001781756 Bacteria 9586736
981 8003835450 8003830390 Bacteria 6541657
982 8016539594 8016530956 Bacteria 8155261
983 8016543890 8016539877 Bacteria 8155419
984 8016557837 8016557553 Bacteria 8154380
985 8016569289 8016566248 Bacteria 8158151
986 8016595856 8016595262 Bacteria 8149947
987 8016606721 8016603502 Bacteria 8731218
988 8016623367 8016622563 Bacteria 7999408
989 8019530874 8019530166 Bacteria 8155624
990 8019540709 8019538911 Bacteria 7872763
991 8019550388 8019547302 Bacteria 7996444
992 8047716355 8047710418 Bacteria 11023148
993 8054559917 8054558443 Bacteria 5204801
994 8056836828 8056829672 Bacteria 9045328
995 nmdc:mga03n38_33851_c1
996 JGI24737J22298_10051184
997 JGI24735J21928_10001861
998 JGI24738J21930_10002057
999 JGI24744J21845_10020508
1000 JGI25151J46595_10003611
1001 JGI25406J46586_10003682
1002 JGI25153J46596_10000059
1003 JGI25153J46596_10000347
1004 JGI25153J46596_10045284
1005 rootH1_10039975
1006 rootL2_10042670
1007 rootL2_10244431
1008 rootH1_10244174
1009 JGI25160J50197_1019999
1010 Ga0006562J51391_1039231
1011 Ga0006562J51391_1097249
1012 Ga0006562J51391_1097250
1013 Ga0055538_1000002
1014 Ga0055539_1000002
1015 Ga0055533_1000004
1016 Ga0055525_1000002
1017 Ga0055524_1003285
1018 Ga0055536_1002443
1019 Ga0055528_1003718
1020 Ga0055530_10000180
1021 Ga0055530_10000371
1022 Ga0055531_10000844
1023 Ga0055531_10020550
1024 Ga0055541_1000002
1025 Ga0065165_1000041
1026 Ga0065704_10001157
1027 Ga0070658_10023456
1028 Ga0070658_10486722
1029 Ga0070676_10005433
1030 Ga0070683_100044156
1031 Ga0070683_100543434
1032 Ga0070690_100000353
1033 Ga0070670_100022096
1034 Ga0070680_100040786
1035 Ga0070682_100002246
1036 Ga0068868_100016065
1037 Ga0070660_100001656
1038 Ga0070689_100001225
1039 Ga0070691_10000400
1040 Ga0070687_100000797
1041 Ga0070687_100033026
1042 Ga0070661_100000384
1043 Ga0070661_100036544
1044 Ga0070692_10005510
1045 Ga0070668_100000244
1046 Ga0070669_100005644
1047 Ga0070675_100010071
1048 Ga0070671_100015311
1049 Ga0070671_100148165
1050 Ga0070671_100156542
1051 Ga0070671_100355568
1052 Ga0070674_100004514
1053 Ga0070674_100058420
1054 Ga0070674_100151898
1055 Ga0070673_100001304
1056 Ga0070673_100043152
1057 Ga0070659_100001838
1058 Ga0070667_100000032
1059 Ga0070667_100038589
1060 Ga0070703_10074344
1061 Ga0070709_10002721
1062 Ga0070714_100011159
1063 Ga0070714_100034133
1064 Ga0070713_100014713
1065 Ga0070713_100177568
1066 Ga0070710_10000631
1067 Ga0070701_10000411
1068 Ga0070711_100012991
1069 Ga0070705_100003021
1070 Ga0070700_100006086
1071 Ga0070694_100009526
1072 Ga0070708_100001636
1073 Ga0070663_100000213
1074 Ga0070663_100002295
1075 Ga0070663_100114797
1076 Ga0070678_100001330
1077 Ga0070678_100067356
1078 Ga0070662_100001264
1079 Ga0070681_10087479
1080 Ga0068867_100009543
1081 Ga0070706_100078965
1082 Ga0070699_100108834
1083 Ga0070684_100006348
1084 Ga0070697_100000600
1085 Ga0070697_100018903
1086 Ga0068853_100002094
1087 Ga0068853_100003586
1088 Ga0070672_100000593
1089 Ga0070686_100008356
1090 Ga0070695_100019548
1091 Ga0070696_100009212
1092 Ga0070693_100002402
1093 Ga0070665_100010157
1094 Ga0070665_100193817
1095 Ga0070665_100279887
1096 Ga0070704_100001660
1097 Ga0068855_100000893
1098 Ga0070664_100001131
1099 Ga0068857_100004274
1100 Ga0068854_100004366
1101 Ga0068856_100002475
1102 Ga0068856_100070159
1103 Ga0070702_100002170
1104 Ga0068852_100001835
1105 Ga0068859_100039295
1106 Ga0068864_100009139
1107 Ga0068866_10000716
1108 Ga0068861_100002260
1109 Ga0068861_100011313
1110 Ga0068851_10110910
1111 Ga0068870_10027496
1112 Ga0068863_100006545
1113 Ga0068863_100052519
1114 Ga0068858_100002708
1115 Ga0068860_100001510
1116 Ga0068862_100001549
1117 Ga0068862_100037119
1118 Ga0068862_100055189
1119 Ga0081455_10160346
1120 Ga0081538_10009878
1121 Ga0081540_1063568
1122 Ga0081539_10000260
1123 Ga0081539_10002379
1124 Ga0081539_10004993
1125 Ga0075365_10020608
1126 Ga0075365_10027832
1127 Ga0075365_10090639
1128 Ga0075368_10007337
1129 Ga0075368_10017684
1130 Ga0075363_100044516
1131 Ga0075364_10060179
1132 Ga0075364_10273090
1133 Ga0070715_10001549
1134 Ga0070716_100003352
1135 Ga0070712_100010677
1136 Ga0075367_10203416
1137 Ga0097621_100140530
1138 Ga0075370_10144723
1139 Ga0068871_100029996
1140 Ga0075428_100060512
1141 Ga0075430_100255262
1142 Ga0075431_100211576
1143 Ga0075433_10016953
1144 Ga0075433_10043589
1145 Ga0075429_100019359
1146 Ga0068865_100000336
1147 Ga0075436_100034897
1148 Ga0097620_100039295
1149 Ga0099826_10058826
1150 Ga0075435_100029485
1151 Ga0075435_100499820
1152 Ga0105244_10063203
1153 Ga0105240_10103548
1154 Ga0105240_10458571
1155 Ga0111539_10155560
1156 Ga0111539_10701496
1157 Ga0105245_10000688
1158 Ga0105245_10154098
1159 Ga0105247_10009820
1160 Ga0105247_10016880
1161 Ga0114129_10058018
1162 Ga0105243_10000473
1163 Ga0105243_10106287
1164 Ga0105241_10002593
1165 Ga0105242_10000217
1166 Ga0105248_10000143
1167 Ga0105248_10000487
1168 Ga0105237_10000638
1169 Ga0105237_10007897
1170 Ga0105238_10000015
1171 Ga0105238_10008427
1172 Ga0105238_10219096
1173 Ga0105249_10000211
1174 Ga0105249_10001143
1175 Ga0105249_10152251
1176 Ga0099796_10003661
1177 Ga0105239_10004376
1178 Ga0105239_10531243
1179 Ga0105239_10576996
1180 Ga0105246_10000451
1181 Ga0157373_10027812
1182 Ga0157369_10001385
1183 Ga0157369_10134064
1184 Ga0157374_10001745
1185 Ga0157374_10004977
1186 Ga0157374_10027795
1187 Ga0157378_10001026
1188 Ga0163162_10000935
1189 Ga0163162_10037798
1190 Ga0163162_10063999
1191 Ga0157372_10003142
1192 Ga0157375_10012343
1193 Ga0157375_10042148
1194 Ga0163163_10040262
1195 Ga0163163_10098993
1196 Ga0157380_10001124
1197 Ga0157380_10045986
1198 Ga0157377_10000791
1199 Ga0157379_10006054
1200 Ga0157376_10000510
1201 Ga0183367_1009
1202 Ga0163161_10025207
1203 Ga0163161_10068801
1204 Ga0163161_10268631
1205 Ga0206353_10718303
1206 Ga0214542_1018224
1207 Ga0214543_1000134
1208 Ga0213872_10100302
1209 Ga0213872_10110791
1210 Ga0213874_10046082
1211 Ga0213876_10009202
1212 Ga0209784_100002
1213 Ga0209566_100003
1214 Ga0209674_100004
1215 Ga0209563_100006
1216 Ga0209026_1001674
1217 Ga0209677_100003
1218 Ga0209129_1000689
1219 Ga0209673_1000010
1220 Ga0209673_1040467
1221 Ga0209130_1000399
1222 Ga0209676_1000547
1223 Ga0209025_1001742
1224 Ga0209025_1024299
1225 Ga0209564_1007507
1226 Ga0209758_1000095
1227 Ga0209758_1030482
1228 Ga0209050_1000034
1229 Ga0209050_1004401
1230 Ga0209050_1014984
1231 Ga0209256_1001682
1232 Ga0209256_1009580
1233 Ga0207426_1000046
1234 Ga0209051_1015616
1235 Ga0209051_1024871
1236 Ga0209257_1000052
1237 Ga0209257_1000477
1238 Ga0209257_1004227
1239 Ga0209257_1019432
1240 Ga0207656_10078840
1241 Ga0207710_10006089
1242 Ga0207680_10006249
1243 Ga0207647_10003873
1244 Ga0207647_10043088
1245 Ga0207699_10010704
1246 Ga0207645_10001040
1247 Ga0207643_10009053
1248 Ga0207705_10018281
1249 Ga0207684_10174360
1250 Ga0207707_10054439
1251 Ga0207695_10188223
1252 Ga0207695_10236318
1253 Ga0207671_10046382
1254 Ga0207671_10048751
1255 Ga0207693_10000278
1256 Ga0207663_10002954
1257 Ga0207660_10042397
1258 Ga0207662_10005916
1259 Ga0207662_10023054
1260 Ga0207657_10000047
1261 Ga0207681_10006557
1262 Ga0207681_10153398
1263 Ga0207694_10000017
1264 Ga0207694_10036175
1265 Ga0207664_10015644
1266 Ga0207644_10034679
1267 Ga0207644_10204472
1268 Ga0207706_10000079
1269 Ga0207686_10016824
1270 Ga0207709_10023947
1271 Ga0207669_10009273
1272 Ga0207669_10079995
1273 Ga0207704_10016264
1274 Ga0207704_10127593
1275 Ga0207665_10000432
1276 Ga0207691_10007711
1277 Ga0207691_10027134
1278 Ga0207711_10001415
1279 Ga0207711_10051163
1280 Ga0207661_10030887
1281 Ga0207651_10019716
1282 Ga0207712_10004820
1283 Ga0207668_10004345
1284 Ga0207640_10007564
1285 Ga0207658_10000048
1286 Ga0207658_10445490
1287 Ga0207639_10005055
1288 Ga0207678_10000111
1289 Ga0207678_10000877
1290 Ga0207708_10000526
1291 Ga0207702_10075114
1292 Ga0207641_10019105
1293 Ga0207641_10428767
1294 Ga0207648_10011260
1295 Ga0207648_10069754
1296 Ga0207676_10060990
1297 Ga0207674_10001475
1298 Ga0207675_100007188
1299 Ga0207675_100018149
1300 Ga0207683_10000026
1301 Ga0207683_10069410
1302 Ga0209813_10011864
1303 Ga0207428_10000668
1304 Ga0207428_10097474
1305 Ga0268266_10021536
1306 Ga0268266_10073294
1307 Ga0268266_10345624
1308 Ga0268265_10000876
1309 Ga0268265_10001620
1310 Ga0268265_10056529
1311 Ga0268264_10018500
1312 Ga0268264_10070350
1313 Ga0268264_10229146
1314 Ga0265336_10000664
1315 Ga0307517_10131954
1316 Ga0307515_10015071
1317 Ga0307515_10123046
1318 Ga0307515_10324832
1319 Ga0265338_10083232
1320 Ga0307511_10012485
1321 Ga0307512_10010397
1322 Ga0265332_10010400
1323 Ga0265328_10021119
1324 Ga0265328_10029163
1325 Ga0265320_10056299
1326 Ga0265325_10016843
1327 Ga0265340_10000024
1328 Ga0265340_10011864
1329 Ga0265340_10011993
1330 Ga0265340_10015861
1331 Ga0265340_10079455
1332 Ga0265339_10001398
1333 Ga0265316_10010461
1334 Ga0265316_10048376
1335 Ga0265316_10053576
1336 Ga0265316_10115896
1337 Ga0265316_10223758
1338 Ga0307513_10029898
1339 Ga0307513_10058751
1340 Ga0307513_10174035
1341 Ga0307513_10200611
1342 Ga0307513_10343730
1343 Ga0307509_10047478
1344 Ga0307509_10263464
1345 Ga0265313_10009270
1346 Ga0307508_10052441
1347 Ga0307508_10055097
1348 Ga0307514_10037737
1349 Ga0307514_10070308
1350 Ga0265314_10029466
1351 Ga0265342_10065193
1352 Ga0307516_10014197
1353 Ga0307405_10033749
1354 Ga0307518_10056055
1355 Ga0307410_10059722
1356 Ga0307407_10200845
1357 Ga0307409_100013759
1358 Ga0307409_100145715
1359 Ga0307409_100268444
1360 Ga0307416_100077246
1361 Ga0307416_100200071
1362 Ga0307414_10239282
1363 Ga0307415_100074593
1364 Ga0307415_100204657
1365 Ga0307510_10096719
1366 Ga0373953_0004923
1367 Ga0373954_0018234
1368 Ga0373956_0063556
1369 Ga0373957_0014754
1370 Ga0373960_0066121
1371 Ga0373924_0049670
1372 Ga0373931_0004176
1373 Ga0373933_0140324
1374 Ga0316582_0062309
1375 Ga0316584_0104569
1376 Ga0316584_0106033
1377 Ga0395899_0000016
1378 Ga0395899_0000197
1379 Ga0395899_0032059
1380 Ga0395899_0034053
1381 Ga0395899_0227247
1382 Ga0395900_0000006
1383 Ga0395900_0093038
1384 Ga0395898_0020812
1385 Ga0395898_0174874
1386 Ga0395905_0004212
1387 Ga0395905_0018788
1388 Ga0395905_0030180
1389 Ga0395905_0073489
1390 Ga0395905_0123707
1391 Ga0395905_0279365
1392 Ga0436364_1558329
1393 Ga0395901_0000001
1394 Ga0395901_0000683
1395 Ga0395901_0165847
1396 Ga0395901_0356948
1397 Ga0395901_0472259
1398 Ga0436365_0968347
1399 Ga0436365_1738300
1400 Ga0436365_1805460
1401 Ga0436360_0359615
1402 Ga0436361_0647556
1403 Ga0436361_0745464
1404 Ga0436361_0794720
1405 Ga0436361_0914477
1406 Ga0436363_0338474
1407 Ga0436363_0394091
1408 Ga0436363_0614601
1409 Ga0436363_1644309
1410 Ga0439436_0001143
1411 Ga0439447_023052
1412 Ga0439465_0003975
1413 Ga0451851_0679826
1414 Ga0439448_0007409
1415 Ga0439449_0001376
1416 Ga0439449_0071515
1417 Ga0439455_0006090
1418 Ga0439457_000207
1419 Ga0450903_000278
1420 Ga0450901_008779
1421 Ga0466969_0016382
1422 Ga0466961_0013455
1423 Ga0466961_0027628
1424 Ga0466961_0051398
1425 Ga0466963_0052875
1426 Ga0466964_0019589
1427 Ga0466964_0039741
1428 Ga0466968_0004993
1429 Ga0466970_0006844
1430 Ga0466970_0079792
1431 Ga0466957_0040230
1432 Ga0466960_0059672
1433 Ga0466959_0003297
1434 Ga0466958_0010420
1435 Ga0466958_0151544
1436 Ga0466967_0040191
1437 Ga0466967_0053848
1438 Ga0495617_017169
1439 Ga0495627_002901
1440 Ga0495627_020006
1441 Ga0495592_0000576
1442 Ga0495592_0036867
1443 Ga0495603_0029320
1444 Ga0495590_0000056
1445 Ga0495590_0000181
1446 Ga0495590_0005479
1447 Ga0495629_0024815
1448 Ga0495629_0037690
1449 Ga0495629_0051449
1450 Ga0495638_0000170
1451 Ga0495638_0070621
1452 Ga0495638_0108248
1453 Ga0495651_0001088
1454 Ga0495651_0146244
1455 Ga0495653_0014171
1456 Ga0495653_0023047
1457 Ga0495653_0044531
1458 Ga0495653_0058615
1459 Ga0495650_0001692
1460 Ga0495580_0017736
1461 Ga0495582_0003999
1462 Ga0495582_0183515
1463 Ga0495605_0013096
1464 Ga0495605_0020407
1465 Ga0495605_0024308
1466 Ga0495605_0031139
1467 Ga0495605_0040953
1468 Ga0495639_0027004
1469 Ga0495662_0002860
1470 Ga0495662_0003653
1471 Ga0495662_0098107
1472 Ga0495664_0003663
1473 Ga0495664_0030585
1474 Ga0495584_0000781
1475 Ga0495584_0004084
1476 Ga0495584_0012951
1477 Ga0495584_0018413
1478 Ga0495584_0018992
1479 Ga0495584_0028938
1480 Ga0495584_0055763
1481 Ga0495585_0001585
1482 Ga0495585_0003957
1483 Ga0495585_0007730
1484 Ga0495585_0073955
1485 Ga0495594_0005242
1486 Ga0495594_0057786
1487 Ga0495594_0088101
1488 Ga0495596_0005730
1489 Ga0495596_0005838
1490 Ga0495596_0009329
1491 Ga0495596_0011210
1492 Ga0495596_0021074
1493 Ga0495596_0063786
1494 Ga0495607_0000876
1495 Ga0495607_0008486
1496 Ga0495607_0023261
1497 Ga0495607_0024504
1498 Ga0495607_0031397
1499 Ga0495607_0047494
1500 Ga0495607_0055921
1501 Ga0495583_0000417
1502 Ga0495583_0000679
1503 Ga0495583_0001028
1504 Ga0495583_0015368
1505 Ga0495583_0022229
1506 Ga0495606_0000149
1507 Ga0495608_0019764
1508 Ga0495610_0014805
1509 Ga0495616_0011077
1510 Ga0495616_0012884
1511 Ga0495616_0015409
1512 Ga0495616_0088451
1513 Ga0495616_0090757
1514 Ga0495618_0012897
1515 Ga0495618_0159371
1516 Ga0495628_0010616
1517 Ga0495628_0031356
1518 Ga0495628_0195200
1519 Ga0495630_0012548
1520 Ga0495630_0111574
1521 Ga0495631_0009289
1522 Ga0495631_0012663
1523 Ga0495631_0110644
1524 Ga0495632_0000253
1525 Ga0495632_0000311
1526 Ga0495632_0000365
1527 Ga0495632_0030056
1528 Ga0495637_0024388
1529 Ga0495643_0000302
1530 Ga0495643_0000729
1531 Ga0495643_0026408
1532 Ga0495644_0005947
1533 Ga0495644_0006899
1534 Ga0495644_0010053
1535 Ga0495648_0000119
1536 Ga0495648_0011121
1537 Ga0495648_0030554
1538 Ga0495648_0104808
1539 Ga0495666_0001696
1540 Ga0495666_0003516
1541 Ga0495642_0001135
1542 Ga0495642_0025039
1543 Ga0495642_0036493
1544 Ga0495652_0001055
1545 Ga0495652_0017628
1546 Ga0495652_0071737
1547 Ga0495654_0005778
1548 Ga0495665_0005387
1549 Ga0495640_0004953
1550 Ga0495640_0033080
1551 Ga0495586_0001960
1552 Ga0495586_0004758
1553 Ga0495586_0026453
1554 Ga0495587_0001673
1555 Ga0495609_0001674
1556 Ga0495609_0038896
1557 Ga0495597_0000123
1558 Ga0495597_0000127
1559 Ga0495597_0000439
1560 Ga0495597_0002383
1561 Ga0495597_0003217
1562 Ga0495597_0004061
1563 Ga0495645_0046359
1564 Ga0495622_0000480
1565 Ga0495622_0023694
1566 Ga0495622_0059605
1567 Ga0495622_0121009
1568 Ga0495633_0000088
1569 Ga0495633_0003948
1570 Ga0495633_0004308
1571 Ga0495633_0004365
1572 Ga0495667_0022019
1573 Ga0495668_0000460
1574 Ga0495668_0001529
1575 Ga0495668_0025601
1576 Ga0495668_0025818
1577 Ga0495668_0052708
1578 Ga0495668_0076011
1579 Ga0495668_0090919
1580 Ga0495668_0110950
1581 Ga0495668_0140030
1582 Ga0495634_0001729
1583 Ga0495634_0003826
1584 Ga0495634_0029265
1585 Ga0495634_0076175
1586 Ga0495611_0000793
1587 Ga0495611_0015713
1588 Ga0495611_0055740
1589 Ga0495625_0002200
1590 Ga0495625_0002701
1591 Ga0495625_0084561
1592 Ga0495635_0024224
1593 Ga0495635_0039975
1594 Ga0495661_0000923
1595 Ga0495661_0001513
1596 Ga0495661_0010130
1597 Ga0495661_0125823
1598 Ga0495661_0181494
1599 Ga0495588_0082701
1600 Ga0495657_0010913
1601 Ga0495657_0100431
1602 Ga0495657_0173736
1603 Ga0495599_0008650
1604 Ga0495599_0105256
1605 Ga0495623_0028591
1606 Ga0495646_0005821
1607 Ga0495646_0096780
1608 Ga0495669_0000479
1609 Ga0495669_0004096
1610 Ga0495613_0001087
1611 Ga0495613_0002547
1612 Ga0495613_0006343
1613 Ga0495613_0014884
1614 Ga0495613_0018858
1615 Ga0495613_0036156
1616 Ga0495670_0000229
1617 Ga0495670_0013404
1618 Ga0495670_0014792
1619 Ga0495649_0001723
1620 Ga0495649_0028444
1621 Ga0495649_0127220
1622 Ga0495589_0000610
1623 Ga0495589_0005398
1624 Ga0495589_0014904
1625 Ga0495589_0015410
1626 Ga0495589_0043427
1627 Ga0495600_0027751
1628 Ga0495660_0002813
1629 Ga0495660_0008510
1630 Ga0495581_0013715
1631 Ga0495581_0015281
1632 Ga0495581_0116140
1633 Ga0495604_0002334
1634 Ga0495604_0009084
1635 Ga0495604_0023674
1636 Ga0495604_0029760
1637 Ga0495604_0039198
1638 Ga0495604_0061766
1639 Ga0495636_0008434
1640 Ga0495636_0043068
1641 Ga0495636_0070873
1642 Ga0495674_0002692
1643 Ga0495674_0023200
1644 Ga0495672_0001319
1645 Ga0495672_0001582
1646 Ga0495672_0020626
1647 Ga0495672_0025826
1648 Ga0495676_0000031
1649 Ga0495676_0000862
1650 Ga0495676_0005345
1651 Ga0495680_0019816
1652 Ga0495683_0005694
1653 Ga0495683_0018019
1654 Ga0495683_0029973
1655 Ga0495683_0043978
1656 Ga0495687_001468
1657 Ga0495687_005116
1658 Ga0495675_0002328
1659 Ga0495675_0010257
1660 Ga0495675_0023769
1661 Ga0495675_0033535
1662 Ga0495675_0071558
1663 Ga0495675_0119798
1664 Ga0495677_0006349
1665 Ga0495677_0008672
1666 Ga0495679_009108
1667 Ga0495685_079380
1668 Ga0495673_0000223
1669 Ga0495681_0000939
1670 Ga0495681_0018579
1671 Ga0495681_0019049
1672 Ga0495681_0040434
1673 Ga0495684_0064158
1674 Ga0495684_0067687
1675 Ga0495684_0311681
1676 Ga0495686_0000021
1677 Ga0495686_0002134
1678 Ga0495686_0008657
1679 Ga0495686_0013091
1680 Ga0495686_0050582
1681 Ga0495593_0004669
1682 Ga0495593_0007232
1683 Ga0495593_0024924
1684 Ga0495593_0028589
1685 Ga0495593_0060351
1686 Ga0495602_0016473
1687 Ga0495602_0028276
1688 Ga0495602_0031172
1689 Ga0495602_0086198
1690 Ga0495614_0005393
1691 Ga0495614_0011401
1692 Ga0495626_0000005
1693 Ga0495626_0015821
1694 Ga0495626_0019890
1695 Ga0495626_0024308
1696 Ga0495626_0035489
1697 Ga0495626_0040297
1698 Ga0495626_0043398
1699 Ga0495626_0050528
1700 Ga0495626_0071295
1701 Ga0496100_0011314
1702 Ga0496100_0385481
1703 Ga0496101_0005155
1704 Ga0496102_0044010
1705 Ga0496102_0093031
1706 Ga0496102_0179800
1707 Ga0496103_0042347
1708 Ga0496105_0023140
1709 Ga0496105_0102242
1710 Ga0496106_0041301
1711 Ga0496106_0141499
1712 Ga0496107_0017244
1713 Ga0496107_0050519
1714 Ga0496108_0010303
1715 Ga0496108_0185860
1716 Ga0496109_0037831
1717 Ga0496109_0326562
1718 Ga0496109_0377124
1719 Ga0496109_0559946
1720 Ga0496110_0014313
1721 Ga0496110_0035014
1722 Ga0496110_0049348
1723 Ga0496111_0001836
1724 Ga0496111_0085602
1725 Ga0496112_0001267
1726 Ga0496112_0016434
1727 Ga0496112_0016818
1728 Ga0496112_0260013
1729 Ga0496114_0045732
1730 Ga0496115_0002726
1731 Ga0496115_0020967
1732 Ga0496115_0046019
1733 Ga0496115_0064859
1734 Ga0496117_0094846
1735 Ga0496122_0000142
1736 Ga0496122_0089925
1737 Ga0496122_0155793
1738 Ga0496123_0000148
1739 Ga0496123_0027358
1740 Ga0496124_0000046
1741 Ga0496124_0381154
1742 Ga0496125_0022904
1743 Ga0496126_0000050
1744 Ga0495678_000256
1745 Ga0495678_000524
1746 Ga0495678_000732
1747 Ga0495678_004011
1748 Ga0495678_016975
1749 Ga0495682_0000308
1750 Ga0501032_0057205
1751 Ga0501032_0090200
1752 Ga0501033_0086063
1753 Ga0501033_0209419
1754 Ga0501034_0131914
1755 Ga0501034_0178180
1756 Ga0501034_0280811
1757 Ga0501034_0393725
1758 Ga0501034_0464770
1759 Ga0501036_0013938
1760 Ga0501036_0092149
1761 Ga0501037_0156139
1762 Ga0501038_0017722
1763 Ga0501038_0060781
1764 Ga0501038_0264471
1765 Ga0501039_0059260
1766 Ga0501039_0095671
1767 Ga0501039_0110515
1768 Ga0501042_0032063
1769 Ga0501042_0337865
1770 Ga0501043_0020490
1771 Ga0501043_0051843
1772 Ga0501043_0054164
1773 Ga0501043_0095690
1774 Ga0501043_0259348
1775 Ga0501046_0071329
1776 Ga0501046_0150064
1777 Ga0501046_0195387
1778 Ga0501047_0058832
1779 Ga0501047_0061667
1780 Ga0501047_0070748
1781 Ga0501047_0242493
1782 Ga0501047_0275166
1783 Ga0501048_0100173
1784 Ga0501048_0319774
1785 Ga0501070_0045431
1786 Ga0501070_0046624
1787 Ga0501070_0050448
1788 Ga0501070_0070803
1789 Ga0501070_0090627
1790 Ga0501070_0091701
1791 Ga0501070_0163330
1792 Ga0501072_0017620
1793 Ga0501073_0004147
1794 Ga0501073_0019004
1795 Ga0501073_0023396
1796 Ga0501074_0006780
1797 Ga0501074_0077661
1798 Ga0501074_0083528
1799 Ga0501076_0245766
1800 Ga0501257_014512
1801 Ga0501079_0375806
1802 Ga0501080_0029055
1803 Ga0501080_0046968
1804 Ga0501080_0064652
1805 Ga0501080_0069187
1806 Ga0501080_0111887
1807 Ga0501080_0247844
1808 Ga0501080_0551761
1809 Ga0501081_0034541
1810 Ga0501083_0000749
1811 Ga0501083_0020618
1812 Ga0501083_0052792
1813 Ga0501083_0141683
1814 Ga0501083_0149104
1815 Ga0501269_003107
1816 Ga0501035_0124124
1817 Ga0501035_0173768
1818 Ga0501044_0017691
1819 Ga0501044_0043682
1820 Ga0501044_0081620
1821 Ga0501044_0101410
1822 Ga0501044_0256423
1823 Ga0501044_0325707
1824 Ga0501045_0128594
1825 Ga0501045_0148648
1826 nmdc:mga0yw44_282764_c1
1827 nmdc:mga06z11_21838_c1
1828 nmdc:mga05p37_321116_c1
1829 nmdc:mga05p37_96330_c1
1830 nmdc:mga09592_26300_c1
1831 nmdc:mga0qj67_86337_c1
1832 nmdc:mga06r32_35609_c1
1833 nmdc:mga08y16_339701_c1
1834 nmdc:mga08y16_456_c1
1835 nmdc:mga0n895_152409_c1
1836 nmdc:mga0n895_73236_c1
1837 nmdc:mga0rr50_21985_c1
1838 nmdc:mga08x19_209840_c1
1839 nmdc:mga0a205_20785_c1
1840 nmdc:mga0a205_227048_c1
1841 Ga0495655_0027280
1842 Ga0495655_0028742
1843 Ga0495595_0094900
1844 Ga0495619_0037869
1845 Ga0495619_0203014
1846 Ga0500578_0073503
1847 Ga0500643_002974
1848 Ga0500644_0009720
1849 Ga0500566_0000273
1850 Ga0500641_0009865
1851 Ga0500641_0012929
1852 Ga0500650_0003353
1853 Ga0500553_015652
1854 Ga0500555_012647
1855 Ga0500556_0094566
1856 Ga0500595_000050
1857 Ga0500597_000191
1858 Ga0500608_004458
1859 Ga0500608_032876
1860 Ga0500608_068534
1861 Ga0500642_0001500
1862 Ga0500652_000390
1863 Ga0500652_086027
1864 Ga0500658_0047555
1865 Ga0500559_0000106
1866 Ga0500568_0002649
1867 Ga0500568_0002674
1868 Ga0500588_0000462
1869 Ga0500588_0062086
1870 Ga0500590_022922
1871 Ga0500604_0002621
1872 Ga0500604_0024172
1873 Ga0500616_0001247
1874 Ga0500622_0000697
1875 Ga0500622_0015301
1876 Ga0500634_0078887
1877 Ga0500636_0012147
1878 Ga0500625_072208
1879 Ga0500645_021809
1880 Ga0500596_000127
1881 Ga0500599_013765
1882 Ga0501084_0250232
1883 Ga0501084_0291171
1884 Ga0501082_0046358
1885 Ga0501082_0100104
1886 Ga0501082_0152946
1887 2509107642
1888 2509375980
1889 2510839595
1890 2513719835
1891 2513997787
1892 2558868253
1893 2579858254
1894 2585304958
1895 2585318881
1896 2585395537
1897 2599100367
1898 2619855430
1899 2620354027
1900 2644019731
1901 2644088757
1902 2644166185
1903 2644180379
1904 2644208884
1905 2644269136
1906 2644343992
1907 2644346810
1908 2644368529
1909 2644436256
1910 2644625873
1911 2644652414
1912 2676487635
1913 2738947905
1914 2753036247
1915 2753324118
1916 2768647398
1917 2770198959
1918 2776270219
1919 2776285054
1920 2786669470
1921 2792461237
1922 2792639545
1923 2808841149
1924 2808919658
1925 2812483263
1926 2819739343
1927 2821447131
1928 2837271229
1929 2840765932
1930 2842521964
1931 2842697673
1932 2843745306
1933 2844537245
1934 2846956405
1935 2848862041
1936 2849564583
1937 2849577694
1938 2850081901
1939 2851155680
1940 2857547099
1941 2862288264
1942 2862297197
1943 2867430126
1944 2873318468
1945 2877682067
1946 2883295599
1947 2883358453
1948 2893067222
1949 2894654983
1950 2899360395
1951 2899804258
1952 2908756360
1953 2912721029
1954 2913312887
1955 2919468552
1956 2935782269
1957 2946075111
1958 2954387193
1959 2954675959
1960 2954688207
1961 2954698029
1962 2954704186
1963 2954717138
1964 2954727106
1965 2954734695
1966 2954746011
1967 2954753582
1968 2954764981
1969 2989775759
1970 3002142490
1971 3006489064
1972 3006501053
1973 8001786643
1974 8003835450
1975 8016539594
1976 8016543890
1977 8016557837
1978 8016569289
1979 8016595856
1980 8016606721
1981 8016623367
1982 8019530874
1983 8019540709
1984 8019550388
1985 8047716355
1986 8054559917
1987 8056836828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

65

360

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9462 1 312
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9394 1 313
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.9199 1 319
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9168 1 313
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9141 1 312
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.962 1 333 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9417 1 225 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9412 2 258 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9394 1 313 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9393 68 334 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A4Q6A8B0-F1-model_v4 deleted 0.9908 2 180
AF-A0A1G9MJ32-F1-model_v4 Predicted oxidoreductase 0.9872 1 332 GO:0004033
GO:0005737
AF-A0A4Q3GSW9-F1-model_v4 Aldo/keto reductase 0.9861 1 209 GO:0004033
GO:0005737
AF-A0A1G9MJ32-F1-model_v4 Predicted oxidoreductase 0.9812 1 332 GO:0004033
GO:0005737
AF-A0A4Q3GSW9-F1-model_v4 Aldo/keto reductase 0.9767 1 209 GO:0004033
GO:0005737

Map