F487733

General Info

Members Datasets Scaffolds Average Seq Length
995 259 1990 184

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10073731|Ga0070658_100737312
Length 182
Sequence MGIIGWVIVAVFVLLVFAMIGLYNRLVRLRALVKEGFSGITVQLRRRADLIPNLVEAVKGYASHEKQVFDDVSENRSKALTAGSVQATAAADAQMTGMLSRLFAVAEAYPELKANTNFLQLQDQLSNIEGELQSSRRYYNATVRDLFPAVLISRPMGFSEEPFYQDDDQSIQTAPKVSFSAA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
189 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
205 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
206 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
207 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
208 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
209 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
210 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
211 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
212 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 3.12
Rhizosphere 95.08
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10073731 3300005327 Bacteria 2799
2 MBSR1b_contig_2711557 2162886012 Bacteria 1011
3 JGI24736J21556_1024961 3300001904 Bacteria 930
4 JGI24741J21665_1026470 3300001915 Bacteria 883
5 JGI24752J21851_1007703 3300001976 Bacteria 1405
6 JGI24740J21852_10013175 3300001979 Bacteria 3094
7 JGI24740J21852_10047364 3300001979 Bacteria 1255
8 JGI24739J22299_10002145 3300001989 Bacteria 7564
9 JGI24739J22299_10087764 3300001989 Bacteria 949
10 JGI24737J22298_10000697 3300001990 Bacteria 11810
11 JGI24737J22298_10005244 3300001990 Bacteria 4488
12 JGI24737J22298_10024936 3300001990 Bacteria 1892
13 JGI24737J22298_10061782 3300001990 Bacteria 1126
14 JGI24737J22298_10134641 3300001990 Bacteria 730
15 JGI24737J22298_10140921 3300001990 Bacteria 712
16 JGI24735J21928_10134445 3300002067 Unclassified 713
17 JGI24738J21930_10000446 3300002075 Bacteria 11684
18 JGI24035J26624_1004344 3300002126 Bacteria 1344
19 Ga0065712_10021395 3300005290 Bacteria 1703
20 Ga0065712_10328147 3300005290 Bacteria 818
21 Ga0065715_10165560 3300005293 Bacteria 1590
22 Ga0070658_10024120 3300005327 Bacteria 4881
23 Ga0070658_10038454 3300005327 Bacteria 3858
24 Ga0070658_10043493 3300005327 Bacteria 3628
25 Ga0070658_10216038 3300005327 Bacteria 1621
26 Ga0070658_10436432 3300005327 Bacteria 1127
27 Ga0070658_10808721 3300005327 Bacteria 814
28 Ga0070676_10028508 3300005328 Bacteria 3172
29 Ga0070676_10172584 3300005328 Bacteria 1400
30 Ga0070676_10206086 3300005328 Bacteria 1291
31 Ga0070676_10257268 3300005328 Bacteria 1168
32 Ga0070676_10343201 3300005328 Bacteria 1025
33 Ga0070676_10657959 3300005328 Bacteria 761
34 Ga0070683_100099718 3300005329 Bacteria 2734
35 Ga0070683_100423224 3300005329 Bacteria 1270
36 Ga0070690_100000954 3300005330 Bacteria 14715
37 Ga0070690_100423631 3300005330 Bacteria 982
38 Ga0070670_100022306 3300005331 Bacteria 5450
39 Ga0070670_100127672 3300005331 Bacteria 2195
40 Ga0070670_100190709 3300005331 Bacteria 1780
41 Ga0070670_100576248 3300005331 Bacteria 1006
42 Ga0070677_10002219 3300005333 Bacteria 6198
43 Ga0070677_10169460 3300005333 Bacteria 1031
44 Ga0070677_10278868 3300005333 Bacteria 841
45 Ga0068869_100038388 3300005334 Bacteria 3413
46 Ga0068869_100055034 3300005334 Bacteria 2899
47 Ga0068869_100211633 3300005334 Bacteria 1533
48 Ga0068869_100220076 3300005334 Bacteria 1504
49 Ga0068869_100301025 3300005334 Bacteria 1295
50 Ga0068869_100612705 3300005334 Bacteria 921
51 Ga0070666_10000218 3300005335 Bacteria 39122
52 Ga0070666_10011260 3300005335 Bacteria 5611
53 Ga0070666_10246767 3300005335 Bacteria 1263
54 Ga0070680_100001389 3300005336 Bacteria 17494
55 Ga0070680_100001897 3300005336 Bacteria 15337
56 Ga0070680_100703299 3300005336 Bacteria 870
57 Ga0070682_100310838 3300005337 Bacteria 1160
58 Ga0068868_100001629 3300005338 Bacteria 15324
59 Ga0068868_100052370 3300005338 Bacteria 3213
60 Ga0070660_100002060 3300005339 Bacteria 13877
61 Ga0070660_100002440 3300005339 Bacteria 12772
62 Ga0070660_100006187 3300005339 Bacteria 8281
63 Ga0070660_100028450 3300005339 Bacteria 4182
64 Ga0070660_100112119 3300005339 Bacteria 2171
65 Ga0070660_100156943 3300005339 Bacteria 1832
66 Ga0070660_100166686 3300005339 Bacteria 1777
67 Ga0070660_100250285 3300005339 Bacteria 1445
68 Ga0070660_100351977 3300005339 Bacteria 1213
69 Ga0070660_100358794 3300005339 Bacteria 1201
70 Ga0070660_100392454 3300005339 Bacteria 1147
71 Ga0070660_100710976 3300005339 Bacteria 843
72 Ga0070689_100262526 3300005340 Bacteria 1428
73 Ga0070689_100471821 3300005340 Bacteria 1071
74 Ga0070687_100623663 3300005343 Bacteria 744
75 Ga0070661_100000042 3300005344 Bacteria 99327
76 Ga0070661_100001002 3300005344 Bacteria 20048
77 Ga0070661_100003895 3300005344 Bacteria 10275
78 Ga0070661_100051557 3300005344 Bacteria 3012
79 Ga0070661_100070502 3300005344 Bacteria 2570
80 Ga0070661_100141545 3300005344 Bacteria 1813
81 Ga0070661_100174670 3300005344 Bacteria 1633
82 Ga0070661_100584023 3300005344 Bacteria 902
83 Ga0070661_100632166 3300005344 Bacteria 868
84 Ga0070692_10018230 3300005345 Bacteria 3371
85 Ga0070692_10284987 3300005345 Bacteria 1003
86 Ga0070668_100000111 3300005347 Bacteria 50557
87 Ga0070668_100006855 3300005347 Bacteria 8448
88 Ga0070668_100019531 3300005347 Bacteria 5101
89 Ga0070668_100043980 3300005347 Bacteria 3425
90 Ga0070668_100111391 3300005347 Bacteria 2178
91 Ga0070668_100312488 3300005347 Bacteria 1321
92 Ga0070668_100459944 3300005347 Bacteria 1095
93 Ga0070669_100026741 3300005353 Bacteria 4151
94 Ga0070669_100028977 3300005353 Bacteria 3990
95 Ga0070669_100048085 3300005353 Bacteria 3113
96 Ga0070669_100255242 3300005353 Bacteria 1397
97 Ga0070669_100839072 3300005353 Bacteria 782
98 Ga0070669_100883802 3300005353 Bacteria 763
99 Ga0070675_100006392 3300005354 Bacteria 9043
100 Ga0070675_100041173 3300005354 Bacteria 3774
101 Ga0070671_100000136 3300005355 Bacteria 47367
102 Ga0070671_100000394 3300005355 Bacteria 30026
103 Ga0070671_100002007 3300005355 Bacteria 15641
104 Ga0070671_100026607 3300005355 Bacteria 4756
105 Ga0070671_100034359 3300005355 Bacteria 4197
106 Ga0070671_100042833 3300005355 Bacteria 3764
107 Ga0070671_100078318 3300005355 Bacteria 2763
108 Ga0070671_100151343 3300005355 Bacteria 1959
109 Ga0070671_100302617 3300005355 Bacteria 1362
110 Ga0070674_100011836 3300005356 Bacteria 5328
111 Ga0070674_100060705 3300005356 Bacteria 2636
112 Ga0070674_100320734 3300005356 Bacteria 1242
113 Ga0070674_100385110 3300005356 Bacteria 1142
114 Ga0070673_100017304 3300005364 Bacteria 5121
115 Ga0070673_100021512 3300005364 Bacteria 4678
116 Ga0070673_100027214 3300005364 Bacteria 4237
117 Ga0070673_100027432 3300005364 Bacteria 4222
118 Ga0070673_100243835 3300005364 Bacteria 1564
119 Ga0070673_100605943 3300005364 Bacteria 999
120 Ga0070673_100906303 3300005364 Bacteria 818
121 Ga0070673_101116175 3300005364 Bacteria 737
122 Ga0070673_101231906 3300005364 Bacteria 702
123 Ga0070688_100456364 3300005365 Bacteria 956
124 Ga0070659_100000600 3300005366 Bacteria 26428
125 Ga0070659_100000688 3300005366 Bacteria 24629
126 Ga0070659_100001283 3300005366 Bacteria 18214
127 Ga0070659_100004264 3300005366 Bacteria 10207
128 Ga0070659_100014262 3300005366 Bacteria 5933
129 Ga0070659_100016191 3300005366 Bacteria 5595
130 Ga0070659_100019675 3300005366 Bacteria 5121
131 Ga0070659_100195210 3300005366 Bacteria 1665
132 Ga0070659_100233425 3300005366 Bacteria 1520
133 Ga0070659_100258687 3300005366 Bacteria 1444
134 Ga0070659_101071541 3300005366 Bacteria 709
135 Ga0070667_100000943 3300005367 Bacteria 26747
136 Ga0070667_100002912 3300005367 Bacteria 14710
137 Ga0070667_100033156 3300005367 Bacteria 4314
138 Ga0070667_100048608 3300005367 Bacteria 3571
139 Ga0070667_100051964 3300005367 Bacteria 3456
140 Ga0070667_100053711 3300005367 Bacteria 3400
141 Ga0070667_100109580 3300005367 Bacteria 2393
142 Ga0070667_100175166 3300005367 Bacteria 1895
143 Ga0070667_100225674 3300005367 Bacteria 1669
144 Ga0070667_100232459 3300005367 Bacteria 1644
145 Ga0070667_100287947 3300005367 Bacteria 1476
146 Ga0070714_100278371 3300005435 Bacteria 1554
147 Ga0070714_100446331 3300005435 Bacteria 1228
148 Ga0070705_100316156 3300005440 Bacteria 1125
149 Ga0070694_100012251 3300005444 Bacteria 5327
150 Ga0070694_100083314 3300005444 Bacteria 2228
151 Ga0070663_100034762 3300005455 Bacteria 3492
152 Ga0070663_100035748 3300005455 Bacteria 3448
153 Ga0070663_100087657 3300005455 Bacteria 2300
154 Ga0070663_100733707 3300005455 Bacteria 842
155 Ga0070663_101055411 3300005455 Bacteria 709
156 Ga0070663_101066674 3300005455 Bacteria 705
157 Ga0070678_100053001 3300005456 Bacteria 2948
158 Ga0070678_100101655 3300005456 Bacteria 2229
159 Ga0070678_100343758 3300005456 Bacteria 1281
160 Ga0070662_100000789 3300005457 Bacteria 19444
161 Ga0070662_100002019 3300005457 Bacteria 12431
162 Ga0070662_100002900 3300005457 Bacteria 10651
163 Ga0070662_100003145 3300005457 Bacteria 10257
164 Ga0070662_100007179 3300005457 Bacteria 7216
165 Ga0070662_100038341 3300005457 Bacteria 3404
166 Ga0070662_100058165 3300005457 Bacteria 2813
167 Ga0070662_100250744 3300005457 Bacteria 1423
168 Ga0070662_100321546 3300005457 Bacteria 1262
169 Ga0070662_100331496 3300005457 Bacteria 1243
170 Ga0070662_100332639 3300005457 Bacteria 1241
171 Ga0070662_100604349 3300005457 Bacteria 923
172 Ga0070681_10008440 3300005458 Bacteria 10084
173 Ga0070681_10027530 3300005458 Bacteria 5715
174 Ga0070681_10064213 3300005458 Bacteria 3643
175 Ga0068867_100002913 3300005459 Bacteria 12061
176 Ga0068867_100075565 3300005459 Bacteria 2528
177 Ga0068867_100182254 3300005459 Bacteria 1670
178 Ga0068867_100190510 3300005459 Bacteria 1636
179 Ga0070685_10643801 3300005466 Bacteria 767
180 Ga0070706_101281910 3300005467 Bacteria 672
181 Ga0070698_100639101 3300005471 Bacteria 1005
182 Ga0070679_100000002 3300005530 Bacteria 312066
183 Ga0070679_100009731 3300005530 Bacteria 9091
184 Ga0070679_100193486 3300005530 Bacteria 2002
185 Ga0070679_100344272 3300005530 Bacteria 1439
186 Ga0070679_100808674 3300005530 Bacteria 880
187 Ga0070684_100042738 3300005535 Bacteria 3914
188 Ga0068853_100000308 3300005539 Bacteria 34286
189 Ga0068853_100018930 3300005539 Bacteria 5702
190 Ga0068853_100108331 3300005539 Bacteria 2465
191 Ga0068853_100115724 3300005539 Bacteria 2387
192 Ga0068853_100120046 3300005539 Bacteria 2344
193 Ga0068853_100284852 3300005539 Bacteria 1524
194 Ga0068853_100446570 3300005539 Bacteria 1216
195 Ga0068853_100493096 3300005539 Bacteria 1156
196 Ga0068853_100575347 3300005539 Bacteria 1068
197 Ga0070672_100005607 3300005543 Bacteria 8348
198 Ga0070672_100081468 3300005543 Bacteria 2595
199 Ga0070672_100099533 3300005543 Bacteria 2356
200 Ga0070672_100137864 3300005543 Bacteria 2010
201 Ga0070672_100210806 3300005543 Bacteria 1627
202 Ga0070672_100224292 3300005543 Bacteria 1577
203 Ga0070672_100392945 3300005543 Bacteria 1188
204 Ga0070672_100412691 3300005543 Bacteria 1159
205 Ga0070686_100024654 3300005544 Bacteria 3608
206 Ga0070686_100611190 3300005544 Bacteria 860
207 Ga0070696_100005316 3300005546 Bacteria 8588
208 Ga0070696_100032106 3300005546 Bacteria 3602
209 Ga0070696_100209580 3300005546 Bacteria 1458
210 Ga0070696_100426784 3300005546 Bacteria 1042
211 Ga0070693_100101880 3300005547 Bacteria 1751
212 Ga0070693_100164296 3300005547 Bacteria 1417
213 Ga0070665_100000361 3300005548 Bacteria 67731
214 Ga0070665_100001120 3300005548 Bacteria 32952
215 Ga0070665_100004569 3300005548 Bacteria 14499
216 Ga0070665_100016369 3300005548 Bacteria 7436
217 Ga0070665_100130599 3300005548 Bacteria 2514
218 Ga0070665_100174313 3300005548 Bacteria 2151
219 Ga0070665_100177607 3300005548 Bacteria 2130
220 Ga0070665_100195580 3300005548 Bacteria 2023
221 Ga0070665_100213269 3300005548 Bacteria 1931
222 Ga0070665_100225012 3300005548 Bacteria 1876
223 Ga0070665_100808870 3300005548 Bacteria 950
224 Ga0070665_100884807 3300005548 Bacteria 906
225 Ga0070704_100140458 3300005549 Bacteria 1885
226 Ga0068855_100009752 3300005563 Bacteria 11585
227 Ga0068855_100026636 3300005563 Bacteria 6918
228 Ga0068855_100100940 3300005563 Bacteria 3322
229 Ga0068855_100164531 3300005563 Bacteria 2515
230 Ga0068855_100269625 3300005563 Bacteria 1893
231 Ga0068855_100803332 3300005563 Bacteria 1000
232 Ga0070664_100001343 3300005564 Bacteria 19621
233 Ga0070664_100004417 3300005564 Bacteria 11298
234 Ga0070664_100009869 3300005564 Bacteria 7738
235 Ga0070664_100012867 3300005564 Bacteria 6808
236 Ga0070664_100028635 3300005564 Bacteria 4636
237 Ga0070664_100031753 3300005564 Bacteria 4415
238 Ga0070664_100048720 3300005564 Bacteria 3581
239 Ga0070664_100220263 3300005564 Bacteria 1698
240 Ga0070664_100289807 3300005564 Bacteria 1478
241 Ga0070664_100912028 3300005564 Bacteria 824
242 Ga0070664_101213651 3300005564 Bacteria 712
243 Ga0068857_100004098 3300005577 Bacteria 12276
244 Ga0068857_100061007 3300005577 Bacteria 3350
245 Ga0068857_100142297 3300005577 Bacteria 2168
246 Ga0068857_100169920 3300005577 Bacteria 1981
247 Ga0068857_100200616 3300005577 Bacteria 1818
248 Ga0068857_100260817 3300005577 Bacteria 1590
249 Ga0068857_100604328 3300005577 Bacteria 1037
250 Ga0068854_100000967 3300005578 Bacteria 17292
251 Ga0068854_100007418 3300005578 Bacteria 7004
252 Ga0068854_100011160 3300005578 Bacteria 5836
253 Ga0068854_100022665 3300005578 Bacteria 4284
254 Ga0068854_100054557 3300005578 Bacteria 2875
255 Ga0068854_100067213 3300005578 Bacteria 2611
256 Ga0068854_100408825 3300005578 Bacteria 1125
257 Ga0068856_100068808 3300005614 Bacteria 3500
258 Ga0068856_100103973 3300005614 Bacteria 2833
259 Ga0068856_101262703 3300005614 Bacteria 754
260 Ga0068852_100009541 3300005616 Bacteria 7212
261 Ga0068852_100059862 3300005616 Bacteria 3304
262 Ga0068852_100136665 3300005616 Bacteria 2264
263 Ga0068852_100259559 3300005616 Bacteria 1668
264 Ga0068852_100315010 3300005616 Bacteria 1518
265 Ga0068859_100006138 3300005617 Bacteria 12210
266 Ga0068859_100010244 3300005617 Bacteria 9435
267 Ga0068859_100020574 3300005617 Bacteria 6621
268 Ga0068859_100023062 3300005617 Bacteria 6242
269 Ga0068859_100066679 3300005617 Bacteria 3634
270 Ga0068859_100078095 3300005617 Bacteria 3351
271 Ga0068859_100151551 3300005617 Bacteria 2394
272 Ga0068859_100179236 3300005617 Bacteria 2201
273 Ga0068859_100467166 3300005617 Bacteria 1357
274 Ga0068859_100573228 3300005617 Bacteria 1222
275 Ga0068859_101524736 3300005617 Bacteria 738
276 Ga0068864_100000549 3300005618 Bacteria 32018
277 Ga0068864_100001958 3300005618 Bacteria 16928
278 Ga0068864_100015634 3300005618 Bacteria 6314
279 Ga0068864_100016637 3300005618 Bacteria 6126
280 Ga0068864_100125712 3300005618 Bacteria 2298
281 Ga0068864_100262675 3300005618 Bacteria 1606
282 Ga0068866_10105396 3300005718 Bacteria 1563
283 Ga0068866_10257268 3300005718 Bacteria 1071
284 Ga0068861_100082333 3300005719 Bacteria 2522
285 Ga0068861_100258112 3300005719 Bacteria 1491
286 Ga0068861_100450754 3300005719 Bacteria 1153
287 Ga0068861_100974734 3300005719 Bacteria 808
288 Ga0068851_10185266 3300005834 Bacteria 1155
289 Ga0068851_10228763 3300005834 Bacteria 1048
290 Ga0068851_10240354 3300005834 Bacteria 1024
291 Ga0068870_10200486 3300005840 Bacteria 1210
292 Ga0068863_100000171 3300005841 Bacteria 69589
293 Ga0068863_100000494 3300005841 Bacteria 39986
294 Ga0068863_100001525 3300005841 Bacteria 22887
295 Ga0068863_100006151 3300005841 Bacteria 11772
296 Ga0068863_100037387 3300005841 Bacteria 4622
297 Ga0068863_100045519 3300005841 Bacteria 4164
298 Ga0068863_100076289 3300005841 Bacteria 3171
299 Ga0068863_100093481 3300005841 Bacteria 2854
300 Ga0068858_100000377 3300005842 Bacteria 46611
301 Ga0068858_100006056 3300005842 Bacteria 11788
302 Ga0068858_100008046 3300005842 Bacteria 10155
303 Ga0068858_100008426 3300005842 Bacteria 9910
304 Ga0068858_100027010 3300005842 Bacteria 5332
305 Ga0068858_100471181 3300005842 Bacteria 1211
306 Ga0068860_100002137 3300005843 Bacteria 20863
307 Ga0068860_100025139 3300005843 Bacteria 5747
308 Ga0068860_100048885 3300005843 Bacteria 4030
309 Ga0068860_100057661 3300005843 Bacteria 3692
310 Ga0068860_100084061 3300005843 Bacteria 3028
311 Ga0068860_100096396 3300005843 Bacteria 2820
312 Ga0068860_100333904 3300005843 Bacteria 1489
313 Ga0068860_100357889 3300005843 Bacteria 1437
314 Ga0068860_100440238 3300005843 Bacteria 1294
315 Ga0068860_100790811 3300005843 Bacteria 962
316 Ga0068862_100001399 3300005844 Bacteria 22376
317 Ga0068862_100004254 3300005844 Bacteria 12120
318 Ga0068862_100024078 3300005844 Bacteria 5105
319 Ga0068862_100086523 3300005844 Bacteria 2725
320 Ga0068862_100094352 3300005844 Bacteria 2610
321 Ga0068862_100094722 3300005844 Bacteria 2604
322 Ga0068862_100837853 3300005844 Bacteria 900
323 Ga0068862_101388962 3300005844 Unclassified 705
324 Ga0081539_10008020 3300005985 Bacteria 9366
325 Ga0081539_10063485 3300005985 Bacteria 2015
326 Ga0075364_10014715 3300006051 Bacteria 4838
327 Ga0075362_10193611 3300006177 Bacteria 988
328 Ga0075369_10155970 3300006186 Bacteria 1045
329 Ga0097621_100029120 3300006237 Bacteria 4359
330 Ga0097621_100145985 3300006237 Bacteria 2025
331 Ga0097621_101204768 3300006237 Bacteria 713
332 Ga0068871_100009749 3300006358 Bacteria 6969
333 Ga0068871_100154159 3300006358 Bacteria 1960
334 Ga0075430_100004853 3300006846 Bacteria 11314
335 Ga0075433_10004236 3300006852 Bacteria 11139
336 Ga0075434_100036538 3300006871 Bacteria 4860
337 Ga0068865_100029875 3300006881 Bacteria 3620
338 Ga0068865_100055592 3300006881 Bacteria 2754
339 Ga0068865_100309644 3300006881 Bacteria 1267
340 Ga0068865_100472841 3300006881 Bacteria 1040
341 Ga0068865_100785078 3300006881 Bacteria 820
342 Ga0068865_100800496 3300006881 Bacteria 813
343 Ga0097620_100006138 3300006931 Bacteria 12210
344 Ga0097620_100010244 3300006931 Bacteria 9435
345 Ga0097620_100020574 3300006931 Bacteria 6621
346 Ga0097620_100023062 3300006931 Bacteria 6242
347 Ga0097620_100066673 3300006931 Bacteria 3634
348 Ga0097620_100078096 3300006931 Bacteria 3351
349 Ga0097620_100151554 3300006931 Bacteria 2394
350 Ga0097620_100179240 3300006931 Bacteria 2201
351 Ga0097620_100467164 3300006931 Bacteria 1357
352 Ga0097620_100573200 3300006931 Bacteria 1222
353 Ga0097620_101524898 3300006931 Bacteria 738
354 Ga0075435_100611124 3300007076 Bacteria 946
355 Ga0075435_100735408 3300007076 Bacteria 858
356 Ga0075435_101285152 3300007076 Bacteria 641
357 Ga0105240_10228632 3300009093 Bacteria 2163
358 Ga0111539_10017823 3300009094 Bacteria 8793
359 Ga0105245_10012139 3300009098 Bacteria 7491
360 Ga0105245_10214206 3300009098 Bacteria 1855
361 Ga0105245_10262537 3300009098 Bacteria 1681
362 Ga0105245_10569255 3300009098 Bacteria 1156
363 Ga0105247_10282866 3300009101 Bacteria 1145
364 Ga0105243_10081201 3300009148 Bacteria 2646
365 Ga0105243_10123755 3300009148 Bacteria 2185
366 Ga0105243_10359616 3300009148 Bacteria 1339
367 Ga0105241_10055169 3300009174 Bacteria 3044
368 Ga0105241_10594674 3300009174 Bacteria 999
369 Ga0105242_10131306 3300009176 Bacteria 2163
370 Ga0105248_10000075 3300009177 Bacteria 114243
371 Ga0105248_10001129 3300009177 Bacteria 29704
372 Ga0105248_10002385 3300009177 Bacteria 20869
373 Ga0105248_10002706 3300009177 Bacteria 19694
374 Ga0105248_10023645 3300009177 Bacteria 6828
375 Ga0105248_10052091 3300009177 Bacteria 4593
376 Ga0105248_10066955 3300009177 Bacteria 4032
377 Ga0105248_10292617 3300009177 Bacteria 1834
378 Ga0105237_10026088 3300009545 Bacteria 5972
379 Ga0105237_10793455 3300009545 Bacteria 954
380 Ga0105238_10090913 3300009551 Bacteria 3040
381 Ga0105238_10206295 3300009551 Bacteria 1941
382 Ga0105238_10593911 3300009551 Bacteria 1115
383 Ga0105238_10605586 3300009551 Bacteria 1104
384 Ga0105238_10982006 3300009551 Bacteria 865
385 Ga0105238_11369520 3300009551 Bacteria 734
386 Ga0105238_11642338 3300009551 Bacteria 673
387 Ga0105249_10001067 3300009553 Bacteria 24310
388 Ga0105249_10002386 3300009553 Bacteria 16304
389 Ga0105249_10021916 3300009553 Bacteria 5722
390 Ga0105249_10164452 3300009553 Bacteria 2147
391 Ga0105249_11513694 3300009553 Bacteria 743
392 Ga0105239_10360171 3300010375 Bacteria 1643
393 Ga0105239_12427104 3300010375 Bacteria 611
394 Ga0105246_10061780 3300011119 Bacteria 2608
395 Ga0105246_10191646 3300011119 Bacteria 1583
396 Ga0105246_10319904 3300011119 Bacteria 1260
397 Ga0157373_10002136 3300013100 Bacteria 14963
398 Ga0157373_10027889 3300013100 Bacteria 4074
399 Ga0157373_10066403 3300013100 Bacteria 2552
400 Ga0157373_10149138 3300013100 Bacteria 1645
401 Ga0157373_10316119 3300013100 Bacteria 1110
402 Ga0157371_10000802 3300013102 Bacteria 36039
403 Ga0157371_10001127 3300013102 Bacteria 28864
404 Ga0157371_10026486 3300013102 Bacteria 4214
405 Ga0157371_10051493 3300013102 Bacteria 2926
406 Ga0157371_10551672 3300013102 Bacteria 854
407 Ga0157371_10599866 3300013102 Bacteria 819
408 Ga0157370_10003539 3300013104 Bacteria 18275
409 Ga0157369_10001462 3300013105 Bacteria 28951
410 Ga0157369_10976431 3300013105 Bacteria 868
411 Ga0157378_10007324 3300013297 Bacteria 9636
412 Ga0157378_10050569 3300013297 Bacteria 3698
413 Ga0157378_10269221 3300013297 Bacteria 1638
414 Ga0157378_10478451 3300013297 Bacteria 1240
415 Ga0163162_10006173 3300013306 Bacteria 11611
416 Ga0163162_10015757 3300013306 Bacteria 7390
417 Ga0163162_10072989 3300013306 Bacteria 3487
418 Ga0163162_10748770 3300013306 Bacteria 1096
419 Ga0157372_10000426 3300013307 Bacteria 46310
420 Ga0157372_10034395 3300013307 Bacteria 5570
421 Ga0157372_10091777 3300013307 Bacteria 3454
422 Ga0157372_10168674 3300013307 Bacteria 2532
423 Ga0157372_10600282 3300013307 Bacteria 1283
424 Ga0157375_10064647 3300013308 Bacteria 3643
425 Ga0157375_10470392 3300013308 Bacteria 1422
426 Ga0157375_10936493 3300013308 Bacteria 1009
427 Ga0157375_11060756 3300013308 Bacteria 947
428 Ga0157375_11412051 3300013308 Bacteria 820
429 Ga0157375_11534668 3300013308 Bacteria 787
430 Ga0163163_10000161 3300014325 Bacteria 70120
431 Ga0163163_10084563 3300014325 Bacteria 3179
432 Ga0157380_10467287 3300014326 Bacteria 1216
433 Ga0182008_10148544 3300014497 Bacteria 1175
434 Ga0157377_10132001 3300014745 Bacteria 1526
435 Ga0157377_10318183 3300014745 Bacteria 1033
436 Ga0157377_10381915 3300014745 Bacteria 954
437 Ga0157377_10674657 3300014745 Bacteria 747
438 Ga0157379_10003023 3300014968 Bacteria 14215
439 Ga0157379_10015484 3300014968 Bacteria 6693
440 Ga0157379_10424753 3300014968 Bacteria 1224
441 Ga0157379_10859794 3300014968 Bacteria 859
442 Ga0157379_11132681 3300014968 Bacteria 750
443 Ga0206356_10238888 3300020070 Bacteria 2816
444 Ga0213876_10067042 3300021384 Bacteria 1895
445 Ga0213876_10079202 3300021384 Bacteria 1736
446 Ga0213876_10420508 3300021384 Bacteria 711
447 Ga0207697_10000146 3300025315 Bacteria 34541
448 Ga0207697_10111499 3300025315 Bacteria 1172
449 Ga0207697_10211892 3300025315 Bacteria 854
450 Ga0207656_10144322 3300025321 Bacteria 1124
451 Ga0207682_10003467 3300025893 Bacteria 6839
452 Ga0207682_10356873 3300025893 Bacteria 689
453 Ga0207688_10000514 3300025901 Bacteria 18701
454 Ga0207688_10069064 3300025901 Bacteria 2002
455 Ga0207688_10076092 3300025901 Bacteria 1911
456 Ga0207680_10000232 3300025903 Bacteria 26760
457 Ga0207680_10009438 3300025903 Bacteria 4841
458 Ga0207680_10027721 3300025903 Bacteria 3159
459 Ga0207647_10000073 3300025904 Bacteria 76404
460 Ga0207647_10001707 3300025904 Bacteria 16885
461 Ga0207647_10014221 3300025904 Bacteria 5492
462 Ga0207647_10057094 3300025904 Bacteria 2394
463 Ga0207647_10071080 3300025904 Bacteria 2100
464 Ga0207647_10071436 3300025904 Bacteria 2094
465 Ga0207699_10445834 3300025906 Unclassified 928
466 Ga0207645_10014645 3300025907 Bacteria 5238
467 Ga0207645_10015778 3300025907 Bacteria 5009
468 Ga0207645_10032935 3300025907 Bacteria 3331
469 Ga0207645_10047280 3300025907 Bacteria 2748
470 Ga0207645_10145886 3300025907 Bacteria 1543
471 Ga0207645_10225289 3300025907 Bacteria 1236
472 Ga0207645_10235014 3300025907 Bacteria 1210
473 Ga0207645_10237637 3300025907 Bacteria 1203
474 Ga0207645_10501034 3300025907 Bacteria 822
475 Ga0207645_10515316 3300025907 Bacteria 810
476 Ga0207643_10236232 3300025908 Bacteria 1122
477 Ga0207643_10567643 3300025908 Bacteria 729
478 Ga0207643_10580328 3300025908 Bacteria 721
479 Ga0207705_10011498 3300025909 Bacteria 6401
480 Ga0207705_10011927 3300025909 Bacteria 6280
481 Ga0207654_10237190 3300025911 Bacteria 1217
482 Ga0207707_10095915 3300025912 Bacteria 2592
483 Ga0207660_10001181 3300025917 Bacteria 17502
484 Ga0207660_10880796 3300025917 Bacteria 731
485 Ga0207662_10363967 3300025918 Bacteria 974
486 Ga0207657_10000453 3300025919 Bacteria 43584
487 Ga0207657_10002427 3300025919 Bacteria 20129
488 Ga0207657_10006164 3300025919 Bacteria 12466
489 Ga0207657_10007101 3300025919 Bacteria 11507
490 Ga0207657_10017518 3300025919 Bacteria 6864
491 Ga0207657_10094350 3300025919 Bacteria 2492
492 Ga0207657_10108375 3300025919 Bacteria 2296
493 Ga0207657_10108620 3300025919 Bacteria 2293
494 Ga0207657_10209062 3300025919 Bacteria 1567
495 Ga0207657_10227692 3300025919 Bacteria 1492
496 Ga0207657_10320976 3300025919 Bacteria 1224
497 Ga0207657_10330486 3300025919 Bacteria 1204
498 Ga0207657_10401814 3300025919 Bacteria 1077
499 Ga0207657_10594868 3300025919 Bacteria 863
500 Ga0207649_10000047 3300025920 Bacteria 110856
501 Ga0207649_10000846 3300025920 Bacteria 19676
502 Ga0207649_10098488 3300025920 Bacteria 1930
503 Ga0207649_10276898 3300025920 Bacteria 1218
504 Ga0207652_10000001 3300025921 Bacteria 1006643
505 Ga0207652_10000002 3300025921 Bacteria 878035
506 Ga0207652_10001787 3300025921 Bacteria 18703
507 Ga0207652_10292359 3300025921 Bacteria 1470
508 Ga0207652_10357606 3300025921 Bacteria 1318
509 Ga0207681_10006610 3300025923 Bacteria 7118
510 Ga0207681_10008684 3300025923 Bacteria 6204
511 Ga0207681_10023769 3300025923 Bacteria 3924
512 Ga0207681_10038517 3300025923 Bacteria 3168
513 Ga0207681_10179411 3300025923 Bacteria 1612
514 Ga0207681_10192270 3300025923 Bacteria 1562
515 Ga0207681_10549111 3300025923 Bacteria 951
516 Ga0207681_10771409 3300025923 Bacteria 802
517 Ga0207694_10193055 3300025924 Bacteria 1655
518 Ga0207694_10258407 3300025924 Bacteria 1426
519 Ga0207694_10462312 3300025924 Bacteria 1060
520 Ga0207650_10069813 3300025925 Bacteria 2640
521 Ga0207650_10189401 3300025925 Bacteria 1643
522 Ga0207650_10266316 3300025925 Bacteria 1391
523 Ga0207650_10329826 3300025925 Bacteria 1251
524 Ga0207650_10339034 3300025925 Bacteria 1234
525 Ga0207659_10021964 3300025926 Bacteria 4244
526 Ga0207659_10120807 3300025926 Bacteria 2007
527 Ga0207659_10180388 3300025926 Bacteria 1672
528 Ga0207659_10450490 3300025926 Bacteria 1084
529 Ga0207687_10005732 3300025927 Bacteria 8219
530 Ga0207687_10037977 3300025927 Bacteria 3289
531 Ga0207687_10187378 3300025927 Bacteria 1607
532 Ga0207644_10000046 3300025931 Bacteria 103962
533 Ga0207644_10010412 3300025931 Bacteria 6127
534 Ga0207644_10025513 3300025931 Bacteria 4064
535 Ga0207644_10041866 3300025931 Bacteria 3243
536 Ga0207644_10086341 3300025931 Bacteria 2329
537 Ga0207644_10148168 3300025931 Bacteria 1814
538 Ga0207690_10000467 3300025932 Bacteria 25995
539 Ga0207690_10001145 3300025932 Bacteria 16858
540 Ga0207690_10006662 3300025932 Bacteria 6844
541 Ga0207690_10012594 3300025932 Bacteria 5063
542 Ga0207690_10020599 3300025932 Bacteria 4078
543 Ga0207690_10034136 3300025932 Bacteria 3276
544 Ga0207690_10055904 3300025932 Bacteria 2660
545 Ga0207690_10152732 3300025932 Bacteria 1713
546 Ga0207690_10169545 3300025932 Bacteria 1634
547 Ga0207690_10262709 3300025932 Bacteria 1338
548 Ga0207690_10396975 3300025932 Bacteria 1099
549 Ga0207690_10417413 3300025932 Bacteria 1073
550 Ga0207690_10625382 3300025932 Bacteria 880
551 Ga0207690_10664855 3300025932 Bacteria 854
552 Ga0207706_10000308 3300025933 Bacteria 52928
553 Ga0207706_10000420 3300025933 Bacteria 45587
554 Ga0207706_10001411 3300025933 Bacteria 24041
555 Ga0207706_10008518 3300025933 Bacteria 9455
556 Ga0207706_10008832 3300025933 Bacteria 9273
557 Ga0207706_10009786 3300025933 Bacteria 8797
558 Ga0207706_10031668 3300025933 Bacteria 4710
559 Ga0207706_10075212 3300025933 Bacteria 2970
560 Ga0207706_10083005 3300025933 Bacteria 2816
561 Ga0207706_10092073 3300025933 Bacteria 2666
562 Ga0207706_10116627 3300025933 Bacteria 2348
563 Ga0207706_10119003 3300025933 Bacteria 2322
564 Ga0207706_10120709 3300025933 Bacteria 2304
565 Ga0207706_10132406 3300025933 Bacteria 2193
566 Ga0207706_10132669 3300025933 Bacteria 2191
567 Ga0207706_10586166 3300025933 Bacteria 959
568 Ga0207706_10655635 3300025933 Bacteria 899
569 Ga0207686_10372114 3300025934 Bacteria 1081
570 Ga0207709_10049168 3300025935 Bacteria 2572
571 Ga0207709_10159115 3300025935 Bacteria 1573
572 Ga0207709_10388644 3300025935 Bacteria 1064
573 Ga0207670_10026144 3300025936 Bacteria 3675
574 Ga0207670_10500254 3300025936 Bacteria 987
575 Ga0207669_10027828 3300025937 Bacteria 3101
576 Ga0207669_10071126 3300025937 Bacteria 2184
577 Ga0207669_10244774 3300025937 Bacteria 1331
578 Ga0207669_10696012 3300025937 Bacteria 835
579 Ga0207704_10027511 3300025938 Bacteria 3139
580 Ga0207704_10211264 3300025938 Bacteria 1428
581 Ga0207691_10017563 3300025940 Bacteria 6780
582 Ga0207691_10084893 3300025940 Bacteria 2842
583 Ga0207691_10132178 3300025940 Bacteria 2203
584 Ga0207691_10138258 3300025940 Bacteria 2148
585 Ga0207691_10148914 3300025940 Bacteria 2059
586 Ga0207691_10158154 3300025940 Bacteria 1989
587 Ga0207691_10244859 3300025940 Bacteria 1549
588 Ga0207691_10282003 3300025940 Bacteria 1429
589 Ga0207691_10380170 3300025940 Bacteria 1206
590 Ga0207711_10000281 3300025941 Bacteria 54787
591 Ga0207711_10000709 3300025941 Bacteria 32766
592 Ga0207711_10006481 3300025941 Bacteria 9852
593 Ga0207711_10021706 3300025941 Bacteria 5364
594 Ga0207711_10023108 3300025941 Bacteria 5207
595 Ga0207711_10046344 3300025941 Bacteria 3714
596 Ga0207711_10065974 3300025941 Bacteria 3130
597 Ga0207711_10107536 3300025941 Bacteria 2476
598 Ga0207711_10438618 3300025941 Bacteria 1215
599 Ga0207689_10000327 3300025942 Bacteria 44239
600 Ga0207689_10008537 3300025942 Bacteria 8930
601 Ga0207689_10127557 3300025942 Bacteria 2093
602 Ga0207689_10180337 3300025942 Bacteria 1741
603 Ga0207689_10291666 3300025942 Bacteria 1351
604 Ga0207661_10032518 3300025944 Bacteria 4042
605 Ga0207661_10424776 3300025944 Bacteria 1208
606 Ga0207661_10529923 3300025944 Bacteria 1078
607 Ga0207679_10001350 3300025945 Bacteria 15480
608 Ga0207679_10010750 3300025945 Bacteria 5902
609 Ga0207679_10027892 3300025945 Bacteria 3911
610 Ga0207679_10042271 3300025945 Bacteria 3274
611 Ga0207679_10049681 3300025945 Bacteria 3062
612 Ga0207679_10234111 3300025945 Bacteria 1553
613 Ga0207679_10830273 3300025945 Bacteria 843
614 Ga0207679_11046469 3300025945 Bacteria 748
615 Ga0207679_11058111 3300025945 Bacteria 744
616 Ga0207667_10003530 3300025949 Bacteria 19329
617 Ga0207667_10032263 3300025949 Bacteria 5646
618 Ga0207667_10044154 3300025949 Bacteria 4725
619 Ga0207667_10082860 3300025949 Bacteria 3322
620 Ga0207667_10439577 3300025949 Bacteria 1326
621 Ga0207667_10662631 3300025949 Bacteria 1048
622 Ga0207667_10991431 3300025949 Bacteria 828
623 Ga0207667_11182241 3300025949 Bacteria 745
624 Ga0207651_10003271 3300025960 Bacteria 7932
625 Ga0207651_10003439 3300025960 Bacteria 7778
626 Ga0207651_10010387 3300025960 Bacteria 5159
627 Ga0207651_10103068 3300025960 Bacteria 2123
628 Ga0207651_10169084 3300025960 Bacteria 1722
629 Ga0207651_10288449 3300025960 Bacteria 1360
630 Ga0207651_10291478 3300025960 Bacteria 1353
631 Ga0207651_10472020 3300025960 Bacteria 1080
632 Ga0207651_10612645 3300025960 Bacteria 953
633 Ga0207651_10931987 3300025960 Bacteria 774
634 Ga0207712_10121822 3300025961 Bacteria 1974
635 Ga0207712_10307410 3300025961 Bacteria 1303
636 Ga0207668_10000091 3300025972 Bacteria 66830
637 Ga0207668_10000136 3300025972 Bacteria 50579
638 Ga0207668_10078040 3300025972 Bacteria 2390
639 Ga0207668_10218331 3300025972 Bacteria 1529
640 Ga0207668_10699252 3300025972 Bacteria 891
641 Ga0207640_10004758 3300025981 Bacteria 7369
642 Ga0207640_10036856 3300025981 Bacteria 3073
643 Ga0207640_10037441 3300025981 Bacteria 3052
644 Ga0207640_10078140 3300025981 Bacteria 2252
645 Ga0207640_10171186 3300025981 Bacteria 1618
646 Ga0207640_10237522 3300025981 Bacteria 1406
647 Ga0207640_10372754 3300025981 Bacteria 1154
648 Ga0207658_10003998 3300025986 Bacteria 10331
649 Ga0207658_10004960 3300025986 Bacteria 9176
650 Ga0207658_10012080 3300025986 Bacteria 5890
651 Ga0207658_10013842 3300025986 Bacteria 5519
652 Ga0207658_10031954 3300025986 Bacteria 3742
653 Ga0207658_10051480 3300025986 Bacteria 3035
654 Ga0207658_10065086 3300025986 Bacteria 2737
655 Ga0207658_10144116 3300025986 Bacteria 1932
656 Ga0207658_10201348 3300025986 Bacteria 1662
657 Ga0207658_10409146 3300025986 Bacteria 1194
658 Ga0207658_10566713 3300025986 Bacteria 1017
659 Ga0207677_10002105 3300026023 Bacteria 10472
660 Ga0207677_10080792 3300026023 Bacteria 2330
661 Ga0207677_10177366 3300026023 Bacteria 1673
662 Ga0207703_10001491 3300026035 Bacteria 21348
663 Ga0207703_10004254 3300026035 Bacteria 11783
664 Ga0207703_10005034 3300026035 Bacteria 10715
665 Ga0207703_10024225 3300026035 Bacteria 4775
666 Ga0207703_10027692 3300026035 Bacteria 4463
667 Ga0207703_10028397 3300026035 Bacteria 4410
668 Ga0207703_10244482 3300026035 Bacteria 1614
669 Ga0207703_10949129 3300026035 Bacteria 824
670 Ga0207639_10000427 3300026041 Bacteria 29093
671 Ga0207639_10075021 3300026041 Bacteria 2658
672 Ga0207639_10118551 3300026041 Bacteria 2170
673 Ga0207639_10296855 3300026041 Bacteria 1427
674 Ga0207639_10613906 3300026041 Bacteria 1004
675 Ga0207678_10002798 3300026067 Bacteria 15830
676 Ga0207678_10011895 3300026067 Bacteria 7641
677 Ga0207678_10013514 3300026067 Bacteria 7169
678 Ga0207678_10017485 3300026067 Bacteria 6296
679 Ga0207678_10452959 3300026067 Bacteria 1116
680 Ga0207678_10798705 3300026067 Bacteria 833
681 Ga0207702_10036981 3300026078 Bacteria 4084
682 Ga0207702_10050716 3300026078 Bacteria 3504
683 Ga0207641_10000001 3300026088 Bacteria 1180841
684 Ga0207641_10002125 3300026088 Bacteria 18732
685 Ga0207641_10004708 3300026088 Bacteria 11767
686 Ga0207641_10094560 3300026088 Bacteria 2621
687 Ga0207641_10110693 3300026088 Bacteria 2434
688 Ga0207641_10408947 3300026088 Bacteria 1304
689 Ga0207641_10502534 3300026088 Bacteria 1177
690 Ga0207648_10002010 3300026089 Bacteria 22197
691 Ga0207648_10012509 3300026089 Bacteria 7943
692 Ga0207648_10047551 3300026089 Bacteria 3760
693 Ga0207648_10210025 3300026089 Bacteria 1728
694 Ga0207648_10767214 3300026089 Bacteria 896
695 Ga0207676_10003879 3300026095 Bacteria 10563
696 Ga0207676_10138246 3300026095 Bacteria 2082
697 Ga0207676_10148748 3300026095 Bacteria 2014
698 Ga0207674_10000139 3300026116 Bacteria 84273
699 Ga0207674_10008456 3300026116 Bacteria 11886
700 Ga0207674_10008693 3300026116 Bacteria 11690
701 Ga0207674_10013878 3300026116 Bacteria 8913
702 Ga0207674_10016337 3300026116 Bacteria 8131
703 Ga0207674_10028196 3300026116 Bacteria 5930
704 Ga0207674_10028214 3300026116 Bacteria 5927
705 Ga0207674_10053547 3300026116 Bacteria 4112
706 Ga0207674_10115766 3300026116 Bacteria 2652
707 Ga0207674_10264301 3300026116 Bacteria 1668
708 Ga0207674_10519135 3300026116 Bacteria 1151
709 Ga0207675_100117308 3300026118 Bacteria 2516
710 Ga0207675_100259908 3300026118 Bacteria 1682
711 Ga0207675_100297678 3300026118 Bacteria 1571
712 Ga0207675_100578938 3300026118 Bacteria 1124
713 Ga0207675_101205763 3300026118 Bacteria 777
714 Ga0207683_10091014 3300026121 Bacteria 2717
715 Ga0207683_10137221 3300026121 Bacteria 2202
716 Ga0207683_10447263 3300026121 Bacteria 1191
717 Ga0207698_10104326 3300026142 Bacteria 2358
718 Ga0207698_10108880 3300026142 Bacteria 2317
719 Ga0207698_10153753 3300026142 Bacteria 2001
720 Ga0207698_10324211 3300026142 Bacteria 1444
721 Ga0207698_10343497 3300026142 Bacteria 1407
722 Ga0207698_10352034 3300026142 Bacteria 1391
723 Ga0207698_10582023 3300026142 Bacteria 1101
724 Ga0209995_1013670 3300027471 Bacteria 1330
725 Ga0209970_1035771 3300027614 Bacteria 873
726 Ga0209974_10004316 3300027876 Bacteria 5055
727 Ga0207428_10565750 3300027907 Bacteria 821
728 Ga0268266_10000181 3300028379 Bacteria 112266
729 Ga0268266_10000186 3300028379 Bacteria 110448
730 Ga0268266_10003655 3300028379 Bacteria 15198
731 Ga0268266_10008063 3300028379 Bacteria 9411
732 Ga0268266_10016418 3300028379 Bacteria 6329
733 Ga0268266_10025018 3300028379 Bacteria 5082
734 Ga0268266_10070939 3300028379 Bacteria 3019
735 Ga0268266_10453593 3300028379 Bacteria 1219
736 Ga0268266_10906914 3300028379 Bacteria 852
737 Ga0268266_11090437 3300028379 Bacteria 773
738 Ga0268265_10008413 3300028380 Bacteria 6965
739 Ga0268265_10016291 3300028380 Bacteria 5102
740 Ga0268265_10020742 3300028380 Bacteria 4592
741 Ga0268265_10022339 3300028380 Bacteria 4443
742 Ga0268265_10037950 3300028380 Bacteria 3540
743 Ga0268265_10051243 3300028380 Bacteria 3115
744 Ga0268265_10130452 3300028380 Bacteria 2087
745 Ga0268265_10210533 3300028380 Bacteria 1693
746 Ga0268264_10001116 3300028381 Bacteria 26474
747 Ga0268264_10001400 3300028381 Bacteria 22542
748 Ga0268264_10023809 3300028381 Bacteria 4995
749 Ga0268264_10043976 3300028381 Bacteria 3703
750 Ga0268264_10085095 3300028381 Bacteria 2713
751 Ga0268264_10117436 3300028381 Bacteria 2340
752 Ga0268264_10183156 3300028381 Bacteria 1904
753 Ga0268264_10493114 3300028381 Bacteria 1193
754 Ga0268264_11124247 3300028381 Bacteria 794
755 Ga0316182_1213046 3300030745 Bacteria 1005
756 Ga0307513_10303786 3300031456 Bacteria 1361
757 Ga0307408_100020943 3300031548 Bacteria 4420
758 Ga0307408_100024059 3300031548 Bacteria 4154
759 Ga0307408_100563287 3300031548 Bacteria 1007
760 Ga0307408_100634831 3300031548 Bacteria 953
761 Ga0307408_100798497 3300031548 Bacteria 856
762 Ga0307405_10031853 3300031731 Bacteria 3109
763 Ga0307405_10071538 3300031731 Bacteria 2232
764 Ga0307405_10119357 3300031731 Bacteria 1802
765 Ga0307405_10209292 3300031731 Bacteria 1422
766 Ga0307413_10011442 3300031824 Bacteria 4364
767 Ga0307413_10036719 3300031824 Bacteria 2823
768 Ga0307413_10065222 3300031824 Bacteria 2266
769 Ga0307413_10102539 3300031824 Bacteria 1894
770 Ga0307413_10122285 3300031824 Bacteria 1765
771 Ga0307413_10197929 3300031824 Bacteria 1448
772 Ga0307413_10284062 3300031824 Bacteria 1246
773 Ga0307410_10001109 3300031852 Bacteria 11774
774 Ga0307410_10001983 3300031852 Bacteria 9632
775 Ga0307410_10005950 3300031852 Bacteria 6524
776 Ga0307410_10009490 3300031852 Bacteria 5457
777 Ga0307410_10036110 3300031852 Bacteria 3215
778 Ga0307410_10065793 3300031852 Bacteria 2494
779 Ga0307410_10138972 3300031852 Bacteria 1794
780 Ga0307410_10159907 3300031852 Bacteria 1686
781 Ga0307410_10212165 3300031852 Bacteria 1484
782 Ga0307410_10246929 3300031852 Bacteria 1386
783 Ga0307406_10003004 3300031901 Bacteria 9180
784 Ga0307406_10027193 3300031901 Bacteria 3444
785 Ga0307406_10210561 3300031901 Bacteria 1438
786 Ga0307406_10567616 3300031901 Bacteria 931
787 Ga0307407_10007183 3300031903 Bacteria 5026
788 Ga0307407_10013518 3300031903 Bacteria 3966
789 Ga0307407_10018552 3300031903 Bacteria 3521
790 Ga0307407_10023132 3300031903 Bacteria 3237
791 Ga0307407_10027273 3300031903 Bacteria 3036
792 Ga0307407_10220723 3300031903 Bacteria 1281
793 Ga0307412_10017447 3300031911 Bacteria 4296
794 Ga0307412_10022914 3300031911 Bacteria 3835
795 Ga0307412_10067812 3300031911 Bacteria 2424
796 Ga0307412_10097167 3300031911 Bacteria 2075
797 Ga0307412_10159953 3300031911 Bacteria 1672
798 Ga0307412_10787861 3300031911 Bacteria 824
799 Ga0307412_10946735 3300031911 Bacteria 758
800 Ga0307409_100006129 3300031995 Bacteria 7029
801 Ga0307409_100142960 3300031995 Bacteria 2064
802 Ga0307409_100177520 3300031995 Bacteria 1881
803 Ga0307409_100198662 3300031995 Bacteria 1792
804 Ga0307409_100575369 3300031995 Bacteria 1109
805 Ga0307409_100664043 3300031995 Bacteria 1038
806 Ga0307409_100730049 3300031995 Bacteria 992
807 Ga0307409_101637148 3300031995 Bacteria 672
808 Ga0307416_100010691 3300032002 Bacteria 6079
809 Ga0307416_100078211 3300032002 Bacteria 2782
810 Ga0307416_100257754 3300032002 Bacteria 1702
811 Ga0307416_100273757 3300032002 Bacteria 1660
812 Ga0307416_100278791 3300032002 Bacteria 1647
813 Ga0307416_100724849 3300032002 Bacteria 1085
814 Ga0307416_100958525 3300032002 Bacteria 957
815 Ga0307414_10006430 3300032004 Bacteria 6553
816 Ga0307414_10014409 3300032004 Bacteria 4739
817 Ga0307414_10038973 3300032004 Bacteria 3197
818 Ga0307414_10059361 3300032004 Bacteria 2700
819 Ga0307414_10134842 3300032004 Bacteria 1923
820 Ga0307414_10198504 3300032004 Bacteria 1630
821 Ga0307414_10274554 3300032004 Bacteria 1413
822 Ga0307414_10423583 3300032004 Bacteria 1161
823 Ga0307414_10835552 3300032004 Bacteria 841
824 Ga0307411_10000508 3300032005 Bacteria 13662
825 Ga0307411_10005676 3300032005 Bacteria 6160
826 Ga0307411_10026247 3300032005 Bacteria 3505
827 Ga0307411_10030116 3300032005 Bacteria 3323
828 Ga0307411_10031926 3300032005 Bacteria 3247
829 Ga0307411_10043405 3300032005 Bacteria 2876
830 Ga0307411_10049718 3300032005 Bacteria 2726
831 Ga0307411_10084722 3300032005 Bacteria 2193
832 Ga0307411_10107049 3300032005 Bacteria 1991
833 Ga0307411_10141520 3300032005 Bacteria 1774
834 Ga0307411_10254539 3300032005 Bacteria 1383
835 Ga0307411_10299473 3300032005 Bacteria 1289
836 Ga0307411_10674163 3300032005 Bacteria 898
837 Ga0307415_100001182 3300032126 Bacteria 12215
838 Ga0307415_100002377 3300032126 Bacteria 9369
839 Ga0307415_100020282 3300032126 Bacteria 4056
840 Ga0307415_100020503 3300032126 Bacteria 4038
841 Ga0307415_100513404 3300032126 Bacteria 1050
842 Ga0307415_100584783 3300032126 Bacteria 991
843 Ga0307415_101088946 3300032126 Bacteria 747
844 Ga0373928_0053281 3300035084 Bacteria 961
845 Ga0373929_0118618 3300035085 Bacteria 683
846 Ga0373940_0034989 3300035088 Bacteria 1358
847 Ga0373953_0189046 3300035117 Bacteria 889
848 Ga0373954_0009064 3300035118 Bacteria 4375
849 Ga0373956_0024838 3300035119 Bacteria 2586
850 Ga0373960_0223093 3300035121 Bacteria 675
851 Ga0373955_0001018 3300035172 Bacteria 11904
852 Ga0373933_0007341 3300035724 Bacteria 6013
853 Ga0373937_0005515 3300036401 Bacteria 10848
854 Ga0395899_0001361 3300037312 Bacteria 20965
855 Ga0395899_0005114 3300037312 Bacteria 10205
856 Ga0395899_0021025 3300037312 Bacteria 4949
857 Ga0395899_0184368 3300037312 Bacteria 1463
858 Ga0395899_0239029 3300037312 Bacteria 1251
859 Ga0395899_0302492 3300037312 Bacteria 1082
860 Ga0395900_0002081 3300037418 Bacteria 22441
861 Ga0395900_0006125 3300037418 Bacteria 12546
862 Ga0395900_0016950 3300037418 Bacteria 7436
863 Ga0395900_0039289 3300037418 Bacteria 4875
864 Ga0395900_0046003 3300037418 Bacteria 4495
865 Ga0395900_0068292 3300037418 Bacteria 3652
866 Ga0395900_0091380 3300037418 Bacteria 3128
867 Ga0395900_0114551 3300037418 Bacteria 2767
868 Ga0395900_0193284 3300037418 Bacteria 2063
869 Ga0395900_0205218 3300037418 Bacteria 1992
870 Ga0395900_0223348 3300037418 Bacteria 1897
871 Ga0395900_0227359 3300037418 Bacteria 1878
872 Ga0395900_0278812 3300037418 Bacteria 1664
873 Ga0395900_0403081 3300037418 Bacteria 1331
874 Ga0395900_0435968 3300037418 Bacteria 1269
875 Ga0395898_0014149 3300037466 Bacteria 8203
876 Ga0395898_0022648 3300037466 Bacteria 6360
877 Ga0395898_0109722 3300037466 Bacteria 2645
878 Ga0395898_0599104 3300037466 Bacteria 1044
879 Ga0395905_0001637 3300037471 Bacteria 26556
880 Ga0395905_0001970 3300037471 Bacteria 23471
881 Ga0395905_0002407 3300037471 Bacteria 20791
882 Ga0395905_0004662 3300037471 Bacteria 14172
883 Ga0395905_0005740 3300037471 Bacteria 12621
884 Ga0395905_0012298 3300037471 Bacteria 8240
885 Ga0395905_0012766 3300037471 Bacteria 8080
886 Ga0395905_0013474 3300037471 Bacteria 7835
887 Ga0395905_0014116 3300037471 Bacteria 7636
888 Ga0395905_0019027 3300037471 Bacteria 6513
889 Ga0395905_0133679 3300037471 Bacteria 2333
890 Ga0395905_0309530 3300037471 Bacteria 1468
891 Ga0395905_0388328 3300037471 Bacteria 1290
892 Ga0395905_0426500 3300037471 Bacteria 1223
893 Ga0395905_0479310 3300037471 Bacteria 1143
894 Ga0395905_0529947 3300037471 Bacteria 1078
895 Ga0395905_0677833 3300037471 Bacteria 933
896 Ga0395905_0898714 3300037471 Bacteria 788
897 Ga0395905_1029486 3300037471 Bacteria 726
898 Ga0395905_1037295 3300037471 Bacteria 723
899 Ga0395901_0000348 3300038443 Bacteria 56412
900 Ga0395901_0006420 3300038443 Bacteria 11916
901 Ga0395901_0010683 3300038443 Bacteria 9309
902 Ga0395901_0022942 3300038443 Bacteria 6398
903 Ga0395901_0029418 3300038443 Bacteria 5657
904 Ga0395901_0058052 3300038443 Bacteria 4025
905 Ga0395901_0074262 3300038443 Bacteria 3547
906 Ga0395901_0100548 3300038443 Bacteria 3033
907 Ga0395901_0170478 3300038443 Bacteria 2284
908 Ga0395901_0280644 3300038443 Bacteria 1730
909 Ga0395901_0623090 3300038443 Bacteria 1085
910 Ga0395901_0827539 3300038443 Bacteria 913
911 Ga0436365_0050495 3300039437 Bacteria 1154
912 Ga0436365_0380271 3300039437 Bacteria 11752
913 Ga0436365_0524748 3300039437 Bacteria 2935
914 Ga0451841_0855332 3300041498 Bacteria 906
915 Ga0439445_0025733 3300042004 Bacteria 1503
916 Ga0439448_0004426 3300042005 Bacteria 3964
917 Ga0439432_018497 3300042006 Bacteria 2328
918 Ga0439432_077746 3300042006 Bacteria 1007
919 Ga0450917_002072 3300042120 Bacteria 1428
920 Ga0450905_005266 3300042142 Bacteria 1736
921 Ga0450889_005517 3300042144 Bacteria 1261
922 Ga0439458_0005611 3300042157 Bacteria 2818
923 Ga0439464_0252342 3300042439 Bacteria 570
924 Ga0453684_1395941 3300044712 Bacteria 727
925 Ga0466957_0008635 3300044842 Bacteria 5800
926 Ga0466967_0340834 3300045976 Bacteria 1449
927 Ga0495590_0056840 3300046457 Bacteria 1368
928 Ga0495610_0184319 3300046512 Bacteria 866
929 Ga0495643_0030403 3300046522 Bacteria 3016
930 Ga0495621_0193124 3300046539 Bacteria 817
931 Ga0495656_0010946 3300046615 Bacteria 3316
932 Ga0495668_0002629 3300046616 Bacteria 14445
933 Ga0495668_0012129 3300046616 Bacteria 5124
934 Ga0495668_0033719 3300046616 Bacteria 2875
935 Ga0495659_0040181 3300046664 Bacteria 1666
936 Ga0495623_0057091 3300046679 Bacteria 2456
937 Ga0495669_0000187 3300046684 Bacteria 38516
938 Ga0495669_0022805 3300046684 Bacteria 2721
939 Ga0495669_0032755 3300046684 Bacteria 2285
940 Ga0495669_0072475 3300046684 Bacteria 1572
941 Ga0495669_0140863 3300046684 Bacteria 1138
942 Ga0495670_0338970 3300046691 Bacteria 808
943 Ga0495686_0220011 3300047472 Bacteria 1081
944 Ga0495602_0030312 3300048088 Bacteria 5133
945 Ga0496100_0036407 3300048903 Bacteria 3104
946 Ga0496101_0009614 3300048904 Bacteria 6361
947 Ga0496101_0331878 3300048904 Bacteria 1194
948 Ga0496102_0074555 3300048905 Bacteria 3119
949 Ga0496102_0390607 3300048905 Bacteria 1309
950 Ga0496103_0060124 3300048906 Bacteria 2361
951 Ga0496103_0152868 3300048906 Bacteria 1479
952 Ga0496103_0592997 3300048906 Bacteria 706
953 Ga0496104_0133285 3300048907 Bacteria 2387
954 Ga0496106_0011914 3300048909 Bacteria 6419
955 Ga0496106_0031923 3300048909 Bacteria 3925
956 Ga0496106_0449961 3300048909 Bacteria 1035
957 Ga0496107_0000451 3300048910 Bacteria 22422
958 Ga0496107_0010601 3300048910 Bacteria 6408
959 Ga0496107_0454941 3300048910 Bacteria 951
960 Ga0496108_0000190 3300048911 Bacteria 57059
961 Ga0496108_0010554 3300048911 Bacteria 7501
962 Ga0496108_0115375 3300048911 Bacteria 2300
963 Ga0496109_0007454 3300048912 Bacteria 9264
964 Ga0496109_0046837 3300048912 Bacteria 3928
965 Ga0496109_0795341 3300048912 Bacteria 884
966 Ga0496110_0008307 3300048913 Bacteria 8348
967 Ga0496110_0078229 3300048913 Bacteria 2944
968 Ga0496111_0015991 3300048914 Bacteria 5163
969 Ga0496111_0047024 3300048914 Bacteria 3107
970 Ga0496112_0000197 3300048915 Bacteria 39454
971 Ga0496112_0408808 3300048915 Bacteria 1296
972 Ga0496113_0005601 3300048916 Bacteria 7856
973 Ga0496113_0028702 3300048916 Bacteria 4005
974 Ga0496114_0017477 3300048917 Bacteria 5789
975 Ga0496114_1179708 3300048917 Bacteria 652
976 Ga0501034_0080637 3300049571 Bacteria 3257
977 Ga0501069_0016298 3300049585 Bacteria 3989
978 Ga0501071_0207477 3300049587 Bacteria 1473
979 Ga0501074_0235411 3300049590 Bacteria 1303
980 Ga0501247_028817 3300049677 Bacteria 750
981 Ga0501225_0064085 3300049705 Bacteria 1037
982 nmdc:mga03683_93970_c1 3300050489 Bacteria 1310
983 nmdc:mga00v17_231110_c1 3300050491 Bacteria 1198
984 nmdc:mga00v17_3686_c1 3300050491 Bacteria 7914
985 nmdc:mga05p37_856268_c1 3300050507 Bacteria 986
986 nmdc:mga09592_775019_c1 3300050508 Bacteria 812
987 nmdc:mga0n895_198556_c1 3300050512 Bacteria 2037
988 nmdc:mga0n895_619408_c1 3300050512 Bacteria 1083
989 nmdc:mga0rr50_581646_c1 3300050513 Bacteria 954
990 nmdc:mga0a205_1022_c1 3300050515 Bacteria 23264
991 Ga0495612_0019584 3300053078 Bacteria 2711
992 Ga0500658_0000029 3300053134 Bacteria 99170
993 Ga0500568_0003256 3300053139 Bacteria 9175
994 Ga0500604_0000025 3300053151 Bacteria 68203
995 Ga0500616_0000254 3300053153 Bacteria 82664
996 Ga0070658_10073731
997 MBSR1b_contig_2711557
998 JGI24736J21556_1024961
999 JGI24741J21665_1026470
1000 JGI24752J21851_1007703
1001 JGI24740J21852_10013175
1002 JGI24740J21852_10047364
1003 JGI24739J22299_10002145
1004 JGI24739J22299_10087764
1005 JGI24737J22298_10000697
1006 JGI24737J22298_10005244
1007 JGI24737J22298_10024936
1008 JGI24737J22298_10061782
1009 JGI24737J22298_10134641
1010 JGI24737J22298_10140921
1011 JGI24735J21928_10134445
1012 JGI24738J21930_10000446
1013 JGI24035J26624_1004344
1014 Ga0065712_10021395
1015 Ga0065712_10328147
1016 Ga0065715_10165560
1017 Ga0070658_10024120
1018 Ga0070658_10038454
1019 Ga0070658_10043493
1020 Ga0070658_10216038
1021 Ga0070658_10436432
1022 Ga0070658_10808721
1023 Ga0070676_10028508
1024 Ga0070676_10172584
1025 Ga0070676_10206086
1026 Ga0070676_10257268
1027 Ga0070676_10343201
1028 Ga0070676_10657959
1029 Ga0070683_100099718
1030 Ga0070683_100423224
1031 Ga0070690_100000954
1032 Ga0070690_100423631
1033 Ga0070670_100022306
1034 Ga0070670_100127672
1035 Ga0070670_100190709
1036 Ga0070670_100576248
1037 Ga0070677_10002219
1038 Ga0070677_10169460
1039 Ga0070677_10278868
1040 Ga0068869_100038388
1041 Ga0068869_100055034
1042 Ga0068869_100211633
1043 Ga0068869_100220076
1044 Ga0068869_100301025
1045 Ga0068869_100612705
1046 Ga0070666_10000218
1047 Ga0070666_10011260
1048 Ga0070666_10246767
1049 Ga0070680_100001389
1050 Ga0070680_100001897
1051 Ga0070680_100703299
1052 Ga0070682_100310838
1053 Ga0068868_100001629
1054 Ga0068868_100052370
1055 Ga0070660_100002060
1056 Ga0070660_100002440
1057 Ga0070660_100006187
1058 Ga0070660_100028450
1059 Ga0070660_100112119
1060 Ga0070660_100156943
1061 Ga0070660_100166686
1062 Ga0070660_100250285
1063 Ga0070660_100351977
1064 Ga0070660_100358794
1065 Ga0070660_100392454
1066 Ga0070660_100710976
1067 Ga0070689_100262526
1068 Ga0070689_100471821
1069 Ga0070687_100623663
1070 Ga0070661_100000042
1071 Ga0070661_100001002
1072 Ga0070661_100003895
1073 Ga0070661_100051557
1074 Ga0070661_100070502
1075 Ga0070661_100141545
1076 Ga0070661_100174670
1077 Ga0070661_100584023
1078 Ga0070661_100632166
1079 Ga0070692_10018230
1080 Ga0070692_10284987
1081 Ga0070668_100000111
1082 Ga0070668_100006855
1083 Ga0070668_100019531
1084 Ga0070668_100043980
1085 Ga0070668_100111391
1086 Ga0070668_100312488
1087 Ga0070668_100459944
1088 Ga0070669_100026741
1089 Ga0070669_100028977
1090 Ga0070669_100048085
1091 Ga0070669_100255242
1092 Ga0070669_100839072
1093 Ga0070669_100883802
1094 Ga0070675_100006392
1095 Ga0070675_100041173
1096 Ga0070671_100000136
1097 Ga0070671_100000394
1098 Ga0070671_100002007
1099 Ga0070671_100026607
1100 Ga0070671_100034359
1101 Ga0070671_100042833
1102 Ga0070671_100078318
1103 Ga0070671_100151343
1104 Ga0070671_100302617
1105 Ga0070674_100011836
1106 Ga0070674_100060705
1107 Ga0070674_100320734
1108 Ga0070674_100385110
1109 Ga0070673_100017304
1110 Ga0070673_100021512
1111 Ga0070673_100027214
1112 Ga0070673_100027432
1113 Ga0070673_100243835
1114 Ga0070673_100605943
1115 Ga0070673_100906303
1116 Ga0070673_101116175
1117 Ga0070673_101231906
1118 Ga0070688_100456364
1119 Ga0070659_100000600
1120 Ga0070659_100000688
1121 Ga0070659_100001283
1122 Ga0070659_100004264
1123 Ga0070659_100014262
1124 Ga0070659_100016191
1125 Ga0070659_100019675
1126 Ga0070659_100195210
1127 Ga0070659_100233425
1128 Ga0070659_100258687
1129 Ga0070659_101071541
1130 Ga0070667_100000943
1131 Ga0070667_100002912
1132 Ga0070667_100033156
1133 Ga0070667_100048608
1134 Ga0070667_100051964
1135 Ga0070667_100053711
1136 Ga0070667_100109580
1137 Ga0070667_100175166
1138 Ga0070667_100225674
1139 Ga0070667_100232459
1140 Ga0070667_100287947
1141 Ga0070714_100278371
1142 Ga0070714_100446331
1143 Ga0070705_100316156
1144 Ga0070694_100012251
1145 Ga0070694_100083314
1146 Ga0070663_100034762
1147 Ga0070663_100035748
1148 Ga0070663_100087657
1149 Ga0070663_100733707
1150 Ga0070663_101055411
1151 Ga0070663_101066674
1152 Ga0070678_100053001
1153 Ga0070678_100101655
1154 Ga0070678_100343758
1155 Ga0070662_100000789
1156 Ga0070662_100002019
1157 Ga0070662_100002900
1158 Ga0070662_100003145
1159 Ga0070662_100007179
1160 Ga0070662_100038341
1161 Ga0070662_100058165
1162 Ga0070662_100250744
1163 Ga0070662_100321546
1164 Ga0070662_100331496
1165 Ga0070662_100332639
1166 Ga0070662_100604349
1167 Ga0070681_10008440
1168 Ga0070681_10027530
1169 Ga0070681_10064213
1170 Ga0068867_100002913
1171 Ga0068867_100075565
1172 Ga0068867_100182254
1173 Ga0068867_100190510
1174 Ga0070685_10643801
1175 Ga0070706_101281910
1176 Ga0070698_100639101
1177 Ga0070679_100000002
1178 Ga0070679_100009731
1179 Ga0070679_100193486
1180 Ga0070679_100344272
1181 Ga0070679_100808674
1182 Ga0070684_100042738
1183 Ga0068853_100000308
1184 Ga0068853_100018930
1185 Ga0068853_100108331
1186 Ga0068853_100115724
1187 Ga0068853_100120046
1188 Ga0068853_100284852
1189 Ga0068853_100446570
1190 Ga0068853_100493096
1191 Ga0068853_100575347
1192 Ga0070672_100005607
1193 Ga0070672_100081468
1194 Ga0070672_100099533
1195 Ga0070672_100137864
1196 Ga0070672_100210806
1197 Ga0070672_100224292
1198 Ga0070672_100392945
1199 Ga0070672_100412691
1200 Ga0070686_100024654
1201 Ga0070686_100611190
1202 Ga0070696_100005316
1203 Ga0070696_100032106
1204 Ga0070696_100209580
1205 Ga0070696_100426784
1206 Ga0070693_100101880
1207 Ga0070693_100164296
1208 Ga0070665_100000361
1209 Ga0070665_100001120
1210 Ga0070665_100004569
1211 Ga0070665_100016369
1212 Ga0070665_100130599
1213 Ga0070665_100174313
1214 Ga0070665_100177607
1215 Ga0070665_100195580
1216 Ga0070665_100213269
1217 Ga0070665_100225012
1218 Ga0070665_100808870
1219 Ga0070665_100884807
1220 Ga0070704_100140458
1221 Ga0068855_100009752
1222 Ga0068855_100026636
1223 Ga0068855_100100940
1224 Ga0068855_100164531
1225 Ga0068855_100269625
1226 Ga0068855_100803332
1227 Ga0070664_100001343
1228 Ga0070664_100004417
1229 Ga0070664_100009869
1230 Ga0070664_100012867
1231 Ga0070664_100028635
1232 Ga0070664_100031753
1233 Ga0070664_100048720
1234 Ga0070664_100220263
1235 Ga0070664_100289807
1236 Ga0070664_100912028
1237 Ga0070664_101213651
1238 Ga0068857_100004098
1239 Ga0068857_100061007
1240 Ga0068857_100142297
1241 Ga0068857_100169920
1242 Ga0068857_100200616
1243 Ga0068857_100260817
1244 Ga0068857_100604328
1245 Ga0068854_100000967
1246 Ga0068854_100007418
1247 Ga0068854_100011160
1248 Ga0068854_100022665
1249 Ga0068854_100054557
1250 Ga0068854_100067213
1251 Ga0068854_100408825
1252 Ga0068856_100068808
1253 Ga0068856_100103973
1254 Ga0068856_101262703
1255 Ga0068852_100009541
1256 Ga0068852_100059862
1257 Ga0068852_100136665
1258 Ga0068852_100259559
1259 Ga0068852_100315010
1260 Ga0068859_100006138
1261 Ga0068859_100010244
1262 Ga0068859_100020574
1263 Ga0068859_100023062
1264 Ga0068859_100066679
1265 Ga0068859_100078095
1266 Ga0068859_100151551
1267 Ga0068859_100179236
1268 Ga0068859_100467166
1269 Ga0068859_100573228
1270 Ga0068859_101524736
1271 Ga0068864_100000549
1272 Ga0068864_100001958
1273 Ga0068864_100015634
1274 Ga0068864_100016637
1275 Ga0068864_100125712
1276 Ga0068864_100262675
1277 Ga0068866_10105396
1278 Ga0068866_10257268
1279 Ga0068861_100082333
1280 Ga0068861_100258112
1281 Ga0068861_100450754
1282 Ga0068861_100974734
1283 Ga0068851_10185266
1284 Ga0068851_10228763
1285 Ga0068851_10240354
1286 Ga0068870_10200486
1287 Ga0068863_100000171
1288 Ga0068863_100000494
1289 Ga0068863_100001525
1290 Ga0068863_100006151
1291 Ga0068863_100037387
1292 Ga0068863_100045519
1293 Ga0068863_100076289
1294 Ga0068863_100093481
1295 Ga0068858_100000377
1296 Ga0068858_100006056
1297 Ga0068858_100008046
1298 Ga0068858_100008426
1299 Ga0068858_100027010
1300 Ga0068858_100471181
1301 Ga0068860_100002137
1302 Ga0068860_100025139
1303 Ga0068860_100048885
1304 Ga0068860_100057661
1305 Ga0068860_100084061
1306 Ga0068860_100096396
1307 Ga0068860_100333904
1308 Ga0068860_100357889
1309 Ga0068860_100440238
1310 Ga0068860_100790811
1311 Ga0068862_100001399
1312 Ga0068862_100004254
1313 Ga0068862_100024078
1314 Ga0068862_100086523
1315 Ga0068862_100094352
1316 Ga0068862_100094722
1317 Ga0068862_100837853
1318 Ga0068862_101388962
1319 Ga0081539_10008020
1320 Ga0081539_10063485
1321 Ga0075364_10014715
1322 Ga0075362_10193611
1323 Ga0075369_10155970
1324 Ga0097621_100029120
1325 Ga0097621_100145985
1326 Ga0097621_101204768
1327 Ga0068871_100009749
1328 Ga0068871_100154159
1329 Ga0075430_100004853
1330 Ga0075433_10004236
1331 Ga0075434_100036538
1332 Ga0068865_100029875
1333 Ga0068865_100055592
1334 Ga0068865_100309644
1335 Ga0068865_100472841
1336 Ga0068865_100785078
1337 Ga0068865_100800496
1338 Ga0097620_100006138
1339 Ga0097620_100010244
1340 Ga0097620_100020574
1341 Ga0097620_100023062
1342 Ga0097620_100066673
1343 Ga0097620_100078096
1344 Ga0097620_100151554
1345 Ga0097620_100179240
1346 Ga0097620_100467164
1347 Ga0097620_100573200
1348 Ga0097620_101524898
1349 Ga0075435_100611124
1350 Ga0075435_100735408
1351 Ga0075435_101285152
1352 Ga0105240_10228632
1353 Ga0111539_10017823
1354 Ga0105245_10012139
1355 Ga0105245_10214206
1356 Ga0105245_10262537
1357 Ga0105245_10569255
1358 Ga0105247_10282866
1359 Ga0105243_10081201
1360 Ga0105243_10123755
1361 Ga0105243_10359616
1362 Ga0105241_10055169
1363 Ga0105241_10594674
1364 Ga0105242_10131306
1365 Ga0105248_10000075
1366 Ga0105248_10001129
1367 Ga0105248_10002385
1368 Ga0105248_10002706
1369 Ga0105248_10023645
1370 Ga0105248_10052091
1371 Ga0105248_10066955
1372 Ga0105248_10292617
1373 Ga0105237_10026088
1374 Ga0105237_10793455
1375 Ga0105238_10090913
1376 Ga0105238_10206295
1377 Ga0105238_10593911
1378 Ga0105238_10605586
1379 Ga0105238_10982006
1380 Ga0105238_11369520
1381 Ga0105238_11642338
1382 Ga0105249_10001067
1383 Ga0105249_10002386
1384 Ga0105249_10021916
1385 Ga0105249_10164452
1386 Ga0105249_11513694
1387 Ga0105239_10360171
1388 Ga0105239_12427104
1389 Ga0105246_10061780
1390 Ga0105246_10191646
1391 Ga0105246_10319904
1392 Ga0157373_10002136
1393 Ga0157373_10027889
1394 Ga0157373_10066403
1395 Ga0157373_10149138
1396 Ga0157373_10316119
1397 Ga0157371_10000802
1398 Ga0157371_10001127
1399 Ga0157371_10026486
1400 Ga0157371_10051493
1401 Ga0157371_10551672
1402 Ga0157371_10599866
1403 Ga0157370_10003539
1404 Ga0157369_10001462
1405 Ga0157369_10976431
1406 Ga0157378_10007324
1407 Ga0157378_10050569
1408 Ga0157378_10269221
1409 Ga0157378_10478451
1410 Ga0163162_10006173
1411 Ga0163162_10015757
1412 Ga0163162_10072989
1413 Ga0163162_10748770
1414 Ga0157372_10000426
1415 Ga0157372_10034395
1416 Ga0157372_10091777
1417 Ga0157372_10168674
1418 Ga0157372_10600282
1419 Ga0157375_10064647
1420 Ga0157375_10470392
1421 Ga0157375_10936493
1422 Ga0157375_11060756
1423 Ga0157375_11412051
1424 Ga0157375_11534668
1425 Ga0163163_10000161
1426 Ga0163163_10084563
1427 Ga0157380_10467287
1428 Ga0182008_10148544
1429 Ga0157377_10132001
1430 Ga0157377_10318183
1431 Ga0157377_10381915
1432 Ga0157377_10674657
1433 Ga0157379_10003023
1434 Ga0157379_10015484
1435 Ga0157379_10424753
1436 Ga0157379_10859794
1437 Ga0157379_11132681
1438 Ga0206356_10238888
1439 Ga0213876_10067042
1440 Ga0213876_10079202
1441 Ga0213876_10420508
1442 Ga0207697_10000146
1443 Ga0207697_10111499
1444 Ga0207697_10211892
1445 Ga0207656_10144322
1446 Ga0207682_10003467
1447 Ga0207682_10356873
1448 Ga0207688_10000514
1449 Ga0207688_10069064
1450 Ga0207688_10076092
1451 Ga0207680_10000232
1452 Ga0207680_10009438
1453 Ga0207680_10027721
1454 Ga0207647_10000073
1455 Ga0207647_10001707
1456 Ga0207647_10014221
1457 Ga0207647_10057094
1458 Ga0207647_10071080
1459 Ga0207647_10071436
1460 Ga0207699_10445834
1461 Ga0207645_10014645
1462 Ga0207645_10015778
1463 Ga0207645_10032935
1464 Ga0207645_10047280
1465 Ga0207645_10145886
1466 Ga0207645_10225289
1467 Ga0207645_10235014
1468 Ga0207645_10237637
1469 Ga0207645_10501034
1470 Ga0207645_10515316
1471 Ga0207643_10236232
1472 Ga0207643_10567643
1473 Ga0207643_10580328
1474 Ga0207705_10011498
1475 Ga0207705_10011927
1476 Ga0207654_10237190
1477 Ga0207707_10095915
1478 Ga0207660_10001181
1479 Ga0207660_10880796
1480 Ga0207662_10363967
1481 Ga0207657_10000453
1482 Ga0207657_10002427
1483 Ga0207657_10006164
1484 Ga0207657_10007101
1485 Ga0207657_10017518
1486 Ga0207657_10094350
1487 Ga0207657_10108375
1488 Ga0207657_10108620
1489 Ga0207657_10209062
1490 Ga0207657_10227692
1491 Ga0207657_10320976
1492 Ga0207657_10330486
1493 Ga0207657_10401814
1494 Ga0207657_10594868
1495 Ga0207649_10000047
1496 Ga0207649_10000846
1497 Ga0207649_10098488
1498 Ga0207649_10276898
1499 Ga0207652_10000001
1500 Ga0207652_10000002
1501 Ga0207652_10001787
1502 Ga0207652_10292359
1503 Ga0207652_10357606
1504 Ga0207681_10006610
1505 Ga0207681_10008684
1506 Ga0207681_10023769
1507 Ga0207681_10038517
1508 Ga0207681_10179411
1509 Ga0207681_10192270
1510 Ga0207681_10549111
1511 Ga0207681_10771409
1512 Ga0207694_10193055
1513 Ga0207694_10258407
1514 Ga0207694_10462312
1515 Ga0207650_10069813
1516 Ga0207650_10189401
1517 Ga0207650_10266316
1518 Ga0207650_10329826
1519 Ga0207650_10339034
1520 Ga0207659_10021964
1521 Ga0207659_10120807
1522 Ga0207659_10180388
1523 Ga0207659_10450490
1524 Ga0207687_10005732
1525 Ga0207687_10037977
1526 Ga0207687_10187378
1527 Ga0207644_10000046
1528 Ga0207644_10010412
1529 Ga0207644_10025513
1530 Ga0207644_10041866
1531 Ga0207644_10086341
1532 Ga0207644_10148168
1533 Ga0207690_10000467
1534 Ga0207690_10001145
1535 Ga0207690_10006662
1536 Ga0207690_10012594
1537 Ga0207690_10020599
1538 Ga0207690_10034136
1539 Ga0207690_10055904
1540 Ga0207690_10152732
1541 Ga0207690_10169545
1542 Ga0207690_10262709
1543 Ga0207690_10396975
1544 Ga0207690_10417413
1545 Ga0207690_10625382
1546 Ga0207690_10664855
1547 Ga0207706_10000308
1548 Ga0207706_10000420
1549 Ga0207706_10001411
1550 Ga0207706_10008518
1551 Ga0207706_10008832
1552 Ga0207706_10009786
1553 Ga0207706_10031668
1554 Ga0207706_10075212
1555 Ga0207706_10083005
1556 Ga0207706_10092073
1557 Ga0207706_10116627
1558 Ga0207706_10119003
1559 Ga0207706_10120709
1560 Ga0207706_10132406
1561 Ga0207706_10132669
1562 Ga0207706_10586166
1563 Ga0207706_10655635
1564 Ga0207686_10372114
1565 Ga0207709_10049168
1566 Ga0207709_10159115
1567 Ga0207709_10388644
1568 Ga0207670_10026144
1569 Ga0207670_10500254
1570 Ga0207669_10027828
1571 Ga0207669_10071126
1572 Ga0207669_10244774
1573 Ga0207669_10696012
1574 Ga0207704_10027511
1575 Ga0207704_10211264
1576 Ga0207691_10017563
1577 Ga0207691_10084893
1578 Ga0207691_10132178
1579 Ga0207691_10138258
1580 Ga0207691_10148914
1581 Ga0207691_10158154
1582 Ga0207691_10244859
1583 Ga0207691_10282003
1584 Ga0207691_10380170
1585 Ga0207711_10000281
1586 Ga0207711_10000709
1587 Ga0207711_10006481
1588 Ga0207711_10021706
1589 Ga0207711_10023108
1590 Ga0207711_10046344
1591 Ga0207711_10065974
1592 Ga0207711_10107536
1593 Ga0207711_10438618
1594 Ga0207689_10000327
1595 Ga0207689_10008537
1596 Ga0207689_10127557
1597 Ga0207689_10180337
1598 Ga0207689_10291666
1599 Ga0207661_10032518
1600 Ga0207661_10424776
1601 Ga0207661_10529923
1602 Ga0207679_10001350
1603 Ga0207679_10010750
1604 Ga0207679_10027892
1605 Ga0207679_10042271
1606 Ga0207679_10049681
1607 Ga0207679_10234111
1608 Ga0207679_10830273
1609 Ga0207679_11046469
1610 Ga0207679_11058111
1611 Ga0207667_10003530
1612 Ga0207667_10032263
1613 Ga0207667_10044154
1614 Ga0207667_10082860
1615 Ga0207667_10439577
1616 Ga0207667_10662631
1617 Ga0207667_10991431
1618 Ga0207667_11182241
1619 Ga0207651_10003271
1620 Ga0207651_10003439
1621 Ga0207651_10010387
1622 Ga0207651_10103068
1623 Ga0207651_10169084
1624 Ga0207651_10288449
1625 Ga0207651_10291478
1626 Ga0207651_10472020
1627 Ga0207651_10612645
1628 Ga0207651_10931987
1629 Ga0207712_10121822
1630 Ga0207712_10307410
1631 Ga0207668_10000091
1632 Ga0207668_10000136
1633 Ga0207668_10078040
1634 Ga0207668_10218331
1635 Ga0207668_10699252
1636 Ga0207640_10004758
1637 Ga0207640_10036856
1638 Ga0207640_10037441
1639 Ga0207640_10078140
1640 Ga0207640_10171186
1641 Ga0207640_10237522
1642 Ga0207640_10372754
1643 Ga0207658_10003998
1644 Ga0207658_10004960
1645 Ga0207658_10012080
1646 Ga0207658_10013842
1647 Ga0207658_10031954
1648 Ga0207658_10051480
1649 Ga0207658_10065086
1650 Ga0207658_10144116
1651 Ga0207658_10201348
1652 Ga0207658_10409146
1653 Ga0207658_10566713
1654 Ga0207677_10002105
1655 Ga0207677_10080792
1656 Ga0207677_10177366
1657 Ga0207703_10001491
1658 Ga0207703_10004254
1659 Ga0207703_10005034
1660 Ga0207703_10024225
1661 Ga0207703_10027692
1662 Ga0207703_10028397
1663 Ga0207703_10244482
1664 Ga0207703_10949129
1665 Ga0207639_10000427
1666 Ga0207639_10075021
1667 Ga0207639_10118551
1668 Ga0207639_10296855
1669 Ga0207639_10613906
1670 Ga0207678_10002798
1671 Ga0207678_10011895
1672 Ga0207678_10013514
1673 Ga0207678_10017485
1674 Ga0207678_10452959
1675 Ga0207678_10798705
1676 Ga0207702_10036981
1677 Ga0207702_10050716
1678 Ga0207641_10000001
1679 Ga0207641_10002125
1680 Ga0207641_10004708
1681 Ga0207641_10094560
1682 Ga0207641_10110693
1683 Ga0207641_10408947
1684 Ga0207641_10502534
1685 Ga0207648_10002010
1686 Ga0207648_10012509
1687 Ga0207648_10047551
1688 Ga0207648_10210025
1689 Ga0207648_10767214
1690 Ga0207676_10003879
1691 Ga0207676_10138246
1692 Ga0207676_10148748
1693 Ga0207674_10000139
1694 Ga0207674_10008456
1695 Ga0207674_10008693
1696 Ga0207674_10013878
1697 Ga0207674_10016337
1698 Ga0207674_10028196
1699 Ga0207674_10028214
1700 Ga0207674_10053547
1701 Ga0207674_10115766
1702 Ga0207674_10264301
1703 Ga0207674_10519135
1704 Ga0207675_100117308
1705 Ga0207675_100259908
1706 Ga0207675_100297678
1707 Ga0207675_100578938
1708 Ga0207675_101205763
1709 Ga0207683_10091014
1710 Ga0207683_10137221
1711 Ga0207683_10447263
1712 Ga0207698_10104326
1713 Ga0207698_10108880
1714 Ga0207698_10153753
1715 Ga0207698_10324211
1716 Ga0207698_10343497
1717 Ga0207698_10352034
1718 Ga0207698_10582023
1719 Ga0209995_1013670
1720 Ga0209970_1035771
1721 Ga0209974_10004316
1722 Ga0207428_10565750
1723 Ga0268266_10000181
1724 Ga0268266_10000186
1725 Ga0268266_10003655
1726 Ga0268266_10008063
1727 Ga0268266_10016418
1728 Ga0268266_10025018
1729 Ga0268266_10070939
1730 Ga0268266_10453593
1731 Ga0268266_10906914
1732 Ga0268266_11090437
1733 Ga0268265_10008413
1734 Ga0268265_10016291
1735 Ga0268265_10020742
1736 Ga0268265_10022339
1737 Ga0268265_10037950
1738 Ga0268265_10051243
1739 Ga0268265_10130452
1740 Ga0268265_10210533
1741 Ga0268264_10001116
1742 Ga0268264_10001400
1743 Ga0268264_10023809
1744 Ga0268264_10043976
1745 Ga0268264_10085095
1746 Ga0268264_10117436
1747 Ga0268264_10183156
1748 Ga0268264_10493114
1749 Ga0268264_11124247
1750 Ga0316182_1213046
1751 Ga0307513_10303786
1752 Ga0307408_100020943
1753 Ga0307408_100024059
1754 Ga0307408_100563287
1755 Ga0307408_100634831
1756 Ga0307408_100798497
1757 Ga0307405_10031853
1758 Ga0307405_10071538
1759 Ga0307405_10119357
1760 Ga0307405_10209292
1761 Ga0307413_10011442
1762 Ga0307413_10036719
1763 Ga0307413_10065222
1764 Ga0307413_10102539
1765 Ga0307413_10122285
1766 Ga0307413_10197929
1767 Ga0307413_10284062
1768 Ga0307410_10001109
1769 Ga0307410_10001983
1770 Ga0307410_10005950
1771 Ga0307410_10009490
1772 Ga0307410_10036110
1773 Ga0307410_10065793
1774 Ga0307410_10138972
1775 Ga0307410_10159907
1776 Ga0307410_10212165
1777 Ga0307410_10246929
1778 Ga0307406_10003004
1779 Ga0307406_10027193
1780 Ga0307406_10210561
1781 Ga0307406_10567616
1782 Ga0307407_10007183
1783 Ga0307407_10013518
1784 Ga0307407_10018552
1785 Ga0307407_10023132
1786 Ga0307407_10027273
1787 Ga0307407_10220723
1788 Ga0307412_10017447
1789 Ga0307412_10022914
1790 Ga0307412_10067812
1791 Ga0307412_10097167
1792 Ga0307412_10159953
1793 Ga0307412_10787861
1794 Ga0307412_10946735
1795 Ga0307409_100006129
1796 Ga0307409_100142960
1797 Ga0307409_100177520
1798 Ga0307409_100198662
1799 Ga0307409_100575369
1800 Ga0307409_100664043
1801 Ga0307409_100730049
1802 Ga0307409_101637148
1803 Ga0307416_100010691
1804 Ga0307416_100078211
1805 Ga0307416_100257754
1806 Ga0307416_100273757
1807 Ga0307416_100278791
1808 Ga0307416_100724849
1809 Ga0307416_100958525
1810 Ga0307414_10006430
1811 Ga0307414_10014409
1812 Ga0307414_10038973
1813 Ga0307414_10059361
1814 Ga0307414_10134842
1815 Ga0307414_10198504
1816 Ga0307414_10274554
1817 Ga0307414_10423583
1818 Ga0307414_10835552
1819 Ga0307411_10000508
1820 Ga0307411_10005676
1821 Ga0307411_10026247
1822 Ga0307411_10030116
1823 Ga0307411_10031926
1824 Ga0307411_10043405
1825 Ga0307411_10049718
1826 Ga0307411_10084722
1827 Ga0307411_10107049
1828 Ga0307411_10141520
1829 Ga0307411_10254539
1830 Ga0307411_10299473
1831 Ga0307411_10674163
1832 Ga0307415_100001182
1833 Ga0307415_100002377
1834 Ga0307415_100020282
1835 Ga0307415_100020503
1836 Ga0307415_100513404
1837 Ga0307415_100584783
1838 Ga0307415_101088946
1839 Ga0373928_0053281
1840 Ga0373929_0118618
1841 Ga0373940_0034989
1842 Ga0373953_0189046
1843 Ga0373954_0009064
1844 Ga0373956_0024838
1845 Ga0373960_0223093
1846 Ga0373955_0001018
1847 Ga0373933_0007341
1848 Ga0373937_0005515
1849 Ga0395899_0001361
1850 Ga0395899_0005114
1851 Ga0395899_0021025
1852 Ga0395899_0184368
1853 Ga0395899_0239029
1854 Ga0395899_0302492
1855 Ga0395900_0002081
1856 Ga0395900_0006125
1857 Ga0395900_0016950
1858 Ga0395900_0039289
1859 Ga0395900_0046003
1860 Ga0395900_0068292
1861 Ga0395900_0091380
1862 Ga0395900_0114551
1863 Ga0395900_0193284
1864 Ga0395900_0205218
1865 Ga0395900_0223348
1866 Ga0395900_0227359
1867 Ga0395900_0278812
1868 Ga0395900_0403081
1869 Ga0395900_0435968
1870 Ga0395898_0014149
1871 Ga0395898_0022648
1872 Ga0395898_0109722
1873 Ga0395898_0599104
1874 Ga0395905_0001637
1875 Ga0395905_0001970
1876 Ga0395905_0002407
1877 Ga0395905_0004662
1878 Ga0395905_0005740
1879 Ga0395905_0012298
1880 Ga0395905_0012766
1881 Ga0395905_0013474
1882 Ga0395905_0014116
1883 Ga0395905_0019027
1884 Ga0395905_0133679
1885 Ga0395905_0309530
1886 Ga0395905_0388328
1887 Ga0395905_0426500
1888 Ga0395905_0479310
1889 Ga0395905_0529947
1890 Ga0395905_0677833
1891 Ga0395905_0898714
1892 Ga0395905_1029486
1893 Ga0395905_1037295
1894 Ga0395901_0000348
1895 Ga0395901_0006420
1896 Ga0395901_0010683
1897 Ga0395901_0022942
1898 Ga0395901_0029418
1899 Ga0395901_0058052
1900 Ga0395901_0074262
1901 Ga0395901_0100548
1902 Ga0395901_0170478
1903 Ga0395901_0280644
1904 Ga0395901_0623090
1905 Ga0395901_0827539
1906 Ga0436365_0050495
1907 Ga0436365_0380271
1908 Ga0436365_0524748
1909 Ga0451841_0855332
1910 Ga0439445_0025733
1911 Ga0439448_0004426
1912 Ga0439432_018497
1913 Ga0439432_077746
1914 Ga0450917_002072
1915 Ga0450905_005266
1916 Ga0450889_005517
1917 Ga0439458_0005611
1918 Ga0439464_0252342
1919 Ga0453684_1395941
1920 Ga0466957_0008635
1921 Ga0466967_0340834
1922 Ga0495590_0056840
1923 Ga0495610_0184319
1924 Ga0495643_0030403
1925 Ga0495621_0193124
1926 Ga0495656_0010946
1927 Ga0495668_0002629
1928 Ga0495668_0012129
1929 Ga0495668_0033719
1930 Ga0495659_0040181
1931 Ga0495623_0057091
1932 Ga0495669_0000187
1933 Ga0495669_0022805
1934 Ga0495669_0032755
1935 Ga0495669_0072475
1936 Ga0495669_0140863
1937 Ga0495670_0338970
1938 Ga0495686_0220011
1939 Ga0495602_0030312
1940 Ga0496100_0036407
1941 Ga0496101_0009614
1942 Ga0496101_0331878
1943 Ga0496102_0074555
1944 Ga0496102_0390607
1945 Ga0496103_0060124
1946 Ga0496103_0152868
1947 Ga0496103_0592997
1948 Ga0496104_0133285
1949 Ga0496106_0011914
1950 Ga0496106_0031923
1951 Ga0496106_0449961
1952 Ga0496107_0000451
1953 Ga0496107_0010601
1954 Ga0496107_0454941
1955 Ga0496108_0000190
1956 Ga0496108_0010554
1957 Ga0496108_0115375
1958 Ga0496109_0007454
1959 Ga0496109_0046837
1960 Ga0496109_0795341
1961 Ga0496110_0008307
1962 Ga0496110_0078229
1963 Ga0496111_0015991
1964 Ga0496111_0047024
1965 Ga0496112_0000197
1966 Ga0496112_0408808
1967 Ga0496113_0005601
1968 Ga0496113_0028702
1969 Ga0496114_0017477
1970 Ga0496114_1179708
1971 Ga0501034_0080637
1972 Ga0501069_0016298
1973 Ga0501071_0207477
1974 Ga0501074_0235411
1975 Ga0501247_028817
1976 Ga0501225_0064085
1977 nmdc:mga03683_93970_c1
1978 nmdc:mga00v17_231110_c1
1979 nmdc:mga00v17_3686_c1
1980 nmdc:mga05p37_856268_c1
1981 nmdc:mga09592_775019_c1
1982 nmdc:mga0n895_198556_c1
1983 nmdc:mga0n895_619408_c1
1984 nmdc:mga0rr50_581646_c1
1985 nmdc:mga0a205_1022_c1
1986 Ga0495612_0019584
1987 Ga0500658_0000029
1988 Ga0500568_0003256
1989 Ga0500604_0000025
1990 Ga0500616_0000254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04011

LemA

LemA family

36

179

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.9177 36 181
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.8811 36 181
2rld-assembly1.cif.gz_D crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.6529 53 145
2rld-assembly1.cif.gz_D crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5772 53 145
3ajw-assembly1.cif.gz_A structure of flij, a soluble component of flagellar type iii export apparatus 0.5747 33 173
ID Description Score Start End Superfamily
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8658 14 182 1.10.287.1490
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8584 28 196 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8489 28 196 1.20.1440.20
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7824 14 182 1.10.287.1490
af_E7FEI6_24_312_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.6468 31 173 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A257YBN4-F1-model_v4 LemA family protein 0.9788 14 183 GO:0016020
AF-A0A2G9Y108-F1-model_v4 LemA family protein 0.9782 18 182 GO:0016020
AF-A0A7X8BGY4-F1-model_v4 LemA family protein 0.9711 18 165 GO:0016020
AF-A0A2H0FCN0-F1-model_v4 LemA family protein 0.9697 18 183 GO:0016020
AF-K1ADQ1-F1-model_v4 deleted 0.969 17 176

Map