F487735

General Info

Members Datasets Scaffolds Average Seq Length
995 299 989 319

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100075231|Ga0070669_1000752312
Length 352
Sequence MYVIFQLLTISKTGYGTLWIANFLWRKLPNYSMQLPTKLIEEELKIFEVRFKDAVRSQAPLLDRIMRYIVKRKGKQLRPMFVLLSAKLFGQVNEPAYRAASLVELLHTATLVHDDVVDDSEERRGFFSVYALWKNKVSVLVGDYLLAKGLLLSLDNKDHEILHILSDAVRKMSEGELLQLEKARSLNLKEEIYFEIIRNKTASLLASACAAGAWSVSNDEIITQRMRSFGENAGMAFQIKDDLFDYASENIGKPTGNDIKEKKLTLPLIYTLNKADKKIRRQMIYIVKNENKNTEKVKWVISQVKQMGGIEYAIEKMNAYKKTTLDILHEFPESEVRKGLEDLVTFVTDRKY

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
4 2914759650 Rhizosphaericola mali Isolate Rhizosphere
5 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
173 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
199 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
200 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
203 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
207 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
208 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
209 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
260 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
261 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
262 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
263 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
264 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
265 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
266 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
267 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
281 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
286 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
287 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
291 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
292 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
293 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
294 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
297 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.72
Nodule 0
Rhizoplane 0.4
Rhizosphere 93.47
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001060 3300002459 Bacteria 5973
2 rootH1_10018275 3300003316 Bacteria 1721
3 rootH2_10036879 3300003320 Bacteria 11260
4 rootH2_10128061 3300003320 Bacteria 3829
5 rootL2_10212701 3300003322 Bacteria 1271
6 rootH1_10025429 3300003323 Bacteria 14783
7 rootH1_10057654 3300003323 Bacteria 6268
8 rootH1_10085398 3300003323 Bacteria 2835
9 JGI25160J50197_1001628 3300003354 Bacteria 11022
10 Ga0065704_10025997 3300005289 Bacteria 1259
11 Ga0065704_10070301 3300005289 Bacteria 37146
12 Ga0065704_10164499 3300005289 Bacteria 1331
13 Ga0065712_10079489 3300005290 Bacteria 3197
14 Ga0065712_10091704 3300005290 Bacteria 2358
15 Ga0065715_10096080 3300005293 Bacteria 3947
16 Ga0065715_10096521 3300005293 Bacteria 3865
17 Ga0065715_10242450 3300005293 Bacteria 1194
18 Ga0070658_10013142 3300005327 Bacteria 6643
19 Ga0070658_10020168 3300005327 Bacteria 5340
20 Ga0070658_10027444 3300005327 Bacteria 4569
21 Ga0070658_10040238 3300005327 Bacteria 3771
22 Ga0070658_10058295 3300005327 Bacteria 3142
23 Ga0070658_10100691 3300005327 Bacteria 2388
24 Ga0070658_10226556 3300005327 Bacteria 1582
25 Ga0070676_10005951 3300005328 Bacteria 6509
26 Ga0070676_10017107 3300005328 Bacteria 4010
27 Ga0070676_10056334 3300005328 Unclassified 2322
28 Ga0070676_10106375 3300005328 Bacteria 1741
29 Ga0070676_10135821 3300005328 Bacteria 1560
30 Ga0070683_100005030 3300005329 Bacteria 10975
31 Ga0070683_100014181 3300005329 Bacteria 6962
32 Ga0070683_100022645 3300005329 Bacteria 5618
33 Ga0070683_100103936 3300005329 Unclassified 2677
34 Ga0070683_100194390 3300005329 Bacteria 1926
35 Ga0070690_100015309 3300005330 Bacteria 4573
36 Ga0070690_100049311 3300005330 Bacteria 2684
37 Ga0070690_100049609 3300005330 Bacteria 2676
38 Ga0070670_100013127 3300005331 Bacteria 7096
39 Ga0070670_100050764 3300005331 Bacteria 3564
40 Ga0070670_100068547 3300005331 Bacteria 3045
41 Ga0070670_100097475 3300005331 Bacteria 2529
42 Ga0070670_100099416 3300005331 Bacteria 2503
43 Ga0070670_100123107 3300005331 Bacteria 2237
44 Ga0070670_100132256 3300005331 Bacteria 2155
45 Ga0070670_100132902 3300005331 Bacteria 2150
46 Ga0070670_100145977 3300005331 Bacteria 2047
47 Ga0070670_100161959 3300005331 Bacteria 1939
48 Ga0070670_100374672 3300005331 Bacteria 1253
49 Ga0070677_10004223 3300005333 Bacteria 4681
50 Ga0070677_10020799 3300005333 Bacteria 2397
51 Ga0070677_10045428 3300005333 Unclassified 1752
52 Ga0068869_100006968 3300005334 Bacteria 7194
53 Ga0068869_100034971 3300005334 Bacteria 3558
54 Ga0068869_100058844 3300005334 Bacteria 2811
55 Ga0068869_100060978 3300005334 Unclassified 2765
56 Ga0068869_100124301 3300005334 Bacteria 1977
57 Ga0068869_100252213 3300005334 Bacteria 1410
58 Ga0070666_10022787 3300005335 Bacteria 4070
59 Ga0070666_10065164 3300005335 Bacteria 2472
60 Ga0070666_10131998 3300005335 Bacteria 1736
61 Ga0070680_100019063 3300005336 Bacteria 5432
62 Ga0070680_100074299 3300005336 Bacteria 2797
63 Ga0070680_100288735 3300005336 Bacteria 1390
64 Ga0070682_100000039 3300005337 Bacteria 144400
65 Ga0070682_100010074 3300005337 Bacteria 5357
66 Ga0070682_100055319 3300005337 Bacteria 2492
67 Ga0070682_100175659 3300005337 Bacteria 1492
68 Ga0068868_100030457 3300005338 Bacteria 4138
69 Ga0068868_100075943 3300005338 Bacteria 2686
70 Ga0068868_100157333 3300005338 Bacteria 1875
71 Ga0068868_100217058 3300005338 Bacteria 1600
72 Ga0070660_100017076 3300005339 Bacteria 5284
73 Ga0070660_100027207 3300005339 Bacteria 4266
74 Ga0070689_100007198 3300005340 Bacteria 7758
75 Ga0070689_100012023 3300005340 Bacteria 6222
76 Ga0070689_100032097 3300005340 Bacteria 3994
77 Ga0070689_100089799 3300005340 Bacteria 2420
78 Ga0070689_100147001 3300005340 Bacteria 1899
79 Ga0070691_10050890 3300005341 Bacteria 1977
80 Ga0070687_100063133 3300005343 Bacteria 1963
81 Ga0070661_100001685 3300005344 Bacteria 15290
82 Ga0070661_100123187 3300005344 Bacteria 1943
83 Ga0070668_100038487 3300005347 Bacteria 3655
84 Ga0070668_100044686 3300005347 Bacteria 3398
85 Ga0070668_100052239 3300005347 Bacteria 3150
86 Ga0070669_100002558 3300005353 Bacteria 13155
87 Ga0070669_100008912 3300005353 Bacteria 7156
88 Ga0070669_100075231 3300005353 Bacteria 2504
89 Ga0070669_100113987 3300005353 Bacteria 2055
90 Ga0070669_100174144 3300005353 Bacteria 1680
91 Ga0070675_100007641 3300005354 Bacteria 8365
92 Ga0070675_100013996 3300005354 Bacteria 6316
93 Ga0070675_100015691 3300005354 Bacteria 5994
94 Ga0070675_100016926 3300005354 Bacteria 5790
95 Ga0070675_100040169 3300005354 Bacteria 3818
96 Ga0070675_100040597 3300005354 Bacteria 3800
97 Ga0070675_100192054 3300005354 Bacteria 1770
98 Ga0070675_100230584 3300005354 Bacteria 1615
99 Ga0070671_100025467 3300005355 Bacteria 4854
100 Ga0070671_100056731 3300005355 Bacteria 3258
101 Ga0070671_100110618 3300005355 Bacteria 2308
102 Ga0070671_100147640 3300005355 Bacteria 1985
103 Ga0070671_100378025 3300005355 Bacteria 1210
104 Ga0070674_100082865 3300005356 Bacteria 2295
105 Ga0070674_100148760 3300005356 Bacteria 1765
106 Ga0070673_100010236 3300005364 Bacteria 6338
107 Ga0070673_100013685 3300005364 Bacteria 5623
108 Ga0070673_100017650 3300005364 Bacteria 5080
109 Ga0070673_100017942 3300005364 Bacteria 5045
110 Ga0070673_100031215 3300005364 Bacteria 3996
111 Ga0070673_100326645 3300005364 Bacteria 1356
112 Ga0070688_100009216 3300005365 Bacteria 5386
113 Ga0070688_100033246 3300005365 Bacteria 3116
114 Ga0070688_100047565 3300005365 Bacteria 2662
115 Ga0070659_100001692 3300005366 Bacteria 15868
116 Ga0070659_100025437 3300005366 Bacteria 4546
117 Ga0070659_100334287 3300005366 Bacteria 1268
118 Ga0070667_100044065 3300005367 Bacteria 3745
119 Ga0070667_100095364 3300005367 Bacteria 2565
120 Ga0070667_100160068 3300005367 Bacteria 1982
121 Ga0070667_100203722 3300005367 Bacteria 1756
122 Ga0070667_100390176 3300005367 Bacteria 1266
123 Ga0070667_100570917 3300005367 Bacteria 1041
124 Ga0070710_10113268 3300005437 Bacteria 1632
125 Ga0070700_100250550 3300005441 Bacteria 1270
126 Ga0070663_100042752 3300005455 Bacteria 3186
127 Ga0070663_100085844 3300005455 Bacteria 2323
128 Ga0070662_100002983 3300005457 Bacteria 10519
129 Ga0070662_100109349 3300005457 Bacteria 2104
130 Ga0070662_100137558 3300005457 Unclassified 1890
131 Ga0070662_100342345 3300005457 Bacteria 1224
132 Ga0070681_10039686 3300005458 Bacteria 4718
133 Ga0070681_10054898 3300005458 Bacteria 3969
134 Ga0070681_10059457 3300005458 Bacteria 3802
135 Ga0070681_10068147 3300005458 Bacteria 3526
136 Ga0070681_10173814 3300005458 Bacteria 2076
137 Ga0070681_10215449 3300005458 Bacteria 1836
138 Ga0068867_100009884 3300005459 Bacteria 6722
139 Ga0068867_100010754 3300005459 Bacteria 6454
140 Ga0068867_100015899 3300005459 Bacteria 5342
141 Ga0068867_100019383 3300005459 Bacteria 4848
142 Ga0068867_100027083 3300005459 Bacteria 4118
143 Ga0068867_100048070 3300005459 Bacteria 3138
144 Ga0068867_100081946 3300005459 Bacteria 2433
145 Ga0068867_100085625 3300005459 Unclassified 2383
146 Ga0068867_100088012 3300005459 Bacteria 2353
147 Ga0068867_100126913 3300005459 Bacteria 1978
148 Ga0068867_100156416 3300005459 Bacteria 1795
149 Ga0068867_100245604 3300005459 Unclassified 1453
150 Ga0068867_100366212 3300005459 Bacteria 1207
151 Ga0070685_10002538 3300005466 Bacteria 9358
152 Ga0070685_10003424 3300005466 Bacteria 8067
153 Ga0070685_10047097 3300005466 Unclassified 2478
154 Ga0070685_10091302 3300005466 Bacteria 1844
155 Ga0070698_100007127 3300005471 Bacteria 12109
156 Ga0070699_100195629 3300005518 Unclassified 1797
157 Ga0070679_100001762 3300005530 Bacteria 19496
158 Ga0070679_100002979 3300005530 Bacteria 15452
159 Ga0070679_100263012 3300005530 Bacteria 1680
160 Ga0070684_100001962 3300005535 Bacteria 15111
161 Ga0070684_100002647 3300005535 Bacteria 13212
162 Ga0070684_100003757 3300005535 Bacteria 11456
163 Ga0070684_100022536 3300005535 Bacteria 5255
164 Ga0070684_100055191 3300005535 Bacteria 3462
165 Ga0070684_100375564 3300005535 Bacteria 1309
166 Ga0068853_100002096 3300005539 Bacteria 14789
167 Ga0068853_100002136 3300005539 Bacteria 14716
168 Ga0068853_100007967 3300005539 Bacteria 8495
169 Ga0068853_100046411 3300005539 Bacteria 3725
170 Ga0068853_100096460 3300005539 Bacteria 2609
171 Ga0068853_100100615 3300005539 Bacteria 2555
172 Ga0068853_100120584 3300005539 Bacteria 2339
173 Ga0068853_100154196 3300005539 Bacteria 2069
174 Ga0068853_100258674 3300005539 Unclassified 1599
175 Ga0070672_100010400 3300005543 Bacteria 6454
176 Ga0070672_100043795 3300005543 Bacteria 3454
177 Ga0070672_100065963 3300005543 Bacteria 2865
178 Ga0070672_100079781 3300005543 Bacteria 2621
179 Ga0070672_100089103 3300005543 Bacteria 2485
180 Ga0070672_100089317 3300005543 Bacteria 2483
181 Ga0070672_100286225 3300005543 Bacteria 1395
182 Ga0070672_100347820 3300005543 Bacteria 1263
183 Ga0070686_100011384 3300005544 Bacteria 5045
184 Ga0070686_100023978 3300005544 Bacteria 3653
185 Ga0070686_100032147 3300005544 Bacteria 3215
186 Ga0070686_100067124 3300005544 Bacteria 2335
187 Ga0070686_100186026 3300005544 Bacteria 1479
188 Ga0070686_100225053 3300005544 Bacteria 1358
189 Ga0070686_100343744 3300005544 Bacteria 1119
190 Ga0070693_100116377 3300005547 Bacteria 1652
191 Ga0068855_100006033 3300005563 Bacteria 14776
192 Ga0068855_100008501 3300005563 Bacteria 12410
193 Ga0068855_100013351 3300005563 Bacteria 9907
194 Ga0068855_100018669 3300005563 Bacteria 8340
195 Ga0068855_100025654 3300005563 Bacteria 7049
196 Ga0068855_100037947 3300005563 Bacteria 5726
197 Ga0068855_100046305 3300005563 Bacteria 5142
198 Ga0068855_100080989 3300005563 Bacteria 3764
199 Ga0068855_100269769 3300005563 Bacteria 1892
200 Ga0070664_100001137 3300005564 Bacteria 21035
201 Ga0070664_100003013 3300005564 Bacteria 13617
202 Ga0070664_100012818 3300005564 Bacteria 6819
203 Ga0070664_100025500 3300005564 Bacteria 4901
204 Ga0070664_100220139 3300005564 Bacteria 1698
205 Ga0070664_100327816 3300005564 Bacteria 1388
206 Ga0068857_100001716 3300005577 Bacteria 17629
207 Ga0068857_100023122 3300005577 Bacteria 5467
208 Ga0068857_100086486 3300005577 Unclassified 2803
209 Ga0068857_100138185 3300005577 Bacteria 2201
210 Ga0068857_100385685 3300005577 Bacteria 1302
211 Ga0068854_100012732 3300005578 Bacteria 5509
212 Ga0068854_100040298 3300005578 Bacteria 3295
213 Ga0068854_100063251 3300005578 Unclassified 2686
214 Ga0068854_100086823 3300005578 Bacteria 2320
215 Ga0068854_100096616 3300005578 Bacteria 2208
216 Ga0068854_100302281 3300005578 Bacteria 1295
217 Ga0068856_100003735 3300005614 Bacteria 15264
218 Ga0068856_100008298 3300005614 Bacteria 10124
219 Ga0068856_100036076 3300005614 Bacteria 4848
220 Ga0068856_100062729 3300005614 Bacteria 3671
221 Ga0068856_100065652 3300005614 Bacteria 3586
222 Ga0068856_100160001 3300005614 Unclassified 2262
223 Ga0070702_100001348 3300005615 Bacteria 9999
224 Ga0070702_100149838 3300005615 Bacteria 1496
225 Ga0068852_100001965 3300005616 Bacteria 14001
226 Ga0068852_100003568 3300005616 Bacteria 10891
227 Ga0068852_100009539 3300005616 Bacteria 7214
228 Ga0068852_100058594 3300005616 Unclassified 3337
229 Ga0068852_100078704 3300005616 Bacteria 2917
230 Ga0068852_100136074 3300005616 Bacteria 2269
231 Ga0068852_100175525 3300005616 Bacteria 2012
232 Ga0068852_100261338 3300005616 Bacteria 1662
233 Ga0068852_100322920 3300005616 Bacteria 1500
234 Ga0068852_100465222 3300005616 Bacteria 1254
235 Ga0068859_100004525 3300005617 Bacteria 14180
236 Ga0068859_100017776 3300005617 Bacteria 7147
237 Ga0068859_100056549 3300005617 Bacteria 3949
238 Ga0068859_100065027 3300005617 Bacteria 3681
239 Ga0068859_100104709 3300005617 Bacteria 2889
240 Ga0068859_100108396 3300005617 Bacteria 2839
241 Ga0068859_100114383 3300005617 Bacteria 2762
242 Ga0068859_100229332 3300005617 Unclassified 1945
243 Ga0068859_100297658 3300005617 Bacteria 1707
244 Ga0068864_100007308 3300005618 Bacteria 9087
245 Ga0068864_100033017 3300005618 Bacteria 4399
246 Ga0068864_100084461 3300005618 Bacteria 2790
247 Ga0068864_100424003 3300005618 Bacteria 1268
248 Ga0068864_100479805 3300005618 Bacteria 1193
249 Ga0068866_10008075 3300005718 Bacteria 4423
250 Ga0068866_10026144 3300005718 Unclassified 2752
251 Ga0068866_10057162 3300005718 Bacteria 2009
252 Ga0068861_100047581 3300005719 Bacteria 3238
253 Ga0068861_100066718 3300005719 Bacteria 2775
254 Ga0068861_100440062 3300005719 Bacteria 1166
255 Ga0068851_10015069 3300005834 Bacteria 3679
256 Ga0068851_10021022 3300005834 Bacteria 3165
257 Ga0068851_10028288 3300005834 Bacteria 2769
258 Ga0068870_10008331 3300005840 Bacteria 4661
259 Ga0068870_10008993 3300005840 Bacteria 4519
260 Ga0068870_10011260 3300005840 Bacteria 4140
261 Ga0068870_10041919 3300005840 Bacteria 2381
262 Ga0068863_100014699 3300005841 Bacteria 7533
263 Ga0068863_100087308 3300005841 Bacteria 2955
264 Ga0068863_100108575 3300005841 Bacteria 2641
265 Ga0068863_100131712 3300005841 Bacteria 2387
266 Ga0068863_100198134 3300005841 Bacteria 1931
267 Ga0068863_100257848 3300005841 Bacteria 1685
268 Ga0068863_100430305 3300005841 Bacteria 1294
269 Ga0068863_100449086 3300005841 Bacteria 1265
270 Ga0068858_100055288 3300005842 Bacteria 3669
271 Ga0068858_100109209 3300005842 Bacteria 2582
272 Ga0068858_100336636 3300005842 Bacteria 1444
273 Ga0068858_100339202 3300005842 Bacteria 1438
274 Ga0068860_100000596 3300005843 Bacteria 43134
275 Ga0068860_100000777 3300005843 Bacteria 35916
276 Ga0068860_100002154 3300005843 Bacteria 20736
277 Ga0068860_100017118 3300005843 Bacteria 7066
278 Ga0068860_100017541 3300005843 Bacteria 6975
279 Ga0068860_100042991 3300005843 Bacteria 4312
280 Ga0068860_100069809 3300005843 Bacteria 3340
281 Ga0068860_100127281 3300005843 Bacteria 2442
282 Ga0068860_100267916 3300005843 Bacteria 1666
283 Ga0068862_100001370 3300005844 Bacteria 22653
284 Ga0068862_100045397 3300005844 Bacteria 3749
285 Ga0075432_10099271 3300006058 Bacteria 1074
286 Ga0075366_10003483 3300006195 Bacteria 8315
287 Ga0075366_10048741 3300006195 Bacteria 2513
288 Ga0075366_10121825 3300006195 Bacteria 1572
289 Ga0097621_100011987 3300006237 Bacteria 6415
290 Ga0097621_100015253 3300006237 Bacteria 5776
291 Ga0097621_100109470 3300006237 Bacteria 2334
292 Ga0097621_100149441 3300006237 Bacteria 2002
293 Ga0097621_100151429 3300006237 Bacteria 1989
294 Ga0097621_100164252 3300006237 Bacteria 1910
295 Ga0097621_100314610 3300006237 Bacteria 1385
296 Ga0068871_100009289 3300006358 Bacteria 7116
297 Ga0068871_100036720 3300006358 Bacteria 3902
298 Ga0068871_100212309 3300006358 Bacteria 1674
299 Ga0068871_100265432 3300006358 Bacteria 1498
300 Ga0068871_100421772 3300006358 Bacteria 1191
301 Ga0075428_100050487 3300006844 Bacteria 4561
302 Ga0075428_100080994 3300006844 Bacteria 3544
303 Ga0075428_100212101 3300006844 Bacteria 2092
304 Ga0075430_100019746 3300006846 Bacteria 5733
305 Ga0075431_100027626 3300006847 Bacteria 5823
306 Ga0075429_100000947 3300006880 Bacteria 22975
307 Ga0075429_100108135 3300006880 Bacteria 2430
308 Ga0075429_100261132 3300006880 Bacteria 1516
309 Ga0068865_100072251 3300006881 Unclassified 2450
310 Ga0068865_100098870 3300006881 Bacteria 2132
311 Ga0068865_100269406 3300006881 Bacteria 1351
312 Ga0068865_100328192 3300006881 Bacteria 1233
313 Ga0097620_100004525 3300006931 Bacteria 14180
314 Ga0097620_100017776 3300006931 Bacteria 7147
315 Ga0097620_100056556 3300006931 Bacteria 3949
316 Ga0097620_100065023 3300006931 Bacteria 3681
317 Ga0097620_100104714 3300006931 Bacteria 2889
318 Ga0097620_100108392 3300006931 Bacteria 2839
319 Ga0097620_100114384 3300006931 Bacteria 2762
320 Ga0097620_100229342 3300006931 Unclassified 1945
321 Ga0097620_100297649 3300006931 Bacteria 1707
322 Ga0105240_10000176 3300009093 Bacteria 130109
323 Ga0105240_10002998 3300009093 Bacteria 26564
324 Ga0105240_10005856 3300009093 Bacteria 18225
325 Ga0105240_10010362 3300009093 Bacteria 13115
326 Ga0105240_10031846 3300009093 Bacteria 6832
327 Ga0105240_10032929 3300009093 Bacteria 6702
328 Ga0105240_10041765 3300009093 Bacteria 5849
329 Ga0105240_10051138 3300009093 Bacteria 5203
330 Ga0105240_10058045 3300009093 Bacteria 4832
331 Ga0105240_10082359 3300009093 Unclassified 3952
332 Ga0111539_10001397 3300009094 Bacteria 32129
333 Ga0111539_10091224 3300009094 Bacteria 3580
334 Ga0111539_10178691 3300009094 Bacteria 2479
335 Ga0111539_10190839 3300009094 Bacteria 2391
336 Ga0105245_10023335 3300009098 Bacteria 5430
337 Ga0105247_10004404 3300009101 Bacteria 8986
338 Ga0105247_10040699 3300009101 Unclassified 2842
339 Ga0114129_10037835 3300009147 Bacteria 6810
340 Ga0114129_10073293 3300009147 Unclassified 4770
341 Ga0105241_10000863 3300009174 Bacteria 23000
342 Ga0105241_10074516 3300009174 Bacteria 2643
343 Ga0105241_10077519 3300009174 Bacteria 2595
344 Ga0105242_10002114 3300009176 Bacteria 15663
345 Ga0105242_10033557 3300009176 Bacteria 4110
346 Ga0105242_10049741 3300009176 Bacteria 3412
347 Ga0105242_10051079 3300009176 Bacteria 3368
348 Ga0105242_10056838 3300009176 Bacteria 3202
349 Ga0105242_10075675 3300009176 Bacteria 2804
350 Ga0105242_10177799 3300009176 Bacteria 1875
351 Ga0105242_10455774 3300009176 Bacteria 1207
352 Ga0105237_10004562 3300009545 Bacteria 15992
353 Ga0105237_10008038 3300009545 Bacteria 11475
354 Ga0105237_10009249 3300009545 Bacteria 10566
355 Ga0105237_10015195 3300009545 Bacteria 8021
356 Ga0105237_10019152 3300009545 Bacteria 7072
357 Ga0105237_10038808 3300009545 Bacteria 4809
358 Ga0105237_10074580 3300009545 Bacteria 3385
359 Ga0105237_10092622 3300009545 Bacteria 3012
360 Ga0105237_10152269 3300009545 Bacteria 2309
361 Ga0105238_10006098 3300009551 Bacteria 11957
362 Ga0105238_10080771 3300009551 Bacteria 3241
363 Ga0105238_10088621 3300009551 Bacteria 3080
364 Ga0105249_10000762 3300009553 Bacteria 28926
365 Ga0105249_10002189 3300009553 Bacteria 16912
366 Ga0105249_10005156 3300009553 Bacteria 11273
367 Ga0105249_10008695 3300009553 Bacteria 8851
368 Ga0105249_10031679 3300009553 Bacteria 4783
369 Ga0105249_10129051 3300009553 Unclassified 2411
370 Ga0105249_10246004 3300009553 Bacteria 1770
371 Ga0105249_10324900 3300009553 Bacteria 1550
372 Ga0105239_10001803 3300010375 Bacteria 28139
373 Ga0105239_10002666 3300010375 Bacteria 22499
374 Ga0105239_10010948 3300010375 Bacteria 10131
375 Ga0105239_10012714 3300010375 Bacteria 9366
376 Ga0105239_10013343 3300010375 Bacteria 9129
377 Ga0105239_10021330 3300010375 Bacteria 7143
378 Ga0105239_10084190 3300010375 Bacteria 3502
379 Ga0105239_10271390 3300010375 Bacteria 1908
380 Ga0105239_10412287 3300010375 Unclassified 1530
381 Ga0105246_10207421 3300011119 Bacteria 1527
382 Ga0157373_10000199 3300013100 Bacteria 49515
383 Ga0157373_10008107 3300013100 Bacteria 7810
384 Ga0157373_10012082 3300013100 Bacteria 6347
385 Ga0157373_10012757 3300013100 Bacteria 6175
386 Ga0157373_10053994 3300013100 Bacteria 2856
387 Ga0157373_10095610 3300013100 Bacteria 2091
388 Ga0157373_10137377 3300013100 Bacteria 1719
389 Ga0157373_10153163 3300013100 Bacteria 1622
390 Ga0157371_10000642 3300013102 Bacteria 41406
391 Ga0157371_10000903 3300013102 Bacteria 33458
392 Ga0157371_10001268 3300013102 Bacteria 26605
393 Ga0157371_10002520 3300013102 Bacteria 17411
394 Ga0157371_10007209 3300013102 Bacteria 9031
395 Ga0157371_10009384 3300013102 Bacteria 7705
396 Ga0157371_10015329 3300013102 Bacteria 5753
397 Ga0157371_10019013 3300013102 Bacteria 5071
398 Ga0157371_10020978 3300013102 Bacteria 4803
399 Ga0157371_10021017 3300013102 Bacteria 4799
400 Ga0157371_10022394 3300013102 Bacteria 4631
401 Ga0157371_10054371 3300013102 Bacteria 2843
402 Ga0157371_10060291 3300013102 Bacteria 2691
403 Ga0157371_10105550 3300013102 Bacteria 1999
404 Ga0157371_10139114 3300013102 Bacteria 1729
405 Ga0157371_10159718 3300013102 Bacteria 1609
406 Ga0157371_10172658 3300013102 Bacteria 1545
407 Ga0157370_10003741 3300013104 Bacteria 17784
408 Ga0157370_10005547 3300013104 Bacteria 14148
409 Ga0157370_10072411 3300013104 Unclassified 3252
410 Ga0157370_10138293 3300013104 Unclassified 2269
411 Ga0157370_10155018 3300013104 Bacteria 2131
412 Ga0157370_10243642 3300013104 Unclassified 1663
413 Ga0157369_10008293 3300013105 Bacteria 11910
414 Ga0157369_10015512 3300013105 Bacteria 8585
415 Ga0157369_10024769 3300013105 Bacteria 6667
416 Ga0157369_10025266 3300013105 Bacteria 6594
417 Ga0157369_10033874 3300013105 Bacteria 5609
418 Ga0157369_10042652 3300013105 Bacteria 4949
419 Ga0157369_10092765 3300013105 Bacteria 3223
420 Ga0157369_10155679 3300013105 Bacteria 2414
421 Ga0157369_10210755 3300013105 Bacteria 2037
422 Ga0157369_10241060 3300013105 Bacteria 1889
423 Ga0157369_10301280 3300013105 Bacteria 1667
424 Ga0157369_10650124 3300013105 Unclassified 1087
425 Ga0157374_10000007 3300013296 Bacteria 595643
426 Ga0157374_10003428 3300013296 Bacteria 13327
427 Ga0157374_10027172 3300013296 Bacteria 5158
428 Ga0157374_10028975 3300013296 Bacteria 5006
429 Ga0157374_10048738 3300013296 Bacteria 3932
430 Ga0157374_10052272 3300013296 Bacteria 3804
431 Ga0157374_10072495 3300013296 Bacteria 3249
432 Ga0157374_10089977 3300013296 Bacteria 2925
433 Ga0157374_10097353 3300013296 Unclassified 2815
434 Ga0157378_10000709 3300013297 Bacteria 31237
435 Ga0157378_10016147 3300013297 Bacteria 6539
436 Ga0157378_10018936 3300013297 Bacteria 6051
437 Ga0157378_10024574 3300013297 Bacteria 5304
438 Ga0157378_10059917 3300013297 Bacteria 3397
439 Ga0157378_10086526 3300013297 Bacteria 2841
440 Ga0157378_10095269 3300013297 Bacteria 2711
441 Ga0157378_10151665 3300013297 Bacteria 2160
442 Ga0157378_10209019 3300013297 Bacteria 1850
443 Ga0157378_10308431 3300013297 Bacteria 1534
444 Ga0157378_10378438 3300013297 Bacteria 1390
445 Ga0163162_10006844 3300013306 Bacteria 11062
446 Ga0163162_10007652 3300013306 Bacteria 10523
447 Ga0163162_10011844 3300013306 Bacteria 8507
448 Ga0163162_10013253 3300013306 Bacteria 8052
449 Ga0163162_10039031 3300013306 Bacteria 4741
450 Ga0163162_10052497 3300013306 Bacteria 4095
451 Ga0163162_10137856 3300013306 Bacteria 2551
452 Ga0163162_10170783 3300013306 Bacteria 2299
453 Ga0163162_10171918 3300013306 Bacteria 2291
454 Ga0163162_10265893 3300013306 Bacteria 1847
455 Ga0157372_10000967 3300013307 Bacteria 31319
456 Ga0157372_10009905 3300013307 Bacteria 10136
457 Ga0157372_10027589 3300013307 Bacteria 6187
458 Ga0157372_10040465 3300013307 Bacteria 5149
459 Ga0157372_10042643 3300013307 Bacteria 5020
460 Ga0157372_10044094 3300013307 Bacteria 4941
461 Ga0157372_10047825 3300013307 Bacteria 4754
462 Ga0157372_10067961 3300013307 Bacteria 4006
463 Ga0157372_10072526 3300013307 Bacteria 3880
464 Ga0157372_10079378 3300013307 Bacteria 3711
465 Ga0157372_10081173 3300013307 Bacteria 3670
466 Ga0157372_10105605 3300013307 Bacteria 3221
467 Ga0157372_10157694 3300013307 Bacteria 2622
468 Ga0157372_10226476 3300013307 Bacteria 2167
469 Ga0157372_10304885 3300013307 Bacteria 1853
470 Ga0157372_10326570 3300013307 Bacteria 1786
471 Ga0157372_10334905 3300013307 Unclassified 1763
472 Ga0157372_10401960 3300013307 Bacteria 1596
473 Ga0157372_10445856 3300013307 Unclassified 1508
474 Ga0157375_10020664 3300013308 Bacteria 6019
475 Ga0157375_10055764 3300013308 Bacteria 3898
476 Ga0157375_10070427 3300013308 Unclassified 3507
477 Ga0157375_10074473 3300013308 Bacteria 3417
478 Ga0157375_10075406 3300013308 Bacteria 3397
479 Ga0157375_10086544 3300013308 Bacteria 3185
480 Ga0157375_10098105 3300013308 Bacteria 3006
481 Ga0157375_10100426 3300013308 Bacteria 2974
482 Ga0157375_10123751 3300013308 Bacteria 2699
483 Ga0157375_10218411 3300013308 Bacteria 2064
484 Ga0163163_10001556 3300014325 Bacteria 19351
485 Ga0163163_10172586 3300014325 Bacteria 2209
486 Ga0163163_10410012 3300014325 Bacteria 1414
487 Ga0157380_10002192 3300014326 Bacteria 13126
488 Ga0157380_10005041 3300014326 Bacteria 9210
489 Ga0157380_10010105 3300014326 Bacteria 6778
490 Ga0157380_10018727 3300014326 Bacteria 5146
491 Ga0157380_10058280 3300014326 Bacteria 3078
492 Ga0157380_10091445 3300014326 Bacteria 2512
493 Ga0157380_10278325 3300014326 Unclassified 1529
494 Ga0157380_10433227 3300014326 Bacteria 1258
495 Ga0157377_10010017 3300014745 Bacteria 4676
496 Ga0157377_10019475 3300014745 Bacteria 3546
497 Ga0157377_10023271 3300014745 Bacteria 3282
498 Ga0157377_10125898 3300014745 Bacteria 1559
499 Ga0157379_10068647 3300014968 Bacteria 3169
500 Ga0157379_10099313 3300014968 Unclassified 2613
501 Ga0157379_10109132 3300014968 Bacteria 2485
502 Ga0157376_10000770 3300014969 Bacteria 20910
503 Ga0157376_10014112 3300014969 Bacteria 5984
504 Ga0157376_10042924 3300014969 Bacteria 3709
505 Ga0157376_10073012 3300014969 Unclassified 2920
506 Ga0157376_10254433 3300014969 Bacteria 1642
507 Ga0163161_10017476 3300017792 Bacteria 5019
508 Ga0163161_10024857 3300017792 Bacteria 4235
509 Ga0163161_10047274 3300017792 Bacteria 3108
510 Ga0163161_10061675 3300017792 Bacteria 2730
511 Ga0163161_10164000 3300017792 Bacteria 1696
512 Ga0163161_10355750 3300017792 Bacteria 1165
513 Ga0163161_10406910 3300017792 Bacteria 1092
514 Ga0209646_1000907 3300025246 Bacteria 9588
515 Ga0207666_1002406 3300025271 Bacteria 2255
516 Ga0207426_1000104 3300025302 Bacteria 249464
517 Ga0207697_10021978 3300025315 Bacteria 2614
518 Ga0207697_10030045 3300025315 Bacteria 2224
519 Ga0207656_10022635 3300025321 Bacteria 2523
520 Ga0207656_10046747 3300025321 Bacteria 1858
521 Ga0207656_10089618 3300025321 Bacteria 1394
522 Ga0207682_10033091 3300025893 Bacteria 2080
523 Ga0207642_10004146 3300025899 Bacteria 4653
524 Ga0207642_10022780 3300025899 Bacteria 2490
525 Ga0207710_10003718 3300025900 Bacteria 6757
526 Ga0207688_10044911 3300025901 Unclassified 2463
527 Ga0207680_10036011 3300025903 Bacteria 2847
528 Ga0207680_10046410 3300025903 Bacteria 2568
529 Ga0207680_10151889 3300025903 Unclassified 1544
530 Ga0207680_10190294 3300025903 Bacteria 1392
531 Ga0207647_10000491 3300025904 Bacteria 31654
532 Ga0207647_10045870 3300025904 Bacteria 2725
533 Ga0207647_10077279 3300025904 Unclassified 2001
534 Ga0207645_10009721 3300025907 Bacteria 6644
535 Ga0207645_10010984 3300025907 Bacteria 6195
536 Ga0207645_10078352 3300025907 Bacteria 2117
537 Ga0207645_10084326 3300025907 Bacteria 2039
538 Ga0207645_10105079 3300025907 Bacteria 1824
539 Ga0207643_10003438 3300025908 Bacteria 8518
540 Ga0207643_10005466 3300025908 Bacteria 6794
541 Ga0207643_10005545 3300025908 Bacteria 6745
542 Ga0207705_10009810 3300025909 Bacteria 6970
543 Ga0207705_10011968 3300025909 Bacteria 6269
544 Ga0207705_10024652 3300025909 Bacteria 4292
545 Ga0207705_10048728 3300025909 Bacteria 3048
546 Ga0207705_10180583 3300025909 Bacteria 1592
547 Ga0207705_10202749 3300025909 Unclassified 1503
548 Ga0207654_10002799 3300025911 Bacteria 8863
549 Ga0207707_10168491 3300025912 Bacteria 1914
550 Ga0207707_10190361 3300025912 Bacteria 1790
551 Ga0207707_10233629 3300025912 Bacteria 1600
552 Ga0207707_10281613 3300025912 Bacteria 1440
553 Ga0207695_10000102 3300025913 Bacteria 257838
554 Ga0207695_10000130 3300025913 Bacteria 224214
555 Ga0207695_10009181 3300025913 Bacteria 12266
556 Ga0207695_10013782 3300025913 Bacteria 9619
557 Ga0207695_10017042 3300025913 Bacteria 8473
558 Ga0207695_10018385 3300025913 Bacteria 8083
559 Ga0207695_10021723 3300025913 Bacteria 7315
560 Ga0207671_10000827 3300025914 Bacteria 39300
561 Ga0207671_10005301 3300025914 Bacteria 11946
562 Ga0207671_10030072 3300025914 Bacteria 4051
563 Ga0207671_10031705 3300025914 Bacteria 3938
564 Ga0207660_10012804 3300025917 Bacteria 5492
565 Ga0207660_10013025 3300025917 Bacteria 5446
566 Ga0207662_10037371 3300025918 Bacteria 2841
567 Ga0207662_10079457 3300025918 Bacteria 1998
568 Ga0207657_10009400 3300025919 Bacteria 9831
569 Ga0207657_10063644 3300025919 Bacteria 3152
570 Ga0207657_10066030 3300025919 Bacteria 3081
571 Ga0207657_10254704 3300025919 Bacteria 1398
572 Ga0207649_10002378 3300025920 Bacteria 10551
573 Ga0207649_10013574 3300025920 Bacteria 4550
574 Ga0207649_10044736 3300025920 Bacteria 2711
575 Ga0207649_10119980 3300025920 Bacteria 1771
576 Ga0207652_10000010 3300025921 Bacteria 247079
577 Ga0207652_10000844 3300025921 Bacteria 29188
578 Ga0207652_10002436 3300025921 Bacteria 15711
579 Ga0207652_10010853 3300025921 Bacteria 7342
580 Ga0207652_10013238 3300025921 Bacteria 6682
581 Ga0207652_10029303 3300025921 Bacteria 4601
582 Ga0207681_10077685 3300025923 Bacteria 2334
583 Ga0207681_10085829 3300025923 Bacteria 2235
584 Ga0207681_10130531 3300025923 Bacteria 1857
585 Ga0207681_10216547 3300025923 Bacteria 1479
586 Ga0207694_10062457 3300025924 Bacteria 2900
587 Ga0207694_10203862 3300025924 Bacteria 1610
588 Ga0207650_10029625 3300025925 Bacteria 3936
589 Ga0207650_10049202 3300025925 Unclassified 3111
590 Ga0207650_10075781 3300025925 Bacteria 2540
591 Ga0207650_10110210 3300025925 Bacteria 2130
592 Ga0207650_10122136 3300025925 Bacteria 2029
593 Ga0207650_10175852 3300025925 Bacteria 1704
594 Ga0207650_10196647 3300025925 Bacteria 1613
595 Ga0207650_10361878 3300025925 Bacteria 1195
596 Ga0207650_10405134 3300025925 Bacteria 1129
597 Ga0207650_10415297 3300025925 Unclassified 1116
598 Ga0207659_10006734 3300025926 Bacteria 7060
599 Ga0207659_10047784 3300025926 Bacteria 3029
600 Ga0207659_10054605 3300025926 Unclassified 2854
601 Ga0207659_10072241 3300025926 Bacteria 2522
602 Ga0207659_10108067 3300025926 Bacteria 2109
603 Ga0207659_10236468 3300025926 Bacteria 1476
604 Ga0207644_10011349 3300025931 Bacteria 5894
605 Ga0207644_10119323 3300025931 Bacteria 2006
606 Ga0207644_10303878 3300025931 Bacteria 1286
607 Ga0207644_10363826 3300025931 Bacteria 1177
608 Ga0207690_10018682 3300025932 Bacteria 4254
609 Ga0207690_10120578 3300025932 Bacteria 1904
610 Ga0207706_10002788 3300025933 Bacteria 16975
611 Ga0207706_10007192 3300025933 Bacteria 10293
612 Ga0207706_10027015 3300025933 Bacteria 5134
613 Ga0207706_10030989 3300025933 Bacteria 4766
614 Ga0207706_10175713 3300025933 Unclassified 1881
615 Ga0207686_10001023 3300025934 Bacteria 16552
616 Ga0207686_10041269 3300025934 Unclassified 2812
617 Ga0207686_10064558 3300025934 Bacteria 2331
618 Ga0207686_10075139 3300025934 Bacteria 2186
619 Ga0207686_10169994 3300025934 Bacteria 1536
620 Ga0207670_10002872 3300025936 Bacteria 9089
621 Ga0207670_10075578 3300025936 Bacteria 2342
622 Ga0207670_10096704 3300025936 Unclassified 2101
623 Ga0207670_10103520 3300025936 Bacteria 2037
624 Ga0207670_10235084 3300025936 Bacteria 1409
625 Ga0207704_10136967 3300025938 Bacteria 1706
626 Ga0207704_10365353 3300025938 Unclassified 1128
627 Ga0207691_10005324 3300025940 Bacteria 12422
628 Ga0207691_10008415 3300025940 Bacteria 9913
629 Ga0207691_10014903 3300025940 Bacteria 7408
630 Ga0207691_10043885 3300025940 Bacteria 4118
631 Ga0207691_10046637 3300025940 Bacteria 3980
632 Ga0207691_10064473 3300025940 Bacteria 3319
633 Ga0207691_10092706 3300025940 Bacteria 2705
634 Ga0207691_10108841 3300025940 Bacteria 2466
635 Ga0207691_10292171 3300025940 Bacteria 1401
636 Ga0207689_10017893 3300025942 Bacteria 5985
637 Ga0207689_10021455 3300025942 Bacteria 5429
638 Ga0207689_10022397 3300025942 Bacteria 5313
639 Ga0207689_10025610 3300025942 Bacteria 4943
640 Ga0207689_10038873 3300025942 Bacteria 3939
641 Ga0207689_10061309 3300025942 Bacteria 3093
642 Ga0207689_10079861 3300025942 Bacteria 2688
643 Ga0207689_10262586 3300025942 Bacteria 1429
644 Ga0207661_10003428 3300025944 Bacteria 11003
645 Ga0207661_10017740 3300025944 Bacteria 5274
646 Ga0207661_10018601 3300025944 Bacteria 5164
647 Ga0207661_10032101 3300025944 Bacteria 4065
648 Ga0207661_10063060 3300025944 Bacteria 3001
649 Ga0207661_10070150 3300025944 Bacteria 2860
650 Ga0207661_10256933 3300025944 Bacteria 1555
651 Ga0207661_10331924 3300025944 Bacteria 1369
652 Ga0207679_10000777 3300025945 Bacteria 20886
653 Ga0207679_10002266 3300025945 Bacteria 11867
654 Ga0207679_10176728 3300025945 Bacteria 1763
655 Ga0207667_10000221 3300025949 Bacteria 79940
656 Ga0207667_10001278 3300025949 Bacteria 31572
657 Ga0207667_10014945 3300025949 Bacteria 8829
658 Ga0207667_10022315 3300025949 Bacteria 6996
659 Ga0207667_10023835 3300025949 Bacteria 6736
660 Ga0207667_10033325 3300025949 Bacteria 5539
661 Ga0207667_10034583 3300025949 Bacteria 5425
662 Ga0207667_10101388 3300025949 Bacteria 2969
663 Ga0207651_10014463 3300025960 Bacteria 4559
664 Ga0207651_10027634 3300025960 Bacteria 3567
665 Ga0207651_10053517 3300025960 Bacteria 2760
666 Ga0207651_10055859 3300025960 Bacteria 2714
667 Ga0207651_10310194 3300025960 Bacteria 1315
668 Ga0207712_10000883 3300025961 Bacteria 21786
669 Ga0207712_10008753 3300025961 Bacteria 6401
670 Ga0207712_10015542 3300025961 Bacteria 4914
671 Ga0207712_10067778 3300025961 Bacteria 2555
672 Ga0207668_10025616 3300025972 Bacteria 3819
673 Ga0207668_10041301 3300025972 Bacteria 3117
674 Ga0207640_10008037 3300025981 Bacteria 5831
675 Ga0207640_10058377 3300025981 Bacteria 2542
676 Ga0207640_10098229 3300025981 Bacteria 2046
677 Ga0207640_10131045 3300025981 Unclassified 1813
678 Ga0207640_10208230 3300025981 Bacteria 1488
679 Ga0207658_10036045 3300025986 Bacteria 3546
680 Ga0207658_10060623 3300025986 Bacteria 2824
681 Ga0207677_10014206 3300026023 Bacteria 4642
682 Ga0207677_10039382 3300026023 Unclassified 3107
683 Ga0207677_10054289 3300026023 Bacteria 2733
684 Ga0207677_10263095 3300026023 Unclassified 1407
685 Ga0207703_10023732 3300026035 Bacteria 4824
686 Ga0207703_10099161 3300026035 Bacteria 2465
687 Ga0207703_10121917 3300026035 Bacteria 2239
688 Ga0207639_10005921 3300026041 Bacteria 8288
689 Ga0207639_10026983 3300026041 Bacteria 4178
690 Ga0207639_10077154 3300026041 Bacteria 2625
691 Ga0207639_10105140 3300026041 Bacteria 2290
692 Ga0207639_10128085 3300026041 Bacteria 2097
693 Ga0207639_10212034 3300026041 Bacteria 1668
694 Ga0207678_10040091 3300026067 Bacteria 4062
695 Ga0207678_10111472 3300026067 Bacteria 2334
696 Ga0207708_10043814 3300026075 Bacteria 3410
697 Ga0207708_10111411 3300026075 Bacteria 2125
698 Ga0207702_10035880 3300026078 Bacteria 4146
699 Ga0207702_10111936 3300026078 Bacteria 2429
700 Ga0207702_10122892 3300026078 Bacteria 2326
701 Ga0207702_10263303 3300026078 Bacteria 1624
702 Ga0207702_10394200 3300026078 Unclassified 1334
703 Ga0207641_10001211 3300026088 Bacteria 25807
704 Ga0207641_10013375 3300026088 Bacteria 6729
705 Ga0207641_10048363 3300026088 Bacteria 3589
706 Ga0207641_10261188 3300026088 Bacteria 1621
707 Ga0207641_10342633 3300026088 Bacteria 1423
708 Ga0207648_10003106 3300026089 Bacteria 17541
709 Ga0207648_10003652 3300026089 Bacteria 16108
710 Ga0207648_10041342 3300026089 Bacteria 4048
711 Ga0207648_10046581 3300026089 Bacteria 3802
712 Ga0207648_10053515 3300026089 Bacteria 3528
713 Ga0207648_10064421 3300026089 Bacteria 3195
714 Ga0207648_10107816 3300026089 Bacteria 2445
715 Ga0207648_10113527 3300026089 Bacteria 2379
716 Ga0207648_10283578 3300026089 Bacteria 1482
717 Ga0207676_10012386 3300026095 Bacteria 6110
718 Ga0207676_10019062 3300026095 Bacteria 4999
719 Ga0207676_10024768 3300026095 Bacteria 4444
720 Ga0207676_10052488 3300026095 Bacteria 3187
721 Ga0207676_10296588 3300026095 Bacteria 1474
722 Ga0207674_10003303 3300026116 Bacteria 19833
723 Ga0207674_10010027 3300026116 Bacteria 10780
724 Ga0207674_10026027 3300026116 Bacteria 6225
725 Ga0207674_10032451 3300026116 Bacteria 5477
726 Ga0207674_10135441 3300026116 Bacteria 2425
727 Ga0207674_10139765 3300026116 Bacteria 2382
728 Ga0207674_10212556 3300026116 Unclassified 1883
729 Ga0207674_10216849 3300026116 Bacteria 1862
730 Ga0207675_100008354 3300026118 Bacteria 9755
731 Ga0207675_100067777 3300026118 Unclassified 3336
732 Ga0207675_100077223 3300026118 Bacteria 3119
733 Ga0207675_100179639 3300026118 Bacteria 2026
734 Ga0207675_100191189 3300026118 Bacteria 1963
735 Ga0207675_100200663 3300026118 Unclassified 1916
736 Ga0207675_100211841 3300026118 Bacteria 1864
737 Ga0207683_10006924 3300026121 Bacteria 9708
738 Ga0207683_10011596 3300026121 Bacteria 7526
739 Ga0207683_10072291 3300026121 Unclassified 3050
740 Ga0207698_10004084 3300026142 Bacteria 8861
741 Ga0207698_10004661 3300026142 Bacteria 8377
742 Ga0207698_10006806 3300026142 Bacteria 7148
743 Ga0207698_10043890 3300026142 Unclassified 3354
744 Ga0207698_10081820 3300026142 Bacteria 2608
745 Ga0207698_10096906 3300026142 Bacteria 2432
746 Ga0207698_10127213 3300026142 Bacteria 2169
747 Ga0207698_10196196 3300026142 Bacteria 1804
748 Ga0207698_10231533 3300026142 Bacteria 1678
749 Ga0207698_10308248 3300026142 Bacteria 1477
750 Ga0209974_10008456 3300027876 Unclassified 3519
751 Ga0207428_10079249 3300027907 Bacteria 2568
752 Ga0207428_10161627 3300027907 Bacteria 1700
753 Ga0268266_10000024 3300028379 Bacteria 490820
754 Ga0268266_10538562 3300028379 Bacteria 1118
755 Ga0268265_10006391 3300028380 Bacteria 7987
756 Ga0268265_10035324 3300028380 Bacteria 3651
757 Ga0268264_10001090 3300028381 Bacteria 26846
758 Ga0268264_10004168 3300028381 Bacteria 12355
759 Ga0268264_10004652 3300028381 Bacteria 11662
760 Ga0268264_10010048 3300028381 Bacteria 7834
761 Ga0268264_10013430 3300028381 Bacteria 6743
762 Ga0268264_10129039 3300028381 Bacteria 2238
763 Ga0268264_10340185 3300028381 Bacteria 1425
764 Ga0268264_10501192 3300028381 Unclassified 1184
765 Ga0307515_10000001 3300028794 Bacteria 4259510
766 Ga0307515_10000036 3300028794 Bacteria 332188
767 Ga0307511_10005808 3300030521 Bacteria 12477
768 Ga0316183_1126150 3300030742 Bacteria 27545
769 Ga0316181_1171461 3300030744 Bacteria 11023
770 Ga0265327_10000159 3300031251 Bacteria 145537
771 Ga0265327_10000974 3300031251 Bacteria 40908
772 Ga0307513_10098240 3300031456 Bacteria 2960
773 Ga0307513_10124145 3300031456 Bacteria 2542
774 Ga0307509_10012711 3300031507 Bacteria 10036
775 Ga0265313_10080842 3300031595 Bacteria 1476
776 Ga0316576_10095485 3300031727 Bacteria 2218
777 Ga0307516_10001566 3300031730 Bacteria 31481
778 Ga0307516_10060958 3300031730 Bacteria 3663
779 Ga0307413_10086178 3300031824 Bacteria 2030
780 Ga0307406_10113244 3300031901 Bacteria 1872
781 Ga0307414_10063577 3300032004 Bacteria 2624
782 Ga0307414_10226012 3300032004 Bacteria 1540
783 Ga0307411_10000353 3300032005 Bacteria 15508
784 Ga0307411_10308611 3300032005 Bacteria 1272
785 Ga0307510_10000208 3300033180 Bacteria 51631
786 Ga0373943_0034926 3300035170 Bacteria 2401
787 Ga0316574_0036024 3300035398 Bacteria 3028
788 Ga0373924_0040079 3300035410 Bacteria 1916
789 Ga0373935_0246129 3300035692 Bacteria 1250
790 Ga0373933_0044738 3300035724 Bacteria 2624
791 Ga0373937_0081670 3300036401 Bacteria 2990
792 Ga0373925_0106301 3300037068 Bacteria 2164
793 Ga0395899_0000021 3300037312 Bacteria 391702
794 Ga0395899_0001914 3300037312 Bacteria 17170
795 Ga0395899_0030274 3300037312 Bacteria 4071
796 Ga0395899_0127959 3300037312 Bacteria 1815
797 Ga0395899_0182144 3300037312 Bacteria 1474
798 Ga0395900_0006326 3300037418 Bacteria 12346
799 Ga0395900_0007456 3300037418 Bacteria 11305
800 Ga0395900_0014716 3300037418 Bacteria 7977
801 Ga0395900_0014765 3300037418 Bacteria 7960
802 Ga0395900_0021684 3300037418 Bacteria 6567
803 Ga0395900_0056280 3300037418 Bacteria 4049
804 Ga0395900_0441177 3300037418 Bacteria 1259
805 Ga0395898_0002208 3300037466 Bacteria 23776
806 Ga0395898_0027229 3300037466 Bacteria 5741
807 Ga0395898_0038707 3300037466 Bacteria 4724
808 Ga0395898_0369567 3300037466 Bacteria 1367
809 Ga0395905_0004469 3300037471 Bacteria 14508
810 Ga0395905_0007405 3300037471 Bacteria 10913
811 Ga0395901_0001995 3300038443 Bacteria 21004
812 Ga0395901_0044313 3300038443 Bacteria 4614
813 Ga0395901_0046680 3300038443 Bacteria 4500
814 Ga0395901_0049721 3300038443 Bacteria 4356
815 Ga0395901_0272764 3300038443 Bacteria 1759
816 Ga0436365_0212609 3300039437 Bacteria 25185
817 Ga0436365_1637134 3300039437 Bacteria 28226
818 Ga0439436_0001397 3300041404 Bacteria 6972
819 Ga0439439_0012087 3300041406 Bacteria 2083
820 Ga0439439_0055674 3300041406 Bacteria 1044
821 Ga0451800_0111037 3300041459 Bacteria 1528
822 Ga0451807_2541090 3300041486 Bacteria 1082
823 Ga0451835_1139280 3300041492 Bacteria 1423
824 Ga0439441_007448 3300042001 Unclassified 1763
825 Ga0439445_0017227 3300042004 Bacteria 1785
826 Ga0439449_0026828 3300042007 Bacteria 2149
827 Ga0439457_000132 3300042014 Bacteria 18796
828 Ga0439462_0016642 3300042015 Bacteria 1901
829 Ga0450923_001909 3300042125 Bacteria 2880
830 Ga0450899_005212 3300042135 Bacteria 1396
831 Ga0439434_0011025 3300042435 Bacteria 2671
832 Ga0439434_0014376 3300042435 Bacteria 2355
833 Ga0439460_0052528 3300042461 Bacteria 1225
834 Ga0451577_0001226 3300042876 Bacteria 35701
835 Ga0451577_0215091 3300042876 Bacteria 1737
836 Ga0451577_0370062 3300042876 Bacteria 1300
837 Ga0466969_0013327 3300044656 Bacteria 4328
838 Ga0466969_0019573 3300044656 Bacteria 3517
839 Ga0466972_0000058 3300044658 Bacteria 110716
840 Ga0466972_0000226 3300044658 Bacteria 39467
841 Ga0466972_0000421 3300044658 Bacteria 22009
842 Ga0466972_0008578 3300044658 Bacteria 5129
843 Ga0466965_0101541 3300044683 Bacteria 1471
844 Ga0466966_0000357 3300044684 Bacteria 29675
845 Ga0466961_0003152 3300044693 Bacteria 10272
846 Ga0466964_0029819 3300044706 Bacteria 2156
847 Ga0453684_0000836 3300044712 Bacteria 103922
848 Ga0453684_0023157 3300044712 Bacteria 9166
849 Ga0453684_0029136 3300044712 Bacteria 7852
850 Ga0453684_0040202 3300044712 Bacteria 6358
851 Ga0466971_0006367 3300044719 Bacteria 5126
852 Ga0466968_0021190 3300044735 Bacteria 2631
853 Ga0466968_0051577 3300044735 Bacteria 1758
854 Ga0466968_0054016 3300044735 Bacteria 1722
855 Ga0466970_0006836 3300044765 Bacteria 5709
856 Ga0466957_0000370 3300044842 Bacteria 22083
857 Ga0466957_0102784 3300044842 Bacteria 1803
858 Ga0466960_0055778 3300044901 Bacteria 1922
859 Ga0466960_0087765 3300044901 Bacteria 1580
860 Ga0466959_0000184 3300045049 Bacteria 40923
861 Ga0466959_0032713 3300045049 Bacteria 3849
862 Ga0466959_0039381 3300045049 Bacteria 3493
863 Ga0451576_0040712 3300045051 Bacteria 4916
864 Ga0451576_0052108 3300045051 Bacteria 4289
865 Ga0466967_0300511 3300045976 Bacteria 1544
866 Ga0495653_0210972 3300046463 Bacteria 1311
867 Ga0495650_0043738 3300046471 Bacteria 1898
868 Ga0495628_0072974 3300046516 Bacteria 2674
869 Ga0495630_0004081 3300046517 Bacteria 10226
870 Ga0495587_0054955 3300046536 Bacteria 2346
871 Ga0495668_0000212 3300046616 Bacteria 84542
872 Ga0495668_0002096 3300046616 Bacteria 17260
873 Ga0495611_0002176 3300046648 Bacteria 9145
874 Ga0495635_0181596 3300046663 Bacteria 1430
875 Ga0495674_0191025 3300047319 Bacteria 1702
876 Ga0495672_0066235 3300047320 Bacteria 2062
877 Ga0495672_0077573 3300047320 Bacteria 1862
878 Ga0495680_0278898 3300047322 Bacteria 1178
879 Ga0495687_000014 3300047443 Bacteria 366896
880 Ga0495686_0000034 3300047472 Bacteria 325038
881 Ga0495686_0010470 3300047472 Bacteria 6593
882 Ga0496110_0138969 3300048913 Bacteria 2196
883 Ga0496110_0176010 3300048913 Bacteria 1942
884 Ga0501031_0009169 3300049568 Bacteria 6433
885 Ga0501032_0007664 3300049569 Bacteria 7871
886 Ga0501032_0016040 3300049569 Bacteria 5275
887 Ga0501034_0004639 3300049571 Bacteria 15223
888 Ga0501034_0007696 3300049571 Bacteria 11462
889 Ga0501034_0049648 3300049571 Bacteria 4233
890 Ga0501034_0075569 3300049571 Bacteria 3376
891 Ga0501034_0221283 3300049571 Bacteria 1845
892 Ga0501036_0008875 3300049572 Bacteria 8256
893 Ga0501036_0037427 3300049572 Bacteria 4104
894 Ga0501036_0076187 3300049572 Unclassified 2838
895 Ga0501037_0013848 3300049573 Bacteria 5943
896 Ga0501037_0014118 3300049573 Bacteria 5884
897 Ga0501037_0115620 3300049573 Unclassified 1931
898 Ga0501038_0010110 3300049574 Bacteria 8637
899 Ga0501038_0014503 3300049574 Bacteria 7182
900 Ga0501038_0037835 3300049574 Bacteria 4228
901 Ga0501039_0006695 3300049575 Bacteria 8762
902 Ga0501043_0003681 3300049579 Bacteria 12590
903 Ga0501043_0008403 3300049579 Bacteria 8131
904 Ga0501043_0139755 3300049579 Bacteria 1897
905 Ga0501043_0180139 3300049579 Bacteria 1647
906 Ga0501046_0003394 3300049580 Bacteria 14611
907 Ga0501046_0027708 3300049580 Bacteria 4620
908 Ga0501047_0014832 3300049581 Bacteria 7418
909 Ga0501047_0035018 3300049581 Bacteria 4849
910 Ga0501047_0072966 3300049581 Bacteria 3304
911 Ga0501048_0044123 3300049582 Bacteria 3190
912 Ga0501067_0006884 3300049583 Bacteria 6308
913 Ga0501068_0028719 3300049584 Bacteria 3291
914 Ga0501070_0009462 3300049586 Bacteria 8237
915 Ga0501070_0073570 3300049586 Bacteria 2828
916 Ga0501072_0207657 3300049588 Bacteria 1561
917 Ga0501072_0283289 3300049588 Unclassified 1318
918 Ga0501073_0021419 3300049589 Bacteria 4660
919 Ga0501073_0047891 3300049589 Unclassified 3002
920 Ga0501073_0083072 3300049589 Unclassified 2229
921 Ga0501074_0002265 3300049590 Bacteria 13385
922 Ga0501202_000967 3300049652 Bacteria 4442
923 Ga0501207_005632 3300049654 Bacteria 1739
924 Ga0501222_002093 3300049662 Bacteria 2765
925 Ga0501224_000131 3300049664 Bacteria 8169
926 Ga0501235_008989 3300049669 Bacteria 2181
927 Ga0501243_000013 3300049675 Bacteria 15475
928 Ga0501252_000069 3300049682 Bacteria 5367
929 Ga0501259_000125 3300049688 Bacteria 11279
930 Ga0501221_000034 3300049704 Bacteria 13503
931 Ga0501225_0000682 3300049705 Bacteria 10615
932 Ga0501225_0064672 3300049705 Bacteria 1033
933 Ga0501083_0010295 3300049744 Bacteria 6589
934 Ga0501266_000514 3300049763 Bacteria 5125
935 Ga0501035_0017463 3300049822 Bacteria 6619
936 Ga0501035_0032317 3300049822 Bacteria 4762
937 Ga0501035_0056995 3300049822 Bacteria 3484
938 Ga0501035_0156771 3300049822 Bacteria 1973
939 Ga0501044_0016285 3300049823 Bacteria 7988
940 Ga0501044_0020439 3300049823 Bacteria 7070
941 Ga0501044_0028605 3300049823 Bacteria 5883
942 Ga0501044_0029705 3300049823 Bacteria 5763
943 Ga0501044_0035617 3300049823 Bacteria 5211
944 Ga0501284_00065 3300050005 Bacteria 32381
945 nmdc:mga0k408_103579_c1 3300050493 Bacteria 1679
946 nmdc:mga0k408_17861_c1 3300050493 Bacteria 3954
947 nmdc:mga0k408_23407_c1 3300050493 Bacteria 3484
948 nmdc:mga0k408_43358_c1 3300050493 Bacteria 2592
949 nmdc:mga05p37_108310_c1 3300050507 Unclassified 3418
950 nmdc:mga05p37_8854_c2 3300050507 Bacteria 10147
951 nmdc:mga09592_130536_c1 3300050508 Bacteria 2162
952 nmdc:mga09592_13422_c1 3300050508 Bacteria 6166
953 nmdc:mga09592_285041_c1 3300050508 Bacteria 1432
954 nmdc:mga09592_30892_c1 3300050508 Bacteria 4460
955 nmdc:mga0qj67_159735_c1 3300050509 Bacteria 1830
956 nmdc:mga08y16_127596_c1 3300050511 Bacteria 2646
957 nmdc:mga08y16_24544_c1 3300050511 Bacteria 6362
958 nmdc:mga08y16_286315_c1 3300050511 Bacteria 1699
959 nmdc:mga08y16_41237_c1 3300050511 Bacteria 4836
960 nmdc:mga0n895_32941_c1 3300050512 Bacteria 4976
961 Ga0500578_0000979 3300053086 Bacteria 31680
962 Ga0500578_0196732 3300053086 Bacteria 1235
963 Ga0500646_0007294 3300053090 Bacteria 2823
964 Ga0500646_0014304 3300053090 Bacteria 2058
965 Ga0500583_0000141 3300053092 Bacteria 30432
966 Ga0500583_0010457 3300053092 Bacteria 3444
967 Ga0500651_0071300 3300053093 Bacteria 2162
968 Ga0500641_0019596 3300053096 Bacteria 2559
969 Ga0500555_029735 3300053103 Bacteria 1552
970 Ga0500562_000073 3300053108 Bacteria 47462
971 Ga0500562_037054 3300053108 Bacteria 1294
972 Ga0500652_021315 3300053131 Bacteria 2439
973 Ga0500559_0150597 3300053136 Bacteria 1092
974 Ga0500568_0001078 3300053139 Bacteria 18433
975 Ga0500568_0005571 3300053139 Bacteria 6486
976 Ga0500588_0020261 3300053146 Bacteria 1780
977 Ga0500589_025325 3300053147 Bacteria 2746
978 Ga0500622_0002318 3300053156 Bacteria 13907
979 Ga0500622_0003489 3300053156 Bacteria 10450
980 Ga0500622_0013260 3300053156 Bacteria 4448
981 Ga0500636_0044125 3300053177 Bacteria 2630
982 Ga0500636_0074405 3300053177 Bacteria 1966
983 Ga0500611_000002 3300053727 Bacteria 345991
984 Ga0500611_001974 3300053727 Bacteria 2376
985 Ga0500645_009406 3300053730 Bacteria 3283
986 Ga0500645_018620 3300053730 Bacteria 2167
987 Ga0500587_009582 3300053739 Bacteria 1236
988 Ga0500661_001277 3300055283 Bacteria 4701
989 Ga0466962_0019064 3300061719 Bacteria 3295

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10060291 Ga0157371_100602912 282
2 3300042876 Ga0451577_0370062 Ga0451577_0370062_44_895 283
3 3300006846 Ga0075430_100019746 Ga0075430_1000197462 287
4 3300006880 Ga0075429_100108135 Ga0075429_1001081352 287
5 3300041492 Ga0451835_1139280 Ga0451835_1139280_19_882 287
6 3300044683 Ga0466965_0101541 Ga0466965_0101541_11_874 287
7 3300047319 Ga0495674_0191025 Ga0495674_0191025_809_1672 287
8 3300049571 Ga0501034_0075569 Ga0501034_0075569_47_910 287
9 3300050508 nmdc:mga09592_130536_c1 nmdc:mga09592_130536_c1_191_1153 287
10 3300050509 nmdc:mga0qj67_159735_c1 nmdc:mga0qj67_159735_c1_813_1775 287
11 3300005614 Ga0068856_100008298 Ga0068856_1000082982 291
12 3300013102 Ga0157371_10015329 Ga0157371_100153291 291
13 3300013307 Ga0157372_10044094 Ga0157372_100440946 291
14 3300026078 Ga0207702_10122892 Ga0207702_101228922 291
15 3300025920 Ga0207649_10119980 Ga0207649_101199802 292
16 3300025942 Ga0207689_10022397 Ga0207689_100223971 292
17 3300028380 Ga0268265_10035324 Ga0268265_100353241 292
18 3300046536 Ga0495587_0054955 Ga0495587_0054955_1434_2312 292
19 3300053136 Ga0500559_0150597 Ga0500559_0150597_156_1034 292
20 3300003323 rootH1_10085398 rootH1_100853982 293
21 3300005544 Ga0070686_100186026 Ga0070686_1001860262 293
22 3300013105 Ga0157369_10241060 Ga0157369_102410601 296
23 3300005340 Ga0070689_100032097 Ga0070689_1000320972 297
24 3300005466 Ga0070685_10002538 Ga0070685_100025386 297
25 3300005544 Ga0070686_100067124 Ga0070686_1000671242 297
26 3300005616 Ga0068852_100136074 Ga0068852_1001360742 297
27 3300005617 Ga0068859_100056549 Ga0068859_1000565492 297
28 3300005834 Ga0068851_10021022 Ga0068851_100210222 297
29 3300005841 Ga0068863_100257848 Ga0068863_1002578482 297
30 3300006931 Ga0097620_100056556 Ga0097620_1000565563 297
31 3300009176 Ga0105242_10002114 Ga0105242_100021143 297
32 3300009553 Ga0105249_10002189 Ga0105249_100021899 297
33 3300013308 Ga0157375_10100426 Ga0157375_101004262 297
34 3300014968 Ga0157379_10099313 Ga0157379_100993132 297
35 3300014969 Ga0157376_10073012 Ga0157376_100730122 297
36 3300017792 Ga0163161_10047274 Ga0163161_100472742 297
37 3300025321 Ga0207656_10022635 Ga0207656_100226352 297
38 3300025934 Ga0207686_10001023 Ga0207686_1000102312 297
39 3300025936 Ga0207670_10075578 Ga0207670_100755782 297
40 3300026088 Ga0207641_10048363 Ga0207641_100483632 297
41 3300026095 Ga0207676_10019062 Ga0207676_100190622 297
42 3300026142 Ga0207698_10127213 Ga0207698_101272132 297
43 3300003316 rootH1_10018275 rootH1_100182752 300
44 3300049568 Ga0501031_0009169 Ga0501031_0009169_4188_5150 300
45 3300049572 Ga0501036_0008875 Ga0501036_0008875_1912_2874 300
46 3300049573 Ga0501037_0013848 Ga0501037_0013848_838_1800 300
47 3300049574 Ga0501038_0010110 Ga0501038_0010110_1709_2671 300
48 3300049575 Ga0501039_0006695 Ga0501039_0006695_6370_7332 300
49 3300049579 Ga0501043_0003681 Ga0501043_0003681_1179_2141 300
50 3300049580 Ga0501046_0027708 Ga0501046_0027708_616_1578 300
51 3300049588 Ga0501072_0283289 Ga0501072_0283289_317_1279 300
52 3300049589 Ga0501073_0083072 Ga0501073_0083072_290_1252 300
53 3300049823 Ga0501044_0028605 Ga0501044_0028605_842_1804 300
54 3300005331 Ga0070670_100050764 Ga0070670_1000507641 302
55 3300013306 Ga0163162_10171918 Ga0163162_101719182 302
56 3300025925 Ga0207650_10361878 Ga0207650_103618781 302
57 3300026116 Ga0207674_10216849 Ga0207674_102168491 302
58 3300005293 Ga0065715_10096521 Ga0065715_100965212 303
59 3300005331 Ga0070670_100132256 Ga0070670_1001322561 303
60 3300005340 Ga0070689_100007198 Ga0070689_1000071983 303
61 3300005364 Ga0070673_100017942 Ga0070673_1000179422 303
62 3300005365 Ga0070688_100009216 Ga0070688_1000092164 303
63 3300005466 Ga0070685_10003424 Ga0070685_100034242 303
64 3300005543 Ga0070672_100089103 Ga0070672_1000891031 303
65 3300005577 Ga0068857_100385685 Ga0068857_1003856851 303
66 3300005617 Ga0068859_100065027 Ga0068859_1000650271 303
67 3300005840 Ga0068870_10011260 Ga0068870_100112603 303
68 3300006931 Ga0097620_100065023 Ga0097620_1000650231 303
69 3300011119 Ga0105246_10207421 Ga0105246_102074211 303
70 3300025908 Ga0207643_10005466 Ga0207643_100054662 303
71 3300025918 Ga0207662_10037371 Ga0207662_100373712 303
72 3300025923 Ga0207681_10130531 Ga0207681_101305312 303
73 3300025936 Ga0207670_10002872 Ga0207670_100028723 303
74 3300025940 Ga0207691_10008415 Ga0207691_100084155 303
75 3300005293 Ga0065715_10096080 Ga0065715_100960801 304
76 3300006844 Ga0075428_100050487 Ga0075428_1000504873 304
77 3300006880 Ga0075429_100000947 Ga0075429_10000094711 304
78 3300025925 Ga0207650_10415297 Ga0207650_104152971 304
79 3300050508 nmdc:mga09592_30892_c1 nmdc:mga09592_30892_c1_1724_2686 304
80 3300014326 Ga0157380_10091445 Ga0157380_100914452 305
81 3300005563 Ga0068855_100037947 Ga0068855_1000379473 306
82 3300005577 Ga0068857_100138185 Ga0068857_1001381852 306
83 3300005614 Ga0068856_100036076 Ga0068856_1000360762 306
84 3300009545 Ga0105237_10009249 Ga0105237_1000924911 306
85 3300010375 Ga0105239_10013343 Ga0105239_100133431 306
86 3300025949 Ga0207667_10014945 Ga0207667_100149453 306
87 3300026078 Ga0207702_10035880 Ga0207702_100358803 306
88 3300026116 Ga0207674_10026027 Ga0207674_100260275 306
89 3300044656 Ga0466969_0019573 Ga0466969_0019573_1366_2328 306
90 3300044684 Ga0466966_0000357 Ga0466966_0000357_20693_21655 306
91 3300045049 Ga0466959_0000184 Ga0466959_0000184_18068_19030 306
92 3300005841 Ga0068863_100087308 Ga0068863_1000873082 307
93 3300009176 Ga0105242_10177799 Ga0105242_101777992 307
94 3300013296 Ga0157374_10048738 Ga0157374_100487382 307
95 3300025934 Ga0207686_10075139 Ga0207686_100751392 307
96 3300026088 Ga0207641_10001211 Ga0207641_100012112 307
97 3300003354 JGI25160J50197_1001628 JGI25160J50197_10016283 308
98 3300005328 Ga0070676_10135821 Ga0070676_101358212 308
99 3300005333 Ga0070677_10020799 Ga0070677_100207991 308
100 3300005544 Ga0070686_100032147 Ga0070686_1000321472 308
101 3300025302 Ga0207426_1000104 Ga0207426_1000104149 308
102 3300026075 Ga0207708_10043814 Ga0207708_100438142 308
103 3300031595 Ga0265313_10080842 Ga0265313_100808422 308
104 3300005539 Ga0068853_100096460 Ga0068853_1000964602 309
105 3300005543 Ga0070672_100286225 Ga0070672_1002862251 309
106 3300005564 Ga0070664_100220139 Ga0070664_1002201392 309
107 3300005616 Ga0068852_100465222 Ga0068852_1004652221 309
108 3300006195 Ga0075366_10048741 Ga0075366_100487412 309
109 3300013297 Ga0157378_10059917 Ga0157378_100599172 309
110 3300013297 Ga0157378_10095269 Ga0157378_100952692 309
111 3300014326 Ga0157380_10018727 Ga0157380_100187274 309
112 3300025914 Ga0207671_10031705 Ga0207671_100317053 309
113 3300025940 Ga0207691_10292171 Ga0207691_102921711 309
114 3300025945 Ga0207679_10176728 Ga0207679_101767282 309
115 3300026041 Ga0207639_10105140 Ga0207639_101051402 309
116 3300031727 Ga0316576_10095485 Ga0316576_100954852 309
117 3300037312 Ga0395899_0000021 Ga0395899_0000021_10857_11789 309
118 3300050493 nmdc:mga0k408_43358_c1 nmdc:mga0k408_43358_c1_1249_2211 309
119 3300005328 Ga0070676_10017107 Ga0070676_100171072 311
120 3300005333 Ga0070677_10045428 Ga0070677_100454282 311
121 3300005334 Ga0068869_100006968 Ga0068869_1000069682 311
122 3300005347 Ga0070668_100052239 Ga0070668_1000522393 311
123 3300005353 Ga0070669_100008912 Ga0070669_1000089127 311
124 3300005354 Ga0070675_100040169 Ga0070675_1000401693 311
125 3300005457 Ga0070662_100137558 Ga0070662_1001375581 311
126 3300005466 Ga0070685_10047097 Ga0070685_100470971 311
127 3300005543 Ga0070672_100043795 Ga0070672_1000437952 311
128 3300005578 Ga0068854_100063251 Ga0068854_1000632512 311
129 3300005718 Ga0068866_10026144 Ga0068866_100261442 311
130 3300005840 Ga0068870_10008993 Ga0068870_100089932 311
131 3300005843 Ga0068860_100042991 Ga0068860_1000429912 311
132 3300006881 Ga0068865_100072251 Ga0068865_1000722512 311
133 3300009176 Ga0105242_10033557 Ga0105242_100335573 311
134 3300009553 Ga0105249_10005156 Ga0105249_1000515611 311
135 3300013296 Ga0157374_10072495 Ga0157374_100724952 311
136 3300013297 Ga0157378_10086526 Ga0157378_100865262 311
137 3300013308 Ga0157375_10070427 Ga0157375_100704272 311
138 3300025901 Ga0207688_10044911 Ga0207688_100449112 311
139 3300025903 Ga0207680_10151889 Ga0207680_101518892 311
140 3300025907 Ga0207645_10010984 Ga0207645_100109842 311
141 3300025908 Ga0207643_10005545 Ga0207643_100055455 311
142 3300025926 Ga0207659_10054605 Ga0207659_100546052 311
143 3300025933 Ga0207706_10175713 Ga0207706_101757132 311
144 3300025934 Ga0207686_10041269 Ga0207686_100412692 311
145 3300025940 Ga0207691_10064473 Ga0207691_100644732 311
146 3300025942 Ga0207689_10017893 Ga0207689_100178933 311
147 3300025961 Ga0207712_10000883 Ga0207712_100008835 311
148 3300025972 Ga0207668_10025616 Ga0207668_100256162 311
149 3300025981 Ga0207640_10131045 Ga0207640_101310452 311
150 3300026089 Ga0207648_10003652 Ga0207648_100036522 311
151 3300026116 Ga0207674_10212556 Ga0207674_102125562 311
152 3300026118 Ga0207675_100067777 Ga0207675_1000677772 311
153 3300026121 Ga0207683_10006924 Ga0207683_1000692411 311
154 3300028381 Ga0268264_10501192 Ga0268264_105011921 311
155 3300005459 Ga0068867_100048070 Ga0068867_1000480701 312
156 3300005843 Ga0068860_100267916 Ga0068860_1002679162 312
157 3300009553 Ga0105249_10324900 Ga0105249_103249001 312
158 3300025925 Ga0207650_10175852 Ga0207650_101758522 312
159 3300026089 Ga0207648_10046581 Ga0207648_100465813 312
160 3300005331 Ga0070670_100161959 Ga0070670_1001619592 313
161 3300005459 Ga0068867_100245604 Ga0068867_1002456042 313
162 3300006195 Ga0075366_10003483 Ga0075366_100034833 313
163 3300013308 Ga0157375_10020664 Ga0157375_100206641 313
164 3300014326 Ga0157380_10005041 Ga0157380_100050412 313
165 3300050493 nmdc:mga0k408_17861_c1 nmdc:mga0k408_17861_c1_231_1193 313
166 3300005459 Ga0068867_100015899 Ga0068867_1000158994 315
167 3300009176 Ga0105242_10049741 Ga0105242_100497413 315
168 3300026089 Ga0207648_10041342 Ga0207648_100413422 315
169 3300028381 Ga0268264_10340185 Ga0268264_103401852 315
170 3300047472 Ga0495686_0010470 Ga0495686_0010470_179_1147 315
171 iso_pu_bacteria 2738541278 2738731401 316
172 iso_pu_bacteria 2818991444 2819588089 316
173 iso_pu_bacteria 2842903701 2842905415 316
174 iso_pu_bacteria 2914759650 2914763067 316
175 iso_pu_bacteria 2929154850 2929157916 316
176 iso_pu_bacteria 8056440228 8056442715 316
177 3300002459 JGI24751J29686_10001060 JGI24751J29686_100010604 320
178 3300003320 rootH2_10036879 rootH2_100368793 320
179 3300003320 rootH2_10128061 rootH2_101280614 320
180 3300003322 rootL2_10212701 rootL2_102127012 320
181 3300003323 rootH1_10025429 rootH1_1002542912 320
182 3300003323 rootH1_10057654 rootH1_100576547 320
183 3300005289 Ga0065704_10025997 Ga0065704_100259971 320
184 3300005289 Ga0065704_10070301 Ga0065704_1007030121 320
185 3300005289 Ga0065704_10164499 Ga0065704_101644991 320
186 3300005290 Ga0065712_10079489 Ga0065712_100794892 320
187 3300005290 Ga0065712_10091704 Ga0065712_100917042 320
188 3300005293 Ga0065715_10242450 Ga0065715_102424502 320
189 3300005327 Ga0070658_10013142 Ga0070658_100131423 320
190 3300005327 Ga0070658_10020168 Ga0070658_100201685 320
191 3300005327 Ga0070658_10027444 Ga0070658_100274444 320
192 3300005327 Ga0070658_10040238 Ga0070658_100402382 320
193 3300005327 Ga0070658_10058295 Ga0070658_100582951 320
194 3300005327 Ga0070658_10100691 Ga0070658_101006912 320
195 3300005327 Ga0070658_10226556 Ga0070658_102265562 320
196 3300005328 Ga0070676_10005951 Ga0070676_100059512 320
197 3300005328 Ga0070676_10056334 Ga0070676_100563342 320
198 3300005328 Ga0070676_10106375 Ga0070676_101063752 320
199 3300005329 Ga0070683_100005030 Ga0070683_1000050303 320
200 3300005329 Ga0070683_100014181 Ga0070683_1000141811 320
201 3300005329 Ga0070683_100022645 Ga0070683_1000226453 320
202 3300005329 Ga0070683_100103936 Ga0070683_1001039362 320
203 3300005329 Ga0070683_100194390 Ga0070683_1001943901 320
204 3300005330 Ga0070690_100015309 Ga0070690_1000153093 320
205 3300005330 Ga0070690_100049311 Ga0070690_1000493112 320
206 3300005330 Ga0070690_100049609 Ga0070690_1000496092 320
207 3300005331 Ga0070670_100013127 Ga0070670_1000131274 320
208 3300005331 Ga0070670_100068547 Ga0070670_1000685473 320
209 3300005331 Ga0070670_100097475 Ga0070670_1000974751 320
210 3300005331 Ga0070670_100099416 Ga0070670_1000994162 320
211 3300005331 Ga0070670_100123107 Ga0070670_1001231072 320
212 3300005331 Ga0070670_100132902 Ga0070670_1001329021 320
213 3300005331 Ga0070670_100145977 Ga0070670_1001459772 320
214 3300005331 Ga0070670_100374672 Ga0070670_1003746721 320
215 3300005333 Ga0070677_10004223 Ga0070677_100042232 320
216 3300005334 Ga0068869_100034971 Ga0068869_1000349713 320
217 3300005334 Ga0068869_100058844 Ga0068869_1000588442 320
218 3300005334 Ga0068869_100060978 Ga0068869_1000609782 320
219 3300005334 Ga0068869_100124301 Ga0068869_1001243012 320
220 3300005334 Ga0068869_100252213 Ga0068869_1002522131 320
221 3300005335 Ga0070666_10022787 Ga0070666_100227872 320
222 3300005335 Ga0070666_10065164 Ga0070666_100651642 320
223 3300005335 Ga0070666_10131998 Ga0070666_101319982 320
224 3300005336 Ga0070680_100019063 Ga0070680_1000190632 320
225 3300005336 Ga0070680_100074299 Ga0070680_1000742992 320
226 3300005336 Ga0070680_100288735 Ga0070680_1002887351 320
227 3300005337 Ga0070682_100000039 Ga0070682_10000003934 320
228 3300005337 Ga0070682_100010074 Ga0070682_1000100741 320
229 3300005337 Ga0070682_100055319 Ga0070682_1000553192 320
230 3300005337 Ga0070682_100175659 Ga0070682_1001756592 320
231 3300005338 Ga0068868_100030457 Ga0068868_1000304572 320
232 3300005338 Ga0068868_100075943 Ga0068868_1000759432 320
233 3300005338 Ga0068868_100157333 Ga0068868_1001573331 320
234 3300005338 Ga0068868_100217058 Ga0068868_1002170581 320
235 3300005339 Ga0070660_100017076 Ga0070660_1000170763 320
236 3300005339 Ga0070660_100027207 Ga0070660_1000272073 320
237 3300005340 Ga0070689_100012023 Ga0070689_1000120237 320
238 3300005340 Ga0070689_100089799 Ga0070689_1000897992 320
239 3300005340 Ga0070689_100147001 Ga0070689_1001470012 320
240 3300005341 Ga0070691_10050890 Ga0070691_100508901 320
241 3300005343 Ga0070687_100063133 Ga0070687_1000631332 320
242 3300005344 Ga0070661_100001685 Ga0070661_10000168512 320
243 3300005344 Ga0070661_100123187 Ga0070661_1001231871 320
244 3300005347 Ga0070668_100038487 Ga0070668_1000384872 320
245 3300005347 Ga0070668_100044686 Ga0070668_1000446862 320
246 3300005353 Ga0070669_100002558 Ga0070669_10000255811 320
247 3300005353 Ga0070669_100075231 Ga0070669_1000752312 320
248 3300005353 Ga0070669_100113987 Ga0070669_1001139871 320
249 3300005353 Ga0070669_100174144 Ga0070669_1001741441 320
250 3300005354 Ga0070675_100007641 Ga0070675_1000076413 320
251 3300005354 Ga0070675_100013996 Ga0070675_1000139963 320
252 3300005354 Ga0070675_100015691 Ga0070675_1000156912 320
253 3300005354 Ga0070675_100016926 Ga0070675_1000169264 320
254 3300005354 Ga0070675_100040597 Ga0070675_1000405972 320
255 3300005354 Ga0070675_100192054 Ga0070675_1001920542 320
256 3300005354 Ga0070675_100230584 Ga0070675_1002305841 320
257 3300005355 Ga0070671_100025467 Ga0070671_1000254673 320
258 3300005355 Ga0070671_100056731 Ga0070671_1000567312 320
259 3300005355 Ga0070671_100110618 Ga0070671_1001106182 320
260 3300005355 Ga0070671_100147640 Ga0070671_1001476402 320
261 3300005355 Ga0070671_100378025 Ga0070671_1003780251 320
262 3300005356 Ga0070674_100082865 Ga0070674_1000828652 320
263 3300005356 Ga0070674_100148760 Ga0070674_1001487602 320
264 3300005364 Ga0070673_100010236 Ga0070673_1000102362 320
265 3300005364 Ga0070673_100013685 Ga0070673_1000136855 320
266 3300005364 Ga0070673_100017650 Ga0070673_1000176504 320
267 3300005364 Ga0070673_100031215 Ga0070673_1000312154 320
268 3300005364 Ga0070673_100326645 Ga0070673_1003266451 320
269 3300005365 Ga0070688_100033246 Ga0070688_1000332462 320
270 3300005365 Ga0070688_100047565 Ga0070688_1000475652 320
271 3300005366 Ga0070659_100001692 Ga0070659_1000016928 320
272 3300005366 Ga0070659_100025437 Ga0070659_1000254372 320
273 3300005366 Ga0070659_100334287 Ga0070659_1003342872 320
274 3300005367 Ga0070667_100044065 Ga0070667_1000440652 320
275 3300005367 Ga0070667_100095364 Ga0070667_1000953642 320
276 3300005367 Ga0070667_100160068 Ga0070667_1001600682 320
277 3300005367 Ga0070667_100203722 Ga0070667_1002037221 320
278 3300005367 Ga0070667_100390176 Ga0070667_1003901761 320
279 3300005367 Ga0070667_100570917 Ga0070667_1005709171 320
280 3300005437 Ga0070710_10113268 Ga0070710_101132681 320
281 3300005441 Ga0070700_100250550 Ga0070700_1002505501 320
282 3300005455 Ga0070663_100042752 Ga0070663_1000427521 320
283 3300005455 Ga0070663_100085844 Ga0070663_1000858441 320
284 3300005457 Ga0070662_100002983 Ga0070662_1000029838 320
285 3300005457 Ga0070662_100109349 Ga0070662_1001093492 320
286 3300005457 Ga0070662_100342345 Ga0070662_1003423451 320
287 3300005458 Ga0070681_10039686 Ga0070681_100396862 320
288 3300005458 Ga0070681_10054898 Ga0070681_100548981 320
289 3300005458 Ga0070681_10059457 Ga0070681_100594573 320
290 3300005458 Ga0070681_10068147 Ga0070681_100681471 320
291 3300005458 Ga0070681_10173814 Ga0070681_101738142 320
292 3300005458 Ga0070681_10215449 Ga0070681_102154492 320
293 3300005459 Ga0068867_100009884 Ga0068867_1000098843 320
294 3300005459 Ga0068867_100010754 Ga0068867_1000107542 320
295 3300005459 Ga0068867_100019383 Ga0068867_1000193835 320
296 3300005459 Ga0068867_100027083 Ga0068867_1000270835 320
297 3300005459 Ga0068867_100081946 Ga0068867_1000819462 320
298 3300005459 Ga0068867_100085625 Ga0068867_1000856252 320
299 3300005459 Ga0068867_100088012 Ga0068867_1000880122 320
300 3300005459 Ga0068867_100126913 Ga0068867_1001269131 320
301 3300005459 Ga0068867_100156416 Ga0068867_1001564162 320
302 3300005459 Ga0068867_100366212 Ga0068867_1003662121 320
303 3300005466 Ga0070685_10091302 Ga0070685_100913022 320
304 3300005471 Ga0070698_100007127 Ga0070698_1000071274 320
305 3300005518 Ga0070699_100195629 Ga0070699_1001956292 320
306 3300005530 Ga0070679_100001762 Ga0070679_10000176220 320
307 3300005530 Ga0070679_100002979 Ga0070679_1000029799 320
308 3300005530 Ga0070679_100263012 Ga0070679_1002630122 320
309 3300005535 Ga0070684_100001962 Ga0070684_1000019629 320
310 3300005535 Ga0070684_100002647 Ga0070684_1000026476 320
311 3300005535 Ga0070684_100003757 Ga0070684_1000037572 320
312 3300005535 Ga0070684_100022536 Ga0070684_1000225361 320
313 3300005535 Ga0070684_100055191 Ga0070684_1000551913 320
314 3300005535 Ga0070684_100375564 Ga0070684_1003755642 320
315 3300005539 Ga0068853_100002096 Ga0068853_10000209610 320
316 3300005539 Ga0068853_100002136 Ga0068853_1000021368 320
317 3300005539 Ga0068853_100007967 Ga0068853_1000079677 320
318 3300005539 Ga0068853_100046411 Ga0068853_1000464112 320
319 3300005539 Ga0068853_100100615 Ga0068853_1001006151 320
320 3300005539 Ga0068853_100120584 Ga0068853_1001205842 320
321 3300005539 Ga0068853_100154196 Ga0068853_1001541962 320
322 3300005539 Ga0068853_100258674 Ga0068853_1002586742 320
323 3300005543 Ga0070672_100010400 Ga0070672_1000104002 320
324 3300005543 Ga0070672_100065963 Ga0070672_1000659632 320
325 3300005543 Ga0070672_100079781 Ga0070672_1000797812 320
326 3300005543 Ga0070672_100089317 Ga0070672_1000893172 320
327 3300005543 Ga0070672_100347820 Ga0070672_1003478201 320
328 3300005544 Ga0070686_100011384 Ga0070686_1000113842 320
329 3300005544 Ga0070686_100023978 Ga0070686_1000239782 320
330 3300005544 Ga0070686_100225053 Ga0070686_1002250532 320
331 3300005544 Ga0070686_100343744 Ga0070686_1003437441 320
332 3300005547 Ga0070693_100116377 Ga0070693_1001163772 320
333 3300005563 Ga0068855_100006033 Ga0068855_10000603316 320
334 3300005563 Ga0068855_100008501 Ga0068855_1000085014 320
335 3300005563 Ga0068855_100013351 Ga0068855_10001335110 320
336 3300005563 Ga0068855_100018669 Ga0068855_1000186696 320
337 3300005563 Ga0068855_100025654 Ga0068855_1000256543 320
338 3300005563 Ga0068855_100046305 Ga0068855_1000463055 320
339 3300005563 Ga0068855_100080989 Ga0068855_1000809891 320
340 3300005563 Ga0068855_100269769 Ga0068855_1002697692 320
341 3300005564 Ga0070664_100001137 Ga0070664_10000113713 320
342 3300005564 Ga0070664_100003013 Ga0070664_1000030138 320
343 3300005564 Ga0070664_100012818 Ga0070664_1000128188 320
344 3300005564 Ga0070664_100025500 Ga0070664_1000255001 320
345 3300005564 Ga0070664_100327816 Ga0070664_1003278162 320
346 3300005577 Ga0068857_100001716 Ga0068857_10000171616 320
347 3300005577 Ga0068857_100023122 Ga0068857_1000231225 320
348 3300005577 Ga0068857_100086486 Ga0068857_1000864862 320
349 3300005578 Ga0068854_100012732 Ga0068854_1000127324 320
350 3300005578 Ga0068854_100040298 Ga0068854_1000402981 320
351 3300005578 Ga0068854_100086823 Ga0068854_1000868232 320
352 3300005578 Ga0068854_100096616 Ga0068854_1000966162 320
353 3300005578 Ga0068854_100302281 Ga0068854_1003022811 320
354 3300005614 Ga0068856_100003735 Ga0068856_1000037358 320
355 3300005614 Ga0068856_100062729 Ga0068856_1000627292 320
356 3300005614 Ga0068856_100065652 Ga0068856_1000656522 320
357 3300005614 Ga0068856_100160001 Ga0068856_1001600012 320
358 3300005615 Ga0070702_100001348 Ga0070702_1000013485 320
359 3300005615 Ga0070702_100149838 Ga0070702_1001498382 320
360 3300005616 Ga0068852_100001965 Ga0068852_1000019658 320
361 3300005616 Ga0068852_100003568 Ga0068852_1000035684 320
362 3300005616 Ga0068852_100009539 Ga0068852_1000095392 320
363 3300005616 Ga0068852_100058594 Ga0068852_1000585942 320
364 3300005616 Ga0068852_100078704 Ga0068852_1000787042 320
365 3300005616 Ga0068852_100175525 Ga0068852_1001755252 320
366 3300005616 Ga0068852_100261338 Ga0068852_1002613382 320
367 3300005616 Ga0068852_100322920 Ga0068852_1003229202 320
368 3300005617 Ga0068859_100004525 Ga0068859_1000045254 320
369 3300005617 Ga0068859_100017776 Ga0068859_1000177767 320
370 3300005617 Ga0068859_100104709 Ga0068859_1001047091 320
371 3300005617 Ga0068859_100108396 Ga0068859_1001083962 320
372 3300005617 Ga0068859_100114383 Ga0068859_1001143832 320
373 3300005617 Ga0068859_100229332 Ga0068859_1002293321 320
374 3300005617 Ga0068859_100297658 Ga0068859_1002976582 320
375 3300005618 Ga0068864_100007308 Ga0068864_1000073082 320
376 3300005618 Ga0068864_100033017 Ga0068864_1000330172 320
377 3300005618 Ga0068864_100084461 Ga0068864_1000844612 320
378 3300005618 Ga0068864_100424003 Ga0068864_1004240032 320
379 3300005618 Ga0068864_100479805 Ga0068864_1004798052 320
380 3300005718 Ga0068866_10008075 Ga0068866_100080755 320
381 3300005718 Ga0068866_10057162 Ga0068866_100571621 320
382 3300005719 Ga0068861_100047581 Ga0068861_1000475812 320
383 3300005719 Ga0068861_100066718 Ga0068861_1000667182 320
384 3300005719 Ga0068861_100440062 Ga0068861_1004400621 320
385 3300005834 Ga0068851_10015069 Ga0068851_100150692 320
386 3300005834 Ga0068851_10028288 Ga0068851_100282882 320
387 3300005840 Ga0068870_10008331 Ga0068870_100083313 320
388 3300005840 Ga0068870_10041919 Ga0068870_100419192 320
389 3300005841 Ga0068863_100014699 Ga0068863_1000146995 320
390 3300005841 Ga0068863_100108575 Ga0068863_1001085752 320
391 3300005841 Ga0068863_100131712 Ga0068863_1001317122 320
392 3300005841 Ga0068863_100198134 Ga0068863_1001981343 320
393 3300005841 Ga0068863_100430305 Ga0068863_1004303052 320
394 3300005841 Ga0068863_100449086 Ga0068863_1004490861 320
395 3300005842 Ga0068858_100055288 Ga0068858_1000552883 320
396 3300005842 Ga0068858_100109209 Ga0068858_1001092092 320
397 3300005842 Ga0068858_100336636 Ga0068858_1003366362 320
398 3300005842 Ga0068858_100339202 Ga0068858_1003392022 320
399 3300005843 Ga0068860_100000596 Ga0068860_10000059633 320
400 3300005843 Ga0068860_100000777 Ga0068860_10000077721 320
401 3300005843 Ga0068860_100002154 Ga0068860_10000215415 320
402 3300005843 Ga0068860_100017118 Ga0068860_1000171185 320
403 3300005843 Ga0068860_100017541 Ga0068860_1000175417 320
404 3300005843 Ga0068860_100069809 Ga0068860_1000698092 320
405 3300005843 Ga0068860_100127281 Ga0068860_1001272812 320
406 3300005844 Ga0068862_100001370 Ga0068862_1000013708 320
407 3300005844 Ga0068862_100045397 Ga0068862_1000453973 320
408 3300006058 Ga0075432_10099271 Ga0075432_100992711 320
409 3300006195 Ga0075366_10121825 Ga0075366_101218251 320
410 3300006237 Ga0097621_100011987 Ga0097621_1000119873 320
411 3300006237 Ga0097621_100015253 Ga0097621_1000152535 320
412 3300006237 Ga0097621_100109470 Ga0097621_1001094702 320
413 3300006237 Ga0097621_100149441 Ga0097621_1001494412 320
414 3300006237 Ga0097621_100151429 Ga0097621_1001514292 320
415 3300006237 Ga0097621_100164252 Ga0097621_1001642522 320
416 3300006237 Ga0097621_100314610 Ga0097621_1003146102 320
417 3300006358 Ga0068871_100009289 Ga0068871_1000092893 320
418 3300006358 Ga0068871_100036720 Ga0068871_1000367202 320
419 3300006358 Ga0068871_100212309 Ga0068871_1002123091 320
420 3300006358 Ga0068871_100265432 Ga0068871_1002654322 320
421 3300006358 Ga0068871_100421772 Ga0068871_1004217721 320
422 3300006844 Ga0075428_100080994 Ga0075428_1000809942 320
423 3300006844 Ga0075428_100212101 Ga0075428_1002121012 320
424 3300006847 Ga0075431_100027626 Ga0075431_1000276263 320
425 3300006880 Ga0075429_100261132 Ga0075429_1002611322 320
426 3300006881 Ga0068865_100098870 Ga0068865_1000988702 320
427 3300006881 Ga0068865_100269406 Ga0068865_1002694061 320
428 3300006881 Ga0068865_100328192 Ga0068865_1003281921 320
429 3300006931 Ga0097620_100004525 Ga0097620_1000045254 320
430 3300006931 Ga0097620_100017776 Ga0097620_1000177767 320
431 3300006931 Ga0097620_100104714 Ga0097620_1001047141 320
432 3300006931 Ga0097620_100108392 Ga0097620_1001083922 320
433 3300006931 Ga0097620_100114384 Ga0097620_1001143842 320
434 3300006931 Ga0097620_100229342 Ga0097620_1002293422 320
435 3300006931 Ga0097620_100297649 Ga0097620_1002976492 320
436 3300009093 Ga0105240_10000176 Ga0105240_1000017628 320
437 3300009093 Ga0105240_10002998 Ga0105240_100029983 320
438 3300009093 Ga0105240_10005856 Ga0105240_1000585612 320
439 3300009093 Ga0105240_10010362 Ga0105240_1001036214 320
440 3300009093 Ga0105240_10031846 Ga0105240_100318466 320
441 3300009093 Ga0105240_10032929 Ga0105240_100329296 320
442 3300009093 Ga0105240_10041765 Ga0105240_100417653 320
443 3300009093 Ga0105240_10051138 Ga0105240_100511384 320
444 3300009093 Ga0105240_10058045 Ga0105240_100580452 320
445 3300009093 Ga0105240_10082359 Ga0105240_100823592 320
446 3300009094 Ga0111539_10001397 Ga0111539_1000139722 320
447 3300009094 Ga0111539_10091224 Ga0111539_100912242 320
448 3300009094 Ga0111539_10178691 Ga0111539_101786912 320
449 3300009094 Ga0111539_10190839 Ga0111539_101908392 320
450 3300009098 Ga0105245_10023335 Ga0105245_100233354 320
451 3300009101 Ga0105247_10004404 Ga0105247_100044048 320
452 3300009101 Ga0105247_10040699 Ga0105247_100406992 320
453 3300009147 Ga0114129_10037835 Ga0114129_100378351 320
454 3300009147 Ga0114129_10073293 Ga0114129_100732933 320
455 3300009174 Ga0105241_10000863 Ga0105241_100008632 320
456 3300009174 Ga0105241_10074516 Ga0105241_100745162 320
457 3300009174 Ga0105241_10077519 Ga0105241_100775192 320
458 3300009176 Ga0105242_10051079 Ga0105242_100510793 320
459 3300009176 Ga0105242_10056838 Ga0105242_100568382 320
460 3300009176 Ga0105242_10075675 Ga0105242_100756752 320
461 3300009176 Ga0105242_10455774 Ga0105242_104557741 320
462 3300009545 Ga0105237_10004562 Ga0105237_1000456214 320
463 3300009545 Ga0105237_10008038 Ga0105237_1000803811 320
464 3300009545 Ga0105237_10015195 Ga0105237_100151957 320
465 3300009545 Ga0105237_10019152 Ga0105237_100191524 320
466 3300009545 Ga0105237_10038808 Ga0105237_100388081 320
467 3300009545 Ga0105237_10074580 Ga0105237_100745802 320
468 3300009545 Ga0105237_10092622 Ga0105237_100926222 320
469 3300009545 Ga0105237_10152269 Ga0105237_101522691 320
470 3300009551 Ga0105238_10006098 Ga0105238_1000609811 320
471 3300009551 Ga0105238_10080771 Ga0105238_100807712 320
472 3300009551 Ga0105238_10088621 Ga0105238_100886212 320
473 3300009553 Ga0105249_10000762 Ga0105249_1000076221 320
474 3300009553 Ga0105249_10008695 Ga0105249_100086959 320
475 3300009553 Ga0105249_10031679 Ga0105249_100316792 320
476 3300009553 Ga0105249_10129051 Ga0105249_101290512 320
477 3300009553 Ga0105249_10246004 Ga0105249_102460042 320
478 3300010375 Ga0105239_10001803 Ga0105239_1000180325 320
479 3300010375 Ga0105239_10002666 Ga0105239_100026669 320
480 3300010375 Ga0105239_10010948 Ga0105239_100109484 320
481 3300010375 Ga0105239_10012714 Ga0105239_100127143 320
482 3300010375 Ga0105239_10021330 Ga0105239_100213303 320
483 3300010375 Ga0105239_10084190 Ga0105239_100841903 320
484 3300010375 Ga0105239_10271390 Ga0105239_102713902 320
485 3300010375 Ga0105239_10412287 Ga0105239_104122872 320
486 3300013100 Ga0157373_10000199 Ga0157373_1000019932 320
487 3300013100 Ga0157373_10008107 Ga0157373_100081075 320
488 3300013100 Ga0157373_10012082 Ga0157373_100120824 320
489 3300013100 Ga0157373_10012757 Ga0157373_100127572 320
490 3300013100 Ga0157373_10053994 Ga0157373_100539942 320
491 3300013100 Ga0157373_10095610 Ga0157373_100956101 320
492 3300013100 Ga0157373_10137377 Ga0157373_101373772 320
493 3300013100 Ga0157373_10153163 Ga0157373_101531631 320
494 3300013102 Ga0157371_10000642 Ga0157371_1000064240 320
495 3300013102 Ga0157371_10000903 Ga0157371_1000090333 320
496 3300013102 Ga0157371_10001268 Ga0157371_1000126822 320
497 3300013102 Ga0157371_10002520 Ga0157371_100025204 320
498 3300013102 Ga0157371_10007209 Ga0157371_100072096 320
499 3300013102 Ga0157371_10009384 Ga0157371_100093849 320
500 3300013102 Ga0157371_10019013 Ga0157371_100190132 320
501 3300013102 Ga0157371_10020978 Ga0157371_100209782 320
502 3300013102 Ga0157371_10021017 Ga0157371_100210171 320
503 3300013102 Ga0157371_10022394 Ga0157371_100223945 320
504 3300013102 Ga0157371_10054371 Ga0157371_100543712 320
505 3300013102 Ga0157371_10105550 Ga0157371_101055501 320
506 3300013102 Ga0157371_10139114 Ga0157371_101391142 320
507 3300013102 Ga0157371_10159718 Ga0157371_101597182 320
508 3300013102 Ga0157371_10172658 Ga0157371_101726582 320
509 3300013104 Ga0157370_10003741 Ga0157370_1000374114 320
510 3300013104 Ga0157370_10005547 Ga0157370_100055479 320
511 3300013104 Ga0157370_10072411 Ga0157370_100724112 320
512 3300013104 Ga0157370_10138293 Ga0157370_101382932 320
513 3300013104 Ga0157370_10155018 Ga0157370_101550182 320
514 3300013104 Ga0157370_10243642 Ga0157370_102436422 320
515 3300013105 Ga0157369_10008293 Ga0157369_100082934 320
516 3300013105 Ga0157369_10015512 Ga0157369_100155123 320
517 3300013105 Ga0157369_10024769 Ga0157369_100247695 320
518 3300013105 Ga0157369_10025266 Ga0157369_100252662 320
519 3300013105 Ga0157369_10033874 Ga0157369_100338744 320
520 3300013105 Ga0157369_10042652 Ga0157369_100426521 320
521 3300013105 Ga0157369_10092765 Ga0157369_100927652 320
522 3300013105 Ga0157369_10155679 Ga0157369_101556791 320
523 3300013105 Ga0157369_10210755 Ga0157369_102107551 320
524 3300013105 Ga0157369_10301280 Ga0157369_103012802 320
525 3300013105 Ga0157369_10650124 Ga0157369_106501241 320
526 3300013296 Ga0157374_10000007 Ga0157374_1000000710 320
527 3300013296 Ga0157374_10003428 Ga0157374_100034289 320
528 3300013296 Ga0157374_10027172 Ga0157374_100271722 320
529 3300013296 Ga0157374_10028975 Ga0157374_100289753 320
530 3300013296 Ga0157374_10052272 Ga0157374_100522722 320
531 3300013296 Ga0157374_10089977 Ga0157374_100899771 320
532 3300013296 Ga0157374_10097353 Ga0157374_100973532 320
533 3300013297 Ga0157378_10000709 Ga0157378_100007095 320
534 3300013297 Ga0157378_10016147 Ga0157378_100161472 320
535 3300013297 Ga0157378_10018936 Ga0157378_100189364 320
536 3300013297 Ga0157378_10024574 Ga0157378_100245742 320
537 3300013297 Ga0157378_10151665 Ga0157378_101516652 320
538 3300013297 Ga0157378_10209019 Ga0157378_102090192 320
539 3300013297 Ga0157378_10308431 Ga0157378_103084312 320
540 3300013297 Ga0157378_10378438 Ga0157378_103784381 320
541 3300013306 Ga0163162_10006844 Ga0163162_100068449 320
542 3300013306 Ga0163162_10007652 Ga0163162_100076527 320
543 3300013306 Ga0163162_10011844 Ga0163162_100118442 320
544 3300013306 Ga0163162_10013253 Ga0163162_100132536 320
545 3300013306 Ga0163162_10039031 Ga0163162_100390312 320
546 3300013306 Ga0163162_10052497 Ga0163162_100524974 320
547 3300013306 Ga0163162_10137856 Ga0163162_101378561 320
548 3300013306 Ga0163162_10170783 Ga0163162_101707832 320
549 3300013306 Ga0163162_10265893 Ga0163162_102658932 320
550 3300013307 Ga0157372_10000967 Ga0157372_1000096711 320
551 3300013307 Ga0157372_10009905 Ga0157372_100099058 320
552 3300013307 Ga0157372_10027589 Ga0157372_100275893 320
553 3300013307 Ga0157372_10040465 Ga0157372_100404652 320
554 3300013307 Ga0157372_10042643 Ga0157372_100426432 320
555 3300013307 Ga0157372_10047825 Ga0157372_100478252 320
556 3300013307 Ga0157372_10067961 Ga0157372_100679612 320
557 3300013307 Ga0157372_10072526 Ga0157372_100725263 320
558 3300013307 Ga0157372_10079378 Ga0157372_100793782 320
559 3300013307 Ga0157372_10081173 Ga0157372_100811733 320
560 3300013307 Ga0157372_10105605 Ga0157372_101056053 320
561 3300013307 Ga0157372_10157694 Ga0157372_101576942 320
562 3300013307 Ga0157372_10226476 Ga0157372_102264762 320
563 3300013307 Ga0157372_10304885 Ga0157372_103048852 320
564 3300013307 Ga0157372_10326570 Ga0157372_103265702 320
565 3300013307 Ga0157372_10334905 Ga0157372_103349052 320
566 3300013307 Ga0157372_10401960 Ga0157372_104019601 320
567 3300013307 Ga0157372_10445856 Ga0157372_104458562 320
568 3300013308 Ga0157375_10055764 Ga0157375_100557641 320
569 3300013308 Ga0157375_10074473 Ga0157375_100744732 320
570 3300013308 Ga0157375_10075406 Ga0157375_100754061 320
571 3300013308 Ga0157375_10086544 Ga0157375_100865442 320
572 3300013308 Ga0157375_10098105 Ga0157375_100981052 320
573 3300013308 Ga0157375_10123751 Ga0157375_101237512 320
574 3300013308 Ga0157375_10218411 Ga0157375_102184112 320
575 3300014325 Ga0163163_10001556 Ga0163163_1000155613 320
576 3300014325 Ga0163163_10172586 Ga0163163_101725862 320
577 3300014325 Ga0163163_10410012 Ga0163163_104100121 320
578 3300014326 Ga0157380_10002192 Ga0157380_1000219213 320
579 3300014326 Ga0157380_10010105 Ga0157380_100101053 320
580 3300014326 Ga0157380_10058280 Ga0157380_100582802 320
581 3300014326 Ga0157380_10278325 Ga0157380_102783252 320
582 3300014326 Ga0157380_10433227 Ga0157380_104332271 320
583 3300014745 Ga0157377_10010017 Ga0157377_100100172 320
584 3300014745 Ga0157377_10019475 Ga0157377_100194752 320
585 3300014745 Ga0157377_10023271 Ga0157377_100232712 320
586 3300014745 Ga0157377_10125898 Ga0157377_101258982 320
587 3300014968 Ga0157379_10068647 Ga0157379_100686473 320
588 3300014968 Ga0157379_10109132 Ga0157379_101091322 320
589 3300014969 Ga0157376_10000770 Ga0157376_100007703 320
590 3300014969 Ga0157376_10014112 Ga0157376_100141125 320
591 3300014969 Ga0157376_10042924 Ga0157376_100429243 320
592 3300014969 Ga0157376_10254433 Ga0157376_102544332 320
593 3300017792 Ga0163161_10017476 Ga0163161_100174762 320
594 3300017792 Ga0163161_10024857 Ga0163161_100248572 320
595 3300017792 Ga0163161_10061675 Ga0163161_100616752 320
596 3300017792 Ga0163161_10164000 Ga0163161_101640002 320
597 3300017792 Ga0163161_10355750 Ga0163161_103557502 320
598 3300017792 Ga0163161_10406910 Ga0163161_104069101 320
599 3300025246 Ga0209646_1000907 Ga0209646_10009075 320
600 3300025271 Ga0207666_1002406 Ga0207666_10024062 320
601 3300025315 Ga0207697_10021978 Ga0207697_100219782 320
602 3300025315 Ga0207697_10030045 Ga0207697_100300452 320
603 3300025321 Ga0207656_10046747 Ga0207656_100467472 320
604 3300025321 Ga0207656_10089618 Ga0207656_100896182 320
605 3300025893 Ga0207682_10033091 Ga0207682_100330912 320
606 3300025899 Ga0207642_10004146 Ga0207642_100041462 320
607 3300025899 Ga0207642_10022780 Ga0207642_100227802 320
608 3300025900 Ga0207710_10003718 Ga0207710_100037187 320
609 3300025903 Ga0207680_10036011 Ga0207680_100360112 320
610 3300025903 Ga0207680_10046410 Ga0207680_100464102 320
611 3300025903 Ga0207680_10190294 Ga0207680_101902941 320
612 3300025904 Ga0207647_10000491 Ga0207647_1000049114 320
613 3300025904 Ga0207647_10045870 Ga0207647_100458703 320
614 3300025904 Ga0207647_10077279 Ga0207647_100772792 320
615 3300025907 Ga0207645_10009721 Ga0207645_100097213 320
616 3300025907 Ga0207645_10078352 Ga0207645_100783522 320
617 3300025907 Ga0207645_10084326 Ga0207645_100843261 320
618 3300025907 Ga0207645_10105079 Ga0207645_101050792 320
619 3300025908 Ga0207643_10003438 Ga0207643_100034386 320
620 3300025909 Ga0207705_10009810 Ga0207705_100098106 320
621 3300025909 Ga0207705_10011968 Ga0207705_100119681 320
622 3300025909 Ga0207705_10024652 Ga0207705_100246523 320
623 3300025909 Ga0207705_10048728 Ga0207705_100487281 320
624 3300025909 Ga0207705_10180583 Ga0207705_101805832 320
625 3300025909 Ga0207705_10202749 Ga0207705_102027491 320
626 3300025911 Ga0207654_10002799 Ga0207654_100027993 320
627 3300025912 Ga0207707_10168491 Ga0207707_101684912 320
628 3300025912 Ga0207707_10190361 Ga0207707_101903612 320
629 3300025912 Ga0207707_10233629 Ga0207707_102336292 320
630 3300025912 Ga0207707_10281613 Ga0207707_102816131 320
631 3300025913 Ga0207695_10000102 Ga0207695_10000102140 320
632 3300025913 Ga0207695_10000130 Ga0207695_10000130191 320
633 3300025913 Ga0207695_10009181 Ga0207695_100091819 320
634 3300025913 Ga0207695_10013782 Ga0207695_100137823 320
635 3300025913 Ga0207695_10017042 Ga0207695_100170421 320
636 3300025913 Ga0207695_10018385 Ga0207695_100183852 320
637 3300025913 Ga0207695_10021723 Ga0207695_100217235 320
638 3300025914 Ga0207671_10000827 Ga0207671_100008272 320
639 3300025914 Ga0207671_10005301 Ga0207671_100053013 320
640 3300025914 Ga0207671_10030072 Ga0207671_100300722 320
641 3300025917 Ga0207660_10012804 Ga0207660_100128043 320
642 3300025917 Ga0207660_10013025 Ga0207660_100130252 320
643 3300025918 Ga0207662_10079457 Ga0207662_100794572 320
644 3300025919 Ga0207657_10009400 Ga0207657_100094008 320
645 3300025919 Ga0207657_10063644 Ga0207657_100636443 320
646 3300025919 Ga0207657_10066030 Ga0207657_100660302 320
647 3300025919 Ga0207657_10254704 Ga0207657_102547041 320
648 3300025920 Ga0207649_10002378 Ga0207649_1000237812 320
649 3300025920 Ga0207649_10013574 Ga0207649_100135742 320
650 3300025920 Ga0207649_10044736 Ga0207649_100447361 320
651 3300025921 Ga0207652_10000010 Ga0207652_10000010176 320
652 3300025921 Ga0207652_10000844 Ga0207652_1000084419 320
653 3300025921 Ga0207652_10002436 Ga0207652_100024368 320
654 3300025921 Ga0207652_10010853 Ga0207652_100108534 320
655 3300025921 Ga0207652_10013238 Ga0207652_100132383 320
656 3300025921 Ga0207652_10029303 Ga0207652_100293031 320
657 3300025923 Ga0207681_10077685 Ga0207681_100776852 320
658 3300025923 Ga0207681_10085829 Ga0207681_100858292 320
659 3300025923 Ga0207681_10216547 Ga0207681_102165472 320
660 3300025924 Ga0207694_10062457 Ga0207694_100624572 320
661 3300025924 Ga0207694_10203862 Ga0207694_102038622 320
662 3300025925 Ga0207650_10029625 Ga0207650_100296253 320
663 3300025925 Ga0207650_10049202 Ga0207650_100492022 320
664 3300025925 Ga0207650_10075781 Ga0207650_100757812 320
665 3300025925 Ga0207650_10110210 Ga0207650_101102101 320
666 3300025925 Ga0207650_10122136 Ga0207650_101221362 320
667 3300025925 Ga0207650_10196647 Ga0207650_101966472 320
668 3300025925 Ga0207650_10405134 Ga0207650_104051341 320
669 3300025926 Ga0207659_10006734 Ga0207659_100067346 320
670 3300025926 Ga0207659_10047784 Ga0207659_100477842 320
671 3300025926 Ga0207659_10072241 Ga0207659_100722412 320
672 3300025926 Ga0207659_10108067 Ga0207659_101080672 320
673 3300025926 Ga0207659_10236468 Ga0207659_102364682 320
674 3300025931 Ga0207644_10011349 Ga0207644_100113492 320
675 3300025931 Ga0207644_10119323 Ga0207644_101193232 320
676 3300025931 Ga0207644_10303878 Ga0207644_103038781 320
677 3300025931 Ga0207644_10363826 Ga0207644_103638261 320
678 3300025932 Ga0207690_10018682 Ga0207690_100186824 320
679 3300025932 Ga0207690_10120578 Ga0207690_101205782 320
680 3300025933 Ga0207706_10002788 Ga0207706_100027886 320
681 3300025933 Ga0207706_10007192 Ga0207706_1000719212 320
682 3300025933 Ga0207706_10027015 Ga0207706_100270151 320
683 3300025933 Ga0207706_10030989 Ga0207706_100309894 320
684 3300025934 Ga0207686_10064558 Ga0207686_100645582 320
685 3300025934 Ga0207686_10169994 Ga0207686_101699941 320
686 3300025936 Ga0207670_10096704 Ga0207670_100967042 320
687 3300025936 Ga0207670_10103520 Ga0207670_101035202 320
688 3300025936 Ga0207670_10235084 Ga0207670_102350842 320
689 3300025938 Ga0207704_10136967 Ga0207704_101369672 320
690 3300025938 Ga0207704_10365353 Ga0207704_103653531 320
691 3300025940 Ga0207691_10005324 Ga0207691_1000532414 320
692 3300025940 Ga0207691_10014903 Ga0207691_100149032 320
693 3300025940 Ga0207691_10043885 Ga0207691_100438853 320
694 3300025940 Ga0207691_10046637 Ga0207691_100466371 320
695 3300025940 Ga0207691_10092706 Ga0207691_100927062 320
696 3300025940 Ga0207691_10108841 Ga0207691_101088412 320
697 3300025942 Ga0207689_10021455 Ga0207689_100214555 320
698 3300025942 Ga0207689_10025610 Ga0207689_100256101 320
699 3300025942 Ga0207689_10038873 Ga0207689_100388733 320
700 3300025942 Ga0207689_10061309 Ga0207689_100613093 320
701 3300025942 Ga0207689_10079861 Ga0207689_100798612 320
702 3300025942 Ga0207689_10262586 Ga0207689_102625862 320
703 3300025944 Ga0207661_10003428 Ga0207661_1000342813 320
704 3300025944 Ga0207661_10017740 Ga0207661_100177402 320
705 3300025944 Ga0207661_10018601 Ga0207661_100186013 320
706 3300025944 Ga0207661_10032101 Ga0207661_100321013 320
707 3300025944 Ga0207661_10063060 Ga0207661_100630602 320
708 3300025944 Ga0207661_10070150 Ga0207661_100701502 320
709 3300025944 Ga0207661_10256933 Ga0207661_102569332 320
710 3300025944 Ga0207661_10331924 Ga0207661_103319242 320
711 3300025945 Ga0207679_10000777 Ga0207679_1000077711 320
712 3300025945 Ga0207679_10002266 Ga0207679_100022662 320
713 3300025949 Ga0207667_10000221 Ga0207667_1000022162 320
714 3300025949 Ga0207667_10001278 Ga0207667_1000127822 320
715 3300025949 Ga0207667_10022315 Ga0207667_100223156 320
716 3300025949 Ga0207667_10023835 Ga0207667_100238356 320
717 3300025949 Ga0207667_10033325 Ga0207667_100333252 320
718 3300025949 Ga0207667_10034583 Ga0207667_100345832 320
719 3300025949 Ga0207667_10101388 Ga0207667_101013882 320
720 3300025960 Ga0207651_10014463 Ga0207651_100144635 320
721 3300025960 Ga0207651_10027634 Ga0207651_100276342 320
722 3300025960 Ga0207651_10053517 Ga0207651_100535172 320
723 3300025960 Ga0207651_10055859 Ga0207651_100558592 320
724 3300025960 Ga0207651_10310194 Ga0207651_103101942 320
725 3300025961 Ga0207712_10008753 Ga0207712_100087536 320
726 3300025961 Ga0207712_10015542 Ga0207712_100155423 320
727 3300025961 Ga0207712_10067778 Ga0207712_100677782 320
728 3300025972 Ga0207668_10041301 Ga0207668_100413012 320
729 3300025981 Ga0207640_10008037 Ga0207640_100080373 320
730 3300025981 Ga0207640_10058377 Ga0207640_100583772 320
731 3300025981 Ga0207640_10098229 Ga0207640_100982292 320
732 3300025981 Ga0207640_10208230 Ga0207640_102082302 320
733 3300025986 Ga0207658_10036045 Ga0207658_100360452 320
734 3300025986 Ga0207658_10060623 Ga0207658_100606232 320
735 3300026023 Ga0207677_10014206 Ga0207677_100142062 320
736 3300026023 Ga0207677_10039382 Ga0207677_100393822 320
737 3300026023 Ga0207677_10054289 Ga0207677_100542892 320
738 3300026023 Ga0207677_10263095 Ga0207677_102630952 320
739 3300026035 Ga0207703_10023732 Ga0207703_100237324 320
740 3300026035 Ga0207703_10099161 Ga0207703_100991612 320
741 3300026035 Ga0207703_10121917 Ga0207703_101219172 320
742 3300026041 Ga0207639_10005921 Ga0207639_100059218 320
743 3300026041 Ga0207639_10026983 Ga0207639_100269832 320
744 3300026041 Ga0207639_10077154 Ga0207639_100771541 320
745 3300026041 Ga0207639_10128085 Ga0207639_101280852 320
746 3300026041 Ga0207639_10212034 Ga0207639_102120341 320
747 3300026067 Ga0207678_10040091 Ga0207678_100400913 320
748 3300026067 Ga0207678_10111472 Ga0207678_101114722 320
749 3300026075 Ga0207708_10111411 Ga0207708_101114112 320
750 3300026078 Ga0207702_10111936 Ga0207702_101119362 320
751 3300026078 Ga0207702_10263303 Ga0207702_102633031 320
752 3300026078 Ga0207702_10394200 Ga0207702_103942002 320
753 3300026088 Ga0207641_10013375 Ga0207641_100133753 320
754 3300026088 Ga0207641_10261188 Ga0207641_102611882 320
755 3300026088 Ga0207641_10342633 Ga0207641_103426332 320
756 3300026089 Ga0207648_10003106 Ga0207648_100031067 320
757 3300026089 Ga0207648_10053515 Ga0207648_100535153 320
758 3300026089 Ga0207648_10064421 Ga0207648_100644213 320
759 3300026089 Ga0207648_10107816 Ga0207648_101078162 320
760 3300026089 Ga0207648_10113527 Ga0207648_101135272 320
761 3300026089 Ga0207648_10283578 Ga0207648_102835782 320
762 3300026095 Ga0207676_10012386 Ga0207676_100123862 320
763 3300026095 Ga0207676_10024768 Ga0207676_100247684 320
764 3300026095 Ga0207676_10052488 Ga0207676_100524882 320
765 3300026095 Ga0207676_10296588 Ga0207676_102965881 320
766 3300026116 Ga0207674_10003303 Ga0207674_1000330310 320
767 3300026116 Ga0207674_10010027 Ga0207674_100100278 320
768 3300026116 Ga0207674_10032451 Ga0207674_100324515 320
769 3300026116 Ga0207674_10135441 Ga0207674_101354412 320
770 3300026116 Ga0207674_10139765 Ga0207674_101397652 320
771 3300026118 Ga0207675_100008354 Ga0207675_1000083546 320
772 3300026118 Ga0207675_100077223 Ga0207675_1000772232 320
773 3300026118 Ga0207675_100179639 Ga0207675_1001796392 320
774 3300026118 Ga0207675_100191189 Ga0207675_1001911891 320
775 3300026118 Ga0207675_100200663 Ga0207675_1002006632 320
776 3300026118 Ga0207675_100211841 Ga0207675_1002118412 320
777 3300026121 Ga0207683_10011596 Ga0207683_100115963 320
778 3300026121 Ga0207683_10072291 Ga0207683_100722912 320
779 3300026142 Ga0207698_10004084 Ga0207698_100040849 320
780 3300026142 Ga0207698_10004661 Ga0207698_100046616 320
781 3300026142 Ga0207698_10006806 Ga0207698_100068065 320
782 3300026142 Ga0207698_10043890 Ga0207698_100438902 320
783 3300026142 Ga0207698_10081820 Ga0207698_100818202 320
784 3300026142 Ga0207698_10096906 Ga0207698_100969062 320
785 3300026142 Ga0207698_10196196 Ga0207698_101961962 320
786 3300026142 Ga0207698_10231533 Ga0207698_102315332 320
787 3300026142 Ga0207698_10308248 Ga0207698_103082482 320
788 3300027876 Ga0209974_10008456 Ga0209974_100084562 320
789 3300027907 Ga0207428_10079249 Ga0207428_100792492 320
790 3300027907 Ga0207428_10161627 Ga0207428_101616272 320
791 3300028379 Ga0268266_10000024 Ga0268266_1000002411 320
792 3300028379 Ga0268266_10538562 Ga0268266_105385621 320
793 3300028380 Ga0268265_10006391 Ga0268265_100063911 320
794 3300028381 Ga0268264_10001090 Ga0268264_1000109014 320
795 3300028381 Ga0268264_10004168 Ga0268264_100041682 320
796 3300028381 Ga0268264_10004652 Ga0268264_100046528 320
797 3300028381 Ga0268264_10010048 Ga0268264_100100486 320
798 3300028381 Ga0268264_10013430 Ga0268264_100134301 320
799 3300028381 Ga0268264_10129039 Ga0268264_101290392 320
800 3300028794 Ga0307515_10000001 Ga0307515_100000011842 320
801 3300028794 Ga0307515_10000036 Ga0307515_10000036185 320
802 3300030521 Ga0307511_10005808 Ga0307511_100058089 320
803 3300030742 Ga0316183_1126150 Ga0316183_11261506 320
804 3300030744 Ga0316181_1171461 Ga0316181_11714614 320
805 3300031251 Ga0265327_10000159 Ga0265327_1000015997 320
806 3300031251 Ga0265327_10000974 Ga0265327_1000097410 320
807 3300031456 Ga0307513_10098240 Ga0307513_100982401 320
808 3300031456 Ga0307513_10124145 Ga0307513_101241452 320
809 3300031507 Ga0307509_10012711 Ga0307509_100127113 320
810 3300031730 Ga0307516_10001566 Ga0307516_1000156612 320
811 3300031730 Ga0307516_10060958 Ga0307516_100609583 320
812 3300031824 Ga0307413_10086178 Ga0307413_100861782 320
813 3300031901 Ga0307406_10113244 Ga0307406_101132442 320
814 3300032004 Ga0307414_10063577 Ga0307414_100635772 320
815 3300032004 Ga0307414_10226012 Ga0307414_102260122 320
816 3300032005 Ga0307411_10000353 Ga0307411_100003535 320
817 3300032005 Ga0307411_10308611 Ga0307411_103086111 320
818 3300033180 Ga0307510_10000208 Ga0307510_1000020836 320
819 3300035170 Ga0373943_0034926 Ga0373943_0034926_1175_2137 320
820 3300035398 Ga0316574_0036024 Ga0316574_0036024_1745_2722 320
821 3300035410 Ga0373924_0040079 Ga0373924_0040079_762_1724 320
822 3300035692 Ga0373935_0246129 Ga0373935_0246129_220_1182 320
823 3300035724 Ga0373933_0044738 Ga0373933_0044738_549_1511 320
824 3300036401 Ga0373937_0081670 Ga0373937_0081670_879_1841 320
825 3300037068 Ga0373925_0106301 Ga0373925_0106301_706_1668 320
826 3300037312 Ga0395899_0001914 Ga0395899_0001914_9905_10867 320
827 3300037312 Ga0395899_0030274 Ga0395899_0030274_1184_2146 320
828 3300037312 Ga0395899_0127959 Ga0395899_0127959_17_979 320
829 3300037312 Ga0395899_0182144 Ga0395899_0182144_396_1358 320
830 3300037418 Ga0395900_0006326 Ga0395900_0006326_9745_10707 320
831 3300037418 Ga0395900_0007456 Ga0395900_0007456_7447_8409 320
832 3300037418 Ga0395900_0014716 Ga0395900_0014716_4847_5809 320
833 3300037418 Ga0395900_0014765 Ga0395900_0014765_5124_6086 320
834 3300037418 Ga0395900_0021684 Ga0395900_0021684_15_977 320
835 3300037418 Ga0395900_0056280 Ga0395900_0056280_655_1686 320
836 3300037418 Ga0395900_0441177 Ga0395900_0441177_162_1124 320
837 3300037466 Ga0395898_0002208 Ga0395898_0002208_6282_7244 320
838 3300037466 Ga0395898_0027229 Ga0395898_0027229_1485_2447 320
839 3300037466 Ga0395898_0038707 Ga0395898_0038707_1407_2369 320
840 3300037466 Ga0395898_0369567 Ga0395898_0369567_333_1295 320
841 3300037471 Ga0395905_0004469 Ga0395905_0004469_3019_4050 320
842 3300037471 Ga0395905_0007405 Ga0395905_0007405_6896_7858 320
843 3300038443 Ga0395901_0001995 Ga0395901_0001995_2650_3612 320
844 3300038443 Ga0395901_0044313 Ga0395901_0044313_1554_2516 320
845 3300038443 Ga0395901_0046680 Ga0395901_0046680_1140_2102 320
846 3300038443 Ga0395901_0049721 Ga0395901_0049721_1520_2482 320
847 3300038443 Ga0395901_0272764 Ga0395901_0272764_133_1095 320
848 3300039437 Ga0436365_0212609 Ga0436365_0212609_19569_20531 320
849 3300039437 Ga0436365_1637134 Ga0436365_1637134_11928_12890 320
850 3300041404 Ga0439436_0001397 Ga0439436_0001397_3569_4531 320
851 3300041406 Ga0439439_0012087 Ga0439439_0012087_311_1273 320
852 3300041406 Ga0439439_0055674 Ga0439439_0055674_44_1006 320
853 3300041459 Ga0451800_0111037 Ga0451800_0111037_76_1038 320
854 3300041486 Ga0451807_2541090 Ga0451807_2541090_80_1042 320
855 3300042001 Ga0439441_007448 Ga0439441_007448_723_1685 320
856 3300042004 Ga0439445_0017227 Ga0439445_0017227_344_1306 320
857 3300042007 Ga0439449_0026828 Ga0439449_0026828_245_1207 320
858 3300042014 Ga0439457_000132 Ga0439457_000132_13856_14818 320
859 3300042015 Ga0439462_0016642 Ga0439462_0016642_784_1746 320
860 3300042125 Ga0450923_001909 Ga0450923_001909_535_1497 320
861 3300042135 Ga0450899_005212 Ga0450899_005212_153_1115 320
862 3300042435 Ga0439434_0011025 Ga0439434_0011025_208_1179 320
863 3300042435 Ga0439434_0014376 Ga0439434_0014376_1155_2117 320
864 3300042461 Ga0439460_0052528 Ga0439460_0052528_237_1199 320
865 3300042876 Ga0451577_0001226 Ga0451577_0001226_16105_17079 320
866 3300042876 Ga0451577_0215091 Ga0451577_0215091_514_1476 320
867 3300044656 Ga0466969_0013327 Ga0466969_0013327_903_1865 320
868 3300044658 Ga0466972_0000058 Ga0466972_0000058_42371_43333 320
869 3300044658 Ga0466972_0000226 Ga0466972_0000226_20304_21266 320
870 3300044658 Ga0466972_0000421 Ga0466972_0000421_10186_11148 320
871 3300044658 Ga0466972_0008578 Ga0466972_0008578_1780_2742 320
872 3300044693 Ga0466961_0003152 Ga0466961_0003152_1898_2860 320
873 3300044706 Ga0466964_0029819 Ga0466964_0029819_503_1465 320
874 3300044712 Ga0453684_0000836 Ga0453684_0000836_90237_91211 320
875 3300044712 Ga0453684_0023157 Ga0453684_0023157_6141_7103 320
876 3300044712 Ga0453684_0029136 Ga0453684_0029136_4580_5542 320
877 3300044712 Ga0453684_0040202 Ga0453684_0040202_4076_5038 320
878 3300044719 Ga0466971_0006367 Ga0466971_0006367_381_1343 320
879 3300044735 Ga0466968_0021190 Ga0466968_0021190_1631_2593 320
880 3300044735 Ga0466968_0051577 Ga0466968_0051577_175_1137 320
881 3300044735 Ga0466968_0054016 Ga0466968_0054016_706_1668 320
882 3300044765 Ga0466970_0006836 Ga0466970_0006836_2808_3770 320
883 3300044842 Ga0466957_0000370 Ga0466957_0000370_13149_14111 320
884 3300044842 Ga0466957_0102784 Ga0466957_0102784_371_1333 320
885 3300044901 Ga0466960_0055778 Ga0466960_0055778_17_1003 320
886 3300044901 Ga0466960_0087765 Ga0466960_0087765_360_1322 320
887 3300045049 Ga0466959_0032713 Ga0466959_0032713_2075_3037 320
888 3300045049 Ga0466959_0039381 Ga0466959_0039381_1168_2130 320
889 3300045051 Ga0451576_0040712 Ga0451576_0040712_2521_3495 320
890 3300045051 Ga0451576_0052108 Ga0451576_0052108_294_1256 320
891 3300045976 Ga0466967_0300511 Ga0466967_0300511_333_1295 320
892 3300046463 Ga0495653_0210972 Ga0495653_0210972_150_1112 320
893 3300046471 Ga0495650_0043738 Ga0495650_0043738_337_1299 320
894 3300046516 Ga0495628_0072974 Ga0495628_0072974_1176_2138 320
895 3300046517 Ga0495630_0004081 Ga0495630_0004081_2123_3085 320
896 3300046616 Ga0495668_0000212 Ga0495668_0000212_76344_77306 320
897 3300046616 Ga0495668_0002096 Ga0495668_0002096_10394_11356 320
898 3300046648 Ga0495611_0002176 Ga0495611_0002176_3439_4401 320
899 3300046663 Ga0495635_0181596 Ga0495635_0181596_297_1259 320
900 3300047320 Ga0495672_0066235 Ga0495672_0066235_744_1706 320
901 3300047320 Ga0495672_0077573 Ga0495672_0077573_247_1209 320
902 3300047322 Ga0495680_0278898 Ga0495680_0278898_200_1162 320
903 3300047443 Ga0495687_000014 Ga0495687_000014_356005_356967 320
904 3300047472 Ga0495686_0000034 Ga0495686_0000034_11408_12370 320
905 3300048913 Ga0496110_0138969 Ga0496110_0138969_1057_2019 320
906 3300048913 Ga0496110_0176010 Ga0496110_0176010_640_1602 320
907 3300049569 Ga0501032_0007664 Ga0501032_0007664_1732_2694 320
908 3300049569 Ga0501032_0016040 Ga0501032_0016040_4292_5254 320
909 3300049571 Ga0501034_0004639 Ga0501034_0004639_5254_6216 320
910 3300049571 Ga0501034_0007696 Ga0501034_0007696_7614_8576 320
911 3300049571 Ga0501034_0049648 Ga0501034_0049648_1763_2725 320
912 3300049571 Ga0501034_0221283 Ga0501034_0221283_873_1835 320
913 3300049572 Ga0501036_0037427 Ga0501036_0037427_1979_2941 320
914 3300049572 Ga0501036_0076187 Ga0501036_0076187_576_1538 320
915 3300049573 Ga0501037_0014118 Ga0501037_0014118_1821_2783 320
916 3300049573 Ga0501037_0115620 Ga0501037_0115620_505_1467 320
917 3300049574 Ga0501038_0014503 Ga0501038_0014503_1032_1994 320
918 3300049574 Ga0501038_0037835 Ga0501038_0037835_1127_2089 320
919 3300049579 Ga0501043_0008403 Ga0501043_0008403_1910_2872 320
920 3300049579 Ga0501043_0139755 Ga0501043_0139755_846_1808 320
921 3300049579 Ga0501043_0180139 Ga0501043_0180139_40_1002 320
922 3300049580 Ga0501046_0003394 Ga0501046_0003394_12746_13708 320
923 3300049581 Ga0501047_0014832 Ga0501047_0014832_4061_5023 320
924 3300049581 Ga0501047_0035018 Ga0501047_0035018_2934_3896 320
925 3300049581 Ga0501047_0072966 Ga0501047_0072966_2214_3176 320
926 3300049582 Ga0501048_0044123 Ga0501048_0044123_1674_2636 320
927 3300049583 Ga0501067_0006884 Ga0501067_0006884_5302_6264 320
928 3300049584 Ga0501068_0028719 Ga0501068_0028719_2057_3019 320
929 3300049586 Ga0501070_0009462 Ga0501070_0009462_2964_3926 320
930 3300049586 Ga0501070_0073570 Ga0501070_0073570_783_1745 320
931 3300049588 Ga0501072_0207657 Ga0501072_0207657_150_1112 320
932 3300049589 Ga0501073_0021419 Ga0501073_0021419_2228_3190 320
933 3300049589 Ga0501073_0047891 Ga0501073_0047891_573_1535 320
934 3300049590 Ga0501074_0002265 Ga0501074_0002265_11277_12239 320
935 3300049652 Ga0501202_000967 Ga0501202_000967_1897_2859 320
936 3300049654 Ga0501207_005632 Ga0501207_005632_497_1459 320
937 3300049662 Ga0501222_002093 Ga0501222_002093_93_1055 320
938 3300049664 Ga0501224_000131 Ga0501224_000131_3425_4387 320
939 3300049669 Ga0501235_008989 Ga0501235_008989_1126_2088 320
940 3300049675 Ga0501243_000013 Ga0501243_000013_2163_3125 320
941 3300049682 Ga0501252_000069 Ga0501252_000069_3277_4239 320
942 3300049688 Ga0501259_000125 Ga0501259_000125_3439_4401 320
943 3300049704 Ga0501221_000034 Ga0501221_000034_6578_7540 320
944 3300049705 Ga0501225_0000682 Ga0501225_0000682_679_1641 320
945 3300049705 Ga0501225_0064672 Ga0501225_0064672_17_997 320
946 3300049744 Ga0501083_0010295 Ga0501083_0010295_3880_4842 320
947 3300049763 Ga0501266_000514 Ga0501266_000514_518_1480 320
948 3300049822 Ga0501035_0017463 Ga0501035_0017463_1581_2543 320
949 3300049822 Ga0501035_0032317 Ga0501035_0032317_1092_2054 320
950 3300049822 Ga0501035_0056995 Ga0501035_0056995_120_1082 320
951 3300049822 Ga0501035_0156771 Ga0501035_0156771_888_1850 320
952 3300049823 Ga0501044_0016285 Ga0501044_0016285_4670_5632 320
953 3300049823 Ga0501044_0020439 Ga0501044_0020439_2637_3599 320
954 3300049823 Ga0501044_0029705 Ga0501044_0029705_3071_4033 320
955 3300049823 Ga0501044_0035617 Ga0501044_0035617_2244_3206 320
956 3300050005 Ga0501284_00065 Ga0501284_00065_13941_14903 320
957 3300050493 nmdc:mga0k408_103579_c1 nmdc:mga0k408_103579_c1_593_1555 320
958 3300050493 nmdc:mga0k408_23407_c1 nmdc:mga0k408_23407_c1_207_1169 320
959 3300050507 nmdc:mga05p37_108310_c1 nmdc:mga05p37_108310_c1_284_1246 320
960 3300050507 nmdc:mga05p37_8854_c2 nmdc:mga05p37_8854_c2_5607_6569 320
961 3300050508 nmdc:mga09592_13422_c1 nmdc:mga09592_13422_c1_1004_1966 320
962 3300050508 nmdc:mga09592_285041_c1 nmdc:mga09592_285041_c1_388_1350 320
963 3300050511 nmdc:mga08y16_127596_c1 nmdc:mga08y16_127596_c1_1424_2386 320
964 3300050511 nmdc:mga08y16_24544_c1 nmdc:mga08y16_24544_c1_1038_2000 320
965 3300050511 nmdc:mga08y16_286315_c1 nmdc:mga08y16_286315_c1_163_1125 320
966 3300050511 nmdc:mga08y16_41237_c1 nmdc:mga08y16_41237_c1_3321_4283 320
967 3300050512 nmdc:mga0n895_32941_c1 nmdc:mga0n895_32941_c1_410_1372 320
968 3300053086 Ga0500578_0000979 Ga0500578_0000979_19920_20882 320
969 3300053086 Ga0500578_0196732 Ga0500578_0196732_260_1222 320
970 3300053090 Ga0500646_0007294 Ga0500646_0007294_1194_2156 320
971 3300053090 Ga0500646_0014304 Ga0500646_0014304_590_1552 320
972 3300053092 Ga0500583_0000141 Ga0500583_0000141_29222_30184 320
973 3300053092 Ga0500583_0010457 Ga0500583_0010457_2469_3431 320
974 3300053093 Ga0500651_0071300 Ga0500651_0071300_189_1151 320
975 3300053096 Ga0500641_0019596 Ga0500641_0019596_536_1498 320
976 3300053103 Ga0500555_029735 Ga0500555_029735_267_1229 320
977 3300053108 Ga0500562_000073 Ga0500562_000073_17271_18233 320
978 3300053108 Ga0500562_037054 Ga0500562_037054_229_1191 320
979 3300053131 Ga0500652_021315 Ga0500652_021315_946_1908 320
980 3300053139 Ga0500568_0001078 Ga0500568_0001078_14564_15526 320
981 3300053139 Ga0500568_0005571 Ga0500568_0005571_2495_3457 320
982 3300053146 Ga0500588_0020261 Ga0500588_0020261_805_1767 320
983 3300053147 Ga0500589_025325 Ga0500589_025325_661_1623 320
984 3300053156 Ga0500622_0002318 Ga0500622_0002318_3044_4006 320
985 3300053156 Ga0500622_0003489 Ga0500622_0003489_7010_7972 320
986 3300053156 Ga0500622_0013260 Ga0500622_0013260_3065_4027 320
987 3300053177 Ga0500636_0044125 Ga0500636_0044125_598_1560 320
988 3300053177 Ga0500636_0074405 Ga0500636_0074405_541_1503 320
989 3300053727 Ga0500611_000002 Ga0500611_000002_129557_130519 320
990 3300053727 Ga0500611_001974 Ga0500611_001974_980_1942 320
991 3300053730 Ga0500645_009406 Ga0500645_009406_781_1743 320
992 3300053730 Ga0500645_018620 Ga0500645_018620_635_1597 320
993 3300053739 Ga0500587_009582 Ga0500587_009582_222_1184 320
994 3300055283 Ga0500661_001277 Ga0500661_001277_3175_4137 320
995 3300061719 Ga0466962_0019064 Ga0466962_0019064_1425_2387 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

59

304

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jxn-assembly1.cif.gz_A-2 crystal structure of polyprenyl synthase isp_b (target efi-509198) from roseobacter denitrificans 0.9286 5 317
4jyx-assembly5.cif.gz_E-3 crystal structure of polyprenyl synthase patl_3739 (target efi-509195) from pseudoalteromonas atlantica, complex with inorganic phosphate and an unknown ligand 0.9188 5 317
3rmg-assembly1.cif.gz_B crystal structure of geranylgeranyl pyrophosphate synthase from bacteroides thetaiotaomicron 0.912 3 317
4jyx-assembly4.cif.gz_F crystal structure of polyprenyl synthase patl_3739 (target efi-509195) from pseudoalteromonas atlantica, complex with inorganic phosphate and an unknown ligand 0.9118 5 319
4jyx-assembly6.cif.gz_C crystal structure of polyprenyl synthase patl_3739 (target efi-509195) from pseudoalteromonas atlantica, complex with inorganic phosphate and an unknown ligand 0.9118 5 319
ID Description Score Start End Superfamily
3oyrA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9108 5 317 1.10.600.10
3mzvA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9083 5 319 1.10.600.10
4lobA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9031 2 316 1.10.600.10
af_P0AD57_1_323_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8964 1 319 1.10.600.10
af_P0AD57_1_323_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8938 1 319 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A3C0AYA4-F1-model_v4 Polyprenyl synthetase 0.98 107 319 GO:0004659
GO:0008299
AF-A0A0R2TLX4-F1-model_v4 Polyprenyl synthetase 0.9687 99 319 GO:0004659
GO:0008299
AF-A0A3C0AYA4-F1-model_v4 Polyprenyl synthetase 0.9578 107 319 GO:0004659
GO:0008299
AF-A0A0R2TLX4-F1-model_v4 Polyprenyl synthetase 0.9517 99 319 GO:0004659
GO:0008299
AF-A0A2G6LLW7-F1-model_v4 Polyprenyl synthetase 0.9451 5 301 GO:0004659
GO:0008299

Feature Viewer

pLDDT pTM Quality
89.57 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map