F487754

General Info

Members Datasets Scaffolds Average Seq Length
995 746 541 258

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0108168|Ga0495638_0108168_301_1233
Length 310
Sequence MWHKASLYPINAFLENYMSTNTQTAASRNAQPVLVKQDDVPAEKPLAASAXXXXAEPAIIVERRQRVGLITLNRPKTLNAIDTRLAADVMAALAVFDADDNIGAVIITGSPRAFAAGADISEMAEKTFSDLYAHDVFGAWDQFPAIRKPVIAAVAGYALGGGFELAMMCDFIIAADDAQFGQPEIKLGVLPGIGGSQRLTRAVGKALAMDLILTGRTIGAQEARASGIVARVVPAAELLQVALETAHTIAAYNAPAVLMAKEAVNRAFEVPLTEGILHERRLFQAAFATEGQKEGMHAFIAKRAPVFRHR

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
5 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
6 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
7 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
8 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
9 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
15 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
16 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
17 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
18 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
19 2512875024 Mesorhizobium loti R88b Isolate Nodule
20 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
21 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
22 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
23 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
24 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
25 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
26 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
27 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
28 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
29 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
30 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
33 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
34 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2519899620 Rhizobium sp. Pop5 Isolate Nodule
45 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
46 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
47 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
48 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
49 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
50 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
51 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
52 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
53 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
54 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
55 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
56 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
57 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
58 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
59 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
60 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
61 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
62 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
63 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
64 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
65 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
66 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
67 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
68 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
69 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
70 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
71 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
72 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
73 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
74 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
75 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
76 2643221599 Rhizobium sp. Root708 Isolate Unclassified
77 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
78 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
79 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
80 2643221723 Ensifer sp. Root278 Isolate Unclassified
81 2643221733 Bosea sp. Root381 Isolate Unclassified
82 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
83 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
84 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
85 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
86 2718217882 Rhizobium sp. N741 Isolate Nodule
87 2718217927 Rhizobium sp. N324 Isolate Nodule
88 2718218009 Rhizobium sp. N561 Isolate Nodule
89 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
90 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
91 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
92 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
93 2718218363 Rhizobium sp. N113 Isolate Nodule
94 2718218365 Rhizobium sp. N731 Isolate Nodule
95 2718218366 Rhizobium sp. N621 Isolate Nodule
96 2718218423 Rhizobium sp. N941 Isolate Nodule
97 2721755514 Rhizobium sp. N6212 Isolate Nodule
98 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
99 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
100 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
101 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
102 2721755809 Rhizobium sp. N541 Isolate Nodule
103 2721755810 Rhizobium sp. N871 Isolate Nodule
104 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
105 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
106 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
107 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
108 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
109 2728369365 Rhizobium sp. N1341 Isolate Nodule
110 2728369397 Rhizobium sp. N1314 Isolate Nodule
111 2738541293 Rhizobium sp. GV031 Isolate Unclassified
112 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
113 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
114 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
115 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
116 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
117 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
118 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
119 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
120 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
121 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
122 2791355256 Rhizobium sp. M10 Isolate Nodule
123 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
124 2791355260 Rhizobium sp. L9 Isolate Nodule
125 2791355261 Rhizobium sp. J15 Isolate Nodule
126 2791355262 Rhizobium sp. M1 Isolate Nodule
127 2791355263 Rhizobium chutanense C5 Isolate Nodule
128 2791355264 Rhizobium sp. S9 Isolate Nodule
129 2791355265 Rhizobium sp. H4 Isolate Nodule
130 2791355267 Rhizobium sp. L18 Isolate Nodule
131 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
132 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
133 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
134 2802429633 Rhizobium anhuiense J3 Isolate Nodule
135 2802429634 Rhizobium anhuiense S10 Isolate Nodule
136 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
137 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
138 2802429637 Rhizobium anhuiense C15 Isolate Nodule
139 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
140 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
141 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
142 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
143 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
144 2838061910 Rhizobium phaseoli L15 Isolate Nodule
145 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
146 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
147 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
148 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
149 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
150 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
151 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
152 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
153 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
154 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
155 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
156 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
157 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
158 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
159 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
160 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
161 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
162 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
163 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
164 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
165 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
166 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
167 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
168 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
169 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
170 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
171 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
172 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
173 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
174 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
175 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
176 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
177 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
178 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
179 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
180 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
181 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
182 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
183 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
184 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
185 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
186 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
187 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
188 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
189 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
190 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
191 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
192 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
193 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
194 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
195 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
196 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
197 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
198 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
199 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
200 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
201 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
202 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
203 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
204 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
205 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
206 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
207 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
208 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
209 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
210 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
211 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
212 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
213 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
214 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
215 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
216 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
217 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
218 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
219 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
220 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
221 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
222 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
223 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
224 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
225 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
226 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
227 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
228 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
229 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
230 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
231 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
232 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
233 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
234 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
235 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
236 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
237 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
238 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
239 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
240 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
241 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
242 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
243 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
244 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
245 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
246 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
247 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
248 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
249 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
250 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
251 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
252 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
253 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
254 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
255 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
256 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
257 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
258 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
259 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
260 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
261 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
262 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
263 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
264 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
265 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
266 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
267 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
268 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
269 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
270 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
271 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
272 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
273 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
274 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
275 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
276 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
277 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
278 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
279 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
280 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
281 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
282 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
283 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
284 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
285 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
286 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
287 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
288 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
289 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
290 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
291 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
292 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
293 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
294 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
295 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
296 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
297 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
298 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
299 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
300 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
301 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
302 2933599457 Rhizobium phaseoli M3 Isolate Nodule
303 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
304 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
305 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
306 2936381700 Rhizobium chutanense C16 Isolate Unclassified
307 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
308 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
309 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
310 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
311 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
312 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
313 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
314 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
315 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
316 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
317 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
318 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
319 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
320 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
321 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
322 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
323 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
324 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
325 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
326 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
327 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
328 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
329 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
330 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
331 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
332 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
333 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
334 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
335 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
336 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
337 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
338 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
339 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
340 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
341 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
342 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
343 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
344 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
345 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
346 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
347 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
348 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
349 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
350 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
351 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
352 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
353 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
354 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
355 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
356 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
357 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
358 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
359 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
360 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
361 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
362 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
363 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
364 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
365 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
366 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
367 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
368 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
369 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
370 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
371 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
372 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
373 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
374 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
375 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
376 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
377 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
378 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
379 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
380 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
381 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
382 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
383 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
384 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
385 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
386 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
387 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
388 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
389 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
390 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
391 2996887358 Rhizobium sp. R711 Isolate Nodule
392 2996893221 Rhizobium sp. R635 Isolate Nodule
393 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
394 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
395 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
396 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
397 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
398 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
399 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
400 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
401 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
402 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
403 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
404 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
405 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
406 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
407 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
408 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
409 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
410 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
411 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
412 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
413 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
414 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
415 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
416 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
417 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
418 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
419 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
420 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
421 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
422 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
423 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
424 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
425 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
426 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
427 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
428 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
429 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
430 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
431 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
432 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
433 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
434 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
435 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
436 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
437 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
438 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
439 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
440 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
441 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
442 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
443 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
444 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
445 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
446 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
447 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
448 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
449 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
450 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
451 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
452 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
453 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
454 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
455 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
456 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
457 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
458 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
459 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
460 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
461 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
462 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
463 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
464 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
465 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
466 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
467 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
468 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
469 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
470 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
471 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
472 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
473 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
474 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
475 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
476 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
477 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
478 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
479 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
480 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
481 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
482 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
483 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
484 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
485 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
486 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
487 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
488 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
489 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
490 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
491 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
492 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
493 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
494 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
495 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
496 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
497 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
498 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
499 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
500 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
501 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
502 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
503 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
504 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
505 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
506 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
507 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
508 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
522 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
523 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
526 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
528 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
529 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
530 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
531 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
532 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
533 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
534 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
535 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
536 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
538 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
539 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
540 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
541 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
542 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
543 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
544 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
545 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
546 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
547 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
548 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
549 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
550 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
551 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
552 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
553 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
554 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
555 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
556 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
557 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
558 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
559 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
560 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
561 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
562 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
563 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
564 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
565 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
566 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
567 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
568 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
569 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
570 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
571 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
572 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
573 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
574 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
575 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
576 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
577 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
578 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
579 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
580 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
581 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
582 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
583 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
584 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
585 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
586 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
587 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
588 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
589 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
590 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
591 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
592 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
593 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
594 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
595 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
596 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
597 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
598 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
599 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
600 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
601 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
602 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
603 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
604 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
605 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
606 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
607 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
608 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
609 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
610 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
611 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
612 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
613 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
614 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
615 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
616 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
617 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
618 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
619 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
620 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
621 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
622 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
623 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
624 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
625 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
626 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
627 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
628 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
629 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
630 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
631 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
632 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
633 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
634 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
635 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
636 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
637 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
638 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
639 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
640 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
641 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
642 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
643 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
644 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
645 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
646 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
647 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
648 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
649 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
650 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
651 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
652 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
653 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
654 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
655 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
656 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
657 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
658 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
659 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
660 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
661 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
662 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
663 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
664 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
665 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
666 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
667 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
668 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
669 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
670 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
671 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
672 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
673 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
674 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
675 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
676 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
677 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
678 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
679 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
680 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
681 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
682 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
683 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
684 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
685 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
686 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
687 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
688 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
689 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
690 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
691 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
692 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
693 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
694 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
695 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
696 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
697 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
698 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
699 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
700 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
701 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
702 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
703 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
704 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
705 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
706 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
707 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
708 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
709 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
710 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
711 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
712 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
713 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
714 8005258706 Rhizobium sp. R693 Isolate Nodule
715 8005275841 Rhizobium sp. N4311 Isolate Nodule
716 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
717 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
718 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
719 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
720 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
721 8005321885 Rhizobium sp. R72 Isolate Nodule
722 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
723 8005382845 Rhizobium sp. R634 Isolate Nodule
724 8005395548 Rhizobium sp. R339 Isolate Nodule
725 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
726 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
727 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
728 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
729 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
730 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
731 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
732 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
733 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
734 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
735 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
736 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
737 8018176218 Rhizobium sp. N122 Isolate Nodule
738 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
739 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
740 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
741 8024501048 Rhizobium sp. H4 Isolate Nodule
742 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
743 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
744 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
745 8056382006 Rhizobium croatiense 13T Isolate Nodule
746 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.37
Metatranscriptomes 0
Isolates 45.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.17
Nodule 36.98
Rhizoplane 1.21
Rhizosphere 37.89
Stem 0
Stem Tuber 0
Unclassified 9.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000723 3300002737 Bacteria 22734
2 JGI25158J39367_1007800 3300002739 Bacteria 1500
3 JGI25157J39369_1003765 3300002741 Bacteria 2976
4 JGI25152J39213_1000949 3300002773 Bacteria 14206
5 JGI25152J39213_1001249 3300002773 Bacteria 11601
6 JGI25152J39213_1004111 3300002773 Bacteria 4702
7 JGI25150J39212_1000133 3300002774 Bacteria 41648
8 JGI25159J45721_1000003 3300002987 Bacteria 274069
9 JGI25159J45721_1001316 3300002987 Bacteria 10484
10 JGI25151J46595_10000407 3300003187 Bacteria 44348
11 JGI25151J46595_10016907 3300003187 Bacteria 3179
12 JGI25151J46595_10019080 3300003187 Bacteria 2924
13 JGI25165J46597_1000019 3300003214 Bacteria 371528
14 JGI25165J46597_1000607 3300003214 Bacteria 30530
15 JGI25165J46597_1008336 3300003214 Bacteria 1632
16 JGI25160J50197_1000003 3300003354 Bacteria 482719
17 JGI25160J50197_1000012 3300003354 Bacteria 267582
18 JGI25160J50197_1005584 3300003354 Bacteria 5208
19 JGI25161J50226_1000002 3300003374 Bacteria 420324
20 JGI25161J50226_1000548 3300003374 Bacteria 16030
21 JGI25161J50226_1001904 3300003374 Bacteria 5784
22 JGI25161J50226_1003853 3300003374 Bacteria 3292
23 Ga0055542_1000493 3300003762 Bacteria 36308
24 Ga0055529_1002300 3300003763 Bacteria 3828
25 Ga0055526_1000639 3300003771 Bacteria 27197
26 Ga0055526_1023736 3300003771 Bacteria 2036
27 Ga0055524_1023182 3300003775 Bacteria 2005
28 Ga0055524_1025940 3300003775 Bacteria 1824
29 Ga0055524_1028756 3300003775 Bacteria 1659
30 Ga0055524_1040940 3300003775 Bacteria 1174
31 Ga0055536_1003170 3300003781 Bacteria 8918
32 Ga0055528_1012850 3300003790 Bacteria 3217
33 Ga0055528_1022043 3300003790 Bacteria 1996
34 Ga0055528_1026614 3300003790 Bacteria 1654
35 Ga0055528_1038331 3300003790 Bacteria 1113
36 Ga0055530_10012113 3300003791 Bacteria 3034
37 Ga0055540_1000181 3300003792 Bacteria 61906
38 Ga0055540_1024686 3300003792 Bacteria 1487
39 Ga0055543_1000011 3300004625 Bacteria 196089
40 Ga0055543_1000223 3300004625 Bacteria 45570
41 Ga0055543_1000359 3300004625 Bacteria 30667
42 Ga0065165_1000025 3300005262 Bacteria 246909
43 Ga0065165_1001668 3300005262 Bacteria 22466
44 Ga0065165_1003740 3300005262 Bacteria 10243
45 Ga0065165_1022339 3300005262 Bacteria 2171
46 Ga0070658_10016770 3300005327 Bacteria 5863
47 Ga0070658_10248214 3300005327 Bacteria 1510
48 Ga0070666_10018796 3300005335 Bacteria 4451
49 Ga0070660_100122721 3300005339 Bacteria 2074
50 Ga0070668_100101908 3300005347 Bacteria 2276
51 Ga0070668_100214010 3300005347 Bacteria 1586
52 Ga0070671_100052083 3300005355 Bacteria 3404
53 Ga0070674_100190387 3300005356 Bacteria 1578
54 Ga0070667_100199413 3300005367 Bacteria 1776
55 Ga0070667_100571052 3300005367 Bacteria 1041
56 Ga0070700_100279377 3300005441 Bacteria 1210
57 Ga0070663_100153491 3300005455 Bacteria 1767
58 Ga0070663_100226311 3300005455 Bacteria 1471
59 Ga0070678_100086731 3300005456 Bacteria 2389
60 Ga0070662_100202097 3300005457 Bacteria 1577
61 Ga0070679_100004088 3300005530 Bacteria 13456
62 Ga0068853_100007936 3300005539 Bacteria 8511
63 Ga0070665_100051973 3300005548 Bacteria 4110
64 Ga0070665_100137694 3300005548 Bacteria 2444
65 Ga0070665_100405713 3300005548 Bacteria 1371
66 Ga0070665_100542109 3300005548 Bacteria 1175
67 Ga0070704_100090342 3300005549 Bacteria 2281
68 Ga0068855_100204532 3300005563 Bacteria 2222
69 Ga0070664_100168246 3300005564 Bacteria 1943
70 Ga0068854_100018610 3300005578 Bacteria 4667
71 Ga0068856_100306331 3300005614 Bacteria 1606
72 Ga0068856_100433468 3300005614 Bacteria 1335
73 Ga0068852_100224939 3300005616 Bacteria 1786
74 Ga0068852_100592194 3300005616 Bacteria 1112
75 Ga0068852_100962890 3300005616 Bacteria 872
76 Ga0068859_100696265 3300005617 Bacteria 1107
77 Ga0068863_100114431 3300005841 Bacteria 2570
78 Ga0068863_100437135 3300005841 Bacteria 1283
79 Ga0068862_100468176 3300005844 Bacteria 1191
80 Ga0081455_10072907 3300005937 Bacteria 2841
81 Ga0081540_1000655 3300005983 Bacteria 32710
82 Ga0081540_1084931 3300005983 Bacteria 1411
83 Ga0075365_10000182 3300006038 Bacteria 20490
84 Ga0075365_10005860 3300006038 Bacteria 6683
85 Ga0075365_10014090 3300006038 Bacteria 4803
86 Ga0075365_10205677 3300006038 Bacteria 1380
87 Ga0075363_100005969 3300006048 Bacteria 5490
88 Ga0075363_100072620 3300006048 Bacteria 1871
89 Ga0075363_100203558 3300006048 Bacteria 1131
90 Ga0075364_10013728 3300006051 Bacteria 4990
91 Ga0075362_10003461 3300006177 Bacteria 5522
92 Ga0075362_10047948 3300006177 Bacteria 1904
93 Ga0075367_10001637 3300006178 Bacteria 9746
94 Ga0075367_10044376 3300006178 Bacteria 2606
95 Ga0075367_10194794 3300006178 Bacteria 1265
96 Ga0075366_10010606 3300006195 Bacteria 5175
97 Ga0075370_10142885 3300006353 Bacteria 1399
98 Ga0075428_100011226 3300006844 Bacteria 9969
99 Ga0075433_10332303 3300006852 Bacteria 1344
100 Ga0075434_100086928 3300006871 Bacteria 3127
101 Ga0075434_100369745 3300006871 Bacteria 1455
102 Ga0097620_100696065 3300006931 Bacteria 1107
103 Ga0105240_10000024 3300009093 Bacteria 375919
104 Ga0105240_10006353 3300009093 Bacteria 17401
105 Ga0105240_10006667 3300009093 Bacteria 16932
106 Ga0105240_10034779 3300009093 Bacteria 6497
107 Ga0105240_10586269 3300009093 Bacteria 1229
108 Ga0105240_10690160 3300009093 Bacteria 1115
109 Ga0105240_10702332 3300009093 Bacteria 1104
110 Ga0111539_10395937 3300009094 Bacteria 1609
111 Ga0105245_10166843 3300009098 Bacteria 2093
112 Ga0114129_10076075 3300009147 Bacteria 4673
113 Ga0114129_10155221 3300009147 Bacteria 3131
114 Ga0105241_10338153 3300009174 Bacteria 1303
115 Ga0105248_10015699 3300009177 Bacteria 8346
116 Ga0105248_10016963 3300009177 Bacteria 8019
117 Ga0105237_10003204 3300009545 Bacteria 19611
118 Ga0105237_10003362 3300009545 Bacteria 19044
119 Ga0105237_10019374 3300009545 Bacteria 7028
120 Ga0105237_10233750 3300009545 Bacteria 1839
121 Ga0105237_10618817 3300009545 Bacteria 1090
122 Ga0105238_10000581 3300009551 Bacteria 38310
123 Ga0105238_10013262 3300009551 Bacteria 8316
124 Ga0105238_10040824 3300009551 Bacteria 4700
125 Ga0105238_10513743 3300009551 Bacteria 1200
126 Ga0105238_10537460 3300009551 Bacteria 1172
127 Ga0105249_10531658 3300009553 Bacteria 1224
128 Ga0123341_1000036 3300009765 Bacteria 61619
129 Ga0123342_1010633 3300009766 Bacteria 10439
130 Ga0105239_10007083 3300010375 Bacteria 12909
131 Ga0105239_10017180 3300010375 Bacteria 7997
132 Ga0105239_10034354 3300010375 Bacteria 5568
133 Ga0105239_10070786 3300010375 Bacteria 3831
134 Ga0105239_10166434 3300010375 Bacteria 2465
135 Ga0157370_10000236 3300013104 Bacteria 70330
136 Ga0157369_10253470 3300013105 Bacteria 1836
137 Ga0157369_11016966 3300013105 Bacteria 848
138 Ga0157374_10476736 3300013296 Bacteria 1251
139 Ga0163162_10004400 3300013306 Bacteria 13556
140 Ga0157372_10398880 3300013307 Bacteria 1603
141 Ga0157375_10148830 3300013308 Bacteria 2475
142 Ga0157380_10666332 3300014326 Bacteria 1040
143 Ga0182008_10029554 3300014497 Bacteria 2769
144 Ga0182007_10010211 3300015262 Bacteria 3724
145 Ga0182005_1015232 3300015265 Bacteria 2147
146 Ga0214542_1000029 3300021321 Bacteria 174097
147 Ga0214543_1000040 3300021327 Bacteria 174142
148 Ga0209436_100773 3300025208 Bacteria 13252
149 Ga0209437_100056 3300025233 Bacteria 363071
150 Ga0207425_1000466 3300025245 Bacteria 25807
151 Ga0207425_1025004 3300025245 Bacteria 1235
152 Ga0209646_1010555 3300025246 Bacteria 1446
153 Ga0209026_1000013 3300025250 Bacteria 415633
154 Ga0209677_100813 3300025253 Bacteria 15606
155 Ga0209148_1000210 3300025254 Bacteria 102885
156 Ga0209148_1016909 3300025254 Bacteria 1248
157 Ga0209759_1000058 3300025256 Bacteria 203580
158 Ga0209129_1000066 3300025258 Bacteria 226820
159 Ga0209129_1000308 3300025258 Bacteria 44371
160 Ga0209129_1001193 3300025258 Bacteria 14965
161 Ga0209129_1003700 3300025258 Bacteria 6479
162 Ga0209233_1000034 3300025261 Bacteria 578898
163 Ga0209233_1000071 3300025261 Bacteria 363290
164 Ga0209233_1000234 3300025261 Bacteria 95145
165 Ga0209455_1000098 3300025272 Bacteria 213890
166 Ga0209673_1000024 3300025273 Bacteria 409632
167 Ga0209673_1003287 3300025273 Bacteria 9728
168 Ga0209673_1005501 3300025273 Bacteria 6348
169 Ga0209673_1007783 3300025273 Bacteria 4870
170 Ga0209673_1023029 3300025273 Bacteria 2132
171 Ga0209130_1000005 3300025284 Bacteria 599620
172 Ga0209130_1000028 3300025284 Bacteria 325668
173 Ga0209130_1028816 3300025284 Bacteria 1163
174 Ga0209676_1001378 3300025292 Bacteria 23720
175 Ga0209676_1011395 3300025292 Bacteria 3591
176 Ga0209025_1000235 3300025294 Bacteria 129981
177 Ga0209025_1000919 3300025294 Bacteria 45324
178 Ga0209025_1010694 3300025294 Bacteria 6174
179 Ga0209025_1013073 3300025294 Bacteria 5248
180 Ga0209025_1021245 3300025294 Bacteria 3506
181 Ga0209025_1046791 3300025294 Bacteria 1775
182 Ga0209564_1000217 3300025295 Bacteria 131090
183 Ga0209564_1002676 3300025295 Bacteria 13521
184 Ga0209564_1049640 3300025295 Bacteria 1036
185 Ga0209758_1000788 3300025297 Bacteria 45324
186 Ga0209758_1001692 3300025297 Bacteria 24831
187 Ga0209758_1002187 3300025297 Bacteria 20483
188 Ga0209758_1017612 3300025297 Bacteria 3545
189 Ga0209758_1034268 3300025297 Bacteria 2023
190 Ga0209050_1003461 3300025298 Bacteria 11603
191 Ga0209050_1008438 3300025298 Bacteria 5508
192 Ga0209256_1000667 3300025299 Bacteria 46381
193 Ga0209256_1004264 3300025299 Bacteria 9137
194 Ga0209256_1006861 3300025299 Bacteria 5852
195 Ga0209256_1006936 3300025299 Bacteria 5789
196 Ga0209256_1014926 3300025299 Bacteria 2751
197 Ga0209256_1033535 3300025299 Bacteria 1380
198 Ga0207426_1000012 3300025302 Bacteria 730942
199 Ga0207426_1000015 3300025302 Bacteria 599316
200 Ga0207426_1000639 3300025302 Bacteria 43792
201 Ga0209051_1000228 3300025303 Bacteria 94166
202 Ga0209051_1006600 3300025303 Bacteria 6507
203 Ga0209051_1007642 3300025303 Bacteria 5877
204 Ga0209051_1028066 3300025303 Bacteria 2229
205 Ga0209051_1056062 3300025303 Bacteria 1274
206 Ga0209051_1069557 3300025303 Bacteria 1066
207 Ga0209257_1002814 3300025304 Bacteria 16341
208 Ga0209257_1004476 3300025304 Bacteria 10800
209 Ga0207656_10053793 3300025321 Bacteria 1748
210 Ga0207680_10094592 3300025903 Bacteria 1908
211 Ga0207645_10028363 3300025907 Bacteria 3614
212 Ga0207684_10196076 3300025910 Bacteria 1742
213 Ga0207654_10011059 3300025911 Bacteria 4594
214 Ga0207654_10160903 3300025911 Bacteria 1450
215 Ga0207695_10000036 3300025913 Bacteria 477897
216 Ga0207695_10002526 3300025913 Bacteria 26879
217 Ga0207695_10014930 3300025913 Bacteria 9166
218 Ga0207695_10046035 3300025913 Bacteria 4625
219 Ga0207695_10048159 3300025913 Bacteria 4504
220 Ga0207671_10000354 3300025914 Bacteria 66092
221 Ga0207671_10005251 3300025914 Bacteria 12026
222 Ga0207671_10015369 3300025914 Bacteria 5995
223 Ga0207671_10154179 3300025914 Bacteria 1776
224 Ga0207671_10470232 3300025914 Bacteria 1002
225 Ga0207652_10012451 3300025921 Bacteria 6874
226 Ga0207694_10004214 3300025924 Bacteria 11251
227 Ga0207694_10007343 3300025924 Bacteria 8358
228 Ga0207694_10513123 3300025924 Bacteria 1004
229 Ga0207687_10536245 3300025927 Bacteria 980
230 Ga0207706_10251063 3300025933 Bacteria 1545
231 Ga0207704_10148402 3300025938 Bacteria 1651
232 Ga0207691_10016827 3300025940 Bacteria 6939
233 Ga0207711_10046674 3300025941 Bacteria 3701
234 Ga0207667_10005231 3300025949 Bacteria 15828
235 Ga0207667_10142935 3300025949 Bacteria 2464
236 Ga0207667_10329953 3300025949 Bacteria 1558
237 Ga0207667_10746135 3300025949 Bacteria 978
238 Ga0207651_10098069 3300025960 Bacteria 2166
239 Ga0207651_10172116 3300025960 Bacteria 1709
240 Ga0207712_10177975 3300025961 Bacteria 1668
241 Ga0207668_10556961 3300025972 Bacteria 994
242 Ga0207640_10012129 3300025981 Bacteria 4900
243 Ga0207658_10016423 3300025986 Bacteria 5092
244 Ga0207658_10246348 3300025986 Bacteria 1517
245 Ga0207658_10324181 3300025986 Bacteria 1334
246 Ga0207658_10582078 3300025986 Bacteria 1004
247 Ga0207677_10760047 3300026023 Bacteria 865
248 Ga0207703_10345483 3300026035 Bacteria 1369
249 Ga0207639_10002694 3300026041 Bacteria 11920
250 Ga0207639_10592467 3300026041 Bacteria 1022
251 Ga0207678_10007681 3300026067 Bacteria 9527
252 Ga0207678_10023575 3300026067 Bacteria 5382
253 Ga0207678_10490795 3300026067 Bacteria 1070
254 Ga0207708_10003093 3300026075 Bacteria 12250
255 Ga0207702_10508716 3300026078 Bacteria 1175
256 Ga0207641_10642968 3300026088 Bacteria 1041
257 Ga0207648_10022724 3300026089 Bacteria 5627
258 Ga0207683_10122981 3300026121 Bacteria 2331
259 Ga0207698_10008506 3300026142 Bacteria 6498
260 Ga0207698_10316142 3300026142 Bacteria 1460
261 Ga0209371_1000840 3300027312 Bacteria 25142
262 Ga0209179_1020523 3300027512 Bacteria 1283
263 Ga0209983_1004895 3300027665 Bacteria 2798
264 Ga0268266_10025750 3300028379 Bacteria 5005
265 Ga0268266_10047886 3300028379 Bacteria 3663
266 Ga0268266_10185397 3300028379 Bacteria 1897
267 Ga0268266_10202952 3300028379 Bacteria 1815
268 Ga0268266_10417634 3300028379 Bacteria 1271
269 Ga0307515_10174880 3300028794 Bacteria 2122
270 Ga0268256_1004174 3300030500 Bacteria 6116
271 Ga0265328_10000069 3300031239 Bacteria 55229
272 Ga0265316_10053727 3300031344 Bacteria 3156
273 Ga0265316_10057925 3300031344 Bacteria 3020
274 Ga0307513_10309991 3300031456 Bacteria 1341
275 Ga0265313_10036974 3300031595 Bacteria 2447
276 Ga0307516_10406022 3300031730 Bacteria 1021
277 Ga0307405_10004258 3300031731 Bacteria 6735
278 Ga0307413_10178022 3300031824 Bacteria 1513
279 Ga0307410_10214122 3300031852 Bacteria 1478
280 Ga0307406_10024866 3300031901 Bacteria 3582
281 Ga0307412_10001127 3300031911 Bacteria 15298
282 Ga0307409_100008912 3300031995 Bacteria 6128
283 Ga0307411_10024809 3300032005 Bacteria 3581
284 Ga0307415_100202607 3300032126 Bacteria 1576
285 Ga0373935_0204865 3300035692 Bacteria 1365
286 Ga0395900_0014652 3300037418 Bacteria 7997
287 Ga0395900_0062523 3300037418 Bacteria 3827
288 Ga0395898_0023281 3300037466 Bacteria 6259
289 Ga0395898_0672758 3300037466 Bacteria 977
290 Ga0395905_0041088 3300037471 Bacteria 4339
291 Ga0395905_0105171 3300037471 Bacteria 2650
292 Ga0395905_0250133 3300037471 Bacteria 1656
293 Ga0395905_0520999 3300037471 Bacteria 1089
294 Ga0436364_0065539 3300037853 Bacteria 3928
295 Ga0395901_0024443 3300038443 Bacteria 6201
296 Ga0395901_0029875 3300038443 Bacteria 5613
297 Ga0395901_0163249 3300038443 Bacteria 2339
298 Ga0395901_0388347 3300038443 Bacteria 1436
299 Ga0436361_0249028 3300039447 Bacteria 4871
300 Ga0439436_0070471 3300041404 Bacteria 974
301 Ga0439461_0002024 3300041410 Bacteria 3205
302 Ga0439466_0067030 3300041411 Bacteria 1149
303 Ga0439465_0011789 3300041413 Bacteria 2738
304 Ga0451787_013798 3300041441 Bacteria 2094
305 Ga0451835_0899430 3300041492 Bacteria 1360
306 Ga0451841_0190918 3300041498 Bacteria 1842
307 Ga0451851_0269401 3300041507 Bacteria 3509
308 Ga0451843_0102840 3300041509 Bacteria 1284
309 Ga0439433_0050109 3300041999 Bacteria 983
310 Ga0439432_030550 3300042006 Bacteria 1746
311 Ga0439449_0021751 3300042007 Bacteria 2401
312 Ga0439455_0031544 3300042012 Bacteria 1320
313 Ga0439457_007290 3300042014 Bacteria 2662
314 Ga0450907_004962 3300042146 Bacteria 2262
315 Ga0450909_007216 3300042185 Bacteria 1606
316 Ga0450918_003019 3300042531 Bacteria 3149
317 Ga0466969_0129957 3300044656 Bacteria 1168
318 Ga0466972_0010886 3300044658 Bacteria 4564
319 Ga0466966_0050785 3300044684 Bacteria 2637
320 Ga0466961_0200063 3300044693 Bacteria 1236
321 Ga0466960_0017225 3300044901 Bacteria 3145
322 Ga0466959_0006206 3300045049 Bacteria 8260
323 Ga0495617_000226 3300046452 Bacteria 34246
324 Ga0495617_015607 3300046452 Bacteria 2572
325 Ga0495592_0002448 3300046454 Bacteria 13094
326 Ga0495590_0004991 3300046457 Bacteria 5295
327 Ga0495638_0000467 3300046460 Bacteria 48587
328 Ga0495638_0010804 3300046460 Bacteria 6314
329 Ga0495638_0108168 3300046460 Bacteria 1654
330 Ga0495605_0008223 3300046474 Bacteria 5901
331 Ga0495605_0033254 3300046474 Bacteria 2619
332 Ga0495605_0070945 3300046474 Bacteria 1646
333 Ga0495664_0227551 3300046477 Bacteria 1129
334 Ga0495584_0000027 3300046491 Bacteria 112488
335 Ga0495584_0136696 3300046491 Bacteria 1244
336 Ga0495584_0230103 3300046491 Bacteria 942
337 Ga0495585_0003384 3300046492 Bacteria 10799
338 Ga0495585_0015650 3300046492 Bacteria 4405
339 Ga0495585_0058083 3300046492 Bacteria 2134
340 Ga0495585_0079793 3300046492 Bacteria 1775
341 Ga0495585_0083591 3300046492 Bacteria 1727
342 Ga0495596_0042999 3300046500 Bacteria 1780
343 Ga0495607_0011201 3300046501 Bacteria 5985
344 Ga0495607_0031771 3300046501 Bacteria 3230
345 Ga0495607_0051513 3300046501 Bacteria 2390
346 Ga0495607_0097365 3300046501 Bacteria 1582
347 Ga0495607_0135272 3300046501 Bacteria 1277
348 Ga0495583_0000108 3300046506 Bacteria 139791
349 Ga0495583_0024318 3300046506 Bacteria 3046
350 Ga0495583_0084695 3300046506 Bacteria 1373
351 Ga0495606_0008464 3300046507 Bacteria 8930
352 Ga0495606_0010287 3300046507 Bacteria 7787
353 Ga0495606_0091417 3300046507 Bacteria 1871
354 Ga0495610_0000420 3300046512 Bacteria 43578
355 Ga0495610_0028642 3300046512 Bacteria 2942
356 Ga0495616_0039923 3300046513 Bacteria 2401
357 Ga0495616_0045839 3300046513 Bacteria 2211
358 Ga0495620_0005563 3300046515 Bacteria 7023
359 Ga0495620_0020353 3300046515 Bacteria 3242
360 Ga0495620_0036878 3300046515 Bacteria 2183
361 Ga0495620_0038743 3300046515 Bacteria 2113
362 Ga0495628_0001848 3300046516 Bacteria 19220
363 Ga0495628_0150809 3300046516 Bacteria 1771
364 Ga0495631_0004857 3300046518 Bacteria 7078
365 Ga0495632_0005291 3300046519 Bacteria 8572
366 Ga0495632_0023560 3300046519 Bacteria 3286
367 Ga0495632_0029038 3300046519 Bacteria 2883
368 Ga0495632_0040073 3300046519 Bacteria 2361
369 Ga0495637_0068461 3300046520 Bacteria 1438
370 Ga0495643_0009129 3300046522 Bacteria 6201
371 Ga0495643_0096911 3300046522 Bacteria 1516
372 Ga0495644_0000337 3300046523 Bacteria 21372
373 Ga0495644_0023803 3300046523 Bacteria 2330
374 Ga0495644_0038287 3300046523 Bacteria 1809
375 Ga0495648_0000329 3300046524 Bacteria 52302
376 Ga0495642_0044367 3300046528 Bacteria 1814
377 Ga0495652_0003480 3300046529 Bacteria 15518
378 Ga0495654_0000070 3300046530 Bacteria 117357
379 Ga0495587_0321246 3300046536 Bacteria 864
380 Ga0495609_0001667 3300046538 Bacteria 14424
381 Ga0495609_0030816 3300046538 Bacteria 2441
382 Ga0495597_0035644 3300046542 Bacteria 2243
383 Ga0495645_0001712 3300046543 Bacteria 14889
384 Ga0495622_0015671 3300046557 Bacteria 3524
385 Ga0495622_0135886 3300046557 Bacteria 1118
386 Ga0495633_0001956 3300046558 Bacteria 14956
387 Ga0495633_0053193 3300046558 Bacteria 1906
388 Ga0495656_0007647 3300046615 Bacteria 3830
389 Ga0495656_0011046 3300046615 Bacteria 3304
390 Ga0495656_0016601 3300046615 Bacteria 2796
391 Ga0495656_0042886 3300046615 Bacteria 1897
392 Ga0495668_0002424 3300046616 Bacteria 15386
393 Ga0495611_0000405 3300046648 Bacteria 26991
394 Ga0495611_0000699 3300046648 Bacteria 19005
395 Ga0495625_0006911 3300046660 Bacteria 10014
396 Ga0495625_0017934 3300046660 Bacteria 5533
397 Ga0495625_0064983 3300046660 Bacteria 2573
398 Ga0495625_0134063 3300046660 Bacteria 1675
399 Ga0495625_0157625 3300046660 Bacteria 1523
400 Ga0495625_0163337 3300046660 Bacteria 1490
401 Ga0495625_0287476 3300046660 Bacteria 1056
402 Ga0495635_0097376 3300046663 Bacteria 2011
403 Ga0495659_0000655 3300046664 Bacteria 12533
404 Ga0495661_0046811 3300046665 Bacteria 2638
405 Ga0495661_0070842 3300046665 Bacteria 2039
406 Ga0495669_0088167 3300046684 Bacteria 1430
407 Ga0495670_0000361 3300046691 Bacteria 21697
408 Ga0495670_0038474 3300046691 Bacteria 2385
409 Ga0495671_0012739 3300046692 Bacteria 4582
410 Ga0495671_0043833 3300046692 Bacteria 2245
411 Ga0495671_0046540 3300046692 Bacteria 2168
412 Ga0495649_0150220 3300046694 Bacteria 1224
413 Ga0495589_0057384 3300046794 Bacteria 1915
414 Ga0495589_0097389 3300046794 Bacteria 1425
415 Ga0495600_0135841 3300046809 Bacteria 1598
416 Ga0495660_0041706 3300046810 Bacteria 2539
417 Ga0495660_0042576 3300046810 Bacteria 2509
418 Ga0495660_0076584 3300046810 Bacteria 1762
419 Ga0495604_0020584 3300047317 Bacteria 5268
420 Ga0495604_0233747 3300047317 Bacteria 1260
421 Ga0495636_0005342 3300047318 Bacteria 5048
422 Ga0495636_0007359 3300047318 Bacteria 4333
423 Ga0495636_0031731 3300047318 Bacteria 2167
424 Ga0495672_0007436 3300047320 Bacteria 8240
425 Ga0495672_0028720 3300047320 Bacteria 3513
426 Ga0495672_0237018 3300047320 Bacteria 893
427 Ga0495676_0006053 3300047321 Bacteria 11118
428 Ga0495676_0018675 3300047321 Bacteria 6115
429 Ga0495683_0001287 3300047323 Bacteria 16958
430 Ga0495677_0000532 3300047445 Bacteria 15863
431 Ga0495677_0001894 3300047445 Bacteria 8354
432 Ga0495685_000293 3300047447 Bacteria 16540
433 Ga0495685_050778 3300047447 Bacteria 1407
434 Ga0495673_0001985 3300047469 Bacteria 15110
435 Ga0495681_0021332 3300047470 Bacteria 3494
436 Ga0495686_0001100 3300047472 Bacteria 32113
437 Ga0495686_0005359 3300047472 Bacteria 10143
438 Ga0495686_0023902 3300047472 Bacteria 4020
439 Ga0495686_0025775 3300047472 Bacteria 3851
440 Ga0495615_0002590 3300048090 Bacteria 2919
441 Ga0495626_0064645 3300048091 Bacteria 1657
442 Ga0495626_0113207 3300048091 Bacteria 1173
443 Ga0495626_0138972 3300048091 Bacteria 1031
444 Ga0496101_0194469 3300048904 Bacteria 1566
445 Ga0496102_0014354 3300048905 Bacteria 6882
446 Ga0496102_0218483 3300048905 Bacteria 1796
447 Ga0496103_0065012 3300048906 Bacteria 2275
448 Ga0496103_0212600 3300048906 Bacteria 1244
449 Ga0496103_0215044 3300048906 Bacteria 1236
450 Ga0496104_0115353 3300048907 Bacteria 2577
451 Ga0496104_0158509 3300048907 Bacteria 2171
452 Ga0496105_0191900 3300048908 Bacteria 1670
453 Ga0496107_0276418 3300048910 Bacteria 1250
454 Ga0496116_0011968 3300048919 Bacteria 7126
455 Ga0496116_0033140 3300048919 Bacteria 3669
456 Ga0496116_0091630 3300048919 Bacteria 1846
457 Ga0496116_0094986 3300048919 Bacteria 1800
458 Ga0496117_0027429 3300048920 Bacteria 4438
459 Ga0496117_0235743 3300048920 Bacteria 1008
460 Ga0496118_0038275 3300048921 Bacteria 3846
461 Ga0496118_0079463 3300048921 Bacteria 2314
462 Ga0496119_0016157 3300048922 Bacteria 5701
463 Ga0496119_0024224 3300048922 Bacteria 4274
464 Ga0496119_0029754 3300048922 Bacteria 3693
465 Ga0496120_0003643 3300048923 Bacteria 13813
466 Ga0496120_0039194 3300048923 Bacteria 2798
467 Ga0496120_0042038 3300048923 Bacteria 2671
468 Ga0496121_0026334 3300048924 Bacteria 5483
469 Ga0496121_0034805 3300048924 Bacteria 4526
470 Ga0496121_0035814 3300048924 Bacteria 4437
471 Ga0496121_0106081 3300048924 Bacteria 2154
472 Ga0496121_0185048 3300048924 Bacteria 1499
473 Ga0496121_0369496 3300048924 Bacteria 949
474 Ga0496122_0017471 3300048925 Bacteria 6706
475 Ga0496122_0087182 3300048925 Bacteria 2145
476 Ga0496124_0064734 3300048927 Bacteria 3051
477 Ga0496124_0112125 3300048927 Bacteria 2193
478 Ga0496124_0275208 3300048927 Bacteria 1230
479 Ga0496125_0011324 3300048928 Bacteria 8933
480 Ga0496125_0053140 3300048928 Bacteria 3325
481 Ga0496126_0063149 3300048929 Bacteria 3320
482 Ga0495678_002381 3300049459 Bacteria 12882
483 Ga0495678_056651 3300049459 Bacteria 1489
484 Ga0495682_0000013 3300049460 Bacteria 259670
485 Ga0495682_0000016 3300049460 Bacteria 233668
486 Ga0495682_0043735 3300049460 Bacteria 1640
487 Ga0501032_0000008 3300049569 Bacteria 240313
488 Ga0501033_0000012 3300049570 Bacteria 241599
489 Ga0501034_0000035 3300049571 Bacteria 241623
490 Ga0501034_0029240 3300049571 Bacteria 5602
491 Ga0501034_0105532 3300049571 Bacteria 2810
492 Ga0501036_0000006 3300049572 Bacteria 241623
493 Ga0501037_0000123 3300049573 Bacteria 72229
494 Ga0501037_0216686 3300049573 Bacteria 1348
495 Ga0501037_0399294 3300049573 Bacteria 943
496 Ga0501038_0000007 3300049574 Bacteria 210775
497 Ga0501038_0053007 3300049574 Bacteria 3495
498 Ga0501039_0000012 3300049575 Bacteria 241623
499 Ga0501039_0056821 3300049575 Bacteria 3032
500 Ga0501043_0000432 3300049579 Bacteria 37703
501 Ga0501047_0006781 3300049581 Bacteria 10761
502 Ga0501047_0208786 3300049581 Bacteria 1812
503 Ga0501047_0269169 3300049581 Bacteria 1550
504 Ga0501070_0088449 3300049586 Bacteria 2564
505 Ga0501071_0541130 3300049587 Bacteria 894
506 Ga0501080_0232322 3300049742 Bacteria 1685
507 Ga0501080_0287736 3300049742 Bacteria 1493
508 Ga0501035_0000035 3300049822 Bacteria 166916
509 Ga0501035_0050909 3300049822 Bacteria 3710
510 Ga0501044_0000015 3300049823 Bacteria 241623
511 Ga0501044_0123532 3300049823 Bacteria 2587
512 nmdc:mga03683_115566_c1 3300050489 Bacteria 1190
513 nmdc:mga03683_32589_c1 3300050489 Bacteria 2097
514 nmdc:mga00v17_27134_c1 3300050491 Bacteria 1741
515 nmdc:mga00v17_34327_c1 3300050491 Bacteria 3012
516 nmdc:mga0yw44_12498_c1 3300050492 Bacteria 4429
517 nmdc:mga06z11_40958_c1 3300050494 Bacteria 2315
518 nmdc:mga04h51_51523_c1 3300050495 Bacteria 1383
519 nmdc:mga07m45_200415_c1 3300050496 Bacteria 1161
520 nmdc:mga05p37_482666_c1 3300050507 Bacteria 1427
521 nmdc:mga0n895_315210_c1 3300050512 Bacteria 1585
522 nmdc:mga08x19_33614_c2 3300050514 Bacteria 2287
523 Ga0495601_0130936 3300053077 Bacteria 1633
524 Ga0500610_0003882 3300053079 Bacteria 5824
525 Ga0495619_0053915 3300053085 Bacteria 2661
526 Ga0500556_0106782 3300053104 Bacteria 1083
527 Ga0500595_042899 3300053119 Bacteria 1444
528 Ga0500618_000506 3300053125 Bacteria 24700
529 Ga0500618_011172 3300053125 Bacteria 2389
530 Ga0500658_0008336 3300053134 Bacteria 3830
531 Ga0500568_0000090 3300053139 Bacteria 86645
532 Ga0500568_0000944 3300053139 Bacteria 20029
533 Ga0500590_000573 3300053148 Bacteria 12923
534 Ga0500604_0068583 3300053151 Bacteria 1127
535 Ga0500604_0072465 3300053151 Bacteria 1100
536 Ga0500616_0000503 3300053153 Bacteria 49936
537 Ga0500616_0015308 3300053153 Bacteria 4388
538 Ga0500620_004653 3300053155 Bacteria 3090
539 Ga0500620_019571 3300053155 Bacteria 1992
540 Ga0500627_0024864 3300053158 Bacteria 2455
541 Ga0530510_0281936 3300061734 Bacteria 1241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10406022 Ga0307516_104060221 238
2 3300005564 Ga0070664_100168246 Ga0070664_1001682462 244
3 3300025960 Ga0207651_10172116 Ga0207651_101721162 244
4 3300013105 Ga0157369_11016966 Ga0157369_110169661 246
5 3300003792 Ga0055540_1000181 Ga0055540_10001811 247
6 3300014497 Ga0182008_10029554 Ga0182008_100295543 247
7 3300025298 Ga0209050_1008438 Ga0209050_10084382 247
8 3300025303 Ga0209051_1000228 Ga0209051_100022897 247
9 3300025304 Ga0209257_1002814 Ga0209257_10028145 247
10 3300041498 Ga0451841_0190918 Ga0451841_0190918_29_802 247
11 3300041507 Ga0451851_0269401 Ga0451851_0269401_867_1640 247
12 3300041509 Ga0451843_0102840 Ga0451843_0102840_371_1144 247
13 3300046492 Ga0495585_0083591 Ga0495585_0083591_856_1629 247
14 3300046507 Ga0495606_0010287 Ga0495606_0010287_2182_2955 247
15 3300046660 Ga0495625_0134063 Ga0495625_0134063_162_935 247
16 3300046513 Ga0495616_0039923 Ga0495616_0039923_364_1134 248
17 3300050489 nmdc:mga03683_32589_c1 nmdc:mga03683_32589_c1_122_895 248
18 3300047321 Ga0495676_0006053 Ga0495676_0006053_6546_7421 249
19 3300048924 Ga0496121_0369496 Ga0496121_0369496_64_837 249
20 3300049587 Ga0501071_0541130 Ga0501071_0541130_15_770 251
21 3300009766 Ga0123342_1010633 Ga0123342_10106338 252
22 3300046492 Ga0495585_0079793 Ga0495585_0079793_188_1069 252
23 3300046501 Ga0495607_0011201 Ga0495607_0011201_2765_3646 252
24 3300046523 Ga0495644_0023803 Ga0495644_0023803_736_1617 252
25 3300046557 Ga0495622_0135886 Ga0495622_0135886_85_966 252
26 3300046615 Ga0495656_0011046 Ga0495656_0011046_1195_2076 252
27 3300046648 Ga0495611_0000699 Ga0495611_0000699_16925_17806 252
28 3300047445 Ga0495677_0000532 Ga0495677_0000532_2411_3292 252
29 3300046516 Ga0495628_0150809 Ga0495628_0150809_20_781 253
30 3300046536 Ga0495587_0321246 Ga0495587_0321246_30_791 253
31 3300047317 Ga0495604_0233747 Ga0495604_0233747_15_776 253
32 iso_pu_bacteria 2501025501 2501075559 253
33 iso_pu_bacteria 2501025502 2501083995 253
34 iso_pu_bacteria 2501025504 2501412682 253
35 iso_pu_bacteria 2503198000 2503204745 253
36 iso_pu_bacteria 2508501123 2509113589 253
37 iso_pu_bacteria 2508501127 2509140331 253
38 iso_pu_bacteria 2509276018 2509370637 253
39 iso_pu_bacteria 2509276021 2509388830 253
40 iso_pu_bacteria 2509276022 2509399005 253
41 iso_pu_bacteria 2509276033 2509444417 253
42 iso_pu_bacteria 2510065019 2510135840 253
43 iso_pu_bacteria 2510065059 2510314343 253
44 iso_pu_bacteria 2510461076 2510897325 253
45 iso_pu_bacteria 2510917013 2511093450 253
46 iso_pu_bacteria 2510917014 2511099899 253
47 iso_pu_bacteria 2510917015 2511102316 253
48 iso_pu_bacteria 2510917028 2511185788 253
49 iso_pu_bacteria 2512875016 2512934520 253
50 iso_pu_bacteria 2512875024 2512962867 253
51 iso_pu_bacteria 2513237082 2513557938 253
52 iso_pu_bacteria 2513237083 2513565558 253
53 iso_pu_bacteria 2513237084 2513571009 253
54 iso_pu_bacteria 2513237085 2513574789 253
55 iso_pu_bacteria 2513237088 2513595354 253
56 iso_pu_bacteria 2513237090 2513613490 253
57 iso_pu_bacteria 2513237093 2513634038 253
58 iso_pu_bacteria 2513237103 2513707408 253
59 iso_pu_bacteria 2513237138 2513866546 253
60 iso_pu_bacteria 2513237144 2513911346 253
61 iso_pu_bacteria 2513237146 2513924455 253
62 iso_pu_bacteria 2513237162 2514022168 253
63 iso_pu_bacteria 2513237164 2514037460 253
64 iso_pu_bacteria 2513237305 2514419831 253
65 iso_pu_bacteria 2513237351 2514586164 253
66 iso_pu_bacteria 2515154113 2515633944 253
67 iso_pu_bacteria 2515154114 2515641236 253
68 iso_pu_bacteria 2515154116 2515659757 253
69 iso_pu_bacteria 2515154134 2515740976 253
70 iso_pu_bacteria 2515154189 2516024963 253
71 iso_pu_bacteria 2516653077 2517038638 253
72 iso_pu_bacteria 2516653085 2517078892 253
73 iso_pu_bacteria 2517093000 2517097681 253
74 iso_pu_bacteria 2517287029 2517409112 253
75 iso_pu_bacteria 2519899620 2520375796 253
76 iso_pu_bacteria 2524023209 2524458080 253
77 iso_pu_bacteria 2529292951 2530648188 253
78 iso_pu_bacteria 2534681796 2535514742 253
79 iso_pu_bacteria 2582581294 2585201113 253
80 iso_pu_bacteria 2582581299 2585232439 253
81 iso_pu_bacteria 2582581304 2585256243 253
82 iso_pu_bacteria 2582581307 2585273659 253
83 iso_pu_bacteria 2582581308 2585279964 253
84 iso_pu_bacteria 2582581315 2585326259 253
85 iso_pu_bacteria 2582581316 2585330423 253
86 iso_pu_bacteria 2582581867 2585398917 253
87 iso_pu_bacteria 2585427526 2585523775 253
88 iso_pu_bacteria 2585427527 2585533782 253
89 iso_pu_bacteria 2585427528 2585541828 253
90 iso_pu_bacteria 2585427530 2585553375 253
91 iso_pu_bacteria 2585427531 2585559833 253
92 iso_pu_bacteria 2585427590 2585818963 253
93 iso_pu_bacteria 2585427593 2585840524 253
94 iso_pu_bacteria 2585427594 2585843880 253
95 iso_pu_bacteria 2585427608 2585900512 253
96 iso_pu_bacteria 2585427609 2585905989 253
97 iso_pu_bacteria 2585428125 2587978896 253
98 iso_pu_bacteria 2588253730 2588514125 253
99 iso_pu_bacteria 2597489875 2597816592 253
100 iso_pu_bacteria 2599185170 2599419582 253
101 iso_pu_bacteria 2599185301 2599935807 253
102 iso_pu_bacteria 2615840624 2616293788 253
103 iso_pu_bacteria 2615840626 2616309398 253
104 iso_pu_bacteria 2615840698 2616556274 253
105 iso_pu_bacteria 2617270742 2617380532 253
106 iso_pu_bacteria 2643221595 2643984956 253
107 iso_pu_bacteria 2643221599 2644004579 253
108 iso_pu_bacteria 2643221627 2644154114 253
109 iso_pu_bacteria 2643221634 2644196910 253
110 iso_pu_bacteria 2643221643 2644237514 253
111 iso_pu_bacteria 2643221723 2644671636 253
112 iso_pu_bacteria 2643221733 2644729752 253
113 iso_pu_bacteria 2657244999 2657682906 253
114 iso_pu_bacteria 2687453392 2688601374 253
115 iso_pu_bacteria 2693429783 2694630395 253
116 iso_pu_bacteria 2693429784 2694637819 253
117 iso_pu_bacteria 2718217882 2719183503 253
118 iso_pu_bacteria 2718217927 2719388249 253
119 iso_pu_bacteria 2718218009 2719734220 253
120 iso_pu_bacteria 2718218232 2720615751 253
121 iso_pu_bacteria 2718218233 2720622536 253
122 iso_pu_bacteria 2718218235 2720633906 253
123 iso_pu_bacteria 2718218269 2720777591 253
124 iso_pu_bacteria 2718218363 2721149615 253
125 iso_pu_bacteria 2718218365 2721161018 253
126 iso_pu_bacteria 2718218366 2721166452 253
127 iso_pu_bacteria 2718218423 2721401886 253
128 iso_pu_bacteria 2721755514 2722842622 253
129 iso_pu_bacteria 2721755556 2723029190 253
130 iso_pu_bacteria 2721755684 2723562825 253
131 iso_pu_bacteria 2721755685 2723569497 253
132 iso_pu_bacteria 2721755686 2723578538 253
133 iso_pu_bacteria 2721755809 2724040700 253
134 iso_pu_bacteria 2721755810 2724046976 253
135 iso_pu_bacteria 2721755819 2724092198 253
136 iso_pu_bacteria 2721755822 2724106762 253
137 iso_pu_bacteria 2721755823 2724112570 253
138 iso_pu_bacteria 2724679232 2725946628 253
139 iso_pu_bacteria 2728369352 2730110126 253
140 iso_pu_bacteria 2728369365 2730166738 253
141 iso_pu_bacteria 2728369397 2730300650 253
142 iso_pu_bacteria 2738541293 2738800952 253
143 iso_pu_bacteria 2738541333 2739038857 253
144 iso_pu_bacteria 2751185821 2753459815 253
145 iso_pu_bacteria 2756170246 2756674615 253
146 iso_pu_bacteria 2765235942 2766063329 253
147 iso_pu_bacteria 2775507266 2778173885 253
148 iso_pu_bacteria 2791355082 2792583215 253
149 iso_pu_bacteria 2791355091 2792621103 253
150 iso_pu_bacteria 2791355092 2792625317 253
151 iso_pu_bacteria 2791355094 2792637747 253
152 iso_pu_bacteria 2791355123 2792746508 253
153 iso_pu_bacteria 2791355256 2793296777 253
154 iso_pu_bacteria 2791355259 2793314052 253
155 iso_pu_bacteria 2791355260 2793322339 253
156 iso_pu_bacteria 2791355261 2793328956 253
157 iso_pu_bacteria 2791355262 2793336764 253
158 iso_pu_bacteria 2791355263 2793341201 253
159 iso_pu_bacteria 2791355264 2793349505 253
160 iso_pu_bacteria 2791355265 2793352643 253
161 iso_pu_bacteria 2791355267 2793365501 253
162 iso_pu_bacteria 2802429268 2804754125 253
163 iso_pu_bacteria 2802429605 2805928201 253
164 iso_pu_bacteria 2802429606 2805935552 253
165 iso_pu_bacteria 2802429633 2806046641 253
166 iso_pu_bacteria 2802429634 2806051402 253
167 iso_pu_bacteria 2802429635 2806059391 253
168 iso_pu_bacteria 2802429636 2806066646 253
169 iso_pu_bacteria 2802429637 2806073703 253
170 iso_pu_bacteria 2818991448 2819608685 253
171 iso_pu_bacteria 2818991453 2819640795 253
172 iso_pu_bacteria 2838022645 2838026380 253
173 iso_pu_bacteria 2838035591 2838039883 253
174 iso_pu_bacteria 2838042994 2838044698 253
175 iso_pu_bacteria 2838061910 2838065829 253
176 iso_pu_bacteria 2838068647 2838070696 253
177 iso_pu_bacteria 2838074704 2838075018 253
178 iso_pu_bacteria 2838661181 2838664166 253
179 iso_pu_bacteria 2838668709 2838674951 253
180 iso_pu_bacteria 2838686498 2838689676 253
181 iso_pu_bacteria 2838701080 2838707244 253
182 iso_pu_bacteria 2838729681 2838731629 253
183 iso_pu_bacteria 2838742623 2838744570 253
184 iso_pu_bacteria 2841734538 2841735773 253
185 iso_pu_bacteria 2841851746 2841853111 253
186 iso_pu_bacteria 2841911363 2841915131 253
187 iso_pu_bacteria 2841917233 2841922028 253
188 iso_pu_bacteria 2842110456 2842112574 253
189 iso_pu_bacteria 2842146304 2842151921 253
190 iso_pu_bacteria 2842156927 2842160437 253
191 iso_pu_bacteria 2842163707 2842165583 253
192 iso_pu_bacteria 2842180545 2842183897 253
193 iso_pu_bacteria 2842192696 2842196211 253
194 iso_pu_bacteria 2842198810 2842202141 253
195 iso_pu_bacteria 2842205361 2842209081 253
196 iso_pu_bacteria 2842217011 2842219247 253
197 iso_pu_bacteria 2842229732 2842231478 253
198 iso_pu_bacteria 2842243621 2842246052 253
199 iso_pu_bacteria 2842250916 2842257125 253
200 iso_pu_bacteria 2842257432 2842260430 253
201 iso_pu_bacteria 2842271015 2842273840 253
202 iso_pu_bacteria 2842278818 2842282229 253
203 iso_pu_bacteria 2842285085 2842286443 253
204 iso_pu_bacteria 2842298080 2842299736 253
205 iso_pu_bacteria 2842304105 2842308932 253
206 iso_pu_bacteria 2842311132 2842312394 253
207 iso_pu_bacteria 2842317721 2842321972 253
208 iso_pu_bacteria 2842357229 2842359742 253
209 iso_pu_bacteria 2842395702 2842397678 253
210 iso_pu_bacteria 2842402390 2842404004 253
211 iso_pu_bacteria 2842409023 2842410293 253
212 iso_pu_bacteria 2842415677 2842416941 253
213 iso_pu_bacteria 2842422224 2842424311 253
214 iso_pu_bacteria 2842447887 2842452815 253
215 iso_pu_bacteria 2842489311 2842494663 253
216 iso_pu_bacteria 2842495871 2842499878 253
217 iso_pu_bacteria 2842509118 2842512965 253
218 iso_pu_bacteria 2844002411 2844004176 253
219 iso_pu_bacteria 2844009547 2844010033 253
220 iso_pu_bacteria 2844454524 2844456423 253
221 iso_pu_bacteria 2847670302 2847672904 253
222 iso_pu_bacteria 2847686936 2847689381 253
223 iso_pu_bacteria 2852387548 2852388137 253
224 iso_pu_bacteria 2856287931 2856289284 253
225 iso_pu_bacteria 2856314179 2856320064 253
226 iso_pu_bacteria 2856320880 2856327923 253
227 iso_pu_bacteria 2856328259 2856332096 253
228 iso_pu_bacteria 2856334872 2856341379 253
229 iso_pu_bacteria 2856349417 2856351537 253
230 iso_pu_bacteria 2856356410 2856359123 253
231 iso_pu_bacteria 2857349434 2857354279 253
232 iso_pu_bacteria 2857357740 2857366242 253
233 iso_pu_bacteria 2857367948 2857374497 253
234 iso_pu_bacteria 2857516855 2857522018 253
235 iso_pu_bacteria 2869162929 2869165808 253
236 iso_pu_bacteria 2869169390 2869175468 253
237 iso_pu_bacteria 2869234852 2869241506 253
238 iso_pu_bacteria 2869242130 2869242221 253
239 iso_pu_bacteria 2869249662 2869252992 253
240 iso_pu_bacteria 2869256925 2869263733 253
241 iso_pu_bacteria 2869264136 2869268751 253
242 iso_pu_bacteria 2869271264 2869272801 253
243 iso_pu_bacteria 2869278585 2869279873 253
244 iso_pu_bacteria 2869285874 2869292409 253
245 iso_pu_bacteria 2871429161 2871429224 253
246 iso_pu_bacteria 2871451962 2871458666 253
247 iso_pu_bacteria 2871459585 2871462098 253
248 iso_pu_bacteria 2871466892 2871470568 253
249 iso_pu_bacteria 2871474448 2871475796 253
250 iso_pu_bacteria 2871488783 2871490748 253
251 iso_pu_bacteria 2871495908 2871499321 253
252 iso_pu_bacteria 2874109183 2874112634 253
253 iso_pu_bacteria 2874116593 2874119557 253
254 iso_pu_bacteria 2874123672 2874129573 253
255 iso_pu_bacteria 2874131515 2874138537 253
256 iso_pu_bacteria 2874139085 2874145635 253
257 iso_pu_bacteria 2874146452 2874154130 253
258 iso_pu_bacteria 2874155637 2874161632 253
259 iso_pu_bacteria 2874162495 2874162622 253
260 iso_pu_bacteria 2874168670 2874171703 253
261 iso_pu_bacteria 2876363079 2876363218 253
262 iso_pu_bacteria 2876369609 2876370805 253
263 iso_pu_bacteria 2876377896 2876378487 253
264 iso_pu_bacteria 2876386047 2876391756 253
265 iso_pu_bacteria 2876392853 2876392982 253
266 iso_pu_bacteria 2876399893 2876404270 253
267 iso_pu_bacteria 2876413966 2876419814 253
268 iso_pu_bacteria 2876420981 2876422928 253
269 iso_pu_bacteria 2878035449 2878035512 253
270 iso_pu_bacteria 2878730984 2878731670 253
271 iso_pu_bacteria 2878738818 2878740285 253
272 iso_pu_bacteria 2878745973 2878752752 253
273 iso_pu_bacteria 2878753008 2878755153 253
274 iso_pu_bacteria 2878760144 2878763511 253
275 iso_pu_bacteria 2878767105 2878770509 253
276 iso_pu_bacteria 2878774303 2878778943 253
277 iso_pu_bacteria 2878781027 2878785007 253
278 iso_pu_bacteria 2878788777 2878792982 253
279 iso_pu_bacteria 2881147464 2881147557 253
280 iso_pu_bacteria 2881155292 2881158664 253
281 iso_pu_bacteria 2881161766 2881164336 253
282 iso_pu_bacteria 2881845957 2881847319 253
283 iso_pu_bacteria 2881861095 2881863154 253
284 iso_pu_bacteria 2882632389 2882632826 253
285 iso_pu_bacteria 2882912400 2882919078 253
286 iso_pu_bacteria 2883087390 2883094894 253
287 iso_pu_bacteria 2885305155 2885306197 253
288 iso_pu_bacteria 2885312484 2885314749 253
289 iso_pu_bacteria 2885318864 2885321484 253
290 iso_pu_bacteria 2885334103 2885337053 253
291 iso_pu_bacteria 2885342637 2885348176 253
292 iso_pu_bacteria 2885350715 2885352668 253
293 iso_pu_bacteria 2888337043 2888342646 253
294 iso_pu_bacteria 2888343758 2888350348 253
295 iso_pu_bacteria 2889010040 2889014205 253
296 iso_pu_bacteria 2889790730 2889793736 253
297 iso_pu_bacteria 2896384573 2896384729 253
298 iso_pu_bacteria 2903448605 2903454707 253
299 iso_pu_bacteria 2903492973 2903494851 253
300 iso_pu_bacteria 2903492973 2903499367 253
301 iso_pu_bacteria 2903521522 2903525168 253
302 iso_pu_bacteria 2903528002 2903532088 253
303 iso_pu_bacteria 2903540706 2903544126 253
304 iso_pu_bacteria 2904659560 2904659688 253
305 iso_pu_bacteria 2906308376 2906315143 253
306 iso_pu_bacteria 2906321335 2906321399 253
307 iso_pu_bacteria 2906328253 2906334607 253
308 iso_pu_bacteria 2906363423 2906369406 253
309 iso_pu_bacteria 2906370794 2906374823 253
310 iso_pu_bacteria 2906378014 2906380653 253
311 iso_pu_bacteria 2906386501 2906389471 253
312 iso_pu_bacteria 2906393657 2906398959 253
313 iso_pu_bacteria 2906401398 2906402911 253
314 iso_pu_bacteria 2906408224 2906411572 253
315 iso_pu_bacteria 2906414383 2906420840 253
316 iso_pu_bacteria 2906427513 2906435376 253
317 iso_pu_bacteria 2913295892 2913298284 253
318 iso_pu_bacteria 2922151315 2922155178 253
319 iso_pu_bacteria 2922158528 2922165110 253
320 iso_pu_bacteria 2922172374 2922178366 253
321 iso_pu_bacteria 2922178524 2922184812 253
322 iso_pu_bacteria 2923556063 2923556355 253
323 iso_pu_bacteria 2924718760 2924719385 253
324 iso_pu_bacteria 2924726620 2924727854 253
325 iso_pu_bacteria 2924733363 2924734346 253
326 iso_pu_bacteria 2924748358 2924754347 253
327 iso_pu_bacteria 2924754689 2924762156 253
328 iso_pu_bacteria 2924762789 2924767641 253
329 iso_pu_bacteria 2924776078 2924777885 253
330 iso_pu_bacteria 2924784321 2924791373 253
331 iso_pu_bacteria 2933016740 2933023467 253
332 iso_pu_bacteria 2933570622 2933575376 253
333 iso_pu_bacteria 2933586486 2933588537 253
334 iso_pu_bacteria 2933599457 2933601500 253
335 iso_pu_bacteria 2935901341 2935902498 253
336 iso_pu_bacteria 2936367885 2936369344 253
337 iso_pu_bacteria 2936375103 2936380040 253
338 iso_pu_bacteria 2936381700 2936385718 253
339 iso_pu_bacteria 2937813078 2937821684 253
340 iso_pu_bacteria 2937836603 2937841668 253
341 iso_pu_bacteria 2937848649 2937849886 253
342 iso_pu_bacteria 2937861824 2937864708 253
343 iso_pu_bacteria 2937868953 2937876249 253
344 iso_pu_bacteria 2937891427 2937897943 253
345 iso_pu_bacteria 2937972304 2937980470 253
346 iso_pu_bacteria 2937994558 2937997971 253
347 iso_pu_bacteria 2938014810 2938017613 253
348 iso_pu_bacteria 2958034702 2958035740 253
349 iso_pu_bacteria 2958041894 2958044771 253
350 iso_pu_bacteria 2958064165 2958066674 253
351 iso_pu_bacteria 2958071322 2958076361 253
352 iso_pu_bacteria 2958092219 2958094163 253
353 iso_pu_bacteria 2958108152 2958111338 253
354 iso_pu_bacteria 2958115193 2958119730 253
355 iso_pu_bacteria 2958130278 2958136809 253
356 iso_pu_bacteria 2958137437 2958137562 253
357 iso_pu_bacteria 2958144490 2958148371 253
358 iso_pu_bacteria 2958158011 2958159616 253
359 iso_pu_bacteria 2958165035 2958168446 253
360 iso_pu_bacteria 2958179912 2958186692 253
361 iso_pu_bacteria 2961077736 2961085193 253
362 iso_pu_bacteria 2961114664 2961115012 253
363 iso_pu_bacteria 2961127735 2961131449 253
364 iso_pu_bacteria 2961136820 2961141748 253
365 iso_pu_bacteria 2961163497 2961166910 253
366 iso_pu_bacteria 2961170736 2961176805 253
367 iso_pu_bacteria 2961183825 2961190096 253
368 iso_pu_bacteria 2963644680 2963651097 253
369 iso_pu_bacteria 2965018300 2965021734 253
370 iso_pu_bacteria 2965025482 2965028904 253
371 iso_pu_bacteria 2965032056 2965039896 253
372 iso_pu_bacteria 2965040258 2965042514 253
373 iso_pu_bacteria 2965089291 2965090604 253
374 iso_pu_bacteria 2965102966 2965110318 253
375 iso_pu_bacteria 2967996073 2968001086 253
376 iso_pu_bacteria 2968003550 2968007139 253
377 iso_pu_bacteria 2968016561 2968021571 253
378 iso_pu_bacteria 2968083720 2968089046 253
379 iso_pu_bacteria 2968091066 2968094152 253
380 iso_pu_bacteria 2968097103 2968100041 253
381 iso_pu_bacteria 2968110612 2968110740 253
382 iso_pu_bacteria 2968117919 2968121532 253
383 iso_pu_bacteria 2968128360 2968131359 253
384 iso_pu_bacteria 2968171901 2968175316 253
385 iso_pu_bacteria 2970469710 2970476750 253
386 iso_pu_bacteria 2970503327 2970509478 253
387 iso_pu_bacteria 2970510686 2970514206 253
388 iso_pu_bacteria 2970524798 2970525461 253
389 iso_pu_bacteria 2970532167 2970534217 253
390 iso_pu_bacteria 2970540015 2970545007 253
391 iso_pu_bacteria 2970547951 2970553735 253
392 iso_pu_bacteria 2970554993 2970558354 253
393 iso_pu_bacteria 2970593180 2970594472 253
394 iso_pu_bacteria 2970619444 2970621198 253
395 iso_pu_bacteria 2970627176 2970628735 253
396 iso_pu_bacteria 2977821940 2977824293 253
397 iso_pu_bacteria 2977828996 2977833497 253
398 iso_pu_bacteria 2977843712 2977850090 253
399 iso_pu_bacteria 2977851361 2977855017 253
400 iso_pu_bacteria 2977858184 2977864872 253
401 iso_pu_bacteria 2977864932 2977868370 253
402 iso_pu_bacteria 2977872689 2977873727 253
403 iso_pu_bacteria 2977907340 2977909492 253
404 iso_pu_bacteria 2977915119 2977918095 253
405 iso_pu_bacteria 2977922695 2977925145 253
406 iso_pu_bacteria 2977935797 2977939961 253
407 iso_pu_bacteria 2977942078 2977943705 253
408 iso_pu_bacteria 2977950692 2977953033 253
409 iso_pu_bacteria 2977957713 2977959450 253
410 iso_pu_bacteria 2977986579 2977991864 253
411 iso_pu_bacteria 2979772303 2979779678 253
412 iso_pu_bacteria 2979779861 2979784389 253
413 iso_pu_bacteria 2979808191 2979814265 253
414 iso_pu_bacteria 2987636660 2987642311 253
415 iso_pu_bacteria 2987645492 2987646006 253
416 iso_pu_bacteria 2987652177 2987654307 253
417 iso_pu_bacteria 2987659509 2987662922 253
418 iso_pu_bacteria 2987666974 2987668112 253
419 iso_pu_bacteria 2987673487 2987680784 253
420 iso_pu_bacteria 2996310559 2996315782 253
421 iso_pu_bacteria 2996336353 2996336762 253
422 iso_pu_bacteria 2996341866 2996348844 253
423 iso_pu_bacteria 2996887358 2996888156 253
424 iso_pu_bacteria 2996893221 2996897764 253
425 iso_pu_bacteria 3000135777 3000135880 253
426 iso_pu_bacteria 3004188549 3004191974 253
427 iso_pu_bacteria 3004203850 3004210393 253
428 iso_pu_bacteria 3004211236 3004216749 253
429 iso_pu_bacteria 3004218560 3004219782 253
430 iso_pu_bacteria 3004232784 3004234039 253
431 iso_pu_bacteria 3004239961 3004247572 253
432 iso_pu_bacteria 3004248173 3004254510 253
433 iso_pu_bacteria 3004268573 3004269573 253
434 iso_pu_bacteria 3004334049 3004338121 253
435 iso_pu_bacteria 3005409236 3005410808 253
436 iso_pu_bacteria 3005416602 3005423095 253
437 iso_pu_bacteria 3005452660 3005456533 253
438 iso_pu_bacteria 637000159 637077691 253
439 iso_pu_bacteria 639633055 639646243 253
440 iso_pu_bacteria 649633066 649875803 253
441 iso_pu_bacteria 8003955200 8003961947 253
442 iso_pu_bacteria 8004300914 8004305839 253
443 iso_pu_bacteria 8004312739 8004320501 253
444 iso_pu_bacteria 8004361976 8004367714 253
445 iso_pu_bacteria 8004374579 8004376732 253
446 iso_pu_bacteria 8004387939 8004395083 253
447 iso_pu_bacteria 8004445564 8004448309 253
448 iso_pu_bacteria 8004633249 8004635594 253
449 iso_pu_bacteria 8004640170 8004646976 253
450 iso_pu_bacteria 8004703790 8004707314 253
451 iso_pu_bacteria 8004714634 8004721404 253
452 iso_pu_bacteria 8004727605 8004731111 253
453 iso_pu_bacteria 8005258706 8005261292 253
454 iso_pu_bacteria 8005275841 8005278455 253
455 iso_pu_bacteria 8005282627 8005283002 253
456 iso_pu_bacteria 8005289223 8005291480 253
457 iso_pu_bacteria 8005301065 8005305638 253
458 iso_pu_bacteria 8005307578 8005310423 253
459 iso_pu_bacteria 8005314921 8005315422 253
460 iso_pu_bacteria 8005321885 8005322683 253
461 iso_pu_bacteria 8005376324 8005377851 253
462 iso_pu_bacteria 8005382845 8005385145 253
463 iso_pu_bacteria 8005395548 8005399775 253
464 iso_pu_bacteria 8005484373 8005484667 253
465 iso_pu_bacteria 8005542996 8005543412 253
466 iso_pu_bacteria 8005556819 8005560192 253
467 iso_pu_bacteria 8005563573 8005564352 253
468 iso_pu_bacteria 8005570704 8005573906 253
469 iso_pu_bacteria 8005626139 8005628042 253
470 iso_pu_bacteria 8005645114 8005649359 253
471 iso_pu_bacteria 8005682033 8005685401 253
472 iso_pu_bacteria 8005688590 8005692608 253
473 iso_pu_bacteria 8005695170 8005699683 253
474 iso_pu_bacteria 8018127388 8018132729 253
475 iso_pu_bacteria 8018163183 8018167425 253
476 iso_pu_bacteria 8018176218 8018181894 253
477 iso_pu_bacteria 8023680758 8023684670 253
478 iso_pu_bacteria 8024479707 8024479870 253
479 iso_pu_bacteria 8024486573 8024491691 253
480 iso_pu_bacteria 8024501048 8024506491 253
481 iso_pu_bacteria 8049293176 8049296744 253
482 iso_pu_bacteria 8055617313 8055624770 253
483 iso_pu_bacteria 8056375014 8056376092 253
484 iso_pu_bacteria 8056382006 8056384165 253
485 iso_pu_bacteria 8057874678 8057877574 253
486 3300031595 Ga0265313_10036974 Ga0265313_100369741 255
487 3300005455 Ga0070663_100226311 Ga0070663_1002263112 256
488 3300014326 Ga0157380_10666332 Ga0157380_106663322 256
489 3300025927 Ga0207687_10536245 Ga0207687_105362451 256
490 3300047321 Ga0495676_0018675 Ga0495676_0018675_921_1808 256
491 3300002737 JGI25162J39368_1000723 JGI25162J39368_10007234 257
492 3300002739 JGI25158J39367_1007800 JGI25158J39367_10078002 257
493 3300002741 JGI25157J39369_1003765 JGI25157J39369_10037653 257
494 3300002773 JGI25152J39213_1000949 JGI25152J39213_10009497 257
495 3300002773 JGI25152J39213_1001249 JGI25152J39213_10012498 257
496 3300002773 JGI25152J39213_1004111 JGI25152J39213_10041115 257
497 3300002774 JGI25150J39212_1000133 JGI25150J39212_100013335 257
498 3300002987 JGI25159J45721_1000003 JGI25159J45721_100000315 257
499 3300002987 JGI25159J45721_1001316 JGI25159J45721_10013164 257
500 3300003187 JGI25151J46595_10000407 JGI25151J46595_100004077 257
501 3300003187 JGI25151J46595_10016907 JGI25151J46595_100169071 257
502 3300003187 JGI25151J46595_10019080 JGI25151J46595_100190801 257
503 3300003214 JGI25165J46597_1000019 JGI25165J46597_1000019263 257
504 3300003214 JGI25165J46597_1000607 JGI25165J46597_100060727 257
505 3300003214 JGI25165J46597_1008336 JGI25165J46597_10083362 257
506 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003196 257
507 3300003354 JGI25160J50197_1000012 JGI25160J50197_1000012126 257
508 3300003354 JGI25160J50197_1005584 JGI25160J50197_10055841 257
509 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002278 257
510 3300003374 JGI25161J50226_1000548 JGI25161J50226_10005482 257
511 3300003374 JGI25161J50226_1001904 JGI25161J50226_10019044 257
512 3300003374 JGI25161J50226_1003853 JGI25161J50226_10038534 257
513 3300003762 Ga0055542_1000493 Ga0055542_100049330 257
514 3300003763 Ga0055529_1002300 Ga0055529_10023003 257
515 3300003771 Ga0055526_1000639 Ga0055526_10006394 257
516 3300003771 Ga0055526_1023736 Ga0055526_10237362 257
517 3300003775 Ga0055524_1023182 Ga0055524_10231821 257
518 3300003775 Ga0055524_1025940 Ga0055524_10259401 257
519 3300003775 Ga0055524_1028756 Ga0055524_10287561 257
520 3300003775 Ga0055524_1040940 Ga0055524_10409402 257
521 3300003781 Ga0055536_1003170 Ga0055536_10031708 257
522 3300003790 Ga0055528_1012850 Ga0055528_10128504 257
523 3300003790 Ga0055528_1022043 Ga0055528_10220432 257
524 3300003790 Ga0055528_1026614 Ga0055528_10266141 257
525 3300003790 Ga0055528_1038331 Ga0055528_10383311 257
526 3300003791 Ga0055530_10012113 Ga0055530_100121133 257
527 3300003792 Ga0055540_1024686 Ga0055540_10246861 257
528 3300004625 Ga0055543_1000011 Ga0055543_100001131 257
529 3300004625 Ga0055543_1000223 Ga0055543_100022318 257
530 3300004625 Ga0055543_1000359 Ga0055543_100035924 257
531 3300005262 Ga0065165_1000025 Ga0065165_1000025135 257
532 3300005262 Ga0065165_1001668 Ga0065165_10016687 257
533 3300005262 Ga0065165_1003740 Ga0065165_10037402 257
534 3300005262 Ga0065165_1022339 Ga0065165_10223392 257
535 3300005327 Ga0070658_10016770 Ga0070658_100167704 257
536 3300005327 Ga0070658_10248214 Ga0070658_102482141 257
537 3300005335 Ga0070666_10018796 Ga0070666_100187961 257
538 3300005339 Ga0070660_100122721 Ga0070660_1001227212 257
539 3300005347 Ga0070668_100101908 Ga0070668_1001019082 257
540 3300005347 Ga0070668_100214010 Ga0070668_1002140102 257
541 3300005355 Ga0070671_100052083 Ga0070671_1000520832 257
542 3300005356 Ga0070674_100190387 Ga0070674_1001903872 257
543 3300005367 Ga0070667_100199413 Ga0070667_1001994132 257
544 3300005367 Ga0070667_100571052 Ga0070667_1005710521 257
545 3300005441 Ga0070700_100279377 Ga0070700_1002793772 257
546 3300005455 Ga0070663_100153491 Ga0070663_1001534911 257
547 3300005456 Ga0070678_100086731 Ga0070678_1000867314 257
548 3300005457 Ga0070662_100202097 Ga0070662_1002020971 257
549 3300005530 Ga0070679_100004088 Ga0070679_1000040882 257
550 3300005539 Ga0068853_100007936 Ga0068853_1000079364 257
551 3300005548 Ga0070665_100051973 Ga0070665_1000519732 257
552 3300005548 Ga0070665_100137694 Ga0070665_1001376942 257
553 3300005548 Ga0070665_100405713 Ga0070665_1004057131 257
554 3300005548 Ga0070665_100542109 Ga0070665_1005421091 257
555 3300005549 Ga0070704_100090342 Ga0070704_1000903422 257
556 3300005563 Ga0068855_100204532 Ga0068855_1002045322 257
557 3300005578 Ga0068854_100018610 Ga0068854_1000186104 257
558 3300005614 Ga0068856_100306331 Ga0068856_1003063313 257
559 3300005614 Ga0068856_100433468 Ga0068856_1004334681 257
560 3300005616 Ga0068852_100224939 Ga0068852_1002249391 257
561 3300005616 Ga0068852_100592194 Ga0068852_1005921941 257
562 3300005616 Ga0068852_100962890 Ga0068852_1009628901 257
563 3300005617 Ga0068859_100696265 Ga0068859_1006962652 257
564 3300005841 Ga0068863_100114431 Ga0068863_1001144312 257
565 3300005841 Ga0068863_100437135 Ga0068863_1004371351 257
566 3300005844 Ga0068862_100468176 Ga0068862_1004681762 257
567 3300005937 Ga0081455_10072907 Ga0081455_100729073 257
568 3300005983 Ga0081540_1000655 Ga0081540_100065514 257
569 3300005983 Ga0081540_1084931 Ga0081540_10849312 257
570 3300006038 Ga0075365_10000182 Ga0075365_1000018215 257
571 3300006038 Ga0075365_10005860 Ga0075365_100058602 257
572 3300006038 Ga0075365_10014090 Ga0075365_100140901 257
573 3300006038 Ga0075365_10205677 Ga0075365_102056772 257
574 3300006048 Ga0075363_100005969 Ga0075363_1000059693 257
575 3300006048 Ga0075363_100072620 Ga0075363_1000726202 257
576 3300006048 Ga0075363_100203558 Ga0075363_1002035582 257
577 3300006051 Ga0075364_10013728 Ga0075364_100137283 257
578 3300006177 Ga0075362_10003461 Ga0075362_100034615 257
579 3300006177 Ga0075362_10047948 Ga0075362_100479482 257
580 3300006178 Ga0075367_10001637 Ga0075367_100016378 257
581 3300006178 Ga0075367_10044376 Ga0075367_100443762 257
582 3300006178 Ga0075367_10194794 Ga0075367_101947942 257
583 3300006195 Ga0075366_10010606 Ga0075366_100106065 257
584 3300006353 Ga0075370_10142885 Ga0075370_101428852 257
585 3300006844 Ga0075428_100011226 Ga0075428_1000112262 257
586 3300006852 Ga0075433_10332303 Ga0075433_103323031 257
587 3300006871 Ga0075434_100086928 Ga0075434_1000869282 257
588 3300006871 Ga0075434_100369745 Ga0075434_1003697451 257
589 3300006931 Ga0097620_100696065 Ga0097620_1006960652 257
590 3300009093 Ga0105240_10000024 Ga0105240_10000024162 257
591 3300009093 Ga0105240_10006353 Ga0105240_1000635311 257
592 3300009093 Ga0105240_10006667 Ga0105240_100066676 257
593 3300009093 Ga0105240_10034779 Ga0105240_100347795 257
594 3300009093 Ga0105240_10586269 Ga0105240_105862692 257
595 3300009093 Ga0105240_10690160 Ga0105240_106901601 257
596 3300009093 Ga0105240_10702332 Ga0105240_107023321 257
597 3300009094 Ga0111539_10395937 Ga0111539_103959372 257
598 3300009098 Ga0105245_10166843 Ga0105245_101668433 257
599 3300009147 Ga0114129_10076075 Ga0114129_100760751 257
600 3300009147 Ga0114129_10155221 Ga0114129_101552212 257
601 3300009174 Ga0105241_10338153 Ga0105241_103381532 257
602 3300009177 Ga0105248_10015699 Ga0105248_100156991 257
603 3300009177 Ga0105248_10016963 Ga0105248_100169633 257
604 3300009545 Ga0105237_10003204 Ga0105237_1000320416 257
605 3300009545 Ga0105237_10003362 Ga0105237_1000336212 257
606 3300009545 Ga0105237_10019374 Ga0105237_100193744 257
607 3300009545 Ga0105237_10233750 Ga0105237_102337501 257
608 3300009545 Ga0105237_10618817 Ga0105237_106188171 257
609 3300009551 Ga0105238_10000581 Ga0105238_1000058122 257
610 3300009551 Ga0105238_10013262 Ga0105238_100132625 257
611 3300009551 Ga0105238_10040824 Ga0105238_100408242 257
612 3300009551 Ga0105238_10513743 Ga0105238_105137431 257
613 3300009551 Ga0105238_10537460 Ga0105238_105374602 257
614 3300009553 Ga0105249_10531658 Ga0105249_105316582 257
615 3300009765 Ga0123341_1000036 Ga0123341_100003635 257
616 3300010375 Ga0105239_10007083 Ga0105239_100070839 257
617 3300010375 Ga0105239_10017180 Ga0105239_100171808 257
618 3300010375 Ga0105239_10034354 Ga0105239_100343542 257
619 3300010375 Ga0105239_10070786 Ga0105239_100707863 257
620 3300010375 Ga0105239_10166434 Ga0105239_101664342 257
621 3300013104 Ga0157370_10000236 Ga0157370_1000023638 257
622 3300013105 Ga0157369_10253470 Ga0157369_102534702 257
623 3300013296 Ga0157374_10476736 Ga0157374_104767361 257
624 3300013306 Ga0163162_10004400 Ga0163162_1000440016 257
625 3300013307 Ga0157372_10398880 Ga0157372_103988802 257
626 3300013308 Ga0157375_10148830 Ga0157375_101488302 257
627 3300015262 Ga0182007_10010211 Ga0182007_100102111 257
628 3300015265 Ga0182005_1015232 Ga0182005_10152322 257
629 3300021321 Ga0214542_1000029 Ga0214542_100002968 257
630 3300021327 Ga0214543_1000040 Ga0214543_100004068 257
631 3300025208 Ga0209436_100773 Ga0209436_1007732 257
632 3300025233 Ga0209437_100056 Ga0209437_100056252 257
633 3300025245 Ga0207425_1000466 Ga0207425_10004667 257
634 3300025245 Ga0207425_1025004 Ga0207425_10250041 257
635 3300025246 Ga0209646_1010555 Ga0209646_10105552 257
636 3300025250 Ga0209026_1000013 Ga0209026_1000013131 257
637 3300025253 Ga0209677_100813 Ga0209677_10081312 257
638 3300025254 Ga0209148_1000210 Ga0209148_10002104 257
639 3300025254 Ga0209148_1016909 Ga0209148_10169091 257
640 3300025256 Ga0209759_1000058 Ga0209759_1000058185 257
641 3300025258 Ga0209129_1000066 Ga0209129_10000661 257
642 3300025258 Ga0209129_1000308 Ga0209129_10003087 257
643 3300025258 Ga0209129_1001193 Ga0209129_10011932 257
644 3300025258 Ga0209129_1003700 Ga0209129_10037003 257
645 3300025261 Ga0209233_1000034 Ga0209233_1000034447 257
646 3300025261 Ga0209233_1000071 Ga0209233_1000071252 257
647 3300025261 Ga0209233_1000234 Ga0209233_100023416 257
648 3300025272 Ga0209455_1000098 Ga0209455_100009889 257
649 3300025273 Ga0209673_1000024 Ga0209673_1000024258 257
650 3300025273 Ga0209673_1003287 Ga0209673_10032878 257
651 3300025273 Ga0209673_1005501 Ga0209673_10055015 257
652 3300025273 Ga0209673_1007783 Ga0209673_10077832 257
653 3300025273 Ga0209673_1023029 Ga0209673_10230292 257
654 3300025284 Ga0209130_1000005 Ga0209130_1000005284 257
655 3300025284 Ga0209130_1000028 Ga0209130_1000028172 257
656 3300025284 Ga0209130_1028816 Ga0209130_10288162 257
657 3300025292 Ga0209676_1001378 Ga0209676_100137822 257
658 3300025292 Ga0209676_1011395 Ga0209676_10113952 257
659 3300025294 Ga0209025_1000235 Ga0209025_100023555 257
660 3300025294 Ga0209025_1000919 Ga0209025_100091936 257
661 3300025294 Ga0209025_1010694 Ga0209025_10106942 257
662 3300025294 Ga0209025_1013073 Ga0209025_10130732 257
663 3300025294 Ga0209025_1021245 Ga0209025_10212452 257
664 3300025294 Ga0209025_1046791 Ga0209025_10467913 257
665 3300025295 Ga0209564_1000217 Ga0209564_100021751 257
666 3300025295 Ga0209564_1002676 Ga0209564_10026762 257
667 3300025295 Ga0209564_1049640 Ga0209564_10496401 257
668 3300025297 Ga0209758_1000788 Ga0209758_100078836 257
669 3300025297 Ga0209758_1001692 Ga0209758_10016926 257
670 3300025297 Ga0209758_1002187 Ga0209758_100218713 257
671 3300025297 Ga0209758_1017612 Ga0209758_10176122 257
672 3300025297 Ga0209758_1034268 Ga0209758_10342682 257
673 3300025298 Ga0209050_1003461 Ga0209050_10034618 257
674 3300025299 Ga0209256_1000667 Ga0209256_100066733 257
675 3300025299 Ga0209256_1004264 Ga0209256_10042645 257
676 3300025299 Ga0209256_1006861 Ga0209256_10068615 257
677 3300025299 Ga0209256_1006936 Ga0209256_10069363 257
678 3300025299 Ga0209256_1014926 Ga0209256_10149263 257
679 3300025299 Ga0209256_1033535 Ga0209256_10335351 257
680 3300025302 Ga0207426_1000012 Ga0207426_1000012409 257
681 3300025302 Ga0207426_1000015 Ga0207426_1000015315 257
682 3300025302 Ga0207426_1000639 Ga0207426_100063930 257
683 3300025303 Ga0209051_1006600 Ga0209051_10066005 257
684 3300025303 Ga0209051_1007642 Ga0209051_10076426 257
685 3300025303 Ga0209051_1028066 Ga0209051_10280661 257
686 3300025303 Ga0209051_1056062 Ga0209051_10560622 257
687 3300025303 Ga0209051_1069557 Ga0209051_10695571 257
688 3300025304 Ga0209257_1004476 Ga0209257_10044769 257
689 3300025321 Ga0207656_10053793 Ga0207656_100537932 257
690 3300025903 Ga0207680_10094592 Ga0207680_100945922 257
691 3300025907 Ga0207645_10028363 Ga0207645_100283633 257
692 3300025910 Ga0207684_10196076 Ga0207684_101960762 257
693 3300025911 Ga0207654_10011059 Ga0207654_100110592 257
694 3300025911 Ga0207654_10160903 Ga0207654_101609032 257
695 3300025913 Ga0207695_10000036 Ga0207695_10000036232 257
696 3300025913 Ga0207695_10002526 Ga0207695_100025269 257
697 3300025913 Ga0207695_10014930 Ga0207695_100149307 257
698 3300025913 Ga0207695_10046035 Ga0207695_100460354 257
699 3300025913 Ga0207695_10048159 Ga0207695_100481592 257
700 3300025914 Ga0207671_10000354 Ga0207671_100003548 257
701 3300025914 Ga0207671_10005251 Ga0207671_1000525110 257
702 3300025914 Ga0207671_10015369 Ga0207671_100153692 257
703 3300025914 Ga0207671_10154179 Ga0207671_101541792 257
704 3300025914 Ga0207671_10470232 Ga0207671_104702321 257
705 3300025921 Ga0207652_10012451 Ga0207652_100124514 257
706 3300025924 Ga0207694_10004214 Ga0207694_100042148 257
707 3300025924 Ga0207694_10007343 Ga0207694_100073434 257
708 3300025924 Ga0207694_10513123 Ga0207694_105131231 257
709 3300025933 Ga0207706_10251063 Ga0207706_102510632 257
710 3300025938 Ga0207704_10148402 Ga0207704_101484022 257
711 3300025940 Ga0207691_10016827 Ga0207691_100168275 257
712 3300025941 Ga0207711_10046674 Ga0207711_100466742 257
713 3300025949 Ga0207667_10005231 Ga0207667_1000523110 257
714 3300025949 Ga0207667_10142935 Ga0207667_101429352 257
715 3300025949 Ga0207667_10329953 Ga0207667_103299532 257
716 3300025949 Ga0207667_10746135 Ga0207667_107461351 257
717 3300025960 Ga0207651_10098069 Ga0207651_100980692 257
718 3300025961 Ga0207712_10177975 Ga0207712_101779752 257
719 3300025972 Ga0207668_10556961 Ga0207668_105569611 257
720 3300025981 Ga0207640_10012129 Ga0207640_100121293 257
721 3300025986 Ga0207658_10016423 Ga0207658_100164235 257
722 3300025986 Ga0207658_10246348 Ga0207658_102463481 257
723 3300025986 Ga0207658_10324181 Ga0207658_103241812 257
724 3300025986 Ga0207658_10582078 Ga0207658_105820782 257
725 3300026023 Ga0207677_10760047 Ga0207677_107600471 257
726 3300026035 Ga0207703_10345483 Ga0207703_103454832 257
727 3300026041 Ga0207639_10002694 Ga0207639_1000269411 257
728 3300026041 Ga0207639_10592467 Ga0207639_105924671 257
729 3300026067 Ga0207678_10007681 Ga0207678_100076817 257
730 3300026067 Ga0207678_10023575 Ga0207678_100235752 257
731 3300026067 Ga0207678_10490795 Ga0207678_104907951 257
732 3300026075 Ga0207708_10003093 Ga0207708_100030932 257
733 3300026078 Ga0207702_10508716 Ga0207702_105087161 257
734 3300026088 Ga0207641_10642968 Ga0207641_106429682 257
735 3300026089 Ga0207648_10022724 Ga0207648_100227244 257
736 3300026121 Ga0207683_10122981 Ga0207683_101229811 257
737 3300026142 Ga0207698_10008506 Ga0207698_100085063 257
738 3300026142 Ga0207698_10316142 Ga0207698_103161421 257
739 3300027312 Ga0209371_1000840 Ga0209371_100084025 257
740 3300027512 Ga0209179_1020523 Ga0209179_10205232 257
741 3300027665 Ga0209983_1004895 Ga0209983_10048951 257
742 3300028379 Ga0268266_10025750 Ga0268266_100257503 257
743 3300028379 Ga0268266_10047886 Ga0268266_100478862 257
744 3300028379 Ga0268266_10185397 Ga0268266_101853972 257
745 3300028379 Ga0268266_10202952 Ga0268266_102029522 257
746 3300028379 Ga0268266_10417634 Ga0268266_104176342 257
747 3300028794 Ga0307515_10174880 Ga0307515_101748802 257
748 3300030500 Ga0268256_1004174 Ga0268256_10041744 257
749 3300031239 Ga0265328_10000069 Ga0265328_1000006933 257
750 3300031344 Ga0265316_10053727 Ga0265316_100537273 257
751 3300031344 Ga0265316_10057925 Ga0265316_100579254 257
752 3300031456 Ga0307513_10309991 Ga0307513_103099912 257
753 3300031731 Ga0307405_10004258 Ga0307405_100042586 257
754 3300031824 Ga0307413_10178022 Ga0307413_101780222 257
755 3300031852 Ga0307410_10214122 Ga0307410_102141222 257
756 3300031901 Ga0307406_10024866 Ga0307406_100248664 257
757 3300031911 Ga0307412_10001127 Ga0307412_1000112713 257
758 3300031995 Ga0307409_100008912 Ga0307409_1000089124 257
759 3300032005 Ga0307411_10024809 Ga0307411_100248093 257
760 3300032126 Ga0307415_100202607 Ga0307415_1002026071 257
761 3300035692 Ga0373935_0204865 Ga0373935_0204865_280_1053 257
762 3300037418 Ga0395900_0014652 Ga0395900_0014652_3721_4554 257
763 3300037418 Ga0395900_0062523 Ga0395900_0062523_2723_3496 257
764 3300037466 Ga0395898_0023281 Ga0395898_0023281_992_1825 257
765 3300037466 Ga0395898_0672758 Ga0395898_0672758_63_836 257
766 3300037471 Ga0395905_0041088 Ga0395905_0041088_876_1649 257
767 3300037471 Ga0395905_0105171 Ga0395905_0105171_670_1443 257
768 3300037471 Ga0395905_0250133 Ga0395905_0250133_744_1517 257
769 3300037471 Ga0395905_0520999 Ga0395905_0520999_175_948 257
770 3300037853 Ga0436364_0065539 Ga0436364_0065539_440_1213 257
771 3300038443 Ga0395901_0024443 Ga0395901_0024443_2553_3326 257
772 3300038443 Ga0395901_0029875 Ga0395901_0029875_312_1085 257
773 3300038443 Ga0395901_0163249 Ga0395901_0163249_333_1166 257
774 3300038443 Ga0395901_0388347 Ga0395901_0388347_292_1065 257
775 3300039447 Ga0436361_0249028 Ga0436361_0249028_134_907 257
776 3300041404 Ga0439436_0070471 Ga0439436_0070471_99_878 257
777 3300041410 Ga0439461_0002024 Ga0439461_0002024_954_1733 257
778 3300041411 Ga0439466_0067030 Ga0439466_0067030_105_878 257
779 3300041413 Ga0439465_0011789 Ga0439465_0011789_128_901 257
780 3300041441 Ga0451787_013798 Ga0451787_013798_1218_1991 257
781 3300041492 Ga0451835_0899430 Ga0451835_0899430_173_946 257
782 3300041999 Ga0439433_0050109 Ga0439433_0050109_113_892 257
783 3300042006 Ga0439432_030550 Ga0439432_030550_459_1232 257
784 3300042007 Ga0439449_0021751 Ga0439449_0021751_311_1084 257
785 3300042012 Ga0439455_0031544 Ga0439455_0031544_87_959 257
786 3300042014 Ga0439457_007290 Ga0439457_007290_1421_2200 257
787 3300042146 Ga0450907_004962 Ga0450907_004962_301_1080 257
788 3300042185 Ga0450909_007216 Ga0450909_007216_572_1351 257
789 3300042531 Ga0450918_003019 Ga0450918_003019_1298_2077 257
790 3300044656 Ga0466969_0129957 Ga0466969_0129957_307_1080 257
791 3300044658 Ga0466972_0010886 Ga0466972_0010886_1693_2466 257
792 3300044684 Ga0466966_0050785 Ga0466966_0050785_1767_2540 257
793 3300044693 Ga0466961_0200063 Ga0466961_0200063_373_1146 257
794 3300044901 Ga0466960_0017225 Ga0466960_0017225_977_1750 257
795 3300045049 Ga0466959_0006206 Ga0466959_0006206_5432_6205 257
796 3300046452 Ga0495617_000226 Ga0495617_000226_15571_16452 257
797 3300046452 Ga0495617_015607 Ga0495617_015607_648_1529 257
798 3300046454 Ga0495592_0002448 Ga0495592_0002448_2643_3419 257
799 3300046457 Ga0495590_0004991 Ga0495590_0004991_189_1001 257
800 3300046460 Ga0495638_0000467 Ga0495638_0000467_46405_47178 257
801 3300046460 Ga0495638_0010804 Ga0495638_0010804_4110_4886 257
802 3300046460 Ga0495638_0108168 Ga0495638_0108168_301_1233 257
803 3300046474 Ga0495605_0008223 Ga0495605_0008223_884_1765 257
804 3300046474 Ga0495605_0033254 Ga0495605_0033254_215_988 257
805 3300046474 Ga0495605_0070945 Ga0495605_0070945_165_941 257
806 3300046477 Ga0495664_0227551 Ga0495664_0227551_97_930 257
807 3300046491 Ga0495584_0000027 Ga0495584_0000027_63873_64754 257
808 3300046491 Ga0495584_0136696 Ga0495584_0136696_199_1131 257
809 3300046491 Ga0495584_0230103 Ga0495584_0230103_44_817 257
810 3300046492 Ga0495585_0003384 Ga0495585_0003384_1871_2752 257
811 3300046492 Ga0495585_0015650 Ga0495585_0015650_2122_2895 257
812 3300046492 Ga0495585_0058083 Ga0495585_0058083_330_1127 257
813 3300046500 Ga0495596_0042999 Ga0495596_0042999_205_981 257
814 3300046501 Ga0495607_0031771 Ga0495607_0031771_1497_2369 257
815 3300046501 Ga0495607_0051513 Ga0495607_0051513_438_1319 257
816 3300046501 Ga0495607_0097365 Ga0495607_0097365_453_1229 257
817 3300046501 Ga0495607_0135272 Ga0495607_0135272_40_921 257
818 3300046506 Ga0495583_0000108 Ga0495583_0000108_128758_129690 257
819 3300046506 Ga0495583_0024318 Ga0495583_0024318_447_1220 257
820 3300046506 Ga0495583_0084695 Ga0495583_0084695_232_1005 257
821 3300046507 Ga0495606_0008464 Ga0495606_0008464_2244_3017 257
822 3300046507 Ga0495606_0091417 Ga0495606_0091417_892_1665 257
823 3300046512 Ga0495610_0000420 Ga0495610_0000420_26933_27706 257
824 3300046512 Ga0495610_0028642 Ga0495610_0028642_1622_2395 257
825 3300046513 Ga0495616_0045839 Ga0495616_0045839_1382_2155 257
826 3300046515 Ga0495620_0005563 Ga0495620_0005563_1469_2242 257
827 3300046515 Ga0495620_0020353 Ga0495620_0020353_1416_2189 257
828 3300046515 Ga0495620_0036878 Ga0495620_0036878_1006_1779 257
829 3300046515 Ga0495620_0038743 Ga0495620_0038743_1206_2003 257
830 3300046516 Ga0495628_0001848 Ga0495628_0001848_10491_11267 257
831 3300046518 Ga0495631_0004857 Ga0495631_0004857_4858_5655 257
832 3300046519 Ga0495632_0005291 Ga0495632_0005291_2734_3507 257
833 3300046519 Ga0495632_0023560 Ga0495632_0023560_2479_3252 257
834 3300046519 Ga0495632_0029038 Ga0495632_0029038_508_1281 257
835 3300046519 Ga0495632_0040073 Ga0495632_0040073_413_1210 257
836 3300046520 Ga0495637_0068461 Ga0495637_0068461_523_1296 257
837 3300046522 Ga0495643_0009129 Ga0495643_0009129_3807_4580 257
838 3300046522 Ga0495643_0096911 Ga0495643_0096911_168_941 257
839 3300046523 Ga0495644_0000337 Ga0495644_0000337_19638_20570 257
840 3300046523 Ga0495644_0038287 Ga0495644_0038287_45_818 257
841 3300046524 Ga0495648_0000329 Ga0495648_0000329_46048_46980 257
842 3300046528 Ga0495642_0044367 Ga0495642_0044367_190_966 257
843 3300046529 Ga0495652_0003480 Ga0495652_0003480_10171_10947 257
844 3300046530 Ga0495654_0000070 Ga0495654_0000070_24847_25620 257
845 3300046538 Ga0495609_0001667 Ga0495609_0001667_237_1169 257
846 3300046538 Ga0495609_0030816 Ga0495609_0030816_1324_2205 257
847 3300046542 Ga0495597_0035644 Ga0495597_0035644_49_822 257
848 3300046543 Ga0495645_0001712 Ga0495645_0001712_2626_3402 257
849 3300046557 Ga0495622_0015671 Ga0495622_0015671_1506_2279 257
850 3300046558 Ga0495633_0001956 Ga0495633_0001956_1641_2522 257
851 3300046558 Ga0495633_0053193 Ga0495633_0053193_903_1676 257
852 3300046615 Ga0495656_0007647 Ga0495656_0007647_2180_3061 257
853 3300046615 Ga0495656_0016601 Ga0495656_0016601_854_1627 257
854 3300046615 Ga0495656_0042886 Ga0495656_0042886_889_1662 257
855 3300046616 Ga0495668_0002424 Ga0495668_0002424_6153_6950 257
856 3300046648 Ga0495611_0000405 Ga0495611_0000405_16804_17736 257
857 3300046660 Ga0495625_0006911 Ga0495625_0006911_7101_7898 257
858 3300046660 Ga0495625_0017934 Ga0495625_0017934_2320_3093 257
859 3300046660 Ga0495625_0064983 Ga0495625_0064983_506_1288 257
860 3300046660 Ga0495625_0157625 Ga0495625_0157625_525_1298 257
861 3300046660 Ga0495625_0163337 Ga0495625_0163337_81_854 257
862 3300046660 Ga0495625_0287476 Ga0495625_0287476_152_925 257
863 3300046663 Ga0495635_0097376 Ga0495635_0097376_821_1594 257
864 3300046664 Ga0495659_0000655 Ga0495659_0000655_6656_7588 257
865 3300046665 Ga0495661_0046811 Ga0495661_0046811_285_1058 257
866 3300046665 Ga0495661_0070842 Ga0495661_0070842_745_1677 257
867 3300046684 Ga0495669_0088167 Ga0495669_0088167_581_1357 257
868 3300046691 Ga0495670_0000361 Ga0495670_0000361_9080_10012 257
869 3300046691 Ga0495670_0038474 Ga0495670_0038474_1388_2161 257
870 3300046692 Ga0495671_0012739 Ga0495671_0012739_267_1148 257
871 3300046692 Ga0495671_0043833 Ga0495671_0043833_393_1166 257
872 3300046692 Ga0495671_0046540 Ga0495671_0046540_827_1759 257
873 3300046694 Ga0495649_0150220 Ga0495649_0150220_183_959 257
874 3300046794 Ga0495589_0057384 Ga0495589_0057384_373_1149 257
875 3300046794 Ga0495589_0097389 Ga0495589_0097389_162_935 257
876 3300046809 Ga0495600_0135841 Ga0495600_0135841_308_1141 257
877 3300046810 Ga0495660_0041706 Ga0495660_0041706_516_1313 257
878 3300046810 Ga0495660_0042576 Ga0495660_0042576_797_1609 257
879 3300046810 Ga0495660_0076584 Ga0495660_0076584_201_974 257
880 3300047317 Ga0495604_0020584 Ga0495604_0020584_519_1292 257
881 3300047318 Ga0495636_0005342 Ga0495636_0005342_3667_4599 257
882 3300047318 Ga0495636_0007359 Ga0495636_0007359_66_842 257
883 3300047318 Ga0495636_0031731 Ga0495636_0031731_1133_1906 257
884 3300047320 Ga0495672_0007436 Ga0495672_0007436_7081_7953 257
885 3300047320 Ga0495672_0028720 Ga0495672_0028720_1339_2112 257
886 3300047320 Ga0495672_0237018 Ga0495672_0237018_97_870 257
887 3300047323 Ga0495683_0001287 Ga0495683_0001287_11183_12064 257
888 3300047445 Ga0495677_0001894 Ga0495677_0001894_686_1618 257
889 3300047447 Ga0495685_000293 Ga0495685_000293_191_1123 257
890 3300047447 Ga0495685_050778 Ga0495685_050778_581_1357 257
891 3300047469 Ga0495673_0001985 Ga0495673_0001985_12746_13627 257
892 3300047470 Ga0495681_0021332 Ga0495681_0021332_507_1280 257
893 3300047472 Ga0495686_0001100 Ga0495686_0001100_29795_30568 257
894 3300047472 Ga0495686_0005359 Ga0495686_0005359_6883_7656 257
895 3300047472 Ga0495686_0023902 Ga0495686_0023902_1746_2519 257
896 3300047472 Ga0495686_0025775 Ga0495686_0025775_196_969 257
897 3300048090 Ga0495615_0002590 Ga0495615_0002590_1122_1895 257
898 3300048091 Ga0495626_0064645 Ga0495626_0064645_171_947 257
899 3300048091 Ga0495626_0113207 Ga0495626_0113207_314_1087 257
900 3300048091 Ga0495626_0138972 Ga0495626_0138972_113_886 257
901 3300048904 Ga0496101_0194469 Ga0496101_0194469_609_1385 257
902 3300048905 Ga0496102_0014354 Ga0496102_0014354_609_1385 257
903 3300048905 Ga0496102_0218483 Ga0496102_0218483_83_856 257
904 3300048906 Ga0496103_0065012 Ga0496103_0065012_33_806 257
905 3300048906 Ga0496103_0212600 Ga0496103_0212600_171_947 257
906 3300048906 Ga0496103_0215044 Ga0496103_0215044_213_986 257
907 3300048907 Ga0496104_0115353 Ga0496104_0115353_166_960 257
908 3300048907 Ga0496104_0158509 Ga0496104_0158509_1099_1875 257
909 3300048908 Ga0496105_0191900 Ga0496105_0191900_349_1125 257
910 3300048910 Ga0496107_0276418 Ga0496107_0276418_296_1069 257
911 3300048919 Ga0496116_0011968 Ga0496116_0011968_6298_7071 257
912 3300048919 Ga0496116_0033140 Ga0496116_0033140_1133_1906 257
913 3300048919 Ga0496116_0091630 Ga0496116_0091630_121_894 257
914 3300048919 Ga0496116_0094986 Ga0496116_0094986_56_829 257
915 3300048920 Ga0496117_0027429 Ga0496117_0027429_2311_3084 257
916 3300048920 Ga0496117_0235743 Ga0496117_0235743_116_889 257
917 3300048921 Ga0496118_0038275 Ga0496118_0038275_1310_2083 257
918 3300048921 Ga0496118_0079463 Ga0496118_0079463_1043_1816 257
919 3300048922 Ga0496119_0016157 Ga0496119_0016157_500_1273 257
920 3300048922 Ga0496119_0024224 Ga0496119_0024224_1142_1936 257
921 3300048922 Ga0496119_0029754 Ga0496119_0029754_1764_2537 257
922 3300048923 Ga0496120_0003643 Ga0496120_0003643_2502_3275 257
923 3300048923 Ga0496120_0039194 Ga0496120_0039194_238_1032 257
924 3300048923 Ga0496120_0042038 Ga0496120_0042038_1211_1984 257
925 3300048924 Ga0496121_0026334 Ga0496121_0026334_2747_3520 257
926 3300048924 Ga0496121_0034805 Ga0496121_0034805_2783_3556 257
927 3300048924 Ga0496121_0035814 Ga0496121_0035814_2272_3045 257
928 3300048924 Ga0496121_0106081 Ga0496121_0106081_1152_1925 257
929 3300048924 Ga0496121_0185048 Ga0496121_0185048_420_1193 257
930 3300048925 Ga0496122_0017471 Ga0496122_0017471_981_1754 257
931 3300048925 Ga0496122_0087182 Ga0496122_0087182_1183_1956 257
932 3300048927 Ga0496124_0064734 Ga0496124_0064734_2161_2934 257
933 3300048927 Ga0496124_0112125 Ga0496124_0112125_371_1144 257
934 3300048927 Ga0496124_0275208 Ga0496124_0275208_192_965 257
935 3300048928 Ga0496125_0011324 Ga0496125_0011324_971_1744 257
936 3300048928 Ga0496125_0053140 Ga0496125_0053140_965_1738 257
937 3300048929 Ga0496126_0063149 Ga0496126_0063149_2196_2969 257
938 3300049459 Ga0495678_002381 Ga0495678_002381_7080_8012 257
939 3300049459 Ga0495678_056651 Ga0495678_056651_104_877 257
940 3300049460 Ga0495682_0000013 Ga0495682_0000013_123176_124057 257
941 3300049460 Ga0495682_0000016 Ga0495682_0000016_61205_62137 257
942 3300049460 Ga0495682_0043735 Ga0495682_0043735_204_1001 257
943 3300049569 Ga0501032_0000008 Ga0501032_0000008_156080_156853 257
944 3300049570 Ga0501033_0000012 Ga0501033_0000012_84772_85545 257
945 3300049571 Ga0501034_0000035 Ga0501034_0000035_84771_85544 257
946 3300049571 Ga0501034_0029240 Ga0501034_0029240_1267_2040 257
947 3300049571 Ga0501034_0105532 Ga0501034_0105532_850_1623 257
948 3300049572 Ga0501036_0000006 Ga0501036_0000006_84771_85544 257
949 3300049573 Ga0501037_0000123 Ga0501037_0000123_61627_62400 257
950 3300049573 Ga0501037_0216686 Ga0501037_0216686_103_876 257
951 3300049573 Ga0501037_0399294 Ga0501037_0399294_118_891 257
952 3300049574 Ga0501038_0000007 Ga0501038_0000007_156080_156853 257
953 3300049574 Ga0501038_0053007 Ga0501038_0053007_2329_3102 257
954 3300049575 Ga0501039_0000012 Ga0501039_0000012_84771_85544 257
955 3300049575 Ga0501039_0056821 Ga0501039_0056821_1272_2045 257
956 3300049579 Ga0501043_0000432 Ga0501043_0000432_2884_3657 257
957 3300049581 Ga0501047_0006781 Ga0501047_0006781_146_919 257
958 3300049581 Ga0501047_0208786 Ga0501047_0208786_913_1686 257
959 3300049581 Ga0501047_0269169 Ga0501047_0269169_601_1374 257
960 3300049586 Ga0501070_0088449 Ga0501070_0088449_1778_2551 257
961 3300049742 Ga0501080_0232322 Ga0501080_0232322_435_1208 257
962 3300049742 Ga0501080_0287736 Ga0501080_0287736_407_1180 257
963 3300049822 Ga0501035_0000035 Ga0501035_0000035_10064_10837 257
964 3300049822 Ga0501035_0050909 Ga0501035_0050909_1662_2435 257
965 3300049823 Ga0501044_0000015 Ga0501044_0000015_156080_156853 257
966 3300049823 Ga0501044_0123532 Ga0501044_0123532_1284_2057 257
967 3300050489 nmdc:mga03683_115566_c1 nmdc:mga03683_115566_c1_11_784 257
968 3300050491 nmdc:mga00v17_27134_c1 nmdc:mga00v17_27134_c1_775_1551 257
969 3300050491 nmdc:mga00v17_34327_c1 nmdc:mga00v17_34327_c1_38_811 257
970 3300050492 nmdc:mga0yw44_12498_c1 nmdc:mga0yw44_12498_c1_1952_2725 257
971 3300050494 nmdc:mga06z11_40958_c1 nmdc:mga06z11_40958_c1_393_1166 257
972 3300050495 nmdc:mga04h51_51523_c1 nmdc:mga04h51_51523_c1_260_1033 257
973 3300050496 nmdc:mga07m45_200415_c1 nmdc:mga07m45_200415_c1_216_989 257
974 3300050507 nmdc:mga05p37_482666_c1 nmdc:mga05p37_482666_c1_275_1048 257
975 3300050512 nmdc:mga0n895_315210_c1 nmdc:mga0n895_315210_c1_729_1502 257
976 3300050514 nmdc:mga08x19_33614_c2 nmdc:mga08x19_33614_c2_408_1184 257
977 3300053077 Ga0495601_0130936 Ga0495601_0130936_662_1435 257
978 3300053079 Ga0500610_0003882 Ga0500610_0003882_3348_4121 257
979 3300053085 Ga0495619_0053915 Ga0495619_0053915_626_1399 257
980 3300053104 Ga0500556_0106782 Ga0500556_0106782_280_1053 257
981 3300053119 Ga0500595_042899 Ga0500595_042899_250_1083 257
982 3300053125 Ga0500618_000506 Ga0500618_000506_1307_2089 257
983 3300053125 Ga0500618_011172 Ga0500618_011172_1256_2029 257
984 3300053134 Ga0500658_0008336 Ga0500658_0008336_1564_2337 257
985 3300053139 Ga0500568_0000090 Ga0500568_0000090_34110_34883 257
986 3300053139 Ga0500568_0000944 Ga0500568_0000944_17912_18685 257
987 3300053148 Ga0500590_000573 Ga0500590_000573_673_1446 257
988 3300053151 Ga0500604_0068583 Ga0500604_0068583_196_969 257
989 3300053151 Ga0500604_0072465 Ga0500604_0072465_131_904 257
990 3300053153 Ga0500616_0000503 Ga0500616_0000503_26395_27168 257
991 3300053153 Ga0500616_0015308 Ga0500616_0015308_1529_2302 257
992 3300053155 Ga0500620_004653 Ga0500620_004653_2141_2914 257
993 3300053155 Ga0500620_019571 Ga0500620_019571_230_1003 257
994 3300053158 Ga0500627_0024864 Ga0500627_0024864_251_1024 257
995 3300061734 Ga0530510_0281936 Ga0530510_0281936_346_1119 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

62

310

0.98

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

67

305

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h81-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis 0.9719 2 254
4fjw-assembly1.cif.gz_D crystal structure of the apo form of the e131q mtb crotonase 0.9679 1 252
3moy-assembly1.cif.gz_A crystal structure of probable enoyl-coa hydratase from mycobacterium smegmatis 0.9648 1 254
3h81-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis 0.9644 2 254
1dub-assembly1.cif.gz_A 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 0.9628 1 254
ID Description Score Start End Superfamily
af_P76082_198_255_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9946 199 254 1.10.12.10
4fjwE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9875 199 251 1.10.12.10
3h81B02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9873 199 252 1.10.12.10
3q0jB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9862 199 251 1.10.12.10
3q0jE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9859 199 251 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A5C7MZ08-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.983 70 254 GO:0004300
GO:0006635
AF-A0A1I6VMX7-F1-model_v4 Enoyl-CoA hydratase 0.9823 67 254 GO:0006635
GO:0016836
AF-A0A443RUL8-F1-model_v4 enoyl-CoA hydratase (EC 4.2.1.17) 0.9802 61 254 GO:0005739
GO:0006635
GO:0016836
AF-G5B246-F1-model_v4 Enoyl-CoA hydratase, mitochondrial (EC 4.2.1.17) (EC 5.3.3.8) (Enoyl-CoA hydratase 1) (Short-chain enoyl-CoA hydratase) 0.9802 67 254 GO:0005739
GO:0006635
GO:0016829
AF-A0A5Q0L4Y1-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9799 65 254 GO:0004300
GO:0006635

Feature Viewer

pLDDT pTM Quality
91.52 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map