F487764

General Info

Members Datasets Scaffolds Average Seq Length
995 602 783 316

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016557553|8016558702
Length 341
Sequence TPAPDSASIVSVTDRVKPVALGMGVTAVHFLGDRAAFVGGEENVAFVDGQGEISTVAVHSGGILSTASDGKRLVMGGDDGKVVSLDAKGAVTLLATDPKRRWIDAVALHPDGAYAWSAGKTAFVKSGKQEEKSIEVPSTVGGLAFAPKGLRLAIAHYNGATLWFPNMAASAEFLPWAGSHLGVTFSPDNKFLVTTMHESALHGWRLADNRHMRMTGYPGRVRSMSWSAGGKALATSGADTVILWPFASKDGPMGKEPAMLAPLQARVSVVACHPKNDIFAAGYSDGTVLMVRLEDGAEILVRRNGTLRPWLRSPGTPRGLCWRSQMKMGTAGFWSFKLLSF

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
18 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
23 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
24 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
25 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
26 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
27 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
28 2791355199
29 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
30 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
31 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
34 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
35 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
36 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
37 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
38 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
39 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
40 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
41 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
42 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
43 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
44 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
45 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
46 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
47 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
48 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
49 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
50 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
51 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
52 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
53 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
54 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
55 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
56 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
57 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
58 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
59 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
60 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
61 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
62 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
63 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
64 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
65 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
66 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
67 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
68 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
69 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
70 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
71 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
72 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
73 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
74 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
75 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
76 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
77 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
78 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
79 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
80 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
81 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
82 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
83 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
84 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
85 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
86 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
87 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
88 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
89 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
90 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
91 2904699407
92 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
93 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
94 2906610324
95 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
96 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
97 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
98 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
99 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
100 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
101 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
102 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
103 2922368715
104 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
105 2922425934
106 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
107 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
108 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
109 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
110 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
111 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
112 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
113 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
114 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
115 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
116 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
117 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
118 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
119 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
120 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
121 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
122 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
123 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
124 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
125 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
126 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
127 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
128 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
129 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
130 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
131 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
132 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
133 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
134 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
135 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
136 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
137 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
138 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
139 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
140 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
141 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
142 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
143 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
144 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
145 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
146 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
147 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
148 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
149 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
150 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
151 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
152 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
153 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
154 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
155 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
156 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
157 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
158 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
159 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
160 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
161 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
162 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
163 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
164 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
165 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
166 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
167 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
168 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
169 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
170 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
171 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
172 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
173 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
174 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
175 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
176 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
177 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
178 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
179 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
180 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
181 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
182 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
183 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
184 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
185 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
186 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
187 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
188 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
189 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
190 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
191 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
192 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
193 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
194 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
195 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
196 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
197 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
198 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
199 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
200 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
201 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
202 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
203 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
204 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
205 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
206 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
207 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
208 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
209 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
210 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
211 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
212 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
213 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
214 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
215 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
216 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
217 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
218 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
219 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
220 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
221 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
222 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
223 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
224 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
225 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
226 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
227 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
228 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
229 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
230 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
231 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
232 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
233 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
234 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
235 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
236 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
237 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
238 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
239 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
240 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
241 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
242 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
243 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
244 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
245 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
246 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
247 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
248 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
249 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
250 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
251 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
252 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
253 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
254 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
255 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
256 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
257 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
258 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
259 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
260 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
261 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
262 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
263 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
264 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
265 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
266 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
267 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
268 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
269 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
270 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
271 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
272 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
273 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
274 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
275 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
276 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
277 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
278 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
280 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
283 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
285 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
337 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
338 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
339 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
340 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
341 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
345 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
346 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
347 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
348 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
349 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
350 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
351 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
352 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
353 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
354 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
355 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
356 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
357 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
358 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
359 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
360 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
361 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
362 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
363 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
364 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
365 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
366 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
367 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
368 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
369 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
370 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
371 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
372 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
373 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
374 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
375 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
376 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
377 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
378 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
379 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
380 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
381 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
382 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
383 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
384 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
385 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
386 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
387 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
388 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
389 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
390 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
391 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
392 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
393 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
394 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
395 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
396 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
397 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
398 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
399 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
400 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
401 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
402 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
403 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
404 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
405 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
406 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
407 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
408 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
409 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
410 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
411 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
412 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
413 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
414 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
415 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
416 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
417 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
418 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
419 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
420 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
421 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
422 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
423 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
424 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
425 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
426 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
427 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
428 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
429 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
430 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
431 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
432 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
433 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
434 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
435 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
436 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
437 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
438 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
439 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
440 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
441 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
442 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
443 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
444 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
445 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
446 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
447 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
448 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
449 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
450 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
451 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
452 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
453 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
454 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
455 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
456 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
457 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
458 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
459 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
460 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
461 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
462 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
463 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
464 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
465 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
466 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
467 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
468 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
469 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
470 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
471 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
472 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
473 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
474 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
475 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
476 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
477 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
478 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
479 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
480 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
481 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
482 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
483 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
484 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
485 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
486 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
489 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
498 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
499 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
500 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
501 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
502 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
503 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
504 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
505 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
506 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
507 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
508 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
509 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
512 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
513 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
514 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
515 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
516 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
517 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
518 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
519 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
520 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
521 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
522 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
523 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
524 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
525 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
526 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
527 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
528 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
529 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
530 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
531 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
532 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
533 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
534 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
535 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
536 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
537 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
538 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
539 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
540 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
541 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
542 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
543 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
544 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
545 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
546 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
547 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
548 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
549 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
550 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
551 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
552 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
553 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
554 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
555 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
556 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
557 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
558 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
559 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
560 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
561 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
562 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
563 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
564 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
565 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
566 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
567 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
568 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
569 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
570 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
571 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
572 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
573 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
574 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
575 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
576 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
577 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
578 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
579 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
580 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
581 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
582 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
583 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
584 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
585 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
586 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
587 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
588 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
589 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
590 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
591 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
592 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
593 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
594 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
595 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
596 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
597 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
598 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
599 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
600 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
601 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
602 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.99
Metatranscriptomes 0.1
Isolates 20.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.26
Nodule 17.09
Rhizoplane 5.53
Rhizosphere 55.18
Stem 0
Stem Tuber 0
Unclassified 9.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005984 3300001979 Bacteria 5089
2 JGI24739J22299_10004386 3300001989 Bacteria 5402
3 JGI24737J22298_10015446 3300001990 Bacteria 2471
4 JGI25406J46586_10000123 3300003203 Bacteria 33753
5 JGI25406J46586_10002008 3300003203 Bacteria 9613
6 JGI25153J46596_10002285 3300003215 Bacteria 11162
7 JGI25153J46596_10005506 3300003215 Bacteria 6629
8 JGI25153J46596_10005817 3300003215 Bacteria 6409
9 JGI25160J50197_1005444 3300003354 Bacteria 5295
10 JGI25404J52841_10003298 3300003659 Bacteria 3173
11 Ga0055531_10021311 3300003794 Bacteria 2518
12 Ga0055543_1006286 3300004625 Bacteria 2898
13 Ga0065165_1003123 3300005262 Bacteria 12280
14 Ga0065165_1006880 3300005262 Bacteria 5780
15 Ga0065165_1010731 3300005262 Bacteria 3914
16 Ga0070658_10045091 3300005327 Bacteria 3564
17 Ga0070683_100057406 3300005329 Bacteria 3616
18 Ga0070690_100184592 3300005330 Bacteria 1442
19 Ga0070690_100190181 3300005330 Bacteria 1423
20 Ga0068869_100024807 3300005334 Bacteria 4156
21 Ga0070680_100102798 3300005336 Bacteria 2373
22 Ga0068868_100042173 3300005338 Bacteria 3559
23 Ga0068868_100043361 3300005338 Bacteria 3514
24 Ga0070660_100003353 3300005339 Bacteria 11009
25 Ga0070689_100073764 3300005340 Bacteria 2669
26 Ga0070689_100252738 3300005340 Bacteria 1455
27 Ga0070691_10009236 3300005341 Bacteria 4506
28 Ga0070661_100033003 3300005344 Bacteria 3750
29 Ga0070668_100098996 3300005347 Bacteria 2308
30 Ga0070668_100180384 3300005347 Bacteria 1724
31 Ga0070668_100359349 3300005347 Bacteria 1234
32 Ga0070668_100446215 3300005347 Bacteria 1111
33 Ga0070667_100087287 3300005367 Bacteria 2677
34 Ga0070667_100201256 3300005367 Bacteria 1767
35 Ga0070709_10005731 3300005434 Bacteria 6736
36 Ga0070709_10061536 3300005434 Bacteria 2390
37 Ga0070709_10201390 3300005434 Bacteria 1410
38 Ga0070714_100032179 3300005435 Bacteria 4377
39 Ga0070714_100094816 3300005435 Bacteria 2620
40 Ga0070714_100098779 3300005435 Bacteria 2568
41 Ga0070713_100024272 3300005436 Bacteria 4721
42 Ga0070713_100056432 3300005436 Bacteria 3267
43 Ga0070710_10007859 3300005437 Bacteria 5178
44 Ga0070711_100292297 3300005439 Bacteria 1293
45 Ga0070700_100032463 3300005441 Bacteria 3137
46 Ga0070708_100024114 3300005445 Bacteria 5182
47 Ga0070663_100014544 3300005455 Bacteria 5054
48 Ga0070663_100028930 3300005455 Bacteria 3779
49 Ga0070663_100070652 3300005455 Bacteria 2539
50 Ga0070663_100110754 3300005455 Bacteria 2062
51 Ga0070663_100161969 3300005455 Bacteria 1722
52 Ga0070678_100106000 3300005456 Bacteria 2189
53 Ga0070678_100145932 3300005456 Bacteria 1899
54 Ga0070681_10033490 3300005458 Bacteria 5158
55 Ga0070681_10043155 3300005458 Bacteria 4518
56 Ga0070681_10298396 3300005458 Bacteria 1521
57 Ga0068867_100114226 3300005459 Bacteria 2079
58 Ga0070706_100093394 3300005467 Bacteria 2792
59 Ga0070679_100012111 3300005530 Bacteria 8239
60 Ga0070679_100099831 3300005530 Bacteria 2890
61 Ga0070679_100106689 3300005530 Bacteria 2787
62 Ga0070679_100161305 3300005530 Bacteria 2216
63 Ga0070684_100006286 3300005535 Bacteria 9176
64 Ga0070684_100025288 3300005535 Bacteria 4989
65 Ga0070684_100122766 3300005535 Bacteria 2337
66 Ga0068853_100001496 3300005539 Bacteria 16976
67 Ga0068853_100134129 3300005539 Bacteria 2218
68 Ga0068853_100197741 3300005539 Bacteria 1829
69 Ga0070672_100113902 3300005543 Bacteria 2207
70 Ga0070672_100123570 3300005543 Bacteria 2121
71 Ga0070686_100022890 3300005544 Bacteria 3727
72 Ga0070665_100078725 3300005548 Bacteria 3303
73 Ga0070665_100118190 3300005548 Bacteria 2653
74 Ga0070665_100156929 3300005548 Bacteria 2277
75 Ga0070665_100157826 3300005548 Bacteria 2270
76 Ga0070665_100200236 3300005548 Bacteria 1997
77 Ga0070665_100470972 3300005548 Bacteria 1267
78 Ga0068855_100063917 3300005563 Bacteria 4293
79 Ga0068855_100066937 3300005563 Bacteria 4187
80 Ga0068855_100433287 3300005563 Bacteria 1437
81 Ga0070664_100233944 3300005564 Bacteria 1648
82 Ga0070664_100304479 3300005564 Bacteria 1441
83 Ga0068857_100004210 3300005577 Bacteria 12119
84 Ga0068857_100012909 3300005577 Bacteria 7278
85 Ga0068857_100056749 3300005577 Bacteria 3475
86 Ga0068857_100220946 3300005577 Bacteria 1731
87 Ga0068854_100008298 3300005578 Bacteria 6670
88 Ga0068854_100028729 3300005578 Bacteria 3845
89 Ga0068856_100006410 3300005614 Bacteria 11545
90 Ga0068856_100019463 3300005614 Bacteria 6589
91 Ga0068856_100025897 3300005614 Bacteria 5721
92 Ga0068852_100076214 3300005616 Bacteria 2960
93 Ga0068852_100081965 3300005616 Bacteria 2865
94 Ga0068852_100225411 3300005616 Bacteria 1784
95 Ga0068852_100256096 3300005616 Bacteria 1678
96 Ga0068864_100037084 3300005618 Bacteria 4158
97 Ga0068861_100072083 3300005719 Bacteria 2679
98 Ga0068861_100124194 3300005719 Bacteria 2086
99 Ga0068851_10005600 3300005834 Bacteria 5700
100 Ga0068870_10024112 3300005840 Bacteria 3009
101 Ga0068870_10065820 3300005840 Bacteria 1961
102 Ga0068858_100085735 3300005842 Bacteria 2930
103 Ga0068860_100003385 3300005843 Bacteria 16406
104 Ga0068860_100053426 3300005843 Bacteria 3841
105 Ga0068860_100087726 3300005843 Bacteria 2961
106 Ga0068860_100096524 3300005843 Bacteria 2817
107 Ga0068862_100122064 3300005844 Bacteria 2297
108 Ga0068862_100138897 3300005844 Bacteria 2155
109 Ga0068862_100146834 3300005844 Bacteria 2096
110 Ga0081455_10033441 3300005937 Bacteria 4621
111 Ga0081455_10047745 3300005937 Bacteria 3705
112 Ga0081455_10120966 3300005937 Bacteria 2063
113 Ga0081540_1005016 3300005983 Bacteria 9944
114 Ga0081540_1005788 3300005983 Bacteria 9148
115 Ga0081540_1013150 3300005983 Bacteria 5401
116 Ga0081540_1015887 3300005983 Bacteria 4745
117 Ga0081540_1016301 3300005983 Bacteria 4655
118 Ga0081540_1029678 3300005983 Bacteria 3042
119 Ga0081540_1050413 3300005983 Bacteria 2068
120 Ga0081539_10000425 3300005985 Bacteria 89942
121 Ga0081539_10001098 3300005985 Bacteria 49182
122 Ga0070717_10153473 3300006028 Bacteria 1994
123 Ga0075365_10045227 3300006038 Bacteria 2887
124 Ga0075368_10016457 3300006042 Bacteria 2756
125 Ga0075363_100010103 3300006048 Bacteria 4463
126 Ga0075363_100125860 3300006048 Bacteria 1435
127 Ga0075364_10038022 3300006051 Bacteria 3118
128 Ga0070715_10007812 3300006163 Bacteria 3697
129 Ga0070716_100010967 3300006173 Bacteria 4559
130 Ga0070716_100061025 3300006173 Bacteria 2180
131 Ga0075362_10072451 3300006177 Bacteria 1576
132 Ga0075362_10079776 3300006177 Bacteria 1507
133 Ga0075367_10126702 3300006178 Bacteria 1576
134 Ga0075369_10063613 3300006186 Bacteria 1614
135 Ga0075369_10104716 3300006186 Bacteria 1271
136 Ga0075366_10060813 3300006195 Bacteria 2244
137 Ga0075366_10068019 3300006195 Bacteria 2120
138 Ga0097621_100237098 3300006237 Bacteria 1594
139 Ga0068871_100052977 3300006358 Bacteria 3287
140 Ga0099822_1018262 3300006943 Bacteria 7332
141 Ga0099823_1029329 3300006944 Bacteria 4670
142 Ga0099794_10033678 3300007265 Bacteria 2409
143 Ga0105250_10083843 3300009092 Bacteria 1293
144 Ga0105240_10009125 3300009093 Bacteria 14079
145 Ga0105240_10019788 3300009093 Bacteria 8990
146 Ga0105240_10027761 3300009093 Bacteria 7408
147 Ga0105240_10046064 3300009093 Bacteria 5528
148 Ga0105240_10084839 3300009093 Bacteria 3882
149 Ga0105240_10095537 3300009093 Bacteria 3624
150 Ga0105240_10261557 3300009093 Bacteria 1996
151 Ga0105245_10034045 3300009098 Bacteria 4516
152 Ga0105245_10053806 3300009098 Bacteria 3614
153 Ga0105245_10493903 3300009098 Bacteria 1239
154 Ga0105245_10545733 3300009098 Bacteria 1181
155 Ga0105243_10275452 3300009148 Bacteria 1513
156 Ga0105241_10015112 3300009174 Bacteria 5655
157 Ga0105241_10047557 3300009174 Bacteria 3262
158 Ga0105241_10106672 3300009174 Bacteria 2236
159 Ga0105241_10278267 3300009174 Bacteria 1428
160 Ga0105242_10173029 3300009176 Bacteria 1899
161 Ga0105248_10155290 3300009177 Bacteria 2582
162 Ga0105248_10226148 3300009177 Bacteria 2106
163 Ga0105248_10310941 3300009177 Bacteria 1774
164 Ga0105237_10008895 3300009545 Bacteria 10820
165 Ga0105237_10018559 3300009545 Bacteria 7197
166 Ga0105237_10100467 3300009545 Bacteria 2884
167 Ga0105237_10389635 3300009545 Bacteria 1398
168 Ga0105237_10397622 3300009545 Bacteria 1383
169 Ga0105238_10026375 3300009551 Bacteria 5924
170 Ga0105238_10041248 3300009551 Bacteria 4675
171 Ga0105249_10087482 3300009553 Bacteria 2907
172 Ga0099796_10047241 3300010159 Bacteria 1481
173 Ga0105239_10008167 3300010375 Bacteria 11943
174 Ga0105239_10063897 3300010375 Bacteria 4041
175 Ga0105239_10079757 3300010375 Bacteria 3602
176 Ga0105239_10081869 3300010375 Bacteria 3553
177 Ga0105239_10227474 3300010375 Bacteria 2093
178 Ga0105239_10229212 3300010375 Bacteria 2084
179 Ga0105239_10335332 3300010375 Bacteria 1706
180 Ga0105246_10012004 3300011119 Bacteria 5394
181 Ga0157370_10215213 3300013104 Bacteria 1780
182 Ga0157369_10031661 3300013105 Bacteria 5821
183 Ga0157369_10047829 3300013105 Bacteria 4642
184 Ga0157369_10091731 3300013105 Bacteria 3242
185 Ga0157369_10160062 3300013105 Bacteria 2376
186 Ga0157369_10175210 3300013105 Bacteria 2258
187 Ga0157374_10061812 3300013296 Bacteria 3509
188 Ga0157374_10353160 3300013296 Bacteria 1461
189 Ga0157378_10073096 3300013297 Bacteria 3082
190 Ga0157378_10177625 3300013297 Bacteria 2001
191 Ga0163162_10020348 3300013306 Bacteria 6519
192 Ga0157372_10327651 3300013307 Bacteria 1783
193 Ga0157375_10047373 3300013308 Bacteria 4198
194 Ga0157375_10801243 3300013308 Bacteria 1091
195 Ga0163163_10248535 3300014325 Bacteria 1829
196 Ga0163163_10295461 3300014325 Bacteria 1672
197 Ga0163163_10579047 3300014325 Bacteria 1185
198 Ga0157380_10230938 3300014326 Bacteria 1662
199 Ga0157376_10018726 3300014969 Bacteria 5318
200 Ga0157376_10120672 3300014969 Bacteria 2323
201 Ga0163161_10223764 3300017792 Bacteria 1458
202 Ga0206356_10561849 3300020070 Bacteria 2527
203 Ga0214544_1000011 3300021320 Bacteria 262952
204 Ga0214542_1000009 3300021321 Bacteria 262861
205 Ga0214542_1024107 3300021321 Bacteria 3474
206 Ga0214545_1000007 3300021324 Bacteria 262984
207 Ga0214545_1021600 3300021324 Bacteria 4771
208 Ga0214543_1000020 3300021327 Bacteria 262861
209 Ga0214543_1028960 3300021327 Bacteria 2544
210 Ga0209148_1000707 3300025254 Bacteria 26803
211 Ga0209148_1006688 3300025254 Bacteria 2472
212 Ga0209233_1001624 3300025261 Bacteria 8741
213 Ga0209455_1004030 3300025272 Bacteria 4969
214 Ga0209455_1011648 3300025272 Bacteria 2152
215 Ga0209564_1009335 3300025295 Bacteria 4684
216 Ga0209758_1000106 3300025297 Bacteria 218450
217 Ga0209758_1002009 3300025297 Bacteria 21878
218 Ga0209758_1002765 3300025297 Bacteria 17179
219 Ga0209758_1003053 3300025297 Bacteria 15935
220 Ga0209758_1006390 3300025297 Bacteria 8493
221 Ga0209758_1026073 3300025297 Bacteria 2543
222 Ga0209758_1027003 3300025297 Bacteria 2467
223 Ga0209758_1033325 3300025297 Bacteria 2071
224 Ga0209256_1004898 3300025299 Bacteria 8041
225 Ga0209256_1024707 3300025299 Bacteria 1764
226 Ga0207426_1000337 3300025302 Bacteria 88200
227 Ga0207426_1009208 3300025302 Bacteria 3925
228 Ga0207426_1027419 3300025302 Bacteria 1898
229 Ga0209051_1032436 3300025303 Bacteria 1993
230 Ga0209257_1000684 3300025304 Bacteria 52769
231 Ga0207656_10009458 3300025321 Bacteria 3621
232 Ga0207692_10026043 3300025898 Bacteria 2740
233 Ga0207688_10037217 3300025901 Bacteria 2698
234 Ga0207647_10009009 3300025904 Bacteria 7112
235 Ga0207647_10038569 3300025904 Bacteria 3019
236 Ga0207699_10003881 3300025906 Bacteria 7143
237 Ga0207699_10118520 3300025906 Bacteria 1708
238 Ga0207699_10152168 3300025906 Bacteria 1532
239 Ga0207643_10023699 3300025908 Bacteria 3386
240 Ga0207684_10133431 3300025910 Bacteria 2131
241 Ga0207654_10000811 3300025911 Bacteria 17219
242 Ga0207654_10019681 3300025911 Bacteria 3568
243 Ga0207707_10001933 3300025912 Bacteria 18846
244 Ga0207707_10012323 3300025912 Bacteria 7431
245 Ga0207707_10028406 3300025912 Bacteria 4889
246 Ga0207707_10102500 3300025912 Bacteria 2502
247 Ga0207707_10119914 3300025912 Bacteria 2299
248 Ga0207695_10000478 3300025913 Bacteria 86076
249 Ga0207695_10036803 3300025913 Bacteria 5286
250 Ga0207695_10056295 3300025913 Bacteria 4093
251 Ga0207695_10070144 3300025913 Bacteria 3584
252 Ga0207695_10134917 3300025913 Bacteria 2422
253 Ga0207671_10032007 3300025914 Bacteria 3916
254 Ga0207671_10042721 3300025914 Bacteria 3355
255 Ga0207671_10089412 3300025914 Bacteria 2318
256 Ga0207693_10003096 3300025915 Bacteria 14328
257 Ga0207693_10020323 3300025915 Bacteria 5283
258 Ga0207663_10001112 3300025916 Bacteria 12359
259 Ga0207663_10012363 3300025916 Bacteria 4614
260 Ga0207663_10239084 3300025916 Bacteria 1331
261 Ga0207660_10009206 3300025917 Bacteria 6389
262 Ga0207660_10076411 3300025917 Bacteria 2449
263 Ga0207657_10012730 3300025919 Bacteria 8285
264 Ga0207657_10017675 3300025919 Bacteria 6833
265 Ga0207649_10021842 3300025920 Bacteria 3692
266 Ga0207649_10063456 3300025920 Bacteria 2332
267 Ga0207652_10198229 3300025921 Bacteria 1807
268 Ga0207694_10001415 3300025924 Bacteria 20567
269 Ga0207694_10126400 3300025924 Bacteria 2046
270 Ga0207687_10027005 3300025927 Bacteria 3848
271 Ga0207700_10059772 3300025928 Bacteria 2884
272 Ga0207700_10242362 3300025928 Bacteria 1537
273 Ga0207700_10315270 3300025928 Bacteria 1354
274 Ga0207664_10260461 3300025929 Bacteria 1517
275 Ga0207644_10059354 3300025931 Bacteria 2767
276 Ga0207644_10060900 3300025931 Bacteria 2732
277 Ga0207644_10062417 3300025931 Bacteria 2703
278 Ga0207690_10067493 3300025932 Bacteria 2453
279 Ga0207706_10044185 3300025933 Bacteria 3950
280 Ga0207706_10146531 3300025933 Bacteria 2077
281 Ga0207706_10303410 3300025933 Bacteria 1391
282 Ga0207686_10056769 3300025934 Bacteria 2462
283 Ga0207665_10000703 3300025939 Bacteria 22673
284 Ga0207711_10064333 3300025941 Bacteria 3168
285 Ga0207711_10100776 3300025941 Bacteria 2555
286 Ga0207711_10104563 3300025941 Bacteria 2509
287 Ga0207689_10099354 3300025942 Bacteria 2391
288 Ga0207661_10000171 3300025944 Bacteria 41708
289 Ga0207679_10084259 3300025945 Bacteria 2439
290 Ga0207667_10011741 3300025949 Bacteria 10158
291 Ga0207667_10013826 3300025949 Bacteria 9221
292 Ga0207667_10046090 3300025949 Bacteria 4616
293 Ga0207667_10115820 3300025949 Bacteria 2762
294 Ga0207667_10216123 3300025949 Bacteria 1964
295 Ga0207667_10305414 3300025949 Bacteria 1625
296 Ga0207651_10087242 3300025960 Bacteria 2271
297 Ga0207712_10131292 3300025961 Bacteria 1909
298 Ga0207668_10037794 3300025972 Bacteria 3234
299 Ga0207668_10058342 3300025972 Bacteria 2697
300 Ga0207668_10133717 3300025972 Bacteria 1897
301 Ga0207640_10098749 3300025981 Bacteria 2042
302 Ga0207640_10149654 3300025981 Bacteria 1713
303 Ga0207640_10195880 3300025981 Bacteria 1527
304 Ga0207658_10082202 3300025986 Bacteria 2473
305 Ga0207658_10107001 3300025986 Bacteria 2203
306 Ga0207677_10029675 3300026023 Bacteria 3480
307 Ga0207677_10078745 3300026023 Bacteria 2354
308 Ga0207703_10014325 3300026035 Bacteria 6185
309 Ga0207639_10052277 3300026041 Bacteria 3113
310 Ga0207639_10092227 3300026041 Bacteria 2427
311 Ga0207639_10107568 3300026041 Bacteria 2266
312 Ga0207639_10190846 3300026041 Bacteria 1750
313 Ga0207639_10398623 3300026041 Bacteria 1239
314 Ga0207678_10014592 3300026067 Bacteria 6914
315 Ga0207678_10027004 3300026067 Bacteria 5006
316 Ga0207678_10027182 3300026067 Bacteria 4990
317 Ga0207678_10041915 3300026067 Bacteria 3968
318 Ga0207708_10028467 3300026075 Bacteria 4231
319 Ga0207708_10102817 3300026075 Bacteria 2212
320 Ga0207702_10000003 3300026078 Bacteria 434196
321 Ga0207702_10000014 3300026078 Bacteria 253304
322 Ga0207702_10252439 3300026078 Bacteria 1657
323 Ga0207641_10112364 3300026088 Bacteria 2417
324 Ga0207648_10023386 3300026089 Bacteria 5536
325 Ga0207648_10151941 3300026089 Bacteria 2043
326 Ga0207676_10036319 3300026095 Bacteria 3747
327 Ga0207674_10004961 3300026116 Bacteria 15902
328 Ga0207674_10009035 3300026116 Bacteria 11446
329 Ga0207674_10044466 3300026116 Bacteria 4574
330 Ga0207674_10129128 3300026116 Bacteria 2492
331 Ga0207675_100024290 3300026118 Bacteria 5636
332 Ga0207675_100107005 3300026118 Bacteria 2637
333 Ga0207675_100171275 3300026118 Bacteria 2075
334 Ga0207675_100354476 3300026118 Bacteria 1438
335 Ga0207683_10014788 3300026121 Bacteria 6643
336 Ga0207683_10113791 3300026121 Bacteria 2424
337 Ga0207698_10059209 3300026142 Bacteria 2973
338 Ga0209389_1000016 3300027296 Bacteria 184844
339 Ga0209589_1000005 3300027357 Bacteria 530958
340 Ga0209489_100005 3300027361 Bacteria 530958
341 Ga0209489_100063 3300027361 Bacteria 144408
342 Ga0209700_100006 3300027363 Bacteria 530958
343 Ga0209700_100012 3300027363 Bacteria 357892
344 Ga0209813_10065617 3300027866 Bacteria 1169
345 Ga0268266_10004322 3300028379 Bacteria 13666
346 Ga0268266_10006723 3300028379 Bacteria 10484
347 Ga0268266_10020674 3300028379 Bacteria 5610
348 Ga0268266_10038251 3300028379 Bacteria 4086
349 Ga0268266_10157354 3300028379 Bacteria 2053
350 Ga0268266_10168492 3300028379 Bacteria 1986
351 Ga0268265_10050871 3300028380 Bacteria 3124
352 Ga0268265_10156107 3300028380 Bacteria 1931
353 Ga0268264_10000042 3300028381 Bacteria 372069
354 Ga0307515_10240563 3300028794 Bacteria 1582
355 Ga0265330_10036743 3300031235 Bacteria 2182
356 Ga0265316_10200092 3300031344 Bacteria 1481
357 Ga0307509_10006260 3300031507 Bacteria 16085
358 Ga0265313_10032460 3300031595 Bacteria 2666
359 Ga0265314_10022030 3300031711 Bacteria 4886
360 Ga0265342_10013040 3300031712 Bacteria 5600
361 Ga0307516_10282320 3300031730 Bacteria 1342
362 Ga0307416_100209239 3300032002 Bacteria 1859
363 Ga0307507_10051819 3300033179 Bacteria 3944
364 Ga0307510_10007708 3300033180 Bacteria 12837
365 Ga0307510_10015767 3300033180 Bacteria 8935
366 Ga0307510_10079377 3300033180 Bacteria 3201
367 Ga0373929_0015395 3300035085 Bacteria 1487
368 Ga0373934_0004936 3300035086 Bacteria 4940
369 Ga0373923_0018906 3300035111 Bacteria 2660
370 Ga0373923_0023254 3300035111 Bacteria 2437
371 Ga0373936_0053549 3300035113 Bacteria 1636
372 Ga0373945_0031078 3300035116 Bacteria 1885
373 Ga0373953_0017673 3300035117 Bacteria 2626
374 Ga0373954_0002374 3300035118 Bacteria 7874
375 Ga0373954_0011969 3300035118 Bacteria 3853
376 Ga0373954_0025175 3300035118 Bacteria 2718
377 Ga0373956_0011847 3300035119 Bacteria 3602
378 Ga0373956_0019983 3300035119 Bacteria 2844
379 Ga0373957_0008219 3300035120 Bacteria 3371
380 Ga0373943_0003127 3300035170 Bacteria 7525
381 Ga0373946_0003423 3300035171 Bacteria 5632
382 Ga0373955_0000590 3300035172 Bacteria 15443
383 Ga0373955_0070318 3300035172 Bacteria 1955
384 Ga0373924_0017284 3300035410 Bacteria 2765
385 Ga0373924_0049834 3300035410 Bacteria 1733
386 Ga0373931_0023347 3300035691 Bacteria 3121
387 Ga0373935_0000569 3300035692 Bacteria 19226
388 Ga0373935_0020182 3300035692 Bacteria 4068
389 Ga0373927_0008338 3300035695 Bacteria 6977
390 Ga0373927_0016947 3300035695 Bacteria 4801
391 Ga0373933_0000180 3300035724 Bacteria 41838
392 Ga0373933_0116885 3300035724 Bacteria 1667
393 Ga0373947_0005868 3300035725 Bacteria 7152
394 Ga0373947_0085749 3300035725 Bacteria 1956
395 Ga0373947_0090542 3300035725 Bacteria 1907
396 Ga0373937_0014626 3300036401 Bacteria 6930
397 Ga0373937_0053457 3300036401 Bacteria 3705
398 Ga0373937_0224225 3300036401 Bacteria 1769
399 Ga0373925_0030197 3300037068 Bacteria 3977
400 Ga0395899_0193077 3300037312 Bacteria 1424
401 Ga0395900_0000753 3300037418 Bacteria 43021
402 Ga0395900_0011126 3300037418 Bacteria 9197
403 Ga0395900_0034589 3300037418 Bacteria 5205
404 Ga0395900_0079769 3300037418 Bacteria 3364
405 Ga0395898_0005579 3300037466 Bacteria 13568
406 Ga0395898_0029509 3300037466 Bacteria 5494
407 Ga0395898_0090869 3300037466 Bacteria 2938
408 Ga0395898_0297732 3300037466 Bacteria 1539
409 Ga0395898_0398421 3300037466 Bacteria 1312
410 Ga0395905_0006649 3300037471 Bacteria 11595
411 Ga0395905_0057052 3300037471 Bacteria 3652
412 Ga0395905_0058930 3300037471 Bacteria 3590
413 Ga0395905_0531533 3300037471 Bacteria 1077
414 Ga0436364_0683264 3300037853 Bacteria 5939
415 Ga0395901_0063621 3300038443 Bacteria 3840
416 Ga0395901_0293763 3300038443 Bacteria 1686
417 Ga0395901_0372305 3300038443 Bacteria 1471
418 Ga0436365_0966326 3300039437 Bacteria 1075
419 Ga0436365_1737269 3300039437 Bacteria 3029
420 Ga0466972_0000771 3300044658 Bacteria 15229
421 Ga0466972_0003626 3300044658 Bacteria 7673
422 Ga0466965_0033173 3300044683 Bacteria 2523
423 Ga0466966_0000720 3300044684 Bacteria 20983
424 Ga0466961_0000136 3300044693 Bacteria 49049
425 Ga0466961_0031967 3300044693 Bacteria 3382
426 Ga0466963_0082772 3300044694 Bacteria 2176
427 Ga0466968_0106163 3300044735 Bacteria 1259
428 Ga0466957_0080681 3300044842 Bacteria 2026
429 Ga0466957_0090965 3300044842 Bacteria 1912
430 Ga0466960_0056191 3300044901 Bacteria 1915
431 Ga0466959_0036415 3300045049 Bacteria 3636
432 Ga0466959_0084671 3300045049 Bacteria 2282
433 Ga0466967_0195562 3300045976 Bacteria 1913
434 Ga0466967_0198779 3300045976 Bacteria 1898
435 Ga0466967_0303482 3300045976 Bacteria 1536
436 Ga0495592_0007391 3300046454 Bacteria 8221
437 Ga0495592_0074009 3300046454 Bacteria 2475
438 Ga0495603_0003935 3300046455 Bacteria 8851
439 Ga0495603_0009958 3300046455 Bacteria 5753
440 Ga0495603_0017918 3300046455 Bacteria 4286
441 Ga0495603_0033395 3300046455 Bacteria 3096
442 Ga0495603_0150103 3300046455 Bacteria 1354
443 Ga0495629_0020427 3300046459 Bacteria 4730
444 Ga0495629_0127125 3300046459 Bacteria 1776
445 Ga0495629_0180633 3300046459 Bacteria 1462
446 Ga0495638_0025345 3300046460 Bacteria 3856
447 Ga0495638_0040365 3300046460 Bacteria 2957
448 Ga0495638_0063301 3300046460 Bacteria 2281
449 Ga0495638_0138305 3300046460 Bacteria 1424
450 Ga0495641_0001899 3300046461 Bacteria 17063
451 Ga0495641_0054881 3300046461 Bacteria 1810
452 Ga0495651_0009620 3300046462 Bacteria 7427
453 Ga0495651_0015465 3300046462 Bacteria 5903
454 Ga0495651_0086272 3300046462 Bacteria 2362
455 Ga0495653_0017260 3300046463 Bacteria 5871
456 Ga0495650_0025642 3300046471 Bacteria 2758
457 Ga0495580_0001711 3300046472 Bacteria 19280
458 Ga0495639_0000278 3300046475 Bacteria 25216
459 Ga0495639_0034245 3300046475 Bacteria 2271
460 Ga0495639_0050147 3300046475 Bacteria 1895
461 Ga0495639_0202392 3300046475 Bacteria 972
462 Ga0495662_0000176 3300046476 Bacteria 25547
463 Ga0495664_0018996 3300046477 Bacteria 3947
464 Ga0495585_0081204 3300046492 Bacteria 1756
465 Ga0495594_0000541 3300046499 Bacteria 19378
466 Ga0495594_0033984 3300046499 Bacteria 2773
467 Ga0495583_0036700 3300046506 Bacteria 2329
468 Ga0495606_0001686 3300046507 Bacteria 28531
469 Ga0495606_0012721 3300046507 Bacteria 6710
470 Ga0495606_0121016 3300046507 Bacteria 1567
471 Ga0495606_0195499 3300046507 Bacteria 1156
472 Ga0495610_0026186 3300046512 Bacteria 3118
473 Ga0495616_0054583 3300046513 Bacteria 1981
474 Ga0495618_0023387 3300046514 Bacteria 3820
475 Ga0495628_0011834 3300046516 Bacteria 7362
476 Ga0495628_0023752 3300046516 Bacteria 5027
477 Ga0495628_0065962 3300046516 Bacteria 2830
478 Ga0495630_0001818 3300046517 Bacteria 14885
479 Ga0495630_0020042 3300046517 Bacteria 4925
480 Ga0495631_0022621 3300046518 Bacteria 2922
481 Ga0495632_0061326 3300046519 Bacteria 1825
482 Ga0495632_0112496 3300046519 Bacteria 1277
483 Ga0495648_0032593 3300046524 Bacteria 3416
484 Ga0495652_0033670 3300046529 Bacteria 4470
485 Ga0495652_0059010 3300046529 Bacteria 3248
486 Ga0495652_0074271 3300046529 Bacteria 2828
487 Ga0495652_0103100 3300046529 Bacteria 2310
488 Ga0495652_0203805 3300046529 Bacteria 1499
489 Ga0495654_0012179 3300046530 Bacteria 4627
490 Ga0495665_0000408 3300046531 Bacteria 21924
491 Ga0495665_0011452 3300046531 Bacteria 4801
492 Ga0495665_0067781 3300046531 Bacteria 1882
493 Ga0495640_0004065 3300046533 Bacteria 11705
494 Ga0495640_0009547 3300046533 Bacteria 7547
495 Ga0495640_0085620 3300046533 Bacteria 2088
496 Ga0495587_0020833 3300046536 Bacteria 4044
497 Ga0495587_0027506 3300046536 Bacteria 3462
498 Ga0495598_0012059 3300046537 Bacteria 2110
499 Ga0495609_0053461 3300046538 Bacteria 1795
500 Ga0495645_0009133 3300046543 Bacteria 6926
501 Ga0495645_0012251 3300046543 Bacteria 6038
502 Ga0495622_0003183 3300046557 Bacteria 7774
503 Ga0495622_0006001 3300046557 Bacteria 5644
504 Ga0495622_0099733 3300046557 Bacteria 1331
505 Ga0495633_0043207 3300046558 Bacteria 2138
506 Ga0495667_0184912 3300046559 Bacteria 1336
507 Ga0495634_0009077 3300046642 Bacteria 7348
508 Ga0495634_0009379 3300046642 Bacteria 7219
509 Ga0495634_0040856 3300046642 Bacteria 3152
510 Ga0495634_0098163 3300046642 Bacteria 1895
511 Ga0495611_0015440 3300046648 Bacteria 3265
512 Ga0495611_0071429 3300046648 Bacteria 1587
513 Ga0495625_0025144 3300046660 Bacteria 4519
514 Ga0495625_0039854 3300046660 Bacteria 3428
515 Ga0495635_0000883 3300046663 Bacteria 19679
516 Ga0495635_0007423 3300046663 Bacteria 7651
517 Ga0495635_0012284 3300046663 Bacteria 5998
518 Ga0495635_0048233 3300046663 Bacteria 2936
519 Ga0495659_0005390 3300046664 Bacteria 4024
520 Ga0495588_0003776 3300046674 Bacteria 6633
521 Ga0495588_0004335 3300046674 Bacteria 6264
522 Ga0495657_0016949 3300046675 Bacteria 5295
523 Ga0495657_0032336 3300046675 Bacteria 3651
524 Ga0495599_0019799 3300046678 Bacteria 4191
525 Ga0495599_0094368 3300046678 Bacteria 1866
526 Ga0495623_0021928 3300046679 Bacteria 4125
527 Ga0495623_0046004 3300046679 Bacteria 2770
528 Ga0495623_0103645 3300046679 Bacteria 1731
529 Ga0495646_0027329 3300046680 Bacteria 3580
530 Ga0495646_0030420 3300046680 Bacteria 3372
531 Ga0495646_0037301 3300046680 Bacteria 3007
532 Ga0495647_0000226 3300046681 Bacteria 15317
533 Ga0495647_0004771 3300046681 Bacteria 4426
534 Ga0495658_0000706 3300046683 Bacteria 18090
535 Ga0495658_0007799 3300046683 Bacteria 5299
536 Ga0495669_0021018 3300046684 Bacteria 2829
537 Ga0495613_0009812 3300046689 Bacteria 7119
538 Ga0495613_0054949 3300046689 Bacteria 2927
539 Ga0495613_0095134 3300046689 Bacteria 2155
540 Ga0495624_0154543 3300046690 Bacteria 1402
541 Ga0495670_0022116 3300046691 Bacteria 3139
542 Ga0495670_0076468 3300046691 Bacteria 1701
543 Ga0495671_0048737 3300046692 Bacteria 2113
544 Ga0495671_0071576 3300046692 Bacteria 1703
545 Ga0495600_0009246 3300046809 Bacteria 6080
546 Ga0495600_0031062 3300046809 Bacteria 3459
547 Ga0495600_0087194 3300046809 Bacteria 2036
548 Ga0495581_0036754 3300047315 Bacteria 2833
549 Ga0495581_0076665 3300047315 Bacteria 1934
550 Ga0495604_0006128 3300047317 Bacteria 9545
551 Ga0495604_0012219 3300047317 Bacteria 6825
552 Ga0495604_0121938 3300047317 Bacteria 1886
553 Ga0495674_0012843 3300047319 Bacteria 7887
554 Ga0495674_0021071 3300047319 Bacteria 6031
555 Ga0495674_0044585 3300047319 Bacteria 3942
556 Ga0495672_0005618 3300047320 Bacteria 9900
557 Ga0495676_0049592 3300047321 Bacteria 3374
558 Ga0495676_0061379 3300047321 Bacteria 2940
559 Ga0495676_0086399 3300047321 Bacteria 2360
560 Ga0495676_0094531 3300047321 Bacteria 2226
561 Ga0495680_0001053 3300047322 Bacteria 30524
562 Ga0495680_0014448 3300047322 Bacteria 6836
563 Ga0495683_0034104 3300047323 Bacteria 2589
564 Ga0495683_0115123 3300047323 Bacteria 1280
565 Ga0495687_016734 3300047443 Bacteria 3679
566 Ga0495675_0025183 3300047444 Bacteria 3794
567 Ga0495675_0063400 3300047444 Bacteria 2338
568 Ga0495681_0035311 3300047470 Bacteria 2483
569 Ga0495684_0010341 3300047471 Bacteria 7218
570 Ga0495684_0033570 3300047471 Bacteria 3935
571 Ga0495686_0068329 3300047472 Bacteria 2192
572 Ga0495593_0000577 3300047673 Bacteria 20839
573 Ga0495593_0101011 3300047673 Bacteria 1479
574 Ga0495602_0021411 3300048088 Bacteria 6366
575 Ga0495602_0022373 3300048088 Bacteria 6189
576 Ga0495602_0091137 3300048088 Bacteria 2529
577 Ga0495614_0027034 3300048089 Bacteria 2474
578 Ga0495626_0029655 3300048091 Bacteria 2646
579 Ga0496100_0012991 3300048903 Bacteria 4792
580 Ga0496100_0040457 3300048903 Bacteria 2966
581 Ga0496100_0079166 3300048903 Bacteria 2214
582 Ga0496101_0003670 3300048904 Bacteria 9579
583 Ga0496102_0001403 3300048905 Bacteria 21391
584 Ga0496102_0110271 3300048905 Bacteria 2565
585 Ga0496102_0145378 3300048905 Bacteria 2225
586 Ga0496102_0200208 3300048905 Bacteria 1882
587 Ga0496102_0443208 3300048905 Bacteria 1218
588 Ga0496103_0125206 3300048906 Bacteria 1639
589 Ga0496104_0014912 3300048907 Bacteria 7025
590 Ga0496104_0040280 3300048907 Bacteria 4378
591 Ga0496104_0257886 3300048907 Bacteria 1656
592 Ga0496104_0315126 3300048907 Bacteria 1477
593 Ga0496105_0011923 3300048908 Bacteria 6883
594 Ga0496105_0021566 3300048908 Bacteria 5213
595 Ga0496106_0001280 3300048909 Bacteria 18862
596 Ga0496106_0004321 3300048909 Bacteria 10554
597 Ga0496106_0016844 3300048909 Bacteria 5408
598 Ga0496107_0010991 3300048910 Bacteria 6298
599 Ga0496107_0030436 3300048910 Bacteria 3847
600 Ga0496107_0062087 3300048910 Bacteria 2707
601 Ga0496107_0084277 3300048910 Bacteria 2319
602 Ga0496108_0003585 3300048911 Bacteria 12437
603 Ga0496108_0029044 3300048911 Bacteria 4576
604 Ga0496108_0031333 3300048911 Bacteria 4412
605 Ga0496108_0033841 3300048911 Bacteria 4245
606 Ga0496108_0075641 3300048911 Bacteria 2845
607 Ga0496108_0198374 3300048911 Bacteria 1741
608 Ga0496109_0004298 3300048912 Bacteria 11898
609 Ga0496109_0008714 3300048912 Bacteria 8637
610 Ga0496109_0133419 3300048912 Bacteria 2319
611 Ga0496110_0014905 3300048913 Bacteria 6460
612 Ga0496110_0024685 3300048913 Bacteria 5127
613 Ga0496111_0004711 3300048914 Bacteria 8653
614 Ga0496111_0074598 3300048914 Bacteria 2471
615 Ga0496112_0003249 3300048915 Bacteria 13400
616 Ga0496112_0036649 3300048915 Bacteria 4785
617 Ga0496112_0067706 3300048915 Bacteria 3524
618 Ga0496112_0130452 3300048915 Bacteria 2484
619 Ga0496112_0192923 3300048915 Bacteria 1998
620 Ga0496112_0303741 3300048915 Bacteria 1541
621 Ga0496112_0331134 3300048915 Bacteria 1466
622 Ga0496112_0384956 3300048915 Bacteria 1343
623 Ga0496113_0002516 3300048916 Bacteria 10686
624 Ga0496113_0051848 3300048916 Bacteria 3062
625 Ga0496114_0115675 3300048917 Bacteria 2301
626 Ga0496115_0004202 3300048918 Bacteria 10415
627 Ga0496115_0067943 3300048918 Bacteria 2884
628 Ga0496115_0142345 3300048918 Bacteria 1979
629 Ga0496115_0190535 3300048918 Bacteria 1694
630 Ga0496115_0197445 3300048918 Bacteria 1662
631 Ga0496115_0214663 3300048918 Bacteria 1589
632 Ga0496115_0290972 3300048918 Bacteria 1340
633 Ga0496118_0001458 3300048921 Bacteria 35562
634 Ga0496118_0016977 3300048921 Bacteria 6648
635 Ga0496118_0081875 3300048921 Bacteria 2264
636 Ga0496118_0229203 3300048921 Bacteria 1074
637 Ga0496119_0020246 3300048922 Bacteria 4859
638 Ga0496119_0061303 3300048922 Bacteria 2247
639 Ga0496119_0112489 3300048922 Bacteria 1509
640 Ga0496119_0113241 3300048922 Bacteria 1502
641 Ga0496121_0000146 3300048924 Bacteria 154459
642 Ga0496121_0000254 3300048924 Bacteria 113314
643 Ga0496121_0001525 3300048924 Bacteria 38839
644 Ga0496121_0005728 3300048924 Bacteria 15775
645 Ga0496121_0009157 3300048924 Bacteria 11444
646 Ga0496121_0031994 3300048924 Bacteria 4793
647 Ga0496121_0113447 3300048924 Bacteria 2062
648 Ga0496121_0196722 3300048924 Bacteria 1440
649 Ga0496122_0050993 3300048925 Bacteria 3150
650 Ga0496123_0142924 3300048926 Bacteria 1305
651 Ga0496124_0002217 3300048927 Bacteria 25870
652 Ga0496124_0119790 3300048927 Bacteria 2105
653 Ga0496124_0124045 3300048927 Bacteria 2060
654 Ga0496125_0009421 3300048928 Bacteria 10037
655 Ga0496125_0179214 3300048928 Bacteria 1414
656 Ga0496125_0197245 3300048928 Bacteria 1322
657 Ga0496126_0003212 3300048929 Bacteria 20945
658 Ga0496126_0004243 3300048929 Bacteria 17254
659 Ga0496126_0011968 3300048929 Bacteria 8917
660 Ga0496126_0012455 3300048929 Bacteria 8710
661 Ga0496126_0023765 3300048929 Bacteria 5934
662 Ga0496126_0055536 3300048929 Bacteria 3583
663 Ga0496126_0100238 3300048929 Bacteria 2535
664 Ga0496126_0224630 3300048929 Bacteria 1576
665 Ga0496126_0255361 3300048929 Bacteria 1459
666 Ga0496126_0312858 3300048929 Bacteria 1292
667 Ga0495682_0006817 3300049460 Bacteria 4599
668 Ga0501031_0000451 3300049568 Bacteria 23790
669 Ga0501032_0000196 3300049569 Bacteria 50261
670 Ga0501033_0001104 3300049570 Bacteria 24475
671 Ga0501034_0001151 3300049571 Bacteria 36663
672 Ga0501036_0000323 3300049572 Bacteria 33256
673 Ga0501037_0001204 3300049573 Bacteria 19110
674 Ga0501038_0002973 3300049574 Bacteria 15796
675 Ga0501039_0000705 3300049575 Bacteria 24064
676 Ga0501043_0000409 3300049579 Bacteria 38657
677 Ga0501043_0129674 3300049579 Bacteria 1976
678 Ga0501046_0000181 3300049580 Bacteria 64035
679 Ga0501047_0000419 3300049581 Bacteria 47535
680 Ga0501047_0094940 3300049581 Bacteria 2861
681 Ga0501048_0000057 3300049582 Bacteria 56138
682 Ga0501067_0000145 3300049583 Bacteria 39277
683 Ga0501068_0001512 3300049584 Bacteria 12380
684 Ga0501069_0016839 3300049585 Bacteria 3927
685 Ga0501070_0022615 3300049586 Bacteria 5264
686 Ga0501071_0014762 3300049587 Bacteria 5347
687 Ga0501072_0000643 3300049588 Bacteria 25050
688 Ga0501073_0000027 3300049589 Bacteria 121860
689 Ga0501074_0000081 3300049590 Bacteria 46487
690 Ga0501079_0003647 3300049741 Bacteria 11342
691 Ga0501080_0000883 3300049742 Bacteria 24535
692 Ga0501083_0010910 3300049744 Bacteria 6390
693 Ga0501035_0003158 3300049822 Bacteria 15827
694 Ga0501044_0001511 3300049823 Bacteria 27265
695 Ga0501045_0132444 3300049824 Bacteria 1853
696 nmdc:mga00v17_36841_c1 3300050491 Bacteria 2918
697 nmdc:mga0yw44_20681_c1 3300050492 Bacteria 3657
698 nmdc:mga0yw44_223246_c1 3300050492 Bacteria 1249
699 nmdc:mga0yw44_55244_c1 3300050492 Bacteria 2416
700 nmdc:mga0yw44_62945_c1 3300050492 Bacteria 2280
701 nmdc:mga0yw44_72265_c1 3300050492 Bacteria 2144
702 nmdc:mga06z11_138426_c1 3300050494 Bacteria 1374
703 nmdc:mga04h51_84883_c1 3300050495 Bacteria 1130
704 nmdc:mga07m45_20736_c1 3300050496 Bacteria 3572
705 nmdc:mga07m45_24087_c1 3300050496 Bacteria 3332
706 nmdc:mga07m45_32628_c1 3300050496 Bacteria 2137
707 nmdc:mga05p37_188753_c1 3300050507 Bacteria 2504
708 nmdc:mga09592_457659_c1 3300050508 Bacteria 1100
709 nmdc:mga0n895_136704_c1 3300050512 Bacteria 2477
710 nmdc:mga0sz30_27845_c1 3300050516 Bacteria 1737
711 Ga0495601_0062415 3300053077 Bacteria 2367
712 Ga0495601_0111788 3300053077 Bacteria 1769
713 Ga0495612_0037631 3300053078 Bacteria 1965
714 Ga0495619_0124370 3300053085 Bacteria 1769
715 Ga0500578_0165010 3300053086 Bacteria 1372
716 Ga0500643_000052 3300053087 Bacteria 144656
717 Ga0500643_046803 3300053087 Bacteria 1248
718 Ga0500581_061300 3300053089 Bacteria 1905
719 Ga0500647_0008273 3300053091 Bacteria 4511
720 Ga0500651_0046771 3300053093 Bacteria 2721
721 Ga0500651_0091596 3300053093 Bacteria 1871
722 Ga0500566_0000113 3300053094 Bacteria 41467
723 Ga0500566_0003433 3300053094 Bacteria 9443
724 Ga0500566_0009055 3300053094 Bacteria 5888
725 Ga0500640_000015 3300053095 Bacteria 25262
726 Ga0500641_0001161 3300053096 Bacteria 9380
727 Ga0500648_101140 3300053097 Bacteria 1603
728 Ga0500650_0025530 3300053098 Bacteria 2642
729 Ga0500554_010459 3300053102 Bacteria 2262
730 Ga0500555_001634 3300053103 Bacteria 6773
731 Ga0500556_0000035 3300053104 Bacteria 145357
732 Ga0500557_000303 3300053105 Bacteria 6656
733 Ga0500572_000335 3300053111 Bacteria 16881
734 Ga0500572_003927 3300053111 Bacteria 3380
735 Ga0500591_019919 3300053115 Bacteria 3252
736 Ga0500592_002069 3300053116 Bacteria 3233
737 Ga0500594_0009707 3300053118 Bacteria 2221
738 Ga0500595_000728 3300053119 Bacteria 19571
739 Ga0500595_019443 3300053119 Bacteria 2464
740 Ga0500595_020188 3300053119 Bacteria 2403
741 Ga0500607_032891 3300053121 Bacteria 2845
742 Ga0500608_000269 3300053122 Bacteria 20074
743 Ga0500614_003851 3300053123 Bacteria 3208
744 Ga0500642_0000027 3300053130 Bacteria 119688
745 Ga0500642_0023426 3300053130 Bacteria 2479
746 Ga0500559_0000064 3300053136 Bacteria 85844
747 Ga0500559_0002132 3300053136 Bacteria 10535
748 Ga0500559_0003196 3300053136 Bacteria 8145
749 Ga0500559_0007573 3300053136 Bacteria 4799
750 Ga0500568_0000443 3300053139 Bacteria 31089
751 Ga0500568_0019363 3300053139 Bacteria 2960
752 Ga0500573_0025041 3300053140 Bacteria 3431
753 Ga0500577_0011003 3300053142 Bacteria 2685
754 Ga0500603_000592 3300053150 Bacteria 9035
755 Ga0500603_040978 3300053150 Bacteria 1235
756 Ga0500604_0006983 3300053151 Bacteria 2989
757 Ga0500604_0012112 3300053151 Bacteria 2325
758 Ga0500616_0000054 3300053153 Bacteria 290186
759 Ga0500622_0003640 3300053156 Bacteria 10132
760 Ga0500622_0012122 3300053156 Bacteria 4678
761 Ga0500630_004643 3300053159 Bacteria 6679
762 Ga0500638_002418 3300053162 Bacteria 6494
763 Ga0500638_042194 3300053162 Bacteria 2215
764 Ga0500639_000050 3300053163 Bacteria 54136
765 Ga0500639_048884 3300053163 Bacteria 2208
766 Ga0500639_059399 3300053163 Bacteria 1974
767 Ga0500636_0000232 3300053177 Bacteria 30484
768 Ga0500636_0001203 3300053177 Bacteria 13970
769 Ga0500636_0006221 3300053177 Bacteria 6850
770 Ga0500637_0000080 3300053178 Bacteria 34464
771 Ga0500637_0029751 3300053178 Bacteria 3032
772 Ga0500576_029821 3300053725 Bacteria 2483
773 Ga0500625_008952 3300053729 Bacteria 4448
774 Ga0500645_004073 3300053730 Bacteria 5727
775 Ga0500645_053820 3300053730 Bacteria 1171
776 Ga0500596_000478 3300053735 Bacteria 7480
777 Ga0500596_001927 3300053735 Bacteria 4162
778 Ga0500596_002066 3300053735 Bacteria 4000
779 Ga0500601_000108 3300053737 Bacteria 17177
780 Ga0500601_002207 3300053737 Bacteria 2092
781 Ga0500661_000271 3300055283 Bacteria 9372
782 Ga0501082_0004691 3300060353 Bacteria 11916
783 Ga0501082_0239300 3300060353 Bacteria 1580

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0180633 Ga0495629_0180633_17_958 256
2 3300046559 Ga0495667_0184912 Ga0495667_0184912_378_1319 260
3 3300009176 Ga0105242_10173029 Ga0105242_101730292 261
4 3300009545 Ga0105237_10389635 Ga0105237_103896351 261
5 3300025931 Ga0207644_10059354 Ga0207644_100593542 261
6 3300035085 Ga0373929_0015395 Ga0373929_0015395_272_1288 261
7 3300035691 Ga0373931_0023347 Ga0373931_0023347_1746_2762 261
8 3300048907 Ga0496104_0257886 Ga0496104_0257886_409_1425 261
9 3300048915 Ga0496112_0067706 Ga0496112_0067706_229_1245 261
10 3300025297 Ga0209758_1006390 Ga0209758_10063904 262
11 3300025927 Ga0207687_10027005 Ga0207687_100270051 262
12 3300045976 Ga0466967_0195562 Ga0466967_0195562_507_1523 263
13 3300047320 Ga0495672_0005618 Ga0495672_0005618_3269_4285 264
14 3300048910 Ga0496107_0030436 Ga0496107_0030436_1228_2244 265
15 3300048916 Ga0496113_0051848 Ga0496113_0051848_1424_2440 265
16 3300046642 Ga0495634_0040856 Ga0495634_0040856_255_1226 266
17 3300013308 Ga0157375_10801243 Ga0157375_108012431 267
18 3300005344 Ga0070661_100033003 Ga0070661_1000330035 269
19 3300005539 Ga0068853_100197741 Ga0068853_1001977412 269
20 3300025920 Ga0207649_10063456 Ga0207649_100634563 269
21 3300025924 Ga0207694_10126400 Ga0207694_101264002 269
22 3300025941 Ga0207711_10064333 Ga0207711_100643332 269
23 3300025981 Ga0207640_10195880 Ga0207640_101958802 269
24 3300026041 Ga0207639_10092227 Ga0207639_100922273 269
25 3300005329 Ga0070683_100057406 Ga0070683_1000574063 270
26 3300005336 Ga0070680_100102798 Ga0070680_1001027983 270
27 3300013105 Ga0157369_10031661 Ga0157369_100316612 270
28 3300013105 Ga0157369_10160062 Ga0157369_101600623 270
29 3300013307 Ga0157372_10327651 Ga0157372_103276512 270
30 3300026116 Ga0207674_10129128 Ga0207674_101291282 270
31 3300005458 Ga0070681_10043155 Ga0070681_100431555 271
32 3300005530 Ga0070679_100161305 Ga0070679_1001613053 271
33 3300005535 Ga0070684_100122766 Ga0070684_1001227662 271
34 3300005843 Ga0068860_100003385 Ga0068860_10000338513 271
35 3300025912 Ga0207707_10028406 Ga0207707_100284067 271
36 3300028381 Ga0268264_10000042 Ga0268264_1000004218 271
37 3300013296 Ga0157374_10353160 Ga0157374_103531601 272
38 3300053163 Ga0500639_048884 Ga0500639_048884_1032_2051 272
39 3300053735 Ga0500596_002066 Ga0500596_002066_381_1400 272
40 3300005548 Ga0070665_100200236 Ga0070665_1002002362 273
41 3300026089 Ga0207648_10023386 Ga0207648_100233866 273
42 3300028379 Ga0268266_10157354 Ga0268266_101573542 273
43 3300053111 Ga0500572_000335 Ga0500572_000335_4491_5510 275
44 3300053136 Ga0500559_0003196 Ga0500559_0003196_2508_3527 275
45 3300053725 Ga0500576_029821 Ga0500576_029821_646_1665 275
46 3300046459 Ga0495629_0127125 Ga0495629_0127125_606_1622 276
47 3300046507 Ga0495606_0195499 Ga0495606_0195499_39_1055 276
48 iso_pu_bacteria 8016583857 8016587662 276
49 3300047470 Ga0495681_0035311 Ga0495681_0035311_305_1321 277
50 3300048915 Ga0496112_0036649 Ga0496112_0036649_3332_4348 277
51 3300017792 Ga0163161_10223764 Ga0163161_102237642 278
52 3300001989 JGI24739J22299_10004386 JGI24739J22299_100043867 279
53 3300001990 JGI24737J22298_10015446 JGI24737J22298_100154461 279
54 3300004625 Ga0055543_1006286 Ga0055543_10062864 279
55 3300005262 Ga0065165_1003123 Ga0065165_10031239 279
56 3300005347 Ga0070668_100359349 Ga0070668_1003593492 279
57 3300005459 Ga0068867_100114226 Ga0068867_1001142262 279
58 3300005539 Ga0068853_100134129 Ga0068853_1001341292 279
59 3300005548 Ga0070665_100118190 Ga0070665_1001181903 279
60 3300005577 Ga0068857_100056749 Ga0068857_1000567491 279
61 3300005577 Ga0068857_100220946 Ga0068857_1002209462 279
62 3300005578 Ga0068854_100008298 Ga0068854_1000082982 279
63 3300005614 Ga0068856_100019463 Ga0068856_1000194632 279
64 3300005616 Ga0068852_100076214 Ga0068852_1000762141 279
65 3300006048 Ga0075363_100010103 Ga0075363_1000101035 279
66 3300006195 Ga0075366_10068019 Ga0075366_100680192 279
67 3300009093 Ga0105240_10095537 Ga0105240_100955374 279
68 3300009098 Ga0105245_10053806 Ga0105245_100538064 279
69 3300009148 Ga0105243_10275452 Ga0105243_102754521 279
70 3300009177 Ga0105248_10226148 Ga0105248_102261482 279
71 3300010375 Ga0105239_10335332 Ga0105239_103353322 279
72 3300025297 Ga0209758_1026073 Ga0209758_10260733 279
73 3300025299 Ga0209256_1024707 Ga0209256_10247072 279
74 3300025904 Ga0207647_10009009 Ga0207647_100090099 279
75 3300025904 Ga0207647_10038569 Ga0207647_100385691 279
76 3300025931 Ga0207644_10060900 Ga0207644_100609004 279
77 3300025949 Ga0207667_10115820 Ga0207667_101158202 279
78 3300026041 Ga0207639_10107568 Ga0207639_101075682 279
79 3300026078 Ga0207702_10252439 Ga0207702_102524392 279
80 3300026089 Ga0207648_10151941 Ga0207648_101519412 279
81 3300026116 Ga0207674_10044466 Ga0207674_100444664 279
82 3300026142 Ga0207698_10059209 Ga0207698_100592091 279
83 3300046471 Ga0495650_0025642 Ga0495650_0025642_59_1078 279
84 3300046507 Ga0495606_0121016 Ga0495606_0121016_457_1476 279
85 3300046513 Ga0495616_0054583 Ga0495616_0054583_571_1590 279
86 3300046519 Ga0495632_0112496 Ga0495632_0112496_175_1140 279
87 3300046557 Ga0495622_0099733 Ga0495622_0099733_148_1167 279
88 3300046648 Ga0495611_0015440 Ga0495611_0015440_1933_2952 279
89 3300046674 Ga0495588_0003776 Ga0495588_0003776_4678_5697 279
90 3300047321 Ga0495676_0094531 Ga0495676_0094531_1018_2037 279
91 3300047443 Ga0495687_016734 Ga0495687_016734_319_1338 279
92 3300048091 Ga0495626_0029655 Ga0495626_0029655_316_1335 279
93 3300048903 Ga0496100_0012991 Ga0496100_0012991_2728_3747 279
94 3300048911 Ga0496108_0198374 Ga0496108_0198374_241_1260 279
95 3300048915 Ga0496112_0384956 Ga0496112_0384956_66_1085 279
96 3300048918 Ga0496115_0190535 Ga0496115_0190535_609_1628 279
97 3300048921 Ga0496118_0081875 Ga0496118_0081875_1171_2190 279
98 3300048922 Ga0496119_0113241 Ga0496119_0113241_223_1242 279
99 3300048924 Ga0496121_0005728 Ga0496121_0005728_13544_14563 279
100 3300050496 nmdc:mga07m45_24087_c1 nmdc:mga07m45_24087_c1_1693_2712 279
101 3300005347 Ga0070668_100446215 Ga0070668_1004462151 280
102 3300005441 Ga0070700_100032463 Ga0070700_1000324633 280
103 3300005455 Ga0070663_100028930 Ga0070663_1000289303 280
104 3300005456 Ga0070678_100145932 Ga0070678_1001459321 280
105 3300005543 Ga0070672_100123570 Ga0070672_1001235702 280
106 3300005544 Ga0070686_100022890 Ga0070686_1000228904 280
107 3300005548 Ga0070665_100078725 Ga0070665_1000787252 280
108 3300005564 Ga0070664_100304479 Ga0070664_1003044792 280
109 3300005719 Ga0068861_100124194 Ga0068861_1001241942 280
110 3300005843 Ga0068860_100053426 Ga0068860_1000534261 280
111 3300009177 Ga0105248_10310941 Ga0105248_103109412 280
112 3300010375 Ga0105239_10081869 Ga0105239_100818692 280
113 3300013296 Ga0157374_10061812 Ga0157374_100618122 280
114 3300013297 Ga0157378_10177625 Ga0157378_101776252 280
115 3300025297 Ga0209758_1033325 Ga0209758_10333252 280
116 3300025933 Ga0207706_10303410 Ga0207706_103034102 280
117 3300025934 Ga0207686_10056769 Ga0207686_100567692 280
118 3300025941 Ga0207711_10100776 Ga0207711_101007763 280
119 3300026023 Ga0207677_10029675 Ga0207677_100296753 280
120 3300026067 Ga0207678_10014592 Ga0207678_100145925 280
121 3300026075 Ga0207708_10028467 Ga0207708_100284674 280
122 3300028379 Ga0268266_10038251 Ga0268266_100382512 280
123 3300039437 Ga0436365_0966326 Ga0436365_0966326_41_1060 280
124 3300046475 Ga0495639_0202392 Ga0495639_0202392_28_954 280
125 3300046684 Ga0495669_0021018 Ga0495669_0021018_733_1752 280
126 3300048903 Ga0496100_0079166 Ga0496100_0079166_759_1778 280
127 3300048904 Ga0496101_0003670 Ga0496101_0003670_3961_4977 280
128 3300048905 Ga0496102_0001403 Ga0496102_0001403_7092_8108 280
129 3300048908 Ga0496105_0011923 Ga0496105_0011923_147_1163 280
130 3300048913 Ga0496110_0014905 Ga0496110_0014905_309_1325 280
131 3300048914 Ga0496111_0004711 Ga0496111_0004711_591_1607 280
132 3300048915 Ga0496112_0192923 Ga0496112_0192923_726_1745 280
133 3300048918 Ga0496115_0004202 Ga0496115_0004202_6749_7765 280
134 3300005262 Ga0065165_1006880 Ga0065165_10068802 281
135 3300009093 Ga0105240_10027761 Ga0105240_100277611 281
136 3300009098 Ga0105245_10545733 Ga0105245_105457331 281
137 3300009545 Ga0105237_10018559 Ga0105237_100185593 281
138 3300010375 Ga0105239_10227474 Ga0105239_102274742 281
139 3300025254 Ga0209148_1000707 Ga0209148_10007077 281
140 3300025261 Ga0209233_1001624 Ga0209233_10016249 281
141 3300025272 Ga0209455_1004030 Ga0209455_10040302 281
142 3300025302 Ga0207426_1009208 Ga0207426_10092082 281
143 3300025302 Ga0207426_1027419 Ga0207426_10274192 281
144 3300025901 Ga0207688_10037217 Ga0207688_100372172 281
145 3300025913 Ga0207695_10000478 Ga0207695_1000047817 281
146 3300025914 Ga0207671_10042721 Ga0207671_100427212 281
147 3300025933 Ga0207706_10044185 Ga0207706_100441853 281
148 3300037418 Ga0395900_0079769 Ga0395900_0079769_1033_2052 281
149 3300037466 Ga0395898_0090869 Ga0395898_0090869_103_1122 281
150 3300037471 Ga0395905_0057052 Ga0395905_0057052_1884_2903 281
151 3300044684 Ga0466966_0000720 Ga0466966_0000720_9593_10612 281
152 3300044693 Ga0466961_0000136 Ga0466961_0000136_25167_26186 281
153 3300046460 Ga0495638_0040365 Ga0495638_0040365_220_1239 281
154 3300046506 Ga0495583_0036700 Ga0495583_0036700_133_1152 281
155 3300046507 Ga0495606_0012721 Ga0495606_0012721_3710_4729 281
156 3300046524 Ga0495648_0032593 Ga0495648_0032593_360_1379 281
157 3300046529 Ga0495652_0203805 Ga0495652_0203805_163_1182 281
158 3300046557 Ga0495622_0006001 Ga0495622_0006001_1110_2129 281
159 3300046660 Ga0495625_0025144 Ga0495625_0025144_977_1996 281
160 3300046663 Ga0495635_0012284 Ga0495635_0012284_752_1771 281
161 3300046689 Ga0495613_0095134 Ga0495613_0095134_691_1710 281
162 3300046690 Ga0495624_0154543 Ga0495624_0154543_56_1075 281
163 3300046692 Ga0495671_0048737 Ga0495671_0048737_940_1959 281
164 3300046809 Ga0495600_0009246 Ga0495600_0009246_376_1395 281
165 3300047317 Ga0495604_0006128 Ga0495604_0006128_3670_4689 281
166 3300047323 Ga0495683_0034104 Ga0495683_0034104_1432_2451 281
167 3300047444 Ga0495675_0025183 Ga0495675_0025183_2481_3500 281
168 3300047472 Ga0495686_0068329 Ga0495686_0068329_303_1322 281
169 3300048088 Ga0495602_0021411 Ga0495602_0021411_4277_5296 281
170 3300048089 Ga0495614_0027034 Ga0495614_0027034_487_1506 281
171 3300048905 Ga0496102_0110271 Ga0496102_0110271_930_1946 281
172 3300048907 Ga0496104_0014912 Ga0496104_0014912_5403_6422 281
173 3300048908 Ga0496105_0021566 Ga0496105_0021566_317_1336 281
174 3300048921 Ga0496118_0229203 Ga0496118_0229203_37_1056 281
175 3300048922 Ga0496119_0020246 Ga0496119_0020246_3531_4550 281
176 3300048927 Ga0496124_0119790 Ga0496124_0119790_356_1375 281
177 3300048928 Ga0496125_0197245 Ga0496125_0197245_293_1312 281
178 3300049460 Ga0495682_0006817 Ga0495682_0006817_2588_3607 281
179 3300049579 Ga0501043_0129674 Ga0501043_0129674_667_1686 281
180 3300049581 Ga0501047_0094940 Ga0501047_0094940_695_1714 281
181 3300050508 nmdc:mga09592_457659_c1 nmdc:mga09592_457659_c1_32_973 281
182 3300053119 Ga0500595_020188 Ga0500595_020188_183_1202 281
183 3300053151 Ga0500604_0012112 Ga0500604_0012112_991_2010 281
184 3300053156 Ga0500622_0012122 Ga0500622_0012122_3560_4579 281
185 3300053730 Ga0500645_053820 Ga0500645_053820_97_1116 281
186 3300053737 Ga0500601_000108 Ga0500601_000108_14867_15886 281
187 iso_pu_bacteria 8019629233 8019638177 281
188 3300005338 Ga0068868_100042173 Ga0068868_1000421733 282
189 3300005455 Ga0070663_100110754 Ga0070663_1001107543 282
190 3300009174 Ga0105241_10106672 Ga0105241_101066721 282
191 3300013306 Ga0163162_10020348 Ga0163162_100203482 282
192 3300014325 Ga0163163_10248535 Ga0163163_102485352 282
193 3300025932 Ga0207690_10067493 Ga0207690_100674933 282
194 3300025933 Ga0207706_10146531 Ga0207706_101465312 282
195 3300025986 Ga0207658_10082202 Ga0207658_100822023 282
196 3300026118 Ga0207675_100024290 Ga0207675_1000242906 282
197 3300046454 Ga0495592_0074009 Ga0495592_0074009_595_1614 282
198 3300046462 Ga0495651_0015465 Ga0495651_0015465_1927_2946 282
199 3300046477 Ga0495664_0018996 Ga0495664_0018996_304_1323 282
200 3300046516 Ga0495628_0023752 Ga0495628_0023752_3859_4878 282
201 3300046529 Ga0495652_0074271 Ga0495652_0074271_1668_2687 282
202 3300046533 Ga0495640_0085620 Ga0495640_0085620_115_1134 282
203 3300046536 Ga0495587_0020833 Ga0495587_0020833_1521_2540 282
204 3300046537 Ga0495598_0012059 Ga0495598_0012059_559_1575 282
205 3300046543 Ga0495645_0012251 Ga0495645_0012251_4381_5400 282
206 3300046648 Ga0495611_0071429 Ga0495611_0071429_337_1353 282
207 3300046663 Ga0495635_0048233 Ga0495635_0048233_1679_2698 282
208 3300046675 Ga0495657_0032336 Ga0495657_0032336_2104_3123 282
209 3300046678 Ga0495599_0094368 Ga0495599_0094368_517_1536 282
210 3300046679 Ga0495623_0046004 Ga0495623_0046004_165_1184 282
211 3300046680 Ga0495646_0027329 Ga0495646_0027329_2533_3552 282
212 3300046689 Ga0495613_0054949 Ga0495613_0054949_352_1371 282
213 3300046809 Ga0495600_0087194 Ga0495600_0087194_559_1578 282
214 3300047317 Ga0495604_0012219 Ga0495604_0012219_4686_5705 282
215 3300047319 Ga0495674_0044585 Ga0495674_0044585_898_1917 282
216 3300047322 Ga0495680_0001053 Ga0495680_0001053_6194_7213 282
217 3300047673 Ga0495593_0101011 Ga0495593_0101011_115_1134 282
218 3300048088 Ga0495602_0022373 Ga0495602_0022373_1281_2300 282
219 3300048907 Ga0496104_0040280 Ga0496104_0040280_1115_2131 282
220 3300048909 Ga0496106_0016844 Ga0496106_0016844_245_1261 282
221 3300048910 Ga0496107_0010991 Ga0496107_0010991_5109_6125 282
222 3300048911 Ga0496108_0029044 Ga0496108_0029044_2286_3302 282
223 3300048912 Ga0496109_0008714 Ga0496109_0008714_1812_2828 282
224 3300048915 Ga0496112_0130452 Ga0496112_0130452_413_1429 282
225 3300048917 Ga0496114_0115675 Ga0496114_0115675_1055_2071 282
226 3300048918 Ga0496115_0290972 Ga0496115_0290972_106_1125 282
227 3300048926 Ga0496123_0142924 Ga0496123_0142924_35_1054 282
228 3300048929 Ga0496126_0012455 Ga0496126_0012455_5786_6805 282
229 3300053094 Ga0500566_0009055 Ga0500566_0009055_3896_4915 282
230 3300053119 Ga0500595_019443 Ga0500595_019443_233_1249 282
231 3300005455 Ga0070663_100070652 Ga0070663_1000706523 283
232 3300046692 Ga0495671_0071576 Ga0495671_0071576_200_1216 283
233 3300047321 Ga0495676_0061379 Ga0495676_0061379_1036_2055 283
234 3300025960 Ga0207651_10087242 Ga0207651_100872422 284
235 3300048911 Ga0496108_0031333 Ga0496108_0031333_2029_3048 284
236 3300005347 Ga0070668_100180384 Ga0070668_1001803842 285
237 3300005530 Ga0070679_100012111 Ga0070679_1000121111 285
238 3300005563 Ga0068855_100066937 Ga0068855_1000669375 285
239 3300009093 Ga0105240_10084839 Ga0105240_100848393 285
240 3300014326 Ga0157380_10230938 Ga0157380_102309382 285
241 3300025912 Ga0207707_10119914 Ga0207707_101199142 285
242 3300025913 Ga0207695_10056295 Ga0207695_100562955 285
243 3300025921 Ga0207652_10198229 Ga0207652_101982292 285
244 3300025949 Ga0207667_10046090 Ga0207667_100460902 285
245 3300025972 Ga0207668_10133717 Ga0207668_101337172 285
246 3300026041 Ga0207639_10052277 Ga0207639_100522773 285
247 3300026118 Ga0207675_100354476 Ga0207675_1003544762 285
248 3300005330 Ga0070690_100184592 Ga0070690_1001845922 286
249 3300005340 Ga0070689_100252738 Ga0070689_1002527382 286
250 3300005456 Ga0070678_100106000 Ga0070678_1001060002 286
251 3300005840 Ga0068870_10065820 Ga0068870_100658203 286
252 3300025931 Ga0207644_10062417 Ga0207644_100624173 286
253 3300025961 Ga0207712_10131292 Ga0207712_101312923 286
254 3300026121 Ga0207683_10113791 Ga0207683_101137912 286
255 3300037418 Ga0395900_0000753 Ga0395900_0000753_36778_37797 286
256 3300037466 Ga0395898_0005579 Ga0395898_0005579_818_1837 286
257 3300038443 Ga0395901_0063621 Ga0395901_0063621_98_1117 286
258 3300003215 JGI25153J46596_10005817 JGI25153J46596_100058172 287
259 3300005334 Ga0068869_100024807 Ga0068869_1000248074 287
260 3300005937 Ga0081455_10120966 Ga0081455_101209662 287
261 3300009545 Ga0105237_10100467 Ga0105237_101004671 287
262 3300025297 Ga0209758_1002765 Ga0209758_100276513 287
263 3300048927 Ga0496124_0124045 Ga0496124_0124045_124_1140 287
264 3300053177 Ga0500636_0000232 Ga0500636_0000232_23061_24080 287
265 3300003215 JGI25153J46596_10005506 JGI25153J46596_100055062 288
266 3300006943 Ga0099822_1018262 Ga0099822_10182622 288
267 3300025297 Ga0209758_1003053 Ga0209758_10030539 288
268 3300027357 Ga0209589_1000005 Ga0209589_1000005309 288
269 3300027361 Ga0209489_100005 Ga0209489_100005309 288
270 3300027363 Ga0209700_100006 Ga0209700_100006309 288
271 3300033180 Ga0307510_10015767 Ga0307510_100157675 288
272 3300037471 Ga0395905_0006649 Ga0395905_0006649_4951_5970 288
273 3300038443 Ga0395901_0293763 Ga0395901_0293763_104_1123 288
274 3300046455 Ga0495603_0017918 Ga0495603_0017918_1006_2022 288
275 3300046461 Ga0495641_0054881 Ga0495641_0054881_172_1188 288
276 3300046660 Ga0495625_0039854 Ga0495625_0039854_361_1365 288
277 3300048918 Ga0496115_0197445 Ga0496115_0197445_74_1090 288
278 3300003215 JGI25153J46596_10002285 JGI25153J46596_1000228510 289
279 3300003794 Ga0055531_10021311 Ga0055531_100213112 289
280 3300005434 Ga0070709_10061536 Ga0070709_100615362 289
281 3300009098 Ga0105245_10493903 Ga0105245_104939032 289
282 3300025295 Ga0209564_1009335 Ga0209564_10093355 289
283 3300025297 Ga0209758_1000106 Ga0209758_1000106159 289
284 3300025303 Ga0209051_1032436 Ga0209051_10324362 289
285 3300025304 Ga0209257_1000684 Ga0209257_100068427 289
286 3300025906 Ga0207699_10003881 Ga0207699_100038812 289
287 3300037466 Ga0395898_0398421 Ga0395898_0398421_182_1198 289
288 3300037471 Ga0395905_0058930 Ga0395905_0058930_2303_3319 289
289 3300038443 Ga0395901_0372305 Ga0395901_0372305_71_1087 289
290 3300053086 Ga0500578_0165010 Ga0500578_0165010_282_1301 289
291 3300025299 Ga0209256_1004898 Ga0209256_10048982 290
292 3300044901 Ga0466960_0056191 Ga0466960_0056191_492_1511 290
293 3300046507 Ga0495606_0001686 Ga0495606_0001686_9784_10791 290
294 3300048906 Ga0496103_0125206 Ga0496103_0125206_231_1250 290
295 3300053729 Ga0500625_008952 Ga0500625_008952_2771_3790 290
296 3300053730 Ga0500645_004073 Ga0500645_004073_2537_3553 290
297 3300005330 Ga0070690_100190181 Ga0070690_1001901812 291
298 3300005347 Ga0070668_100098996 Ga0070668_1000989962 291
299 3300005548 Ga0070665_100157826 Ga0070665_1001578262 291
300 3300005563 Ga0068855_100063917 Ga0068855_1000639174 291
301 3300005564 Ga0070664_100233944 Ga0070664_1002339442 291
302 3300005614 Ga0068856_100025897 Ga0068856_1000258975 291
303 3300005618 Ga0068864_100037084 Ga0068864_1000370842 291
304 3300005719 Ga0068861_100072083 Ga0068861_1000720832 291
305 3300005840 Ga0068870_10024112 Ga0068870_100241123 291
306 3300005843 Ga0068860_100087726 Ga0068860_1000877262 291
307 3300005844 Ga0068862_100122064 Ga0068862_1001220642 291
308 3300006042 Ga0075368_10016457 Ga0075368_100164573 291
309 3300006051 Ga0075364_10038022 Ga0075364_100380223 291
310 3300006178 Ga0075367_10126702 Ga0075367_101267022 291
311 3300006186 Ga0075369_10104716 Ga0075369_101047162 291
312 3300006237 Ga0097621_100237098 Ga0097621_1002370981 291
313 3300009098 Ga0105245_10034045 Ga0105245_100340452 291
314 3300009174 Ga0105241_10047557 Ga0105241_100475572 291
315 3300009177 Ga0105248_10155290 Ga0105248_101552902 291
316 3300010375 Ga0105239_10229212 Ga0105239_102292122 291
317 3300011119 Ga0105246_10012004 Ga0105246_100120043 291
318 3300013297 Ga0157378_10073096 Ga0157378_100730962 291
319 3300025908 Ga0207643_10023699 Ga0207643_100236992 291
320 3300025911 Ga0207654_10019681 Ga0207654_100196813 291
321 3300025920 Ga0207649_10021842 Ga0207649_100218424 291
322 3300025941 Ga0207711_10104563 Ga0207711_101045632 291
323 3300025945 Ga0207679_10084259 Ga0207679_100842593 291
324 3300025949 Ga0207667_10216123 Ga0207667_102161232 291
325 3300025972 Ga0207668_10037794 Ga0207668_100377943 291
326 3300025981 Ga0207640_10098749 Ga0207640_100987494 291
327 3300026023 Ga0207677_10078745 Ga0207677_100787452 291
328 3300026035 Ga0207703_10014325 Ga0207703_100143258 291
329 3300026088 Ga0207641_10112364 Ga0207641_101123642 291
330 3300026095 Ga0207676_10036319 Ga0207676_100363194 291
331 3300026118 Ga0207675_100107005 Ga0207675_1001070052 291
332 3300027866 Ga0209813_10065617 Ga0209813_100656171 291
333 3300028379 Ga0268266_10020674 Ga0268266_100206742 291
334 3300028380 Ga0268265_10050871 Ga0268265_100508713 291
335 3300044658 Ga0466972_0000771 Ga0466972_0000771_11742_12761 291
336 3300048905 Ga0496102_0145378 Ga0496102_0145378_53_1069 291
337 3300048907 Ga0496104_0315126 Ga0496104_0315126_380_1396 291
338 3300048911 Ga0496108_0075641 Ga0496108_0075641_230_1246 291
339 3300048918 Ga0496115_0214663 Ga0496115_0214663_257_1273 291
340 3300048924 Ga0496121_0031994 Ga0496121_0031994_2308_3324 291
341 3300048928 Ga0496125_0179214 Ga0496125_0179214_385_1401 291
342 3300050491 nmdc:mga00v17_36841_c1 nmdc:mga00v17_36841_c1_1319_2335 291
343 3300050492 nmdc:mga0yw44_223246_c1 nmdc:mga0yw44_223246_c1_131_1147 291
344 3300050492 nmdc:mga0yw44_72265_c1 nmdc:mga0yw44_72265_c1_821_1837 291
345 3300050495 nmdc:mga04h51_84883_c1 nmdc:mga04h51_84883_c1_35_1051 291
346 3300050496 nmdc:mga07m45_32628_c1 nmdc:mga07m45_32628_c1_827_1843 291
347 3300046460 Ga0495638_0025345 Ga0495638_0025345_544_1560 292
348 3300046492 Ga0495585_0081204 Ga0495585_0081204_238_1254 292
349 3300046499 Ga0495594_0033984 Ga0495594_0033984_135_1151 292
350 3300046518 Ga0495631_0022621 Ga0495631_0022621_495_1511 292
351 3300046519 Ga0495632_0061326 Ga0495632_0061326_695_1711 292
352 3300046691 Ga0495670_0076468 Ga0495670_0076468_303_1319 292
353 3300047323 Ga0495683_0115123 Ga0495683_0115123_244_1260 292
354 3300053091 Ga0500647_0008273 Ga0500647_0008273_1963_2982 292
355 3300053105 Ga0500557_000303 Ga0500557_000303_939_1958 292
356 3300009092 Ga0105250_10083843 Ga0105250_100838432 293
357 3300014325 Ga0163163_10295461 Ga0163163_102954612 293
358 3300026041 Ga0207639_10190846 Ga0207639_101908462 293
359 3300033180 Ga0307510_10007708 Ga0307510_100077088 293
360 3300046455 Ga0495603_0009958 Ga0495603_0009958_4182_5198 293
361 3300046538 Ga0495609_0053461 Ga0495609_0053461_161_1177 293
362 3300046558 Ga0495633_0043207 Ga0495633_0043207_658_1674 293
363 3300046664 Ga0495659_0005390 Ga0495659_0005390_2828_3844 293
364 3300046674 Ga0495588_0004335 Ga0495588_0004335_1081_2097 293
365 3300046691 Ga0495670_0022116 Ga0495670_0022116_1833_2849 293
366 3300053103 Ga0500555_001634 Ga0500555_001634_479_1498 293
367 3300053139 Ga0500568_0019363 Ga0500568_0019363_1176_2195 293
368 3300005367 Ga0070667_100201256 Ga0070667_1002012562 294
369 3300006195 Ga0075366_10060813 Ga0075366_100608132 294
370 3300006944 Ga0099823_1029329 Ga0099823_10293292 294
371 3300009553 Ga0105249_10087482 Ga0105249_100874822 294
372 3300025942 Ga0207689_10099354 Ga0207689_100993542 294
373 3300025972 Ga0207668_10058342 Ga0207668_100583422 294
374 3300026075 Ga0207708_10102817 Ga0207708_101028173 294
375 3300026118 Ga0207675_100171275 Ga0207675_1001712753 294
376 3300027296 Ga0209389_1000016 Ga0209389_100001651 294
377 3300027361 Ga0209489_100063 Ga0209489_1000639 294
378 3300027363 Ga0209700_100012 Ga0209700_10001252 294
379 3300033180 Ga0307510_10079377 Ga0307510_100793772 294
380 3300050496 nmdc:mga07m45_20736_c1 nmdc:mga07m45_20736_c1_2384_3403 294
381 3300010159 Ga0099796_10047241 Ga0099796_100472411 295
382 3300031730 Ga0307516_10282320 Ga0307516_102823201 295
383 3300046455 Ga0495603_0150103 Ga0495603_0150103_67_1083 295
384 3300048915 Ga0496112_0331134 Ga0496112_0331134_372_1391 295
385 3300003354 JGI25160J50197_1005444 JGI25160J50197_10054444 296
386 3300005367 Ga0070667_100087287 Ga0070667_1000872873 296
387 3300005543 Ga0070672_100113902 Ga0070672_1001139022 296
388 3300005548 Ga0070665_100156929 Ga0070665_1001569293 296
389 3300005842 Ga0068858_100085735 Ga0068858_1000857352 296
390 3300005843 Ga0068860_100096524 Ga0068860_1000965242 296
391 3300005844 Ga0068862_100138897 Ga0068862_1001388972 296
392 3300006173 Ga0070716_100061025 Ga0070716_1000610252 296
393 3300025302 Ga0207426_1000337 Ga0207426_100033725 296
394 3300025986 Ga0207658_10107001 Ga0207658_101070012 296
395 3300028379 Ga0268266_10004322 Ga0268266_1000432215 296
396 3300028380 Ga0268265_10156107 Ga0268265_101561072 296
397 3300046460 Ga0495638_0063301 Ga0495638_0063301_15_1034 296
398 3300048905 Ga0496102_0443208 Ga0496102_0443208_119_1135 296
399 3300048911 Ga0496108_0033841 Ga0496108_0033841_2676_3692 296
400 3300048912 Ga0496109_0133419 Ga0496109_0133419_937_1953 296
401 3300032002 Ga0307416_100209239 Ga0307416_1002092392 297
402 3300005338 Ga0068868_100043361 Ga0068868_1000433612 298
403 3300005844 Ga0068862_100146834 Ga0068862_1001468342 298
404 3300005439 Ga0070711_100292297 Ga0070711_1002922971 299
405 3300005455 Ga0070663_100014544 Ga0070663_1000145445 299
406 3300009093 Ga0105240_10019788 Ga0105240_100197884 299
407 3300013104 Ga0157370_10215213 Ga0157370_102152132 299
408 3300013105 Ga0157369_10047829 Ga0157369_100478294 299
409 3300025913 Ga0207695_10036803 Ga0207695_100368034 299
410 3300025914 Ga0207671_10032007 Ga0207671_100320073 299
411 3300025916 Ga0207663_10239084 Ga0207663_102390841 299
412 3300035086 Ga0373934_0004936 Ga0373934_0004936_638_1654 299
413 3300035111 Ga0373923_0018906 Ga0373923_0018906_858_1874 299
414 3300035117 Ga0373953_0017673 Ga0373953_0017673_1010_2026 299
415 3300035118 Ga0373954_0002374 Ga0373954_0002374_3118_4134 299
416 3300035119 Ga0373956_0019983 Ga0373956_0019983_558_1574 299
417 3300035120 Ga0373957_0008219 Ga0373957_0008219_2071_3087 299
418 3300035172 Ga0373955_0000590 Ga0373955_0000590_9787_10803 299
419 3300035410 Ga0373924_0049834 Ga0373924_0049834_549_1565 299
420 3300037312 Ga0395899_0193077 Ga0395899_0193077_372_1391 299
421 3300037418 Ga0395900_0011126 Ga0395900_0011126_3282_4301 299
422 3300037466 Ga0395898_0029509 Ga0395898_0029509_1382_2401 299
423 3300046454 Ga0495592_0007391 Ga0495592_0007391_5932_6948 299
424 3300046459 Ga0495629_0020427 Ga0495629_0020427_2952_3968 299
425 3300046462 Ga0495651_0009620 Ga0495651_0009620_1011_2027 299
426 3300046463 Ga0495653_0017260 Ga0495653_0017260_2073_3089 299
427 3300046514 Ga0495618_0023387 Ga0495618_0023387_1795_2811 299
428 3300046516 Ga0495628_0011834 Ga0495628_0011834_5233_6249 299
429 3300046529 Ga0495652_0033670 Ga0495652_0033670_1326_2342 299
430 3300046533 Ga0495640_0009547 Ga0495640_0009547_3561_4577 299
431 3300046536 Ga0495587_0027506 Ga0495587_0027506_2037_3053 299
432 3300046543 Ga0495645_0009133 Ga0495645_0009133_5493_6509 299
433 3300046642 Ga0495634_0009379 Ga0495634_0009379_3214_4230 299
434 3300046663 Ga0495635_0007423 Ga0495635_0007423_2984_4000 299
435 3300046675 Ga0495657_0016949 Ga0495657_0016949_1811_2827 299
436 3300046678 Ga0495599_0019799 Ga0495599_0019799_1048_2064 299
437 3300046679 Ga0495623_0021928 Ga0495623_0021928_2129_3145 299
438 3300046680 Ga0495646_0030420 Ga0495646_0030420_1795_2811 299
439 3300046809 Ga0495600_0031062 Ga0495600_0031062_343_1359 299
440 3300047322 Ga0495680_0014448 Ga0495680_0014448_2037_3053 299
441 3300047444 Ga0495675_0063400 Ga0495675_0063400_352_1368 299
442 3300047471 Ga0495684_0033570 Ga0495684_0033570_2894_3910 299
443 3300048088 Ga0495602_0091137 Ga0495602_0091137_503_1519 299
444 3300050512 nmdc:mga0n895_136704_c1 nmdc:mga0n895_136704_c1_295_1311 299
445 3300053077 Ga0495601_0111788 Ga0495601_0111788_27_1043 299
446 3300053078 Ga0495612_0037631 Ga0495612_0037631_479_1495 299
447 3300053085 Ga0495619_0124370 Ga0495619_0124370_27_1043 299
448 3300005262 Ga0065165_1010731 Ga0065165_10107312 300
449 3300037853 Ga0436364_0683264 Ga0436364_0683264_468_1490 300
450 3300044842 Ga0466957_0080681 Ga0466957_0080681_483_1502 300
451 3300037471 Ga0395905_0531533 Ga0395905_0531533_22_996 301
452 3300053177 Ga0500636_0001203 Ga0500636_0001203_2827_3846 301
453 3300006177 Ga0075362_10072451 Ga0075362_100724511 302
454 3300045049 Ga0466959_0084671 Ga0466959_0084671_1039_2058 302
455 3300039437 Ga0436365_1737269 Ga0436365_1737269_1337_2356 303
456 3300031344 Ga0265316_10200092 Ga0265316_102000922 304
457 3300031711 Ga0265314_10022030 Ga0265314_100220305 304
458 3300031712 Ga0265342_10013040 Ga0265342_100130406 304
459 3300046460 Ga0495638_0138305 Ga0495638_0138305_217_1206 304
460 3300013105 Ga0157369_10175210 Ga0157369_101752103 305
461 3300036401 Ga0373937_0224225 Ga0373937_0224225_409_1425 305
462 3300046462 Ga0495651_0086272 Ga0495651_0086272_1290_2306 305
463 3300048924 Ga0496121_0000254 Ga0496121_0000254_21953_22969 305
464 3300005530 Ga0070679_100099831 Ga0070679_1000998313 306
465 3300005983 Ga0081540_1050413 Ga0081540_10504132 306
466 3300009093 Ga0105240_10261557 Ga0105240_102615572 306
467 3300009174 Ga0105241_10278267 Ga0105241_102782672 306
468 3300010375 Ga0105239_10079757 Ga0105239_100797572 306
469 3300025913 Ga0207695_10134917 Ga0207695_101349172 306
470 3300031507 Ga0307509_10006260 Ga0307509_1000626011 306
471 3300033179 Ga0307507_10051819 Ga0307507_100518194 306
472 3300035116 Ga0373945_0031078 Ga0373945_0031078_369_1388 306
473 3300035119 Ga0373956_0011847 Ga0373956_0011847_2334_3353 306
474 3300035695 Ga0373927_0008338 Ga0373927_0008338_4271_5284 306
475 3300035724 Ga0373933_0116885 Ga0373933_0116885_310_1329 306
476 3300044693 Ga0466961_0031967 Ga0466961_0031967_1259_2278 306
477 3300044842 Ga0466957_0090965 Ga0466957_0090965_680_1699 306
478 3300045049 Ga0466959_0036415 Ga0466959_0036415_1008_2027 306
479 3300047317 Ga0495604_0121938 Ga0495604_0121938_681_1700 306
480 3300048909 Ga0496106_0001280 Ga0496106_0001280_86_1099 306
481 3300048921 Ga0496118_0001458 Ga0496118_0001458_16115_17128 306
482 3300048924 Ga0496121_0000146 Ga0496121_0000146_59977_60990 306
483 3300048927 Ga0496124_0002217 Ga0496124_0002217_18014_19027 306
484 3300048929 Ga0496126_0011968 Ga0496126_0011968_867_1880 306
485 3300053097 Ga0500648_101140 Ga0500648_101140_338_1351 306
486 3300053136 Ga0500559_0007573 Ga0500559_0007573_2420_3433 306
487 3300053140 Ga0500573_0025041 Ga0500573_0025041_294_1307 306
488 3300053735 Ga0500596_001927 Ga0500596_001927_2860_3873 306
489 3300025297 Ga0209758_1027003 Ga0209758_10270032 307
490 3300025929 Ga0207664_10260461 Ga0207664_102604611 307
491 3300026067 Ga0207678_10041915 Ga0207678_100419153 307
492 3300028794 Ga0307515_10240563 Ga0307515_102405632 307
493 3300046512 Ga0495610_0026186 Ga0495610_0026186_1821_2843 307
494 3300046530 Ga0495654_0012179 Ga0495654_0012179_328_1350 307
495 3300048921 Ga0496118_0016977 Ga0496118_0016977_4912_5934 307
496 3300048922 Ga0496119_0061303 Ga0496119_0061303_943_1965 307
497 3300048924 Ga0496121_0009157 Ga0496121_0009157_4653_5675 307
498 3300048928 Ga0496125_0009421 Ga0496125_0009421_4866_5888 307
499 3300048929 Ga0496126_0100238 Ga0496126_0100238_840_1859 307
500 3300053089 Ga0500581_061300 Ga0500581_061300_68_1090 307
501 3300053093 Ga0500651_0091596 Ga0500651_0091596_343_1362 307
502 3300053094 Ga0500566_0003433 Ga0500566_0003433_6101_7120 307
503 3300053096 Ga0500641_0001161 Ga0500641_0001161_2807_3829 307
504 3300053098 Ga0500650_0025530 Ga0500650_0025530_1227_2249 307
505 3300053104 Ga0500556_0000035 Ga0500556_0000035_48801_49823 307
506 3300053116 Ga0500592_002069 Ga0500592_002069_744_1766 307
507 3300053122 Ga0500608_000269 Ga0500608_000269_14438_15457 307
508 3300053130 Ga0500642_0000027 Ga0500642_0000027_64273_65295 307
509 3300053136 Ga0500559_0000064 Ga0500559_0000064_52163_53182 307
510 3300053139 Ga0500568_0000443 Ga0500568_0000443_17234_18256 307
511 3300053142 Ga0500577_0011003 Ga0500577_0011003_925_1947 307
512 3300053151 Ga0500604_0006983 Ga0500604_0006983_361_1383 307
513 iso_pu_bacteria 2721755755 2723842546 307
514 3300005983 Ga0081540_1013150 Ga0081540_10131505 308
515 iso_pu_bacteria 2922361189 2922367566 308
516 iso_pu_bacteria 8006964411 8006965432 308
517 iso_pu_bacteria 8006994254 8006999177 308
518 iso_pu_bacteria 8016557553 8016558702 308
519 3300005340 Ga0070689_100073764 Ga0070689_1000737642 309
520 3300005434 Ga0070709_10005731 Ga0070709_100057312 309
521 3300005435 Ga0070714_100094816 Ga0070714_1000948162 309
522 3300005437 Ga0070710_10007859 Ga0070710_100078592 309
523 3300025898 Ga0207692_10026043 Ga0207692_100260432 309
524 3300025906 Ga0207699_10118520 Ga0207699_101185202 309
525 3300025915 Ga0207693_10003096 Ga0207693_1000309612 309
526 3300025928 Ga0207700_10059772 Ga0207700_100597722 309
527 3300053087 Ga0500643_046803 Ga0500643_046803_34_1056 309
528 3300053153 Ga0500616_0000054 Ga0500616_0000054_237301_238323 309
529 3300053156 Ga0500622_0003640 Ga0500622_0003640_4771_5793 309
530 3300005339 Ga0070660_100003353 Ga0070660_10000335313 310
531 3300005341 Ga0070691_10009236 Ga0070691_100092365 310
532 3300005455 Ga0070663_100161969 Ga0070663_1001619691 310
533 3300005458 Ga0070681_10033490 Ga0070681_100334902 310
534 3300005535 Ga0070684_100006286 Ga0070684_1000062863 310
535 3300005539 Ga0068853_100001496 Ga0068853_10000149619 310
536 3300005577 Ga0068857_100004210 Ga0068857_10000421015 310
537 3300005616 Ga0068852_100256096 Ga0068852_1002560961 310
538 3300005834 Ga0068851_10005600 Ga0068851_100056003 310
539 3300009093 Ga0105240_10009125 Ga0105240_100091253 310
540 3300009545 Ga0105237_10008895 Ga0105237_1000889513 310
541 3300009551 Ga0105238_10026375 Ga0105238_100263753 310
542 3300010375 Ga0105239_10008167 Ga0105239_1000816712 310
543 3300013105 Ga0157369_10091731 Ga0157369_100917312 310
544 3300020070 Ga0206356_10561849 Ga0206356_105618492 310
545 3300025912 Ga0207707_10001933 Ga0207707_1000193319 310
546 3300025913 Ga0207695_10070144 Ga0207695_100701443 310
547 3300025914 Ga0207671_10089412 Ga0207671_100894122 310
548 3300025917 Ga0207660_10009206 Ga0207660_100092064 310
549 3300025919 Ga0207657_10017675 Ga0207657_100176756 310
550 3300025949 Ga0207667_10013826 Ga0207667_1001382613 310
551 3300026116 Ga0207674_10004961 Ga0207674_1000496115 310
552 3300035725 Ga0373947_0085749 Ga0373947_0085749_733_1755 310
553 3300045976 Ga0466967_0198779 Ga0466967_0198779_491_1492 310
554 3300046455 Ga0495603_0033395 Ga0495603_0033395_1035_2057 310
555 3300046531 Ga0495665_0067781 Ga0495665_0067781_711_1733 310
556 3300047321 Ga0495676_0049592 Ga0495676_0049592_432_1454 310
557 3300005445 Ga0070708_100024114 Ga0070708_1000241144 311
558 3300005467 Ga0070706_100093394 Ga0070706_1000933944 311
559 3300025910 Ga0207684_10133431 Ga0207684_101334312 311
560 3300048918 Ga0496115_0067943 Ga0496115_0067943_786_1808 311
561 iso_pu_bacteria 8016575299 8016581054 311
562 3300005983 Ga0081540_1005016 Ga0081540_10050165 312
563 3300026067 Ga0207678_10027182 Ga0207678_100271824 312
564 3300037418 Ga0395900_0034589 Ga0395900_0034589_1427_2446 312
565 3300060353 Ga0501082_0239300 Ga0501082_0239300_377_1381 312
566 iso_pu_bacteria 2791355199 2793078589 312
567 iso_pu_bacteria 2879110137 2879113503 312
568 iso_pu_bacteria 2889033259 2889034176 312
569 iso_pu_bacteria 8006984368 8006986161 312
570 3300005614 Ga0068856_100006410 Ga0068856_1000064108 313
571 3300006358 Ga0068871_100052977 Ga0068871_1000529772 313
572 3300013308 Ga0157375_10047373 Ga0157375_100473734 313
573 3300026078 Ga0207702_10000014 Ga0207702_10000014252 313
574 3300026121 Ga0207683_10014788 Ga0207683_100147886 313
575 3300031235 Ga0265330_10036743 Ga0265330_100367432 313
576 iso_pu_bacteria 2507262055 2507504355 313
577 iso_pu_bacteria 2508501009 2508545790 313
578 iso_pu_bacteria 2508501042 2508694616 313
579 iso_pu_bacteria 2511231028 2511398382 313
580 iso_pu_bacteria 2513237092 2513624472 313
581 iso_pu_bacteria 2513237094 2513638663 313
582 iso_pu_bacteria 2513237095 2513649946 313
583 iso_pu_bacteria 2513237096 2513655386 313
584 iso_pu_bacteria 2513237104 2513716791 313
585 iso_pu_bacteria 2513237137 2513860050 313
586 iso_pu_bacteria 2513237139 2513874241 313
587 iso_pu_bacteria 2513237145 2513916536 313
588 iso_pu_bacteria 2513237161 2514009993 313
589 iso_pu_bacteria 2515154112 2515624457 313
590 iso_pu_bacteria 2517093001 2517104616 313
591 iso_pu_bacteria 2517572143 2517889873 313
592 iso_pu_bacteria 2524023205 2524438568 313
593 iso_pu_bacteria 2524023228 2524532939 313
594 iso_pu_bacteria 2528768022 2528850421 313
595 iso_pu_bacteria 2617270735 2617353866 313
596 iso_pu_bacteria 2617270741 2617374643 313
597 iso_pu_bacteria 2667528175 2671121103 313
598 iso_pu_bacteria 2728368998 2728751732 313
599 iso_pu_bacteria 2744054633 2745077206 313
600 iso_pu_bacteria 2791355196 2793059375 313
601 iso_pu_bacteria 2791355197 2793073397 313
602 iso_pu_bacteria 2802429603 2805922131 313
603 iso_pu_bacteria 2816332527 2818240946 313
604 iso_pu_bacteria 2824617872 2824618916 313
605 iso_pu_bacteria 2824626560 2824632932 313
606 iso_pu_bacteria 2824635225 2824642631 313
607 iso_pu_bacteria 2824644064 2824650879 313
608 iso_pu_bacteria 2824661429 2824667377 313
609 iso_pu_bacteria 2824671348 2824675544 313
610 iso_pu_bacteria 2824679649 2824686557 313
611 iso_pu_bacteria 2824687955 2824691766 313
612 iso_pu_bacteria 2824704595 2824711683 313
613 iso_pu_bacteria 2824714736 2824720731 313
614 iso_pu_bacteria 2824723954 2824730675 313
615 iso_pu_bacteria 2824732956 2824739301 313
616 iso_pu_bacteria 2824746037 2824750385 313
617 iso_pu_bacteria 2824753945 2824761085 313
618 iso_pu_bacteria 2824763712 2824771798 313
619 iso_pu_bacteria 2824773399 2824779760 313
620 iso_pu_bacteria 2838122688 2838126102 313
621 iso_pu_bacteria 2841941048 2841942505 313
622 iso_pu_bacteria 2841949485 2841953145 313
623 iso_pu_bacteria 2841966195 2841970831 313
624 iso_pu_bacteria 2841974524 2841977910 313
625 iso_pu_bacteria 2841983080 2841984525 313
626 iso_pu_bacteria 2844315083 2844321364 313
627 iso_pu_bacteria 2847930680 2847932049 313
628 iso_pu_bacteria 2847939898 2847943286 313
629 iso_pu_bacteria 2849076700 2849077013 313
630 iso_pu_bacteria 2874620515 2874624249 313
631 iso_pu_bacteria 2874628541 2874630278 313
632 iso_pu_bacteria 2874645413 2874651679 313
633 iso_pu_bacteria 2876761206 2876767690 313
634 iso_pu_bacteria 2879142872 2879148543 313
635 iso_pu_bacteria 2881364244 2881367751 313
636 iso_pu_bacteria 2885374607 2885376200 313
637 iso_pu_bacteria 2885409591 2885411503 313
638 iso_pu_bacteria 2888378607 2888387660 313
639 iso_pu_bacteria 2893066018 2893070666 313
640 iso_pu_bacteria 2903727486 2903731446 313
641 iso_pu_bacteria 2903748898 2903749015 313
642 iso_pu_bacteria 2904666416 2904670960 313
643 iso_pu_bacteria 2904690495 2904692690 313
644 iso_pu_bacteria 2904699407 2904711206 313
645 iso_pu_bacteria 2904711408 2904713581 313
646 iso_pu_bacteria 2906602504 2906607978 313
647 iso_pu_bacteria 2906610324 2906612390 313
648 iso_pu_bacteria 2906635258 2906637842 313
649 iso_pu_bacteria 2906643746 2906647258 313
650 iso_pu_bacteria 2906660503 2906663431 313
651 iso_pu_bacteria 2908739725 2908739736 313
652 iso_pu_bacteria 2908756301 2908757670 313
653 iso_pu_bacteria 2908775508 2908777124 313
654 iso_pu_bacteria 2922368715 2922376647 313
655 iso_pu_bacteria 2922425934 2922426903 313
656 iso_pu_bacteria 2929615660 2929619850 313
657 iso_pu_bacteria 2929624759 2929629161 313
658 iso_pu_bacteria 2932794094 2932796627 313
659 iso_pu_bacteria 2932801729 2932802591 313
660 iso_pu_bacteria 2932828146 2932835632 313
661 iso_pu_bacteria 2933577622 2933581768 313
662 iso_pu_bacteria 2935616580 2935624594 313
663 iso_pu_bacteria 2935630451 2935633064 313
664 iso_pu_bacteria 2935638405 2935647179 313
665 iso_pu_bacteria 2935665750 2935674358 313
666 iso_pu_bacteria 2935675223 2935684239 313
667 iso_pu_bacteria 2935694250 2935697629 313
668 iso_pu_bacteria 2935769743 2935775169 313
669 iso_pu_bacteria 2935793552 2935798765 313
670 iso_pu_bacteria 2935801545 2935809867 313
671 iso_pu_bacteria 2935810662 2935819352 313
672 iso_pu_bacteria 2935827899 2935836603 313
673 iso_pu_bacteria 2935864058 2935868665 313
674 iso_pu_bacteria 2935873716 2935879439 313
675 iso_pu_bacteria 2935883170 2935883598 313
676 iso_pu_bacteria 2935975950 2935980081 313
677 iso_pu_bacteria 2935992306 2936000233 313
678 iso_pu_bacteria 2936037263 2936045975 313
679 iso_pu_bacteria 2940556831 2940563348 313
680 iso_pu_bacteria 2941507105 2941509634 313
681 iso_pu_bacteria 2941515067 2941517463 313
682 iso_pu_bacteria 2941523033 2941526584 313
683 iso_pu_bacteria 2941531003 2941531934 313
684 iso_pu_bacteria 2941538514 2941547261 313
685 iso_pu_bacteria 3005474847 3005476089 313
686 iso_pu_bacteria 3005506211 3005506644 313
687 iso_pu_bacteria 3005594810 3005601716 313
688 iso_pu_bacteria 3005710791 3005717456 313
689 iso_pu_bacteria 3005718088 3005724397 313
690 iso_pu_bacteria 8006973647 8006977431 313
691 iso_pu_bacteria 8016511872 8016519184 313
692 iso_pu_bacteria 8016522445 8016525131 313
693 iso_pu_bacteria 8016539877 8016542997 313
694 iso_pu_bacteria 8016566248 8016568397 313
695 iso_pu_bacteria 8016595262 8016596679 313
696 iso_pu_bacteria 8016622563 8016630244 313
697 iso_pu_bacteria 8017057580 8017066320 313
698 iso_pu_bacteria 8019530166 8019538382 313
699 iso_pu_bacteria 8019547302 8019549185 313
700 iso_pu_bacteria 8019555841 8019561224 313
701 iso_pu_bacteria 8019597564 8019605365 313
702 iso_pu_bacteria 8019608314 8019613177 313
703 iso_pu_bacteria 8019619141 8019623867 313
704 iso_pu_bacteria 8019638758 8019641460 313
705 iso_pu_bacteria 8019648815 8019651582 313
706 iso_pu_bacteria 8055742211 8055750398 313
707 3300003203 JGI25406J46586_10002008 JGI25406J46586_100020087 314
708 3300003659 JGI25404J52841_10003298 JGI25404J52841_100032982 314
709 3300005937 Ga0081455_10033441 Ga0081455_100334412 314
710 3300005983 Ga0081540_1005788 Ga0081540_100578810 314
711 3300005983 Ga0081540_1015887 Ga0081540_10158872 314
712 3300005983 Ga0081540_1016301 Ga0081540_10163012 314
713 3300005983 Ga0081540_1029678 Ga0081540_10296784 314
714 3300005985 Ga0081539_10001098 Ga0081539_1000109811 314
715 3300044658 Ga0466972_0003626 Ga0466972_0003626_955_1974 314
716 3300044683 Ga0466965_0033173 Ga0466965_0033173_45_1064 314
717 3300044735 Ga0466968_0106163 Ga0466968_0106163_78_1097 314
718 3300047315 Ga0495581_0076665 Ga0495581_0076665_82_1098 314
719 3300048914 Ga0496111_0074598 Ga0496111_0074598_1077_2099 314
720 3300048915 Ga0496112_0303741 Ga0496112_0303741_130_1152 314
721 3300048929 Ga0496126_0255361 Ga0496126_0255361_89_1105 314
722 3300049568 Ga0501031_0000451 Ga0501031_0000451_21513_22532 314
723 3300049569 Ga0501032_0000196 Ga0501032_0000196_33067_34086 314
724 3300049570 Ga0501033_0001104 Ga0501033_0001104_15655_16674 314
725 3300049571 Ga0501034_0001151 Ga0501034_0001151_33067_34086 314
726 3300049572 Ga0501036_0000323 Ga0501036_0000323_7160_8179 314
727 3300049573 Ga0501037_0001204 Ga0501037_0001204_15386_16405 314
728 3300049574 Ga0501038_0002973 Ga0501038_0002973_12072_13091 314
729 3300049575 Ga0501039_0000705 Ga0501039_0000705_12607_13626 314
730 3300049579 Ga0501043_0000409 Ga0501043_0000409_4572_5591 314
731 3300049580 Ga0501046_0000181 Ga0501046_0000181_33067_34086 314
732 3300049581 Ga0501047_0000419 Ga0501047_0000419_15386_16405 314
733 3300049582 Ga0501048_0000057 Ga0501048_0000057_33707_34726 314
734 3300049583 Ga0501067_0000145 Ga0501067_0000145_33010_34029 314
735 3300049584 Ga0501068_0001512 Ga0501068_0001512_9957_10976 314
736 3300049585 Ga0501069_0016839 Ga0501069_0016839_2691_3710 314
737 3300049586 Ga0501070_0022615 Ga0501070_0022615_2578_3597 314
738 3300049587 Ga0501071_0014762 Ga0501071_0014762_3830_4849 314
739 3300049588 Ga0501072_0000643 Ga0501072_0000643_11355_12374 314
740 3300049589 Ga0501073_0000027 Ga0501073_0000027_34110_35129 314
741 3300049590 Ga0501074_0000081 Ga0501074_0000081_36948_37967 314
742 3300049741 Ga0501079_0003647 Ga0501079_0003647_3293_4312 314
743 3300049742 Ga0501080_0000883 Ga0501080_0000883_3559_4578 314
744 3300049744 Ga0501083_0010910 Ga0501083_0010910_5317_6336 314
745 3300049822 Ga0501035_0003158 Ga0501035_0003158_12103_13122 314
746 3300049823 Ga0501044_0001511 Ga0501044_0001511_15514_16533 314
747 3300049824 Ga0501045_0132444 Ga0501045_0132444_652_1671 314
748 3300060353 Ga0501082_0004691 Ga0501082_0004691_3523_4542 314
749 iso_pu_bacteria 2824600985 2824604620 314
750 iso_pu_bacteria 2824609381 2824616172 314
751 iso_pu_bacteria 2824653114 2824658369 314
752 iso_pu_bacteria 2824696289 2824698995 314
753 iso_pu_bacteria 2841957949 2841960653 314
754 iso_pu_bacteria 2842038055 2842041754 314
755 iso_pu_bacteria 2842045827 2842049796 314
756 iso_pu_bacteria 2874590934 2874595689 314
757 iso_pu_bacteria 2874612657 2874620311 314
758 iso_pu_bacteria 2876771140 2876775884 314
759 iso_pu_bacteria 2876818435 2876821574 314
760 iso_pu_bacteria 2879074833 2879079975 314
761 iso_pu_bacteria 2879083081 2879085725 314
762 iso_pu_bacteria 2879099564 2879100894 314
763 iso_pu_bacteria 2879127579 2879134058 314
764 iso_pu_bacteria 2885366525 2885374458 314
765 iso_pu_bacteria 2888388044 2888391503 314
766 iso_pu_bacteria 2888419890 2888426877 314
767 iso_pu_bacteria 2906626472 2906633052 314
768 iso_pu_bacteria 2922393267 2922398594 314
769 iso_pu_bacteria 2932784394 2932789707 314
770 iso_pu_bacteria 2932809354 2932817781 314
771 iso_pu_bacteria 2932818245 2932827108 314
772 iso_pu_bacteria 2935608549 2935613230 314
773 iso_pu_bacteria 2935648319 2935655596 314
774 iso_pu_bacteria 2935656913 2935664500 314
775 iso_pu_bacteria 2935684952 2935689110 314
776 iso_pu_bacteria 2935703347 2935711347 314
777 iso_pu_bacteria 2935713505 2935720056 314
778 iso_pu_bacteria 2935722832 2935728327 314
779 iso_pu_bacteria 2935732158 2935737076 314
780 iso_pu_bacteria 2935741537 2935746863 314
781 iso_pu_bacteria 2935750917 2935757830 314
782 iso_pu_bacteria 2935760218 2935764208 314
783 iso_pu_bacteria 2935777560 2935780071 314
784 iso_pu_bacteria 2935785616 2935790193 314
785 iso_pu_bacteria 2935819856 2935824916 314
786 iso_pu_bacteria 2935837841 2935846813 314
787 iso_pu_bacteria 2935847175 2935852136 314
788 iso_pu_bacteria 2935855204 2935863196 314
789 iso_pu_bacteria 2935908558 2935911483 314
790 iso_pu_bacteria 2935916978 2935925400 314
791 iso_pu_bacteria 2935926038 2935928512 314
792 iso_pu_bacteria 2935934488 2935938157 314
793 iso_pu_bacteria 2935942939 2935945439 314
794 iso_pu_bacteria 2935951376 2935954055 314
795 iso_pu_bacteria 2935959822 2935965434 314
796 iso_pu_bacteria 2935967501 2935971677 314
797 iso_pu_bacteria 2935984226 2935984242 314
798 iso_pu_bacteria 2936002035 2936010275 314
799 iso_pu_bacteria 2936011229 2936018546 314
800 iso_pu_bacteria 2936019824 2936027064 314
801 iso_pu_bacteria 2936028420 2936035969 314
802 iso_pu_bacteria 2936046547 2936054048 314
803 iso_pu_bacteria 2936055302 2936055322 314
804 iso_pu_bacteria 3005483717 3005485980 314
805 iso_pu_bacteria 3005587118 3005591802 314
806 iso_pu_bacteria 8016530956 8016538709 314
807 iso_pu_bacteria 8016548790 8016550293 314
808 iso_pu_bacteria 8016603502 8016607554 314
809 iso_pu_bacteria 8016613128 8016619344 314
810 iso_pu_bacteria 8016630954 8016636905 314
811 iso_pu_bacteria 8019538911 8019541440 314
812 iso_pu_bacteria 8019576017 8019578298 314
813 iso_pu_bacteria 8019659431 8019666094 314
814 iso_pu_bacteria 8019668869 8019675605 314
815 iso_pu_bacteria 8019678201 8019680494 314
816 iso_pu_bacteria 8019687851 8019695264 314
817 iso_pu_bacteria 8056967851 8056971821 314
818 3300005434 Ga0070709_10201390 Ga0070709_102013902 315
819 3300005435 Ga0070714_100032179 Ga0070714_1000321793 315
820 3300005435 Ga0070714_100098779 Ga0070714_1000987792 315
821 3300005436 Ga0070713_100024272 Ga0070713_1000242722 315
822 3300005436 Ga0070713_100056432 Ga0070713_1000564325 315
823 3300005530 Ga0070679_100106689 Ga0070679_1001066892 315
824 3300005563 Ga0068855_100433287 Ga0068855_1004332872 315
825 3300005937 Ga0081455_10047745 Ga0081455_100477452 315
826 3300006028 Ga0070717_10153473 Ga0070717_101534732 315
827 3300006038 Ga0075365_10045227 Ga0075365_100452272 315
828 3300006048 Ga0075363_100125860 Ga0075363_1001258601 315
829 3300006163 Ga0070715_10007812 Ga0070715_100078122 315
830 3300006173 Ga0070716_100010967 Ga0070716_1000109673 315
831 3300006177 Ga0075362_10079776 Ga0075362_100797762 315
832 3300006186 Ga0075369_10063613 Ga0075369_100636132 315
833 3300007265 Ga0099794_10033678 Ga0099794_100336782 315
834 3300014325 Ga0163163_10579047 Ga0163163_105790471 315
835 3300014969 Ga0157376_10018726 Ga0157376_100187264 315
836 3300014969 Ga0157376_10120672 Ga0157376_101206723 315
837 3300025906 Ga0207699_10152168 Ga0207699_101521682 315
838 3300025912 Ga0207707_10102500 Ga0207707_101025002 315
839 3300025915 Ga0207693_10020323 Ga0207693_100203234 315
840 3300025916 Ga0207663_10001112 Ga0207663_1000111211 315
841 3300025928 Ga0207700_10242362 Ga0207700_102423621 315
842 3300025939 Ga0207665_10000703 Ga0207665_100007039 315
843 3300025949 Ga0207667_10305414 Ga0207667_103054142 315
844 3300026067 Ga0207678_10027004 Ga0207678_100270045 315
845 3300028379 Ga0268266_10006723 Ga0268266_100067234 315
846 3300028379 Ga0268266_10168492 Ga0268266_101684922 315
847 3300035724 Ga0373933_0000180 Ga0373933_0000180_36654_37694 315
848 3300035725 Ga0373947_0090542 Ga0373947_0090542_766_1782 315
849 3300037466 Ga0395898_0297732 Ga0395898_0297732_179_1195 315
850 3300046475 Ga0495639_0034245 Ga0495639_0034245_768_1784 315
851 3300048910 Ga0496107_0084277 Ga0496107_0084277_438_1454 315
852 3300048918 Ga0496115_0142345 Ga0496115_0142345_319_1335 315
853 3300048924 Ga0496121_0113447 Ga0496121_0113447_797_1813 315
854 3300048925 Ga0496122_0050993 Ga0496122_0050993_949_1965 315
855 3300048929 Ga0496126_0003212 Ga0496126_0003212_827_1843 315
856 3300048929 Ga0496126_0004243 Ga0496126_0004243_3254_4270 315
857 3300048929 Ga0496126_0312858 Ga0496126_0312858_229_1245 315
858 3300050492 nmdc:mga0yw44_20681_c1 nmdc:mga0yw44_20681_c1_518_1534 315
859 3300050492 nmdc:mga0yw44_55244_c1 nmdc:mga0yw44_55244_c1_1364_2380 315
860 3300050494 nmdc:mga06z11_138426_c1 nmdc:mga06z11_138426_c1_320_1336 315
861 3300050507 nmdc:mga05p37_188753_c1 nmdc:mga05p37_188753_c1_1017_2033 315
862 3300050516 nmdc:mga0sz30_27845_c1 nmdc:mga0sz30_27845_c1_507_1523 315
863 3300053077 Ga0495601_0062415 Ga0495601_0062415_668_1684 315
864 3300053094 Ga0500566_0000113 Ga0500566_0000113_16607_17623 315
865 3300053095 Ga0500640_000015 Ga0500640_000015_54_1070 315
866 3300053102 Ga0500554_010459 Ga0500554_010459_419_1435 315
867 3300053111 Ga0500572_003927 Ga0500572_003927_1574_2590 315
868 3300053115 Ga0500591_019919 Ga0500591_019919_1348_2364 315
869 3300053118 Ga0500594_0009707 Ga0500594_0009707_1040_2056 315
870 3300053119 Ga0500595_000728 Ga0500595_000728_6240_7256 315
871 3300053123 Ga0500614_003851 Ga0500614_003851_1873_2889 315
872 3300053136 Ga0500559_0002132 Ga0500559_0002132_5308_6324 315
873 3300053150 Ga0500603_000592 Ga0500603_000592_3184_4200 315
874 3300053150 Ga0500603_040978 Ga0500603_040978_27_1043 315
875 3300053159 Ga0500630_004643 Ga0500630_004643_4907_5923 315
876 3300053162 Ga0500638_002418 Ga0500638_002418_724_1740 315
877 3300053162 Ga0500638_042194 Ga0500638_042194_1136_2152 315
878 3300053163 Ga0500639_000050 Ga0500639_000050_38679_39695 315
879 3300053163 Ga0500639_059399 Ga0500639_059399_192_1208 315
880 3300053178 Ga0500637_0000080 Ga0500637_0000080_11997_13013 315
881 3300053178 Ga0500637_0029751 Ga0500637_0029751_1300_2316 315
882 3300053735 Ga0500596_000478 Ga0500596_000478_297_1313 315
883 3300053737 Ga0500601_002207 Ga0500601_002207_356_1372 315
884 3300055283 Ga0500661_000271 Ga0500661_000271_6930_7946 315
885 3300001979 JGI24740J21852_10005984 JGI24740J21852_100059845 316
886 3300003203 JGI25406J46586_10000123 JGI25406J46586_1000012328 316
887 3300005327 Ga0070658_10045091 Ga0070658_100450914 316
888 3300005458 Ga0070681_10298396 Ga0070681_102983961 316
889 3300005535 Ga0070684_100025288 Ga0070684_1000252885 316
890 3300005548 Ga0070665_100470972 Ga0070665_1004709722 316
891 3300005577 Ga0068857_100012909 Ga0068857_1000129097 316
892 3300005578 Ga0068854_100028729 Ga0068854_1000287292 316
893 3300005616 Ga0068852_100081965 Ga0068852_1000819652 316
894 3300005616 Ga0068852_100225411 Ga0068852_1002254112 316
895 3300005985 Ga0081539_10000425 Ga0081539_1000042532 316
896 3300009093 Ga0105240_10046064 Ga0105240_100460646 316
897 3300009174 Ga0105241_10015112 Ga0105241_100151126 316
898 3300009545 Ga0105237_10397622 Ga0105237_103976222 316
899 3300009551 Ga0105238_10041248 Ga0105238_100412482 316
900 3300010375 Ga0105239_10063897 Ga0105239_100638973 316
901 3300021320 Ga0214544_1000011 Ga0214544_100001130 316
902 3300021321 Ga0214542_1000009 Ga0214542_1000009212 316
903 3300021321 Ga0214542_1024107 Ga0214542_10241072 316
904 3300021324 Ga0214545_1000007 Ga0214545_100000730 316
905 3300021324 Ga0214545_1021600 Ga0214545_10216002 316
906 3300021327 Ga0214543_1000020 Ga0214543_1000020212 316
907 3300021327 Ga0214543_1028960 Ga0214543_10289604 316
908 3300025254 Ga0209148_1006688 Ga0209148_10066882 316
909 3300025272 Ga0209455_1011648 Ga0209455_10116482 316
910 3300025297 Ga0209758_1002009 Ga0209758_100200920 316
911 3300025321 Ga0207656_10009458 Ga0207656_100094585 316
912 3300025911 Ga0207654_10000811 Ga0207654_1000081118 316
913 3300025912 Ga0207707_10012323 Ga0207707_100123233 316
914 3300025916 Ga0207663_10012363 Ga0207663_100123633 316
915 3300025917 Ga0207660_10076411 Ga0207660_100764112 316
916 3300025919 Ga0207657_10012730 Ga0207657_100127302 316
917 3300025924 Ga0207694_10001415 Ga0207694_1000141511 316
918 3300025928 Ga0207700_10315270 Ga0207700_103152701 316
919 3300025944 Ga0207661_10000171 Ga0207661_1000017141 316
920 3300025949 Ga0207667_10011741 Ga0207667_100117415 316
921 3300025981 Ga0207640_10149654 Ga0207640_101496542 316
922 3300026041 Ga0207639_10398623 Ga0207639_103986232 316
923 3300026078 Ga0207702_10000003 Ga0207702_1000000322 316
924 3300026116 Ga0207674_10009035 Ga0207674_100090358 316
925 3300031595 Ga0265313_10032460 Ga0265313_100324603 316
926 3300035111 Ga0373923_0023254 Ga0373923_0023254_184_1203 316
927 3300035113 Ga0373936_0053549 Ga0373936_0053549_147_1166 316
928 3300035118 Ga0373954_0011969 Ga0373954_0011969_1466_2485 316
929 3300035118 Ga0373954_0025175 Ga0373954_0025175_628_1647 316
930 3300035170 Ga0373943_0003127 Ga0373943_0003127_888_1907 316
931 3300035171 Ga0373946_0003423 Ga0373946_0003423_721_1740 316
932 3300035172 Ga0373955_0070318 Ga0373955_0070318_139_1158 316
933 3300035410 Ga0373924_0017284 Ga0373924_0017284_95_1114 316
934 3300035692 Ga0373935_0000569 Ga0373935_0000569_12502_13521 316
935 3300035692 Ga0373935_0020182 Ga0373935_0020182_2983_4005 316
936 3300035695 Ga0373927_0016947 Ga0373927_0016947_681_1700 316
937 3300035725 Ga0373947_0005868 Ga0373947_0005868_4436_5455 316
938 3300036401 Ga0373937_0014626 Ga0373937_0014626_858_1877 316
939 3300036401 Ga0373937_0053457 Ga0373937_0053457_1100_2119 316
940 3300037068 Ga0373925_0030197 Ga0373925_0030197_946_1968 316
941 3300044694 Ga0466963_0082772 Ga0466963_0082772_138_1157 316
942 3300045976 Ga0466967_0303482 Ga0466967_0303482_74_1093 316
943 3300046455 Ga0495603_0003935 Ga0495603_0003935_4641_5660 316
944 3300046461 Ga0495641_0001899 Ga0495641_0001899_4400_5419 316
945 3300046472 Ga0495580_0001711 Ga0495580_0001711_12586_13605 316
946 3300046475 Ga0495639_0000278 Ga0495639_0000278_3064_4083 316
947 3300046475 Ga0495639_0050147 Ga0495639_0050147_592_1614 316
948 3300046476 Ga0495662_0000176 Ga0495662_0000176_12652_13671 316
949 3300046499 Ga0495594_0000541 Ga0495594_0000541_4634_5653 316
950 3300046516 Ga0495628_0065962 Ga0495628_0065962_857_1876 316
951 3300046517 Ga0495630_0001818 Ga0495630_0001818_1986_3005 316
952 3300046517 Ga0495630_0020042 Ga0495630_0020042_1533_2552 316
953 3300046529 Ga0495652_0059010 Ga0495652_0059010_532_1551 316
954 3300046529 Ga0495652_0103100 Ga0495652_0103100_853_1875 316
955 3300046531 Ga0495665_0000408 Ga0495665_0000408_12709_13728 316
956 3300046531 Ga0495665_0011452 Ga0495665_0011452_2364_3386 316
957 3300046533 Ga0495640_0004065 Ga0495640_0004065_4683_5702 316
958 3300046557 Ga0495622_0003183 Ga0495622_0003183_2544_3563 316
959 3300046642 Ga0495634_0009077 Ga0495634_0009077_682_1701 316
960 3300046642 Ga0495634_0098163 Ga0495634_0098163_264_1286 316
961 3300046663 Ga0495635_0000883 Ga0495635_0000883_5377_6396 316
962 3300046679 Ga0495623_0103645 Ga0495623_0103645_352_1374 316
963 3300046680 Ga0495646_0037301 Ga0495646_0037301_611_1630 316
964 3300046681 Ga0495647_0000226 Ga0495647_0000226_10474_11493 316
965 3300046681 Ga0495647_0004771 Ga0495647_0004771_1571_2593 316
966 3300046683 Ga0495658_0000706 Ga0495658_0000706_3191_4210 316
967 3300046683 Ga0495658_0007799 Ga0495658_0007799_1197_2219 316
968 3300046689 Ga0495613_0009812 Ga0495613_0009812_64_1083 316
969 3300047315 Ga0495581_0036754 Ga0495581_0036754_1363_2382 316
970 3300047319 Ga0495674_0012843 Ga0495674_0012843_6417_7436 316
971 3300047319 Ga0495674_0021071 Ga0495674_0021071_2999_4021 316
972 3300047321 Ga0495676_0086399 Ga0495676_0086399_444_1463 316
973 3300047471 Ga0495684_0010341 Ga0495684_0010341_5185_6207 316
974 3300047673 Ga0495593_0000577 Ga0495593_0000577_6993_8012 316
975 3300048903 Ga0496100_0040457 Ga0496100_0040457_134_1150 316
976 3300048905 Ga0496102_0200208 Ga0496102_0200208_776_1792 316
977 3300048909 Ga0496106_0004321 Ga0496106_0004321_3819_4835 316
978 3300048910 Ga0496107_0062087 Ga0496107_0062087_154_1170 316
979 3300048911 Ga0496108_0003585 Ga0496108_0003585_6286_7302 316
980 3300048912 Ga0496109_0004298 Ga0496109_0004298_6060_7076 316
981 3300048913 Ga0496110_0024685 Ga0496110_0024685_2290_3306 316
982 3300048915 Ga0496112_0003249 Ga0496112_0003249_7270_8286 316
983 3300048916 Ga0496113_0002516 Ga0496113_0002516_8850_9866 316
984 3300048922 Ga0496119_0112489 Ga0496119_0112489_228_1247 316
985 3300048924 Ga0496121_0001525 Ga0496121_0001525_19681_20700 316
986 3300048924 Ga0496121_0196722 Ga0496121_0196722_57_1076 316
987 3300048929 Ga0496126_0023765 Ga0496126_0023765_530_1549 316
988 3300048929 Ga0496126_0055536 Ga0496126_0055536_1019_2038 316
989 3300048929 Ga0496126_0224630 Ga0496126_0224630_219_1238 316
990 3300050492 nmdc:mga0yw44_62945_c1 nmdc:mga0yw44_62945_c1_41_1060 316
991 3300053087 Ga0500643_000052 Ga0500643_000052_86160_87179 316
992 3300053093 Ga0500651_0046771 Ga0500651_0046771_944_1963 316
993 3300053121 Ga0500607_032891 Ga0500607_032891_481_1500 316
994 3300053130 Ga0500642_0023426 Ga0500642_0023426_637_1656 316
995 3300053177 Ga0500636_0006221 Ga0500636_0006221_5813_6832 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00400

WD40

WD domain, G-beta repeat

209

244

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r5z-assembly2.cif.gz_E 9-bladed beta-propeller formed by three 3-bladed fragments 0.8664 108 218
5mzh-assembly1.cif.gz_A crystal structure of oda16 from chlamydomonas reinhardtii 0.8579 19 315
7v08-assembly1.cif.gz_x nucleoplasmic pre-60s intermediate of the nog2 containing pre-rotation state from a spb1 d52a suppressor 3 strain 0.8486 19 315
4wjs-assembly1.cif.gz_A crystal structure of rsa4 from chaetomium thermophilum 0.8403 18 315
5nnz-assembly2.cif.gz_B crystal structure of human oda16 0.836 18 312
ID Description Score Start End Superfamily
af_Q54H44_7_161_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8816 58 185 2.40.128.630
af_O22212_162_377_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8795 97 215 2.130.10.10
af_Q0DGP5_451_595_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8784 98 217 2.40.128.630
af_Q9D994_190_301_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.87 135 239 2.130.10.10
af_B7Z0R7_305_459_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.8664 138 246 2.110.10.10
ID Description Score Start End GO Terms
AF-A0A527VSA3-F1-model_v4 WD40 repeat domain-containing protein 0.9748 117 275
AF-A0A527GQZ9-F1-model_v4 WD40 repeat domain-containing protein 0.9748 154 286
AF-A0A5R2MZY7-F1-model_v4 WD40 repeat domain-containing protein 0.9734 133 262
AF-A0A529GK95-F1-model_v4 WD40 repeat domain-containing protein 0.9718 64 315
AF-A0A0D7E0B5-F1-model_v4 WD-repeat family protein 0.9716 184 315

Feature Viewer

pLDDT pTM Quality
91.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map