F487764
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 995 | 602 | 783 | 316 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8016557553|8016558702 |
| Length | 341 |
| Sequence | TPAPDSASIVSVTDRVKPVALGMGVTAVHFLGDRAAFVGGEENVAFVDGQGEISTVAVHSGGILSTASDGKRLVMGGDDGKVVSLDAKGAVTLLATDPKRRWIDAVALHPDGAYAWSAGKTAFVKSGKQEEKSIEVPSTVGGLAFAPKGLRLAIAHYNGATLWFPNMAASAEFLPWAGSHLGVTFSPDNKFLVTTMHESALHGWRLADNRHMRMTGYPGRVRSMSWSAGGKALATSGADTVILWPFASKDGPMGKEPAMLAPLQARVSVVACHPKNDIFAAGYSDGTVLMVRLEDGAEILVRRNGTLRPWLRSPGTPRGLCWRSQMKMGTAGFWSFKLLSF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 17 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 18 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 19 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 22 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 23 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 24 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 25 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 26 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 27 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 28 | 2791355199 | |||
| 29 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 30 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 31 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 32 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 33 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 34 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 35 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 36 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 37 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 38 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 39 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 40 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 41 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 42 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 43 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 44 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 45 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 46 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 47 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 48 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 49 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 50 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 51 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 52 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 53 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 54 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 55 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 56 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 57 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 58 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 59 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 60 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 61 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 62 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 63 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 64 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 65 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 66 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 67 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 68 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 69 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 70 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 71 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 72 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 73 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 74 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 75 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 76 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 77 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 78 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 79 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 80 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 81 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 82 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 83 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 84 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 85 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 86 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 87 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 88 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 89 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 90 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 91 | 2904699407 | |||
| 92 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 93 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 94 | 2906610324 | |||
| 95 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 96 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 97 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 98 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 99 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 100 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 101 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 102 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 103 | 2922368715 | |||
| 104 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 105 | 2922425934 | |||
| 106 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 107 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 108 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 109 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 110 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 111 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 112 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 113 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 114 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 115 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 116 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 117 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 118 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 119 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 120 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 121 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 122 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 123 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 124 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 125 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 126 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 127 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 128 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 129 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 130 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 131 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 132 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 133 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 134 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 135 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 136 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 137 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 138 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 139 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 140 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 141 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 142 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 143 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 144 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 145 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 146 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 147 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 148 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 149 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 150 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 151 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 152 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 153 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 154 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 155 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 156 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 157 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 158 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 159 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 160 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 161 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 162 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 163 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 164 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 165 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 166 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 167 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 168 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 169 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 170 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 171 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 172 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 173 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 174 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 175 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 176 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 177 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 178 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 179 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 180 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 181 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 182 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 183 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 184 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 185 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 186 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 187 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 189 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 190 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 191 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 192 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 193 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 195 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 202 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 205 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 209 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 210 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 211 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 212 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 213 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 214 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 216 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 218 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 220 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 221 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 222 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 223 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 224 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 225 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 226 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 227 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 228 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 229 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 230 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 231 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 232 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 233 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 235 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 236 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 237 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 238 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 239 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 240 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 241 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 242 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 243 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 244 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 246 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 247 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 248 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 249 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 260 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 274 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 275 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 276 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 277 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 278 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 282 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 284 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 337 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 338 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 339 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 340 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 341 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 345 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 346 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 347 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 348 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 349 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 350 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 351 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 352 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 353 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 354 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 355 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 356 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 357 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 358 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 359 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 360 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 361 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 362 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 363 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 364 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 365 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 366 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 367 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 368 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 369 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 370 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 371 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 372 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 373 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 374 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 375 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 376 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 377 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 378 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 379 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 380 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 381 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 382 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 383 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 384 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 385 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 386 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 387 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 388 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 389 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 390 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 391 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 392 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 462 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 463 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 464 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 465 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 466 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 467 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 468 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 469 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 470 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 471 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 472 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 473 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 474 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 475 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 476 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 477 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 478 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 479 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 480 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 481 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 482 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 483 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 484 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 485 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 513 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 514 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 515 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 516 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 517 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 521 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 525 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 526 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 527 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 528 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 529 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 530 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 531 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 532 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 533 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 534 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 535 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 536 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 537 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 538 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 539 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 540 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 541 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 542 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 543 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 544 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 545 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 546 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 547 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 548 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 549 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 550 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 551 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 552 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 553 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 554 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 555 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 556 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 557 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 558 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 559 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 560 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 561 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 562 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 563 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 564 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 565 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 566 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 567 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 568 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 569 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 570 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 571 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 572 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 573 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 574 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 575 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 576 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 577 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 578 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 579 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 580 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 581 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 582 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 583 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 584 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 585 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 586 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 587 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 588 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 589 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 590 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 591 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 592 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 593 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 594 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 595 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 596 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 597 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 598 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 599 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 600 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 601 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 602 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.99 |
| Metatranscriptomes | 0.1 |
| Isolates | 20.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.26 |
| Nodule | 17.09 |
| Rhizoplane | 5.53 |
| Rhizosphere | 55.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005984 | 3300001979 | Bacteria | 5089 |
| 2 | JGI24739J22299_10004386 | 3300001989 | Bacteria | 5402 |
| 3 | JGI24737J22298_10015446 | 3300001990 | Bacteria | 2471 |
| 4 | JGI25406J46586_10000123 | 3300003203 | Bacteria | 33753 |
| 5 | JGI25406J46586_10002008 | 3300003203 | Bacteria | 9613 |
| 6 | JGI25153J46596_10002285 | 3300003215 | Bacteria | 11162 |
| 7 | JGI25153J46596_10005506 | 3300003215 | Bacteria | 6629 |
| 8 | JGI25153J46596_10005817 | 3300003215 | Bacteria | 6409 |
| 9 | JGI25160J50197_1005444 | 3300003354 | Bacteria | 5295 |
| 10 | JGI25404J52841_10003298 | 3300003659 | Bacteria | 3173 |
| 11 | Ga0055531_10021311 | 3300003794 | Bacteria | 2518 |
| 12 | Ga0055543_1006286 | 3300004625 | Bacteria | 2898 |
| 13 | Ga0065165_1003123 | 3300005262 | Bacteria | 12280 |
| 14 | Ga0065165_1006880 | 3300005262 | Bacteria | 5780 |
| 15 | Ga0065165_1010731 | 3300005262 | Bacteria | 3914 |
| 16 | Ga0070658_10045091 | 3300005327 | Bacteria | 3564 |
| 17 | Ga0070683_100057406 | 3300005329 | Bacteria | 3616 |
| 18 | Ga0070690_100184592 | 3300005330 | Bacteria | 1442 |
| 19 | Ga0070690_100190181 | 3300005330 | Bacteria | 1423 |
| 20 | Ga0068869_100024807 | 3300005334 | Bacteria | 4156 |
| 21 | Ga0070680_100102798 | 3300005336 | Bacteria | 2373 |
| 22 | Ga0068868_100042173 | 3300005338 | Bacteria | 3559 |
| 23 | Ga0068868_100043361 | 3300005338 | Bacteria | 3514 |
| 24 | Ga0070660_100003353 | 3300005339 | Bacteria | 11009 |
| 25 | Ga0070689_100073764 | 3300005340 | Bacteria | 2669 |
| 26 | Ga0070689_100252738 | 3300005340 | Bacteria | 1455 |
| 27 | Ga0070691_10009236 | 3300005341 | Bacteria | 4506 |
| 28 | Ga0070661_100033003 | 3300005344 | Bacteria | 3750 |
| 29 | Ga0070668_100098996 | 3300005347 | Bacteria | 2308 |
| 30 | Ga0070668_100180384 | 3300005347 | Bacteria | 1724 |
| 31 | Ga0070668_100359349 | 3300005347 | Bacteria | 1234 |
| 32 | Ga0070668_100446215 | 3300005347 | Bacteria | 1111 |
| 33 | Ga0070667_100087287 | 3300005367 | Bacteria | 2677 |
| 34 | Ga0070667_100201256 | 3300005367 | Bacteria | 1767 |
| 35 | Ga0070709_10005731 | 3300005434 | Bacteria | 6736 |
| 36 | Ga0070709_10061536 | 3300005434 | Bacteria | 2390 |
| 37 | Ga0070709_10201390 | 3300005434 | Bacteria | 1410 |
| 38 | Ga0070714_100032179 | 3300005435 | Bacteria | 4377 |
| 39 | Ga0070714_100094816 | 3300005435 | Bacteria | 2620 |
| 40 | Ga0070714_100098779 | 3300005435 | Bacteria | 2568 |
| 41 | Ga0070713_100024272 | 3300005436 | Bacteria | 4721 |
| 42 | Ga0070713_100056432 | 3300005436 | Bacteria | 3267 |
| 43 | Ga0070710_10007859 | 3300005437 | Bacteria | 5178 |
| 44 | Ga0070711_100292297 | 3300005439 | Bacteria | 1293 |
| 45 | Ga0070700_100032463 | 3300005441 | Bacteria | 3137 |
| 46 | Ga0070708_100024114 | 3300005445 | Bacteria | 5182 |
| 47 | Ga0070663_100014544 | 3300005455 | Bacteria | 5054 |
| 48 | Ga0070663_100028930 | 3300005455 | Bacteria | 3779 |
| 49 | Ga0070663_100070652 | 3300005455 | Bacteria | 2539 |
| 50 | Ga0070663_100110754 | 3300005455 | Bacteria | 2062 |
| 51 | Ga0070663_100161969 | 3300005455 | Bacteria | 1722 |
| 52 | Ga0070678_100106000 | 3300005456 | Bacteria | 2189 |
| 53 | Ga0070678_100145932 | 3300005456 | Bacteria | 1899 |
| 54 | Ga0070681_10033490 | 3300005458 | Bacteria | 5158 |
| 55 | Ga0070681_10043155 | 3300005458 | Bacteria | 4518 |
| 56 | Ga0070681_10298396 | 3300005458 | Bacteria | 1521 |
| 57 | Ga0068867_100114226 | 3300005459 | Bacteria | 2079 |
| 58 | Ga0070706_100093394 | 3300005467 | Bacteria | 2792 |
| 59 | Ga0070679_100012111 | 3300005530 | Bacteria | 8239 |
| 60 | Ga0070679_100099831 | 3300005530 | Bacteria | 2890 |
| 61 | Ga0070679_100106689 | 3300005530 | Bacteria | 2787 |
| 62 | Ga0070679_100161305 | 3300005530 | Bacteria | 2216 |
| 63 | Ga0070684_100006286 | 3300005535 | Bacteria | 9176 |
| 64 | Ga0070684_100025288 | 3300005535 | Bacteria | 4989 |
| 65 | Ga0070684_100122766 | 3300005535 | Bacteria | 2337 |
| 66 | Ga0068853_100001496 | 3300005539 | Bacteria | 16976 |
| 67 | Ga0068853_100134129 | 3300005539 | Bacteria | 2218 |
| 68 | Ga0068853_100197741 | 3300005539 | Bacteria | 1829 |
| 69 | Ga0070672_100113902 | 3300005543 | Bacteria | 2207 |
| 70 | Ga0070672_100123570 | 3300005543 | Bacteria | 2121 |
| 71 | Ga0070686_100022890 | 3300005544 | Bacteria | 3727 |
| 72 | Ga0070665_100078725 | 3300005548 | Bacteria | 3303 |
| 73 | Ga0070665_100118190 | 3300005548 | Bacteria | 2653 |
| 74 | Ga0070665_100156929 | 3300005548 | Bacteria | 2277 |
| 75 | Ga0070665_100157826 | 3300005548 | Bacteria | 2270 |
| 76 | Ga0070665_100200236 | 3300005548 | Bacteria | 1997 |
| 77 | Ga0070665_100470972 | 3300005548 | Bacteria | 1267 |
| 78 | Ga0068855_100063917 | 3300005563 | Bacteria | 4293 |
| 79 | Ga0068855_100066937 | 3300005563 | Bacteria | 4187 |
| 80 | Ga0068855_100433287 | 3300005563 | Bacteria | 1437 |
| 81 | Ga0070664_100233944 | 3300005564 | Bacteria | 1648 |
| 82 | Ga0070664_100304479 | 3300005564 | Bacteria | 1441 |
| 83 | Ga0068857_100004210 | 3300005577 | Bacteria | 12119 |
| 84 | Ga0068857_100012909 | 3300005577 | Bacteria | 7278 |
| 85 | Ga0068857_100056749 | 3300005577 | Bacteria | 3475 |
| 86 | Ga0068857_100220946 | 3300005577 | Bacteria | 1731 |
| 87 | Ga0068854_100008298 | 3300005578 | Bacteria | 6670 |
| 88 | Ga0068854_100028729 | 3300005578 | Bacteria | 3845 |
| 89 | Ga0068856_100006410 | 3300005614 | Bacteria | 11545 |
| 90 | Ga0068856_100019463 | 3300005614 | Bacteria | 6589 |
| 91 | Ga0068856_100025897 | 3300005614 | Bacteria | 5721 |
| 92 | Ga0068852_100076214 | 3300005616 | Bacteria | 2960 |
| 93 | Ga0068852_100081965 | 3300005616 | Bacteria | 2865 |
| 94 | Ga0068852_100225411 | 3300005616 | Bacteria | 1784 |
| 95 | Ga0068852_100256096 | 3300005616 | Bacteria | 1678 |
| 96 | Ga0068864_100037084 | 3300005618 | Bacteria | 4158 |
| 97 | Ga0068861_100072083 | 3300005719 | Bacteria | 2679 |
| 98 | Ga0068861_100124194 | 3300005719 | Bacteria | 2086 |
| 99 | Ga0068851_10005600 | 3300005834 | Bacteria | 5700 |
| 100 | Ga0068870_10024112 | 3300005840 | Bacteria | 3009 |
| 101 | Ga0068870_10065820 | 3300005840 | Bacteria | 1961 |
| 102 | Ga0068858_100085735 | 3300005842 | Bacteria | 2930 |
| 103 | Ga0068860_100003385 | 3300005843 | Bacteria | 16406 |
| 104 | Ga0068860_100053426 | 3300005843 | Bacteria | 3841 |
| 105 | Ga0068860_100087726 | 3300005843 | Bacteria | 2961 |
| 106 | Ga0068860_100096524 | 3300005843 | Bacteria | 2817 |
| 107 | Ga0068862_100122064 | 3300005844 | Bacteria | 2297 |
| 108 | Ga0068862_100138897 | 3300005844 | Bacteria | 2155 |
| 109 | Ga0068862_100146834 | 3300005844 | Bacteria | 2096 |
| 110 | Ga0081455_10033441 | 3300005937 | Bacteria | 4621 |
| 111 | Ga0081455_10047745 | 3300005937 | Bacteria | 3705 |
| 112 | Ga0081455_10120966 | 3300005937 | Bacteria | 2063 |
| 113 | Ga0081540_1005016 | 3300005983 | Bacteria | 9944 |
| 114 | Ga0081540_1005788 | 3300005983 | Bacteria | 9148 |
| 115 | Ga0081540_1013150 | 3300005983 | Bacteria | 5401 |
| 116 | Ga0081540_1015887 | 3300005983 | Bacteria | 4745 |
| 117 | Ga0081540_1016301 | 3300005983 | Bacteria | 4655 |
| 118 | Ga0081540_1029678 | 3300005983 | Bacteria | 3042 |
| 119 | Ga0081540_1050413 | 3300005983 | Bacteria | 2068 |
| 120 | Ga0081539_10000425 | 3300005985 | Bacteria | 89942 |
| 121 | Ga0081539_10001098 | 3300005985 | Bacteria | 49182 |
| 122 | Ga0070717_10153473 | 3300006028 | Bacteria | 1994 |
| 123 | Ga0075365_10045227 | 3300006038 | Bacteria | 2887 |
| 124 | Ga0075368_10016457 | 3300006042 | Bacteria | 2756 |
| 125 | Ga0075363_100010103 | 3300006048 | Bacteria | 4463 |
| 126 | Ga0075363_100125860 | 3300006048 | Bacteria | 1435 |
| 127 | Ga0075364_10038022 | 3300006051 | Bacteria | 3118 |
| 128 | Ga0070715_10007812 | 3300006163 | Bacteria | 3697 |
| 129 | Ga0070716_100010967 | 3300006173 | Bacteria | 4559 |
| 130 | Ga0070716_100061025 | 3300006173 | Bacteria | 2180 |
| 131 | Ga0075362_10072451 | 3300006177 | Bacteria | 1576 |
| 132 | Ga0075362_10079776 | 3300006177 | Bacteria | 1507 |
| 133 | Ga0075367_10126702 | 3300006178 | Bacteria | 1576 |
| 134 | Ga0075369_10063613 | 3300006186 | Bacteria | 1614 |
| 135 | Ga0075369_10104716 | 3300006186 | Bacteria | 1271 |
| 136 | Ga0075366_10060813 | 3300006195 | Bacteria | 2244 |
| 137 | Ga0075366_10068019 | 3300006195 | Bacteria | 2120 |
| 138 | Ga0097621_100237098 | 3300006237 | Bacteria | 1594 |
| 139 | Ga0068871_100052977 | 3300006358 | Bacteria | 3287 |
| 140 | Ga0099822_1018262 | 3300006943 | Bacteria | 7332 |
| 141 | Ga0099823_1029329 | 3300006944 | Bacteria | 4670 |
| 142 | Ga0099794_10033678 | 3300007265 | Bacteria | 2409 |
| 143 | Ga0105250_10083843 | 3300009092 | Bacteria | 1293 |
| 144 | Ga0105240_10009125 | 3300009093 | Bacteria | 14079 |
| 145 | Ga0105240_10019788 | 3300009093 | Bacteria | 8990 |
| 146 | Ga0105240_10027761 | 3300009093 | Bacteria | 7408 |
| 147 | Ga0105240_10046064 | 3300009093 | Bacteria | 5528 |
| 148 | Ga0105240_10084839 | 3300009093 | Bacteria | 3882 |
| 149 | Ga0105240_10095537 | 3300009093 | Bacteria | 3624 |
| 150 | Ga0105240_10261557 | 3300009093 | Bacteria | 1996 |
| 151 | Ga0105245_10034045 | 3300009098 | Bacteria | 4516 |
| 152 | Ga0105245_10053806 | 3300009098 | Bacteria | 3614 |
| 153 | Ga0105245_10493903 | 3300009098 | Bacteria | 1239 |
| 154 | Ga0105245_10545733 | 3300009098 | Bacteria | 1181 |
| 155 | Ga0105243_10275452 | 3300009148 | Bacteria | 1513 |
| 156 | Ga0105241_10015112 | 3300009174 | Bacteria | 5655 |
| 157 | Ga0105241_10047557 | 3300009174 | Bacteria | 3262 |
| 158 | Ga0105241_10106672 | 3300009174 | Bacteria | 2236 |
| 159 | Ga0105241_10278267 | 3300009174 | Bacteria | 1428 |
| 160 | Ga0105242_10173029 | 3300009176 | Bacteria | 1899 |
| 161 | Ga0105248_10155290 | 3300009177 | Bacteria | 2582 |
| 162 | Ga0105248_10226148 | 3300009177 | Bacteria | 2106 |
| 163 | Ga0105248_10310941 | 3300009177 | Bacteria | 1774 |
| 164 | Ga0105237_10008895 | 3300009545 | Bacteria | 10820 |
| 165 | Ga0105237_10018559 | 3300009545 | Bacteria | 7197 |
| 166 | Ga0105237_10100467 | 3300009545 | Bacteria | 2884 |
| 167 | Ga0105237_10389635 | 3300009545 | Bacteria | 1398 |
| 168 | Ga0105237_10397622 | 3300009545 | Bacteria | 1383 |
| 169 | Ga0105238_10026375 | 3300009551 | Bacteria | 5924 |
| 170 | Ga0105238_10041248 | 3300009551 | Bacteria | 4675 |
| 171 | Ga0105249_10087482 | 3300009553 | Bacteria | 2907 |
| 172 | Ga0099796_10047241 | 3300010159 | Bacteria | 1481 |
| 173 | Ga0105239_10008167 | 3300010375 | Bacteria | 11943 |
| 174 | Ga0105239_10063897 | 3300010375 | Bacteria | 4041 |
| 175 | Ga0105239_10079757 | 3300010375 | Bacteria | 3602 |
| 176 | Ga0105239_10081869 | 3300010375 | Bacteria | 3553 |
| 177 | Ga0105239_10227474 | 3300010375 | Bacteria | 2093 |
| 178 | Ga0105239_10229212 | 3300010375 | Bacteria | 2084 |
| 179 | Ga0105239_10335332 | 3300010375 | Bacteria | 1706 |
| 180 | Ga0105246_10012004 | 3300011119 | Bacteria | 5394 |
| 181 | Ga0157370_10215213 | 3300013104 | Bacteria | 1780 |
| 182 | Ga0157369_10031661 | 3300013105 | Bacteria | 5821 |
| 183 | Ga0157369_10047829 | 3300013105 | Bacteria | 4642 |
| 184 | Ga0157369_10091731 | 3300013105 | Bacteria | 3242 |
| 185 | Ga0157369_10160062 | 3300013105 | Bacteria | 2376 |
| 186 | Ga0157369_10175210 | 3300013105 | Bacteria | 2258 |
| 187 | Ga0157374_10061812 | 3300013296 | Bacteria | 3509 |
| 188 | Ga0157374_10353160 | 3300013296 | Bacteria | 1461 |
| 189 | Ga0157378_10073096 | 3300013297 | Bacteria | 3082 |
| 190 | Ga0157378_10177625 | 3300013297 | Bacteria | 2001 |
| 191 | Ga0163162_10020348 | 3300013306 | Bacteria | 6519 |
| 192 | Ga0157372_10327651 | 3300013307 | Bacteria | 1783 |
| 193 | Ga0157375_10047373 | 3300013308 | Bacteria | 4198 |
| 194 | Ga0157375_10801243 | 3300013308 | Bacteria | 1091 |
| 195 | Ga0163163_10248535 | 3300014325 | Bacteria | 1829 |
| 196 | Ga0163163_10295461 | 3300014325 | Bacteria | 1672 |
| 197 | Ga0163163_10579047 | 3300014325 | Bacteria | 1185 |
| 198 | Ga0157380_10230938 | 3300014326 | Bacteria | 1662 |
| 199 | Ga0157376_10018726 | 3300014969 | Bacteria | 5318 |
| 200 | Ga0157376_10120672 | 3300014969 | Bacteria | 2323 |
| 201 | Ga0163161_10223764 | 3300017792 | Bacteria | 1458 |
| 202 | Ga0206356_10561849 | 3300020070 | Bacteria | 2527 |
| 203 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 204 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 205 | Ga0214542_1024107 | 3300021321 | Bacteria | 3474 |
| 206 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 207 | Ga0214545_1021600 | 3300021324 | Bacteria | 4771 |
| 208 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 209 | Ga0214543_1028960 | 3300021327 | Bacteria | 2544 |
| 210 | Ga0209148_1000707 | 3300025254 | Bacteria | 26803 |
| 211 | Ga0209148_1006688 | 3300025254 | Bacteria | 2472 |
| 212 | Ga0209233_1001624 | 3300025261 | Bacteria | 8741 |
| 213 | Ga0209455_1004030 | 3300025272 | Bacteria | 4969 |
| 214 | Ga0209455_1011648 | 3300025272 | Bacteria | 2152 |
| 215 | Ga0209564_1009335 | 3300025295 | Bacteria | 4684 |
| 216 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 217 | Ga0209758_1002009 | 3300025297 | Bacteria | 21878 |
| 218 | Ga0209758_1002765 | 3300025297 | Bacteria | 17179 |
| 219 | Ga0209758_1003053 | 3300025297 | Bacteria | 15935 |
| 220 | Ga0209758_1006390 | 3300025297 | Bacteria | 8493 |
| 221 | Ga0209758_1026073 | 3300025297 | Bacteria | 2543 |
| 222 | Ga0209758_1027003 | 3300025297 | Bacteria | 2467 |
| 223 | Ga0209758_1033325 | 3300025297 | Bacteria | 2071 |
| 224 | Ga0209256_1004898 | 3300025299 | Bacteria | 8041 |
| 225 | Ga0209256_1024707 | 3300025299 | Bacteria | 1764 |
| 226 | Ga0207426_1000337 | 3300025302 | Bacteria | 88200 |
| 227 | Ga0207426_1009208 | 3300025302 | Bacteria | 3925 |
| 228 | Ga0207426_1027419 | 3300025302 | Bacteria | 1898 |
| 229 | Ga0209051_1032436 | 3300025303 | Bacteria | 1993 |
| 230 | Ga0209257_1000684 | 3300025304 | Bacteria | 52769 |
| 231 | Ga0207656_10009458 | 3300025321 | Bacteria | 3621 |
| 232 | Ga0207692_10026043 | 3300025898 | Bacteria | 2740 |
| 233 | Ga0207688_10037217 | 3300025901 | Bacteria | 2698 |
| 234 | Ga0207647_10009009 | 3300025904 | Bacteria | 7112 |
| 235 | Ga0207647_10038569 | 3300025904 | Bacteria | 3019 |
| 236 | Ga0207699_10003881 | 3300025906 | Bacteria | 7143 |
| 237 | Ga0207699_10118520 | 3300025906 | Bacteria | 1708 |
| 238 | Ga0207699_10152168 | 3300025906 | Bacteria | 1532 |
| 239 | Ga0207643_10023699 | 3300025908 | Bacteria | 3386 |
| 240 | Ga0207684_10133431 | 3300025910 | Bacteria | 2131 |
| 241 | Ga0207654_10000811 | 3300025911 | Bacteria | 17219 |
| 242 | Ga0207654_10019681 | 3300025911 | Bacteria | 3568 |
| 243 | Ga0207707_10001933 | 3300025912 | Bacteria | 18846 |
| 244 | Ga0207707_10012323 | 3300025912 | Bacteria | 7431 |
| 245 | Ga0207707_10028406 | 3300025912 | Bacteria | 4889 |
| 246 | Ga0207707_10102500 | 3300025912 | Bacteria | 2502 |
| 247 | Ga0207707_10119914 | 3300025912 | Bacteria | 2299 |
| 248 | Ga0207695_10000478 | 3300025913 | Bacteria | 86076 |
| 249 | Ga0207695_10036803 | 3300025913 | Bacteria | 5286 |
| 250 | Ga0207695_10056295 | 3300025913 | Bacteria | 4093 |
| 251 | Ga0207695_10070144 | 3300025913 | Bacteria | 3584 |
| 252 | Ga0207695_10134917 | 3300025913 | Bacteria | 2422 |
| 253 | Ga0207671_10032007 | 3300025914 | Bacteria | 3916 |
| 254 | Ga0207671_10042721 | 3300025914 | Bacteria | 3355 |
| 255 | Ga0207671_10089412 | 3300025914 | Bacteria | 2318 |
| 256 | Ga0207693_10003096 | 3300025915 | Bacteria | 14328 |
| 257 | Ga0207693_10020323 | 3300025915 | Bacteria | 5283 |
| 258 | Ga0207663_10001112 | 3300025916 | Bacteria | 12359 |
| 259 | Ga0207663_10012363 | 3300025916 | Bacteria | 4614 |
| 260 | Ga0207663_10239084 | 3300025916 | Bacteria | 1331 |
| 261 | Ga0207660_10009206 | 3300025917 | Bacteria | 6389 |
| 262 | Ga0207660_10076411 | 3300025917 | Bacteria | 2449 |
| 263 | Ga0207657_10012730 | 3300025919 | Bacteria | 8285 |
| 264 | Ga0207657_10017675 | 3300025919 | Bacteria | 6833 |
| 265 | Ga0207649_10021842 | 3300025920 | Bacteria | 3692 |
| 266 | Ga0207649_10063456 | 3300025920 | Bacteria | 2332 |
| 267 | Ga0207652_10198229 | 3300025921 | Bacteria | 1807 |
| 268 | Ga0207694_10001415 | 3300025924 | Bacteria | 20567 |
| 269 | Ga0207694_10126400 | 3300025924 | Bacteria | 2046 |
| 270 | Ga0207687_10027005 | 3300025927 | Bacteria | 3848 |
| 271 | Ga0207700_10059772 | 3300025928 | Bacteria | 2884 |
| 272 | Ga0207700_10242362 | 3300025928 | Bacteria | 1537 |
| 273 | Ga0207700_10315270 | 3300025928 | Bacteria | 1354 |
| 274 | Ga0207664_10260461 | 3300025929 | Bacteria | 1517 |
| 275 | Ga0207644_10059354 | 3300025931 | Bacteria | 2767 |
| 276 | Ga0207644_10060900 | 3300025931 | Bacteria | 2732 |
| 277 | Ga0207644_10062417 | 3300025931 | Bacteria | 2703 |
| 278 | Ga0207690_10067493 | 3300025932 | Bacteria | 2453 |
| 279 | Ga0207706_10044185 | 3300025933 | Bacteria | 3950 |
| 280 | Ga0207706_10146531 | 3300025933 | Bacteria | 2077 |
| 281 | Ga0207706_10303410 | 3300025933 | Bacteria | 1391 |
| 282 | Ga0207686_10056769 | 3300025934 | Bacteria | 2462 |
| 283 | Ga0207665_10000703 | 3300025939 | Bacteria | 22673 |
| 284 | Ga0207711_10064333 | 3300025941 | Bacteria | 3168 |
| 285 | Ga0207711_10100776 | 3300025941 | Bacteria | 2555 |
| 286 | Ga0207711_10104563 | 3300025941 | Bacteria | 2509 |
| 287 | Ga0207689_10099354 | 3300025942 | Bacteria | 2391 |
| 288 | Ga0207661_10000171 | 3300025944 | Bacteria | 41708 |
| 289 | Ga0207679_10084259 | 3300025945 | Bacteria | 2439 |
| 290 | Ga0207667_10011741 | 3300025949 | Bacteria | 10158 |
| 291 | Ga0207667_10013826 | 3300025949 | Bacteria | 9221 |
| 292 | Ga0207667_10046090 | 3300025949 | Bacteria | 4616 |
| 293 | Ga0207667_10115820 | 3300025949 | Bacteria | 2762 |
| 294 | Ga0207667_10216123 | 3300025949 | Bacteria | 1964 |
| 295 | Ga0207667_10305414 | 3300025949 | Bacteria | 1625 |
| 296 | Ga0207651_10087242 | 3300025960 | Bacteria | 2271 |
| 297 | Ga0207712_10131292 | 3300025961 | Bacteria | 1909 |
| 298 | Ga0207668_10037794 | 3300025972 | Bacteria | 3234 |
| 299 | Ga0207668_10058342 | 3300025972 | Bacteria | 2697 |
| 300 | Ga0207668_10133717 | 3300025972 | Bacteria | 1897 |
| 301 | Ga0207640_10098749 | 3300025981 | Bacteria | 2042 |
| 302 | Ga0207640_10149654 | 3300025981 | Bacteria | 1713 |
| 303 | Ga0207640_10195880 | 3300025981 | Bacteria | 1527 |
| 304 | Ga0207658_10082202 | 3300025986 | Bacteria | 2473 |
| 305 | Ga0207658_10107001 | 3300025986 | Bacteria | 2203 |
| 306 | Ga0207677_10029675 | 3300026023 | Bacteria | 3480 |
| 307 | Ga0207677_10078745 | 3300026023 | Bacteria | 2354 |
| 308 | Ga0207703_10014325 | 3300026035 | Bacteria | 6185 |
| 309 | Ga0207639_10052277 | 3300026041 | Bacteria | 3113 |
| 310 | Ga0207639_10092227 | 3300026041 | Bacteria | 2427 |
| 311 | Ga0207639_10107568 | 3300026041 | Bacteria | 2266 |
| 312 | Ga0207639_10190846 | 3300026041 | Bacteria | 1750 |
| 313 | Ga0207639_10398623 | 3300026041 | Bacteria | 1239 |
| 314 | Ga0207678_10014592 | 3300026067 | Bacteria | 6914 |
| 315 | Ga0207678_10027004 | 3300026067 | Bacteria | 5006 |
| 316 | Ga0207678_10027182 | 3300026067 | Bacteria | 4990 |
| 317 | Ga0207678_10041915 | 3300026067 | Bacteria | 3968 |
| 318 | Ga0207708_10028467 | 3300026075 | Bacteria | 4231 |
| 319 | Ga0207708_10102817 | 3300026075 | Bacteria | 2212 |
| 320 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 321 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 322 | Ga0207702_10252439 | 3300026078 | Bacteria | 1657 |
| 323 | Ga0207641_10112364 | 3300026088 | Bacteria | 2417 |
| 324 | Ga0207648_10023386 | 3300026089 | Bacteria | 5536 |
| 325 | Ga0207648_10151941 | 3300026089 | Bacteria | 2043 |
| 326 | Ga0207676_10036319 | 3300026095 | Bacteria | 3747 |
| 327 | Ga0207674_10004961 | 3300026116 | Bacteria | 15902 |
| 328 | Ga0207674_10009035 | 3300026116 | Bacteria | 11446 |
| 329 | Ga0207674_10044466 | 3300026116 | Bacteria | 4574 |
| 330 | Ga0207674_10129128 | 3300026116 | Bacteria | 2492 |
| 331 | Ga0207675_100024290 | 3300026118 | Bacteria | 5636 |
| 332 | Ga0207675_100107005 | 3300026118 | Bacteria | 2637 |
| 333 | Ga0207675_100171275 | 3300026118 | Bacteria | 2075 |
| 334 | Ga0207675_100354476 | 3300026118 | Bacteria | 1438 |
| 335 | Ga0207683_10014788 | 3300026121 | Bacteria | 6643 |
| 336 | Ga0207683_10113791 | 3300026121 | Bacteria | 2424 |
| 337 | Ga0207698_10059209 | 3300026142 | Bacteria | 2973 |
| 338 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 339 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 340 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 341 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 342 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 343 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 344 | Ga0209813_10065617 | 3300027866 | Bacteria | 1169 |
| 345 | Ga0268266_10004322 | 3300028379 | Bacteria | 13666 |
| 346 | Ga0268266_10006723 | 3300028379 | Bacteria | 10484 |
| 347 | Ga0268266_10020674 | 3300028379 | Bacteria | 5610 |
| 348 | Ga0268266_10038251 | 3300028379 | Bacteria | 4086 |
| 349 | Ga0268266_10157354 | 3300028379 | Bacteria | 2053 |
| 350 | Ga0268266_10168492 | 3300028379 | Bacteria | 1986 |
| 351 | Ga0268265_10050871 | 3300028380 | Bacteria | 3124 |
| 352 | Ga0268265_10156107 | 3300028380 | Bacteria | 1931 |
| 353 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 354 | Ga0307515_10240563 | 3300028794 | Bacteria | 1582 |
| 355 | Ga0265330_10036743 | 3300031235 | Bacteria | 2182 |
| 356 | Ga0265316_10200092 | 3300031344 | Bacteria | 1481 |
| 357 | Ga0307509_10006260 | 3300031507 | Bacteria | 16085 |
| 358 | Ga0265313_10032460 | 3300031595 | Bacteria | 2666 |
| 359 | Ga0265314_10022030 | 3300031711 | Bacteria | 4886 |
| 360 | Ga0265342_10013040 | 3300031712 | Bacteria | 5600 |
| 361 | Ga0307516_10282320 | 3300031730 | Bacteria | 1342 |
| 362 | Ga0307416_100209239 | 3300032002 | Bacteria | 1859 |
| 363 | Ga0307507_10051819 | 3300033179 | Bacteria | 3944 |
| 364 | Ga0307510_10007708 | 3300033180 | Bacteria | 12837 |
| 365 | Ga0307510_10015767 | 3300033180 | Bacteria | 8935 |
| 366 | Ga0307510_10079377 | 3300033180 | Bacteria | 3201 |
| 367 | Ga0373929_0015395 | 3300035085 | Bacteria | 1487 |
| 368 | Ga0373934_0004936 | 3300035086 | Bacteria | 4940 |
| 369 | Ga0373923_0018906 | 3300035111 | Bacteria | 2660 |
| 370 | Ga0373923_0023254 | 3300035111 | Bacteria | 2437 |
| 371 | Ga0373936_0053549 | 3300035113 | Bacteria | 1636 |
| 372 | Ga0373945_0031078 | 3300035116 | Bacteria | 1885 |
| 373 | Ga0373953_0017673 | 3300035117 | Bacteria | 2626 |
| 374 | Ga0373954_0002374 | 3300035118 | Bacteria | 7874 |
| 375 | Ga0373954_0011969 | 3300035118 | Bacteria | 3853 |
| 376 | Ga0373954_0025175 | 3300035118 | Bacteria | 2718 |
| 377 | Ga0373956_0011847 | 3300035119 | Bacteria | 3602 |
| 378 | Ga0373956_0019983 | 3300035119 | Bacteria | 2844 |
| 379 | Ga0373957_0008219 | 3300035120 | Bacteria | 3371 |
| 380 | Ga0373943_0003127 | 3300035170 | Bacteria | 7525 |
| 381 | Ga0373946_0003423 | 3300035171 | Bacteria | 5632 |
| 382 | Ga0373955_0000590 | 3300035172 | Bacteria | 15443 |
| 383 | Ga0373955_0070318 | 3300035172 | Bacteria | 1955 |
| 384 | Ga0373924_0017284 | 3300035410 | Bacteria | 2765 |
| 385 | Ga0373924_0049834 | 3300035410 | Bacteria | 1733 |
| 386 | Ga0373931_0023347 | 3300035691 | Bacteria | 3121 |
| 387 | Ga0373935_0000569 | 3300035692 | Bacteria | 19226 |
| 388 | Ga0373935_0020182 | 3300035692 | Bacteria | 4068 |
| 389 | Ga0373927_0008338 | 3300035695 | Bacteria | 6977 |
| 390 | Ga0373927_0016947 | 3300035695 | Bacteria | 4801 |
| 391 | Ga0373933_0000180 | 3300035724 | Bacteria | 41838 |
| 392 | Ga0373933_0116885 | 3300035724 | Bacteria | 1667 |
| 393 | Ga0373947_0005868 | 3300035725 | Bacteria | 7152 |
| 394 | Ga0373947_0085749 | 3300035725 | Bacteria | 1956 |
| 395 | Ga0373947_0090542 | 3300035725 | Bacteria | 1907 |
| 396 | Ga0373937_0014626 | 3300036401 | Bacteria | 6930 |
| 397 | Ga0373937_0053457 | 3300036401 | Bacteria | 3705 |
| 398 | Ga0373937_0224225 | 3300036401 | Bacteria | 1769 |
| 399 | Ga0373925_0030197 | 3300037068 | Bacteria | 3977 |
| 400 | Ga0395899_0193077 | 3300037312 | Bacteria | 1424 |
| 401 | Ga0395900_0000753 | 3300037418 | Bacteria | 43021 |
| 402 | Ga0395900_0011126 | 3300037418 | Bacteria | 9197 |
| 403 | Ga0395900_0034589 | 3300037418 | Bacteria | 5205 |
| 404 | Ga0395900_0079769 | 3300037418 | Bacteria | 3364 |
| 405 | Ga0395898_0005579 | 3300037466 | Bacteria | 13568 |
| 406 | Ga0395898_0029509 | 3300037466 | Bacteria | 5494 |
| 407 | Ga0395898_0090869 | 3300037466 | Bacteria | 2938 |
| 408 | Ga0395898_0297732 | 3300037466 | Bacteria | 1539 |
| 409 | Ga0395898_0398421 | 3300037466 | Bacteria | 1312 |
| 410 | Ga0395905_0006649 | 3300037471 | Bacteria | 11595 |
| 411 | Ga0395905_0057052 | 3300037471 | Bacteria | 3652 |
| 412 | Ga0395905_0058930 | 3300037471 | Bacteria | 3590 |
| 413 | Ga0395905_0531533 | 3300037471 | Bacteria | 1077 |
| 414 | Ga0436364_0683264 | 3300037853 | Bacteria | 5939 |
| 415 | Ga0395901_0063621 | 3300038443 | Bacteria | 3840 |
| 416 | Ga0395901_0293763 | 3300038443 | Bacteria | 1686 |
| 417 | Ga0395901_0372305 | 3300038443 | Bacteria | 1471 |
| 418 | Ga0436365_0966326 | 3300039437 | Bacteria | 1075 |
| 419 | Ga0436365_1737269 | 3300039437 | Bacteria | 3029 |
| 420 | Ga0466972_0000771 | 3300044658 | Bacteria | 15229 |
| 421 | Ga0466972_0003626 | 3300044658 | Bacteria | 7673 |
| 422 | Ga0466965_0033173 | 3300044683 | Bacteria | 2523 |
| 423 | Ga0466966_0000720 | 3300044684 | Bacteria | 20983 |
| 424 | Ga0466961_0000136 | 3300044693 | Bacteria | 49049 |
| 425 | Ga0466961_0031967 | 3300044693 | Bacteria | 3382 |
| 426 | Ga0466963_0082772 | 3300044694 | Bacteria | 2176 |
| 427 | Ga0466968_0106163 | 3300044735 | Bacteria | 1259 |
| 428 | Ga0466957_0080681 | 3300044842 | Bacteria | 2026 |
| 429 | Ga0466957_0090965 | 3300044842 | Bacteria | 1912 |
| 430 | Ga0466960_0056191 | 3300044901 | Bacteria | 1915 |
| 431 | Ga0466959_0036415 | 3300045049 | Bacteria | 3636 |
| 432 | Ga0466959_0084671 | 3300045049 | Bacteria | 2282 |
| 433 | Ga0466967_0195562 | 3300045976 | Bacteria | 1913 |
| 434 | Ga0466967_0198779 | 3300045976 | Bacteria | 1898 |
| 435 | Ga0466967_0303482 | 3300045976 | Bacteria | 1536 |
| 436 | Ga0495592_0007391 | 3300046454 | Bacteria | 8221 |
| 437 | Ga0495592_0074009 | 3300046454 | Bacteria | 2475 |
| 438 | Ga0495603_0003935 | 3300046455 | Bacteria | 8851 |
| 439 | Ga0495603_0009958 | 3300046455 | Bacteria | 5753 |
| 440 | Ga0495603_0017918 | 3300046455 | Bacteria | 4286 |
| 441 | Ga0495603_0033395 | 3300046455 | Bacteria | 3096 |
| 442 | Ga0495603_0150103 | 3300046455 | Bacteria | 1354 |
| 443 | Ga0495629_0020427 | 3300046459 | Bacteria | 4730 |
| 444 | Ga0495629_0127125 | 3300046459 | Bacteria | 1776 |
| 445 | Ga0495629_0180633 | 3300046459 | Bacteria | 1462 |
| 446 | Ga0495638_0025345 | 3300046460 | Bacteria | 3856 |
| 447 | Ga0495638_0040365 | 3300046460 | Bacteria | 2957 |
| 448 | Ga0495638_0063301 | 3300046460 | Bacteria | 2281 |
| 449 | Ga0495638_0138305 | 3300046460 | Bacteria | 1424 |
| 450 | Ga0495641_0001899 | 3300046461 | Bacteria | 17063 |
| 451 | Ga0495641_0054881 | 3300046461 | Bacteria | 1810 |
| 452 | Ga0495651_0009620 | 3300046462 | Bacteria | 7427 |
| 453 | Ga0495651_0015465 | 3300046462 | Bacteria | 5903 |
| 454 | Ga0495651_0086272 | 3300046462 | Bacteria | 2362 |
| 455 | Ga0495653_0017260 | 3300046463 | Bacteria | 5871 |
| 456 | Ga0495650_0025642 | 3300046471 | Bacteria | 2758 |
| 457 | Ga0495580_0001711 | 3300046472 | Bacteria | 19280 |
| 458 | Ga0495639_0000278 | 3300046475 | Bacteria | 25216 |
| 459 | Ga0495639_0034245 | 3300046475 | Bacteria | 2271 |
| 460 | Ga0495639_0050147 | 3300046475 | Bacteria | 1895 |
| 461 | Ga0495639_0202392 | 3300046475 | Bacteria | 972 |
| 462 | Ga0495662_0000176 | 3300046476 | Bacteria | 25547 |
| 463 | Ga0495664_0018996 | 3300046477 | Bacteria | 3947 |
| 464 | Ga0495585_0081204 | 3300046492 | Bacteria | 1756 |
| 465 | Ga0495594_0000541 | 3300046499 | Bacteria | 19378 |
| 466 | Ga0495594_0033984 | 3300046499 | Bacteria | 2773 |
| 467 | Ga0495583_0036700 | 3300046506 | Bacteria | 2329 |
| 468 | Ga0495606_0001686 | 3300046507 | Bacteria | 28531 |
| 469 | Ga0495606_0012721 | 3300046507 | Bacteria | 6710 |
| 470 | Ga0495606_0121016 | 3300046507 | Bacteria | 1567 |
| 471 | Ga0495606_0195499 | 3300046507 | Bacteria | 1156 |
| 472 | Ga0495610_0026186 | 3300046512 | Bacteria | 3118 |
| 473 | Ga0495616_0054583 | 3300046513 | Bacteria | 1981 |
| 474 | Ga0495618_0023387 | 3300046514 | Bacteria | 3820 |
| 475 | Ga0495628_0011834 | 3300046516 | Bacteria | 7362 |
| 476 | Ga0495628_0023752 | 3300046516 | Bacteria | 5027 |
| 477 | Ga0495628_0065962 | 3300046516 | Bacteria | 2830 |
| 478 | Ga0495630_0001818 | 3300046517 | Bacteria | 14885 |
| 479 | Ga0495630_0020042 | 3300046517 | Bacteria | 4925 |
| 480 | Ga0495631_0022621 | 3300046518 | Bacteria | 2922 |
| 481 | Ga0495632_0061326 | 3300046519 | Bacteria | 1825 |
| 482 | Ga0495632_0112496 | 3300046519 | Bacteria | 1277 |
| 483 | Ga0495648_0032593 | 3300046524 | Bacteria | 3416 |
| 484 | Ga0495652_0033670 | 3300046529 | Bacteria | 4470 |
| 485 | Ga0495652_0059010 | 3300046529 | Bacteria | 3248 |
| 486 | Ga0495652_0074271 | 3300046529 | Bacteria | 2828 |
| 487 | Ga0495652_0103100 | 3300046529 | Bacteria | 2310 |
| 488 | Ga0495652_0203805 | 3300046529 | Bacteria | 1499 |
| 489 | Ga0495654_0012179 | 3300046530 | Bacteria | 4627 |
| 490 | Ga0495665_0000408 | 3300046531 | Bacteria | 21924 |
| 491 | Ga0495665_0011452 | 3300046531 | Bacteria | 4801 |
| 492 | Ga0495665_0067781 | 3300046531 | Bacteria | 1882 |
| 493 | Ga0495640_0004065 | 3300046533 | Bacteria | 11705 |
| 494 | Ga0495640_0009547 | 3300046533 | Bacteria | 7547 |
| 495 | Ga0495640_0085620 | 3300046533 | Bacteria | 2088 |
| 496 | Ga0495587_0020833 | 3300046536 | Bacteria | 4044 |
| 497 | Ga0495587_0027506 | 3300046536 | Bacteria | 3462 |
| 498 | Ga0495598_0012059 | 3300046537 | Bacteria | 2110 |
| 499 | Ga0495609_0053461 | 3300046538 | Bacteria | 1795 |
| 500 | Ga0495645_0009133 | 3300046543 | Bacteria | 6926 |
| 501 | Ga0495645_0012251 | 3300046543 | Bacteria | 6038 |
| 502 | Ga0495622_0003183 | 3300046557 | Bacteria | 7774 |
| 503 | Ga0495622_0006001 | 3300046557 | Bacteria | 5644 |
| 504 | Ga0495622_0099733 | 3300046557 | Bacteria | 1331 |
| 505 | Ga0495633_0043207 | 3300046558 | Bacteria | 2138 |
| 506 | Ga0495667_0184912 | 3300046559 | Bacteria | 1336 |
| 507 | Ga0495634_0009077 | 3300046642 | Bacteria | 7348 |
| 508 | Ga0495634_0009379 | 3300046642 | Bacteria | 7219 |
| 509 | Ga0495634_0040856 | 3300046642 | Bacteria | 3152 |
| 510 | Ga0495634_0098163 | 3300046642 | Bacteria | 1895 |
| 511 | Ga0495611_0015440 | 3300046648 | Bacteria | 3265 |
| 512 | Ga0495611_0071429 | 3300046648 | Bacteria | 1587 |
| 513 | Ga0495625_0025144 | 3300046660 | Bacteria | 4519 |
| 514 | Ga0495625_0039854 | 3300046660 | Bacteria | 3428 |
| 515 | Ga0495635_0000883 | 3300046663 | Bacteria | 19679 |
| 516 | Ga0495635_0007423 | 3300046663 | Bacteria | 7651 |
| 517 | Ga0495635_0012284 | 3300046663 | Bacteria | 5998 |
| 518 | Ga0495635_0048233 | 3300046663 | Bacteria | 2936 |
| 519 | Ga0495659_0005390 | 3300046664 | Bacteria | 4024 |
| 520 | Ga0495588_0003776 | 3300046674 | Bacteria | 6633 |
| 521 | Ga0495588_0004335 | 3300046674 | Bacteria | 6264 |
| 522 | Ga0495657_0016949 | 3300046675 | Bacteria | 5295 |
| 523 | Ga0495657_0032336 | 3300046675 | Bacteria | 3651 |
| 524 | Ga0495599_0019799 | 3300046678 | Bacteria | 4191 |
| 525 | Ga0495599_0094368 | 3300046678 | Bacteria | 1866 |
| 526 | Ga0495623_0021928 | 3300046679 | Bacteria | 4125 |
| 527 | Ga0495623_0046004 | 3300046679 | Bacteria | 2770 |
| 528 | Ga0495623_0103645 | 3300046679 | Bacteria | 1731 |
| 529 | Ga0495646_0027329 | 3300046680 | Bacteria | 3580 |
| 530 | Ga0495646_0030420 | 3300046680 | Bacteria | 3372 |
| 531 | Ga0495646_0037301 | 3300046680 | Bacteria | 3007 |
| 532 | Ga0495647_0000226 | 3300046681 | Bacteria | 15317 |
| 533 | Ga0495647_0004771 | 3300046681 | Bacteria | 4426 |
| 534 | Ga0495658_0000706 | 3300046683 | Bacteria | 18090 |
| 535 | Ga0495658_0007799 | 3300046683 | Bacteria | 5299 |
| 536 | Ga0495669_0021018 | 3300046684 | Bacteria | 2829 |
| 537 | Ga0495613_0009812 | 3300046689 | Bacteria | 7119 |
| 538 | Ga0495613_0054949 | 3300046689 | Bacteria | 2927 |
| 539 | Ga0495613_0095134 | 3300046689 | Bacteria | 2155 |
| 540 | Ga0495624_0154543 | 3300046690 | Bacteria | 1402 |
| 541 | Ga0495670_0022116 | 3300046691 | Bacteria | 3139 |
| 542 | Ga0495670_0076468 | 3300046691 | Bacteria | 1701 |
| 543 | Ga0495671_0048737 | 3300046692 | Bacteria | 2113 |
| 544 | Ga0495671_0071576 | 3300046692 | Bacteria | 1703 |
| 545 | Ga0495600_0009246 | 3300046809 | Bacteria | 6080 |
| 546 | Ga0495600_0031062 | 3300046809 | Bacteria | 3459 |
| 547 | Ga0495600_0087194 | 3300046809 | Bacteria | 2036 |
| 548 | Ga0495581_0036754 | 3300047315 | Bacteria | 2833 |
| 549 | Ga0495581_0076665 | 3300047315 | Bacteria | 1934 |
| 550 | Ga0495604_0006128 | 3300047317 | Bacteria | 9545 |
| 551 | Ga0495604_0012219 | 3300047317 | Bacteria | 6825 |
| 552 | Ga0495604_0121938 | 3300047317 | Bacteria | 1886 |
| 553 | Ga0495674_0012843 | 3300047319 | Bacteria | 7887 |
| 554 | Ga0495674_0021071 | 3300047319 | Bacteria | 6031 |
| 555 | Ga0495674_0044585 | 3300047319 | Bacteria | 3942 |
| 556 | Ga0495672_0005618 | 3300047320 | Bacteria | 9900 |
| 557 | Ga0495676_0049592 | 3300047321 | Bacteria | 3374 |
| 558 | Ga0495676_0061379 | 3300047321 | Bacteria | 2940 |
| 559 | Ga0495676_0086399 | 3300047321 | Bacteria | 2360 |
| 560 | Ga0495676_0094531 | 3300047321 | Bacteria | 2226 |
| 561 | Ga0495680_0001053 | 3300047322 | Bacteria | 30524 |
| 562 | Ga0495680_0014448 | 3300047322 | Bacteria | 6836 |
| 563 | Ga0495683_0034104 | 3300047323 | Bacteria | 2589 |
| 564 | Ga0495683_0115123 | 3300047323 | Bacteria | 1280 |
| 565 | Ga0495687_016734 | 3300047443 | Bacteria | 3679 |
| 566 | Ga0495675_0025183 | 3300047444 | Bacteria | 3794 |
| 567 | Ga0495675_0063400 | 3300047444 | Bacteria | 2338 |
| 568 | Ga0495681_0035311 | 3300047470 | Bacteria | 2483 |
| 569 | Ga0495684_0010341 | 3300047471 | Bacteria | 7218 |
| 570 | Ga0495684_0033570 | 3300047471 | Bacteria | 3935 |
| 571 | Ga0495686_0068329 | 3300047472 | Bacteria | 2192 |
| 572 | Ga0495593_0000577 | 3300047673 | Bacteria | 20839 |
| 573 | Ga0495593_0101011 | 3300047673 | Bacteria | 1479 |
| 574 | Ga0495602_0021411 | 3300048088 | Bacteria | 6366 |
| 575 | Ga0495602_0022373 | 3300048088 | Bacteria | 6189 |
| 576 | Ga0495602_0091137 | 3300048088 | Bacteria | 2529 |
| 577 | Ga0495614_0027034 | 3300048089 | Bacteria | 2474 |
| 578 | Ga0495626_0029655 | 3300048091 | Bacteria | 2646 |
| 579 | Ga0496100_0012991 | 3300048903 | Bacteria | 4792 |
| 580 | Ga0496100_0040457 | 3300048903 | Bacteria | 2966 |
| 581 | Ga0496100_0079166 | 3300048903 | Bacteria | 2214 |
| 582 | Ga0496101_0003670 | 3300048904 | Bacteria | 9579 |
| 583 | Ga0496102_0001403 | 3300048905 | Bacteria | 21391 |
| 584 | Ga0496102_0110271 | 3300048905 | Bacteria | 2565 |
| 585 | Ga0496102_0145378 | 3300048905 | Bacteria | 2225 |
| 586 | Ga0496102_0200208 | 3300048905 | Bacteria | 1882 |
| 587 | Ga0496102_0443208 | 3300048905 | Bacteria | 1218 |
| 588 | Ga0496103_0125206 | 3300048906 | Bacteria | 1639 |
| 589 | Ga0496104_0014912 | 3300048907 | Bacteria | 7025 |
| 590 | Ga0496104_0040280 | 3300048907 | Bacteria | 4378 |
| 591 | Ga0496104_0257886 | 3300048907 | Bacteria | 1656 |
| 592 | Ga0496104_0315126 | 3300048907 | Bacteria | 1477 |
| 593 | Ga0496105_0011923 | 3300048908 | Bacteria | 6883 |
| 594 | Ga0496105_0021566 | 3300048908 | Bacteria | 5213 |
| 595 | Ga0496106_0001280 | 3300048909 | Bacteria | 18862 |
| 596 | Ga0496106_0004321 | 3300048909 | Bacteria | 10554 |
| 597 | Ga0496106_0016844 | 3300048909 | Bacteria | 5408 |
| 598 | Ga0496107_0010991 | 3300048910 | Bacteria | 6298 |
| 599 | Ga0496107_0030436 | 3300048910 | Bacteria | 3847 |
| 600 | Ga0496107_0062087 | 3300048910 | Bacteria | 2707 |
| 601 | Ga0496107_0084277 | 3300048910 | Bacteria | 2319 |
| 602 | Ga0496108_0003585 | 3300048911 | Bacteria | 12437 |
| 603 | Ga0496108_0029044 | 3300048911 | Bacteria | 4576 |
| 604 | Ga0496108_0031333 | 3300048911 | Bacteria | 4412 |
| 605 | Ga0496108_0033841 | 3300048911 | Bacteria | 4245 |
| 606 | Ga0496108_0075641 | 3300048911 | Bacteria | 2845 |
| 607 | Ga0496108_0198374 | 3300048911 | Bacteria | 1741 |
| 608 | Ga0496109_0004298 | 3300048912 | Bacteria | 11898 |
| 609 | Ga0496109_0008714 | 3300048912 | Bacteria | 8637 |
| 610 | Ga0496109_0133419 | 3300048912 | Bacteria | 2319 |
| 611 | Ga0496110_0014905 | 3300048913 | Bacteria | 6460 |
| 612 | Ga0496110_0024685 | 3300048913 | Bacteria | 5127 |
| 613 | Ga0496111_0004711 | 3300048914 | Bacteria | 8653 |
| 614 | Ga0496111_0074598 | 3300048914 | Bacteria | 2471 |
| 615 | Ga0496112_0003249 | 3300048915 | Bacteria | 13400 |
| 616 | Ga0496112_0036649 | 3300048915 | Bacteria | 4785 |
| 617 | Ga0496112_0067706 | 3300048915 | Bacteria | 3524 |
| 618 | Ga0496112_0130452 | 3300048915 | Bacteria | 2484 |
| 619 | Ga0496112_0192923 | 3300048915 | Bacteria | 1998 |
| 620 | Ga0496112_0303741 | 3300048915 | Bacteria | 1541 |
| 621 | Ga0496112_0331134 | 3300048915 | Bacteria | 1466 |
| 622 | Ga0496112_0384956 | 3300048915 | Bacteria | 1343 |
| 623 | Ga0496113_0002516 | 3300048916 | Bacteria | 10686 |
| 624 | Ga0496113_0051848 | 3300048916 | Bacteria | 3062 |
| 625 | Ga0496114_0115675 | 3300048917 | Bacteria | 2301 |
| 626 | Ga0496115_0004202 | 3300048918 | Bacteria | 10415 |
| 627 | Ga0496115_0067943 | 3300048918 | Bacteria | 2884 |
| 628 | Ga0496115_0142345 | 3300048918 | Bacteria | 1979 |
| 629 | Ga0496115_0190535 | 3300048918 | Bacteria | 1694 |
| 630 | Ga0496115_0197445 | 3300048918 | Bacteria | 1662 |
| 631 | Ga0496115_0214663 | 3300048918 | Bacteria | 1589 |
| 632 | Ga0496115_0290972 | 3300048918 | Bacteria | 1340 |
| 633 | Ga0496118_0001458 | 3300048921 | Bacteria | 35562 |
| 634 | Ga0496118_0016977 | 3300048921 | Bacteria | 6648 |
| 635 | Ga0496118_0081875 | 3300048921 | Bacteria | 2264 |
| 636 | Ga0496118_0229203 | 3300048921 | Bacteria | 1074 |
| 637 | Ga0496119_0020246 | 3300048922 | Bacteria | 4859 |
| 638 | Ga0496119_0061303 | 3300048922 | Bacteria | 2247 |
| 639 | Ga0496119_0112489 | 3300048922 | Bacteria | 1509 |
| 640 | Ga0496119_0113241 | 3300048922 | Bacteria | 1502 |
| 641 | Ga0496121_0000146 | 3300048924 | Bacteria | 154459 |
| 642 | Ga0496121_0000254 | 3300048924 | Bacteria | 113314 |
| 643 | Ga0496121_0001525 | 3300048924 | Bacteria | 38839 |
| 644 | Ga0496121_0005728 | 3300048924 | Bacteria | 15775 |
| 645 | Ga0496121_0009157 | 3300048924 | Bacteria | 11444 |
| 646 | Ga0496121_0031994 | 3300048924 | Bacteria | 4793 |
| 647 | Ga0496121_0113447 | 3300048924 | Bacteria | 2062 |
| 648 | Ga0496121_0196722 | 3300048924 | Bacteria | 1440 |
| 649 | Ga0496122_0050993 | 3300048925 | Bacteria | 3150 |
| 650 | Ga0496123_0142924 | 3300048926 | Bacteria | 1305 |
| 651 | Ga0496124_0002217 | 3300048927 | Bacteria | 25870 |
| 652 | Ga0496124_0119790 | 3300048927 | Bacteria | 2105 |
| 653 | Ga0496124_0124045 | 3300048927 | Bacteria | 2060 |
| 654 | Ga0496125_0009421 | 3300048928 | Bacteria | 10037 |
| 655 | Ga0496125_0179214 | 3300048928 | Bacteria | 1414 |
| 656 | Ga0496125_0197245 | 3300048928 | Bacteria | 1322 |
| 657 | Ga0496126_0003212 | 3300048929 | Bacteria | 20945 |
| 658 | Ga0496126_0004243 | 3300048929 | Bacteria | 17254 |
| 659 | Ga0496126_0011968 | 3300048929 | Bacteria | 8917 |
| 660 | Ga0496126_0012455 | 3300048929 | Bacteria | 8710 |
| 661 | Ga0496126_0023765 | 3300048929 | Bacteria | 5934 |
| 662 | Ga0496126_0055536 | 3300048929 | Bacteria | 3583 |
| 663 | Ga0496126_0100238 | 3300048929 | Bacteria | 2535 |
| 664 | Ga0496126_0224630 | 3300048929 | Bacteria | 1576 |
| 665 | Ga0496126_0255361 | 3300048929 | Bacteria | 1459 |
| 666 | Ga0496126_0312858 | 3300048929 | Bacteria | 1292 |
| 667 | Ga0495682_0006817 | 3300049460 | Bacteria | 4599 |
| 668 | Ga0501031_0000451 | 3300049568 | Bacteria | 23790 |
| 669 | Ga0501032_0000196 | 3300049569 | Bacteria | 50261 |
| 670 | Ga0501033_0001104 | 3300049570 | Bacteria | 24475 |
| 671 | Ga0501034_0001151 | 3300049571 | Bacteria | 36663 |
| 672 | Ga0501036_0000323 | 3300049572 | Bacteria | 33256 |
| 673 | Ga0501037_0001204 | 3300049573 | Bacteria | 19110 |
| 674 | Ga0501038_0002973 | 3300049574 | Bacteria | 15796 |
| 675 | Ga0501039_0000705 | 3300049575 | Bacteria | 24064 |
| 676 | Ga0501043_0000409 | 3300049579 | Bacteria | 38657 |
| 677 | Ga0501043_0129674 | 3300049579 | Bacteria | 1976 |
| 678 | Ga0501046_0000181 | 3300049580 | Bacteria | 64035 |
| 679 | Ga0501047_0000419 | 3300049581 | Bacteria | 47535 |
| 680 | Ga0501047_0094940 | 3300049581 | Bacteria | 2861 |
| 681 | Ga0501048_0000057 | 3300049582 | Bacteria | 56138 |
| 682 | Ga0501067_0000145 | 3300049583 | Bacteria | 39277 |
| 683 | Ga0501068_0001512 | 3300049584 | Bacteria | 12380 |
| 684 | Ga0501069_0016839 | 3300049585 | Bacteria | 3927 |
| 685 | Ga0501070_0022615 | 3300049586 | Bacteria | 5264 |
| 686 | Ga0501071_0014762 | 3300049587 | Bacteria | 5347 |
| 687 | Ga0501072_0000643 | 3300049588 | Bacteria | 25050 |
| 688 | Ga0501073_0000027 | 3300049589 | Bacteria | 121860 |
| 689 | Ga0501074_0000081 | 3300049590 | Bacteria | 46487 |
| 690 | Ga0501079_0003647 | 3300049741 | Bacteria | 11342 |
| 691 | Ga0501080_0000883 | 3300049742 | Bacteria | 24535 |
| 692 | Ga0501083_0010910 | 3300049744 | Bacteria | 6390 |
| 693 | Ga0501035_0003158 | 3300049822 | Bacteria | 15827 |
| 694 | Ga0501044_0001511 | 3300049823 | Bacteria | 27265 |
| 695 | Ga0501045_0132444 | 3300049824 | Bacteria | 1853 |
| 696 | nmdc:mga00v17_36841_c1 | 3300050491 | Bacteria | 2918 |
| 697 | nmdc:mga0yw44_20681_c1 | 3300050492 | Bacteria | 3657 |
| 698 | nmdc:mga0yw44_223246_c1 | 3300050492 | Bacteria | 1249 |
| 699 | nmdc:mga0yw44_55244_c1 | 3300050492 | Bacteria | 2416 |
| 700 | nmdc:mga0yw44_62945_c1 | 3300050492 | Bacteria | 2280 |
| 701 | nmdc:mga0yw44_72265_c1 | 3300050492 | Bacteria | 2144 |
| 702 | nmdc:mga06z11_138426_c1 | 3300050494 | Bacteria | 1374 |
| 703 | nmdc:mga04h51_84883_c1 | 3300050495 | Bacteria | 1130 |
| 704 | nmdc:mga07m45_20736_c1 | 3300050496 | Bacteria | 3572 |
| 705 | nmdc:mga07m45_24087_c1 | 3300050496 | Bacteria | 3332 |
| 706 | nmdc:mga07m45_32628_c1 | 3300050496 | Bacteria | 2137 |
| 707 | nmdc:mga05p37_188753_c1 | 3300050507 | Bacteria | 2504 |
| 708 | nmdc:mga09592_457659_c1 | 3300050508 | Bacteria | 1100 |
| 709 | nmdc:mga0n895_136704_c1 | 3300050512 | Bacteria | 2477 |
| 710 | nmdc:mga0sz30_27845_c1 | 3300050516 | Bacteria | 1737 |
| 711 | Ga0495601_0062415 | 3300053077 | Bacteria | 2367 |
| 712 | Ga0495601_0111788 | 3300053077 | Bacteria | 1769 |
| 713 | Ga0495612_0037631 | 3300053078 | Bacteria | 1965 |
| 714 | Ga0495619_0124370 | 3300053085 | Bacteria | 1769 |
| 715 | Ga0500578_0165010 | 3300053086 | Bacteria | 1372 |
| 716 | Ga0500643_000052 | 3300053087 | Bacteria | 144656 |
| 717 | Ga0500643_046803 | 3300053087 | Bacteria | 1248 |
| 718 | Ga0500581_061300 | 3300053089 | Bacteria | 1905 |
| 719 | Ga0500647_0008273 | 3300053091 | Bacteria | 4511 |
| 720 | Ga0500651_0046771 | 3300053093 | Bacteria | 2721 |
| 721 | Ga0500651_0091596 | 3300053093 | Bacteria | 1871 |
| 722 | Ga0500566_0000113 | 3300053094 | Bacteria | 41467 |
| 723 | Ga0500566_0003433 | 3300053094 | Bacteria | 9443 |
| 724 | Ga0500566_0009055 | 3300053094 | Bacteria | 5888 |
| 725 | Ga0500640_000015 | 3300053095 | Bacteria | 25262 |
| 726 | Ga0500641_0001161 | 3300053096 | Bacteria | 9380 |
| 727 | Ga0500648_101140 | 3300053097 | Bacteria | 1603 |
| 728 | Ga0500650_0025530 | 3300053098 | Bacteria | 2642 |
| 729 | Ga0500554_010459 | 3300053102 | Bacteria | 2262 |
| 730 | Ga0500555_001634 | 3300053103 | Bacteria | 6773 |
| 731 | Ga0500556_0000035 | 3300053104 | Bacteria | 145357 |
| 732 | Ga0500557_000303 | 3300053105 | Bacteria | 6656 |
| 733 | Ga0500572_000335 | 3300053111 | Bacteria | 16881 |
| 734 | Ga0500572_003927 | 3300053111 | Bacteria | 3380 |
| 735 | Ga0500591_019919 | 3300053115 | Bacteria | 3252 |
| 736 | Ga0500592_002069 | 3300053116 | Bacteria | 3233 |
| 737 | Ga0500594_0009707 | 3300053118 | Bacteria | 2221 |
| 738 | Ga0500595_000728 | 3300053119 | Bacteria | 19571 |
| 739 | Ga0500595_019443 | 3300053119 | Bacteria | 2464 |
| 740 | Ga0500595_020188 | 3300053119 | Bacteria | 2403 |
| 741 | Ga0500607_032891 | 3300053121 | Bacteria | 2845 |
| 742 | Ga0500608_000269 | 3300053122 | Bacteria | 20074 |
| 743 | Ga0500614_003851 | 3300053123 | Bacteria | 3208 |
| 744 | Ga0500642_0000027 | 3300053130 | Bacteria | 119688 |
| 745 | Ga0500642_0023426 | 3300053130 | Bacteria | 2479 |
| 746 | Ga0500559_0000064 | 3300053136 | Bacteria | 85844 |
| 747 | Ga0500559_0002132 | 3300053136 | Bacteria | 10535 |
| 748 | Ga0500559_0003196 | 3300053136 | Bacteria | 8145 |
| 749 | Ga0500559_0007573 | 3300053136 | Bacteria | 4799 |
| 750 | Ga0500568_0000443 | 3300053139 | Bacteria | 31089 |
| 751 | Ga0500568_0019363 | 3300053139 | Bacteria | 2960 |
| 752 | Ga0500573_0025041 | 3300053140 | Bacteria | 3431 |
| 753 | Ga0500577_0011003 | 3300053142 | Bacteria | 2685 |
| 754 | Ga0500603_000592 | 3300053150 | Bacteria | 9035 |
| 755 | Ga0500603_040978 | 3300053150 | Bacteria | 1235 |
| 756 | Ga0500604_0006983 | 3300053151 | Bacteria | 2989 |
| 757 | Ga0500604_0012112 | 3300053151 | Bacteria | 2325 |
| 758 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 759 | Ga0500622_0003640 | 3300053156 | Bacteria | 10132 |
| 760 | Ga0500622_0012122 | 3300053156 | Bacteria | 4678 |
| 761 | Ga0500630_004643 | 3300053159 | Bacteria | 6679 |
| 762 | Ga0500638_002418 | 3300053162 | Bacteria | 6494 |
| 763 | Ga0500638_042194 | 3300053162 | Bacteria | 2215 |
| 764 | Ga0500639_000050 | 3300053163 | Bacteria | 54136 |
| 765 | Ga0500639_048884 | 3300053163 | Bacteria | 2208 |
| 766 | Ga0500639_059399 | 3300053163 | Bacteria | 1974 |
| 767 | Ga0500636_0000232 | 3300053177 | Bacteria | 30484 |
| 768 | Ga0500636_0001203 | 3300053177 | Bacteria | 13970 |
| 769 | Ga0500636_0006221 | 3300053177 | Bacteria | 6850 |
| 770 | Ga0500637_0000080 | 3300053178 | Bacteria | 34464 |
| 771 | Ga0500637_0029751 | 3300053178 | Bacteria | 3032 |
| 772 | Ga0500576_029821 | 3300053725 | Bacteria | 2483 |
| 773 | Ga0500625_008952 | 3300053729 | Bacteria | 4448 |
| 774 | Ga0500645_004073 | 3300053730 | Bacteria | 5727 |
| 775 | Ga0500645_053820 | 3300053730 | Bacteria | 1171 |
| 776 | Ga0500596_000478 | 3300053735 | Bacteria | 7480 |
| 777 | Ga0500596_001927 | 3300053735 | Bacteria | 4162 |
| 778 | Ga0500596_002066 | 3300053735 | Bacteria | 4000 |
| 779 | Ga0500601_000108 | 3300053737 | Bacteria | 17177 |
| 780 | Ga0500601_002207 | 3300053737 | Bacteria | 2092 |
| 781 | Ga0500661_000271 | 3300055283 | Bacteria | 9372 |
| 782 | Ga0501082_0004691 | 3300060353 | Bacteria | 11916 |
| 783 | Ga0501082_0239300 | 3300060353 | Bacteria | 1580 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0180633 | Ga0495629_0180633_17_958 | 256 |
| 2 | 3300046559 | Ga0495667_0184912 | Ga0495667_0184912_378_1319 | 260 |
| 3 | 3300009176 | Ga0105242_10173029 | Ga0105242_101730292 | 261 |
| 4 | 3300009545 | Ga0105237_10389635 | Ga0105237_103896351 | 261 |
| 5 | 3300025931 | Ga0207644_10059354 | Ga0207644_100593542 | 261 |
| 6 | 3300035085 | Ga0373929_0015395 | Ga0373929_0015395_272_1288 | 261 |
| 7 | 3300035691 | Ga0373931_0023347 | Ga0373931_0023347_1746_2762 | 261 |
| 8 | 3300048907 | Ga0496104_0257886 | Ga0496104_0257886_409_1425 | 261 |
| 9 | 3300048915 | Ga0496112_0067706 | Ga0496112_0067706_229_1245 | 261 |
| 10 | 3300025297 | Ga0209758_1006390 | Ga0209758_10063904 | 262 |
| 11 | 3300025927 | Ga0207687_10027005 | Ga0207687_100270051 | 262 |
| 12 | 3300045976 | Ga0466967_0195562 | Ga0466967_0195562_507_1523 | 263 |
| 13 | 3300047320 | Ga0495672_0005618 | Ga0495672_0005618_3269_4285 | 264 |
| 14 | 3300048910 | Ga0496107_0030436 | Ga0496107_0030436_1228_2244 | 265 |
| 15 | 3300048916 | Ga0496113_0051848 | Ga0496113_0051848_1424_2440 | 265 |
| 16 | 3300046642 | Ga0495634_0040856 | Ga0495634_0040856_255_1226 | 266 |
| 17 | 3300013308 | Ga0157375_10801243 | Ga0157375_108012431 | 267 |
| 18 | 3300005344 | Ga0070661_100033003 | Ga0070661_1000330035 | 269 |
| 19 | 3300005539 | Ga0068853_100197741 | Ga0068853_1001977412 | 269 |
| 20 | 3300025920 | Ga0207649_10063456 | Ga0207649_100634563 | 269 |
| 21 | 3300025924 | Ga0207694_10126400 | Ga0207694_101264002 | 269 |
| 22 | 3300025941 | Ga0207711_10064333 | Ga0207711_100643332 | 269 |
| 23 | 3300025981 | Ga0207640_10195880 | Ga0207640_101958802 | 269 |
| 24 | 3300026041 | Ga0207639_10092227 | Ga0207639_100922273 | 269 |
| 25 | 3300005329 | Ga0070683_100057406 | Ga0070683_1000574063 | 270 |
| 26 | 3300005336 | Ga0070680_100102798 | Ga0070680_1001027983 | 270 |
| 27 | 3300013105 | Ga0157369_10031661 | Ga0157369_100316612 | 270 |
| 28 | 3300013105 | Ga0157369_10160062 | Ga0157369_101600623 | 270 |
| 29 | 3300013307 | Ga0157372_10327651 | Ga0157372_103276512 | 270 |
| 30 | 3300026116 | Ga0207674_10129128 | Ga0207674_101291282 | 270 |
| 31 | 3300005458 | Ga0070681_10043155 | Ga0070681_100431555 | 271 |
| 32 | 3300005530 | Ga0070679_100161305 | Ga0070679_1001613053 | 271 |
| 33 | 3300005535 | Ga0070684_100122766 | Ga0070684_1001227662 | 271 |
| 34 | 3300005843 | Ga0068860_100003385 | Ga0068860_10000338513 | 271 |
| 35 | 3300025912 | Ga0207707_10028406 | Ga0207707_100284067 | 271 |
| 36 | 3300028381 | Ga0268264_10000042 | Ga0268264_1000004218 | 271 |
| 37 | 3300013296 | Ga0157374_10353160 | Ga0157374_103531601 | 272 |
| 38 | 3300053163 | Ga0500639_048884 | Ga0500639_048884_1032_2051 | 272 |
| 39 | 3300053735 | Ga0500596_002066 | Ga0500596_002066_381_1400 | 272 |
| 40 | 3300005548 | Ga0070665_100200236 | Ga0070665_1002002362 | 273 |
| 41 | 3300026089 | Ga0207648_10023386 | Ga0207648_100233866 | 273 |
| 42 | 3300028379 | Ga0268266_10157354 | Ga0268266_101573542 | 273 |
| 43 | 3300053111 | Ga0500572_000335 | Ga0500572_000335_4491_5510 | 275 |
| 44 | 3300053136 | Ga0500559_0003196 | Ga0500559_0003196_2508_3527 | 275 |
| 45 | 3300053725 | Ga0500576_029821 | Ga0500576_029821_646_1665 | 275 |
| 46 | 3300046459 | Ga0495629_0127125 | Ga0495629_0127125_606_1622 | 276 |
| 47 | 3300046507 | Ga0495606_0195499 | Ga0495606_0195499_39_1055 | 276 |
| 48 | iso_pu_bacteria | 8016583857 | 8016587662 | 276 |
| 49 | 3300047470 | Ga0495681_0035311 | Ga0495681_0035311_305_1321 | 277 |
| 50 | 3300048915 | Ga0496112_0036649 | Ga0496112_0036649_3332_4348 | 277 |
| 51 | 3300017792 | Ga0163161_10223764 | Ga0163161_102237642 | 278 |
| 52 | 3300001989 | JGI24739J22299_10004386 | JGI24739J22299_100043867 | 279 |
| 53 | 3300001990 | JGI24737J22298_10015446 | JGI24737J22298_100154461 | 279 |
| 54 | 3300004625 | Ga0055543_1006286 | Ga0055543_10062864 | 279 |
| 55 | 3300005262 | Ga0065165_1003123 | Ga0065165_10031239 | 279 |
| 56 | 3300005347 | Ga0070668_100359349 | Ga0070668_1003593492 | 279 |
| 57 | 3300005459 | Ga0068867_100114226 | Ga0068867_1001142262 | 279 |
| 58 | 3300005539 | Ga0068853_100134129 | Ga0068853_1001341292 | 279 |
| 59 | 3300005548 | Ga0070665_100118190 | Ga0070665_1001181903 | 279 |
| 60 | 3300005577 | Ga0068857_100056749 | Ga0068857_1000567491 | 279 |
| 61 | 3300005577 | Ga0068857_100220946 | Ga0068857_1002209462 | 279 |
| 62 | 3300005578 | Ga0068854_100008298 | Ga0068854_1000082982 | 279 |
| 63 | 3300005614 | Ga0068856_100019463 | Ga0068856_1000194632 | 279 |
| 64 | 3300005616 | Ga0068852_100076214 | Ga0068852_1000762141 | 279 |
| 65 | 3300006048 | Ga0075363_100010103 | Ga0075363_1000101035 | 279 |
| 66 | 3300006195 | Ga0075366_10068019 | Ga0075366_100680192 | 279 |
| 67 | 3300009093 | Ga0105240_10095537 | Ga0105240_100955374 | 279 |
| 68 | 3300009098 | Ga0105245_10053806 | Ga0105245_100538064 | 279 |
| 69 | 3300009148 | Ga0105243_10275452 | Ga0105243_102754521 | 279 |
| 70 | 3300009177 | Ga0105248_10226148 | Ga0105248_102261482 | 279 |
| 71 | 3300010375 | Ga0105239_10335332 | Ga0105239_103353322 | 279 |
| 72 | 3300025297 | Ga0209758_1026073 | Ga0209758_10260733 | 279 |
| 73 | 3300025299 | Ga0209256_1024707 | Ga0209256_10247072 | 279 |
| 74 | 3300025904 | Ga0207647_10009009 | Ga0207647_100090099 | 279 |
| 75 | 3300025904 | Ga0207647_10038569 | Ga0207647_100385691 | 279 |
| 76 | 3300025931 | Ga0207644_10060900 | Ga0207644_100609004 | 279 |
| 77 | 3300025949 | Ga0207667_10115820 | Ga0207667_101158202 | 279 |
| 78 | 3300026041 | Ga0207639_10107568 | Ga0207639_101075682 | 279 |
| 79 | 3300026078 | Ga0207702_10252439 | Ga0207702_102524392 | 279 |
| 80 | 3300026089 | Ga0207648_10151941 | Ga0207648_101519412 | 279 |
| 81 | 3300026116 | Ga0207674_10044466 | Ga0207674_100444664 | 279 |
| 82 | 3300026142 | Ga0207698_10059209 | Ga0207698_100592091 | 279 |
| 83 | 3300046471 | Ga0495650_0025642 | Ga0495650_0025642_59_1078 | 279 |
| 84 | 3300046507 | Ga0495606_0121016 | Ga0495606_0121016_457_1476 | 279 |
| 85 | 3300046513 | Ga0495616_0054583 | Ga0495616_0054583_571_1590 | 279 |
| 86 | 3300046519 | Ga0495632_0112496 | Ga0495632_0112496_175_1140 | 279 |
| 87 | 3300046557 | Ga0495622_0099733 | Ga0495622_0099733_148_1167 | 279 |
| 88 | 3300046648 | Ga0495611_0015440 | Ga0495611_0015440_1933_2952 | 279 |
| 89 | 3300046674 | Ga0495588_0003776 | Ga0495588_0003776_4678_5697 | 279 |
| 90 | 3300047321 | Ga0495676_0094531 | Ga0495676_0094531_1018_2037 | 279 |
| 91 | 3300047443 | Ga0495687_016734 | Ga0495687_016734_319_1338 | 279 |
| 92 | 3300048091 | Ga0495626_0029655 | Ga0495626_0029655_316_1335 | 279 |
| 93 | 3300048903 | Ga0496100_0012991 | Ga0496100_0012991_2728_3747 | 279 |
| 94 | 3300048911 | Ga0496108_0198374 | Ga0496108_0198374_241_1260 | 279 |
| 95 | 3300048915 | Ga0496112_0384956 | Ga0496112_0384956_66_1085 | 279 |
| 96 | 3300048918 | Ga0496115_0190535 | Ga0496115_0190535_609_1628 | 279 |
| 97 | 3300048921 | Ga0496118_0081875 | Ga0496118_0081875_1171_2190 | 279 |
| 98 | 3300048922 | Ga0496119_0113241 | Ga0496119_0113241_223_1242 | 279 |
| 99 | 3300048924 | Ga0496121_0005728 | Ga0496121_0005728_13544_14563 | 279 |
| 100 | 3300050496 | nmdc:mga07m45_24087_c1 | nmdc:mga07m45_24087_c1_1693_2712 | 279 |
| 101 | 3300005347 | Ga0070668_100446215 | Ga0070668_1004462151 | 280 |
| 102 | 3300005441 | Ga0070700_100032463 | Ga0070700_1000324633 | 280 |
| 103 | 3300005455 | Ga0070663_100028930 | Ga0070663_1000289303 | 280 |
| 104 | 3300005456 | Ga0070678_100145932 | Ga0070678_1001459321 | 280 |
| 105 | 3300005543 | Ga0070672_100123570 | Ga0070672_1001235702 | 280 |
| 106 | 3300005544 | Ga0070686_100022890 | Ga0070686_1000228904 | 280 |
| 107 | 3300005548 | Ga0070665_100078725 | Ga0070665_1000787252 | 280 |
| 108 | 3300005564 | Ga0070664_100304479 | Ga0070664_1003044792 | 280 |
| 109 | 3300005719 | Ga0068861_100124194 | Ga0068861_1001241942 | 280 |
| 110 | 3300005843 | Ga0068860_100053426 | Ga0068860_1000534261 | 280 |
| 111 | 3300009177 | Ga0105248_10310941 | Ga0105248_103109412 | 280 |
| 112 | 3300010375 | Ga0105239_10081869 | Ga0105239_100818692 | 280 |
| 113 | 3300013296 | Ga0157374_10061812 | Ga0157374_100618122 | 280 |
| 114 | 3300013297 | Ga0157378_10177625 | Ga0157378_101776252 | 280 |
| 115 | 3300025297 | Ga0209758_1033325 | Ga0209758_10333252 | 280 |
| 116 | 3300025933 | Ga0207706_10303410 | Ga0207706_103034102 | 280 |
| 117 | 3300025934 | Ga0207686_10056769 | Ga0207686_100567692 | 280 |
| 118 | 3300025941 | Ga0207711_10100776 | Ga0207711_101007763 | 280 |
| 119 | 3300026023 | Ga0207677_10029675 | Ga0207677_100296753 | 280 |
| 120 | 3300026067 | Ga0207678_10014592 | Ga0207678_100145925 | 280 |
| 121 | 3300026075 | Ga0207708_10028467 | Ga0207708_100284674 | 280 |
| 122 | 3300028379 | Ga0268266_10038251 | Ga0268266_100382512 | 280 |
| 123 | 3300039437 | Ga0436365_0966326 | Ga0436365_0966326_41_1060 | 280 |
| 124 | 3300046475 | Ga0495639_0202392 | Ga0495639_0202392_28_954 | 280 |
| 125 | 3300046684 | Ga0495669_0021018 | Ga0495669_0021018_733_1752 | 280 |
| 126 | 3300048903 | Ga0496100_0079166 | Ga0496100_0079166_759_1778 | 280 |
| 127 | 3300048904 | Ga0496101_0003670 | Ga0496101_0003670_3961_4977 | 280 |
| 128 | 3300048905 | Ga0496102_0001403 | Ga0496102_0001403_7092_8108 | 280 |
| 129 | 3300048908 | Ga0496105_0011923 | Ga0496105_0011923_147_1163 | 280 |
| 130 | 3300048913 | Ga0496110_0014905 | Ga0496110_0014905_309_1325 | 280 |
| 131 | 3300048914 | Ga0496111_0004711 | Ga0496111_0004711_591_1607 | 280 |
| 132 | 3300048915 | Ga0496112_0192923 | Ga0496112_0192923_726_1745 | 280 |
| 133 | 3300048918 | Ga0496115_0004202 | Ga0496115_0004202_6749_7765 | 280 |
| 134 | 3300005262 | Ga0065165_1006880 | Ga0065165_10068802 | 281 |
| 135 | 3300009093 | Ga0105240_10027761 | Ga0105240_100277611 | 281 |
| 136 | 3300009098 | Ga0105245_10545733 | Ga0105245_105457331 | 281 |
| 137 | 3300009545 | Ga0105237_10018559 | Ga0105237_100185593 | 281 |
| 138 | 3300010375 | Ga0105239_10227474 | Ga0105239_102274742 | 281 |
| 139 | 3300025254 | Ga0209148_1000707 | Ga0209148_10007077 | 281 |
| 140 | 3300025261 | Ga0209233_1001624 | Ga0209233_10016249 | 281 |
| 141 | 3300025272 | Ga0209455_1004030 | Ga0209455_10040302 | 281 |
| 142 | 3300025302 | Ga0207426_1009208 | Ga0207426_10092082 | 281 |
| 143 | 3300025302 | Ga0207426_1027419 | Ga0207426_10274192 | 281 |
| 144 | 3300025901 | Ga0207688_10037217 | Ga0207688_100372172 | 281 |
| 145 | 3300025913 | Ga0207695_10000478 | Ga0207695_1000047817 | 281 |
| 146 | 3300025914 | Ga0207671_10042721 | Ga0207671_100427212 | 281 |
| 147 | 3300025933 | Ga0207706_10044185 | Ga0207706_100441853 | 281 |
| 148 | 3300037418 | Ga0395900_0079769 | Ga0395900_0079769_1033_2052 | 281 |
| 149 | 3300037466 | Ga0395898_0090869 | Ga0395898_0090869_103_1122 | 281 |
| 150 | 3300037471 | Ga0395905_0057052 | Ga0395905_0057052_1884_2903 | 281 |
| 151 | 3300044684 | Ga0466966_0000720 | Ga0466966_0000720_9593_10612 | 281 |
| 152 | 3300044693 | Ga0466961_0000136 | Ga0466961_0000136_25167_26186 | 281 |
| 153 | 3300046460 | Ga0495638_0040365 | Ga0495638_0040365_220_1239 | 281 |
| 154 | 3300046506 | Ga0495583_0036700 | Ga0495583_0036700_133_1152 | 281 |
| 155 | 3300046507 | Ga0495606_0012721 | Ga0495606_0012721_3710_4729 | 281 |
| 156 | 3300046524 | Ga0495648_0032593 | Ga0495648_0032593_360_1379 | 281 |
| 157 | 3300046529 | Ga0495652_0203805 | Ga0495652_0203805_163_1182 | 281 |
| 158 | 3300046557 | Ga0495622_0006001 | Ga0495622_0006001_1110_2129 | 281 |
| 159 | 3300046660 | Ga0495625_0025144 | Ga0495625_0025144_977_1996 | 281 |
| 160 | 3300046663 | Ga0495635_0012284 | Ga0495635_0012284_752_1771 | 281 |
| 161 | 3300046689 | Ga0495613_0095134 | Ga0495613_0095134_691_1710 | 281 |
| 162 | 3300046690 | Ga0495624_0154543 | Ga0495624_0154543_56_1075 | 281 |
| 163 | 3300046692 | Ga0495671_0048737 | Ga0495671_0048737_940_1959 | 281 |
| 164 | 3300046809 | Ga0495600_0009246 | Ga0495600_0009246_376_1395 | 281 |
| 165 | 3300047317 | Ga0495604_0006128 | Ga0495604_0006128_3670_4689 | 281 |
| 166 | 3300047323 | Ga0495683_0034104 | Ga0495683_0034104_1432_2451 | 281 |
| 167 | 3300047444 | Ga0495675_0025183 | Ga0495675_0025183_2481_3500 | 281 |
| 168 | 3300047472 | Ga0495686_0068329 | Ga0495686_0068329_303_1322 | 281 |
| 169 | 3300048088 | Ga0495602_0021411 | Ga0495602_0021411_4277_5296 | 281 |
| 170 | 3300048089 | Ga0495614_0027034 | Ga0495614_0027034_487_1506 | 281 |
| 171 | 3300048905 | Ga0496102_0110271 | Ga0496102_0110271_930_1946 | 281 |
| 172 | 3300048907 | Ga0496104_0014912 | Ga0496104_0014912_5403_6422 | 281 |
| 173 | 3300048908 | Ga0496105_0021566 | Ga0496105_0021566_317_1336 | 281 |
| 174 | 3300048921 | Ga0496118_0229203 | Ga0496118_0229203_37_1056 | 281 |
| 175 | 3300048922 | Ga0496119_0020246 | Ga0496119_0020246_3531_4550 | 281 |
| 176 | 3300048927 | Ga0496124_0119790 | Ga0496124_0119790_356_1375 | 281 |
| 177 | 3300048928 | Ga0496125_0197245 | Ga0496125_0197245_293_1312 | 281 |
| 178 | 3300049460 | Ga0495682_0006817 | Ga0495682_0006817_2588_3607 | 281 |
| 179 | 3300049579 | Ga0501043_0129674 | Ga0501043_0129674_667_1686 | 281 |
| 180 | 3300049581 | Ga0501047_0094940 | Ga0501047_0094940_695_1714 | 281 |
| 181 | 3300050508 | nmdc:mga09592_457659_c1 | nmdc:mga09592_457659_c1_32_973 | 281 |
| 182 | 3300053119 | Ga0500595_020188 | Ga0500595_020188_183_1202 | 281 |
| 183 | 3300053151 | Ga0500604_0012112 | Ga0500604_0012112_991_2010 | 281 |
| 184 | 3300053156 | Ga0500622_0012122 | Ga0500622_0012122_3560_4579 | 281 |
| 185 | 3300053730 | Ga0500645_053820 | Ga0500645_053820_97_1116 | 281 |
| 186 | 3300053737 | Ga0500601_000108 | Ga0500601_000108_14867_15886 | 281 |
| 187 | iso_pu_bacteria | 8019629233 | 8019638177 | 281 |
| 188 | 3300005338 | Ga0068868_100042173 | Ga0068868_1000421733 | 282 |
| 189 | 3300005455 | Ga0070663_100110754 | Ga0070663_1001107543 | 282 |
| 190 | 3300009174 | Ga0105241_10106672 | Ga0105241_101066721 | 282 |
| 191 | 3300013306 | Ga0163162_10020348 | Ga0163162_100203482 | 282 |
| 192 | 3300014325 | Ga0163163_10248535 | Ga0163163_102485352 | 282 |
| 193 | 3300025932 | Ga0207690_10067493 | Ga0207690_100674933 | 282 |
| 194 | 3300025933 | Ga0207706_10146531 | Ga0207706_101465312 | 282 |
| 195 | 3300025986 | Ga0207658_10082202 | Ga0207658_100822023 | 282 |
| 196 | 3300026118 | Ga0207675_100024290 | Ga0207675_1000242906 | 282 |
| 197 | 3300046454 | Ga0495592_0074009 | Ga0495592_0074009_595_1614 | 282 |
| 198 | 3300046462 | Ga0495651_0015465 | Ga0495651_0015465_1927_2946 | 282 |
| 199 | 3300046477 | Ga0495664_0018996 | Ga0495664_0018996_304_1323 | 282 |
| 200 | 3300046516 | Ga0495628_0023752 | Ga0495628_0023752_3859_4878 | 282 |
| 201 | 3300046529 | Ga0495652_0074271 | Ga0495652_0074271_1668_2687 | 282 |
| 202 | 3300046533 | Ga0495640_0085620 | Ga0495640_0085620_115_1134 | 282 |
| 203 | 3300046536 | Ga0495587_0020833 | Ga0495587_0020833_1521_2540 | 282 |
| 204 | 3300046537 | Ga0495598_0012059 | Ga0495598_0012059_559_1575 | 282 |
| 205 | 3300046543 | Ga0495645_0012251 | Ga0495645_0012251_4381_5400 | 282 |
| 206 | 3300046648 | Ga0495611_0071429 | Ga0495611_0071429_337_1353 | 282 |
| 207 | 3300046663 | Ga0495635_0048233 | Ga0495635_0048233_1679_2698 | 282 |
| 208 | 3300046675 | Ga0495657_0032336 | Ga0495657_0032336_2104_3123 | 282 |
| 209 | 3300046678 | Ga0495599_0094368 | Ga0495599_0094368_517_1536 | 282 |
| 210 | 3300046679 | Ga0495623_0046004 | Ga0495623_0046004_165_1184 | 282 |
| 211 | 3300046680 | Ga0495646_0027329 | Ga0495646_0027329_2533_3552 | 282 |
| 212 | 3300046689 | Ga0495613_0054949 | Ga0495613_0054949_352_1371 | 282 |
| 213 | 3300046809 | Ga0495600_0087194 | Ga0495600_0087194_559_1578 | 282 |
| 214 | 3300047317 | Ga0495604_0012219 | Ga0495604_0012219_4686_5705 | 282 |
| 215 | 3300047319 | Ga0495674_0044585 | Ga0495674_0044585_898_1917 | 282 |
| 216 | 3300047322 | Ga0495680_0001053 | Ga0495680_0001053_6194_7213 | 282 |
| 217 | 3300047673 | Ga0495593_0101011 | Ga0495593_0101011_115_1134 | 282 |
| 218 | 3300048088 | Ga0495602_0022373 | Ga0495602_0022373_1281_2300 | 282 |
| 219 | 3300048907 | Ga0496104_0040280 | Ga0496104_0040280_1115_2131 | 282 |
| 220 | 3300048909 | Ga0496106_0016844 | Ga0496106_0016844_245_1261 | 282 |
| 221 | 3300048910 | Ga0496107_0010991 | Ga0496107_0010991_5109_6125 | 282 |
| 222 | 3300048911 | Ga0496108_0029044 | Ga0496108_0029044_2286_3302 | 282 |
| 223 | 3300048912 | Ga0496109_0008714 | Ga0496109_0008714_1812_2828 | 282 |
| 224 | 3300048915 | Ga0496112_0130452 | Ga0496112_0130452_413_1429 | 282 |
| 225 | 3300048917 | Ga0496114_0115675 | Ga0496114_0115675_1055_2071 | 282 |
| 226 | 3300048918 | Ga0496115_0290972 | Ga0496115_0290972_106_1125 | 282 |
| 227 | 3300048926 | Ga0496123_0142924 | Ga0496123_0142924_35_1054 | 282 |
| 228 | 3300048929 | Ga0496126_0012455 | Ga0496126_0012455_5786_6805 | 282 |
| 229 | 3300053094 | Ga0500566_0009055 | Ga0500566_0009055_3896_4915 | 282 |
| 230 | 3300053119 | Ga0500595_019443 | Ga0500595_019443_233_1249 | 282 |
| 231 | 3300005455 | Ga0070663_100070652 | Ga0070663_1000706523 | 283 |
| 232 | 3300046692 | Ga0495671_0071576 | Ga0495671_0071576_200_1216 | 283 |
| 233 | 3300047321 | Ga0495676_0061379 | Ga0495676_0061379_1036_2055 | 283 |
| 234 | 3300025960 | Ga0207651_10087242 | Ga0207651_100872422 | 284 |
| 235 | 3300048911 | Ga0496108_0031333 | Ga0496108_0031333_2029_3048 | 284 |
| 236 | 3300005347 | Ga0070668_100180384 | Ga0070668_1001803842 | 285 |
| 237 | 3300005530 | Ga0070679_100012111 | Ga0070679_1000121111 | 285 |
| 238 | 3300005563 | Ga0068855_100066937 | Ga0068855_1000669375 | 285 |
| 239 | 3300009093 | Ga0105240_10084839 | Ga0105240_100848393 | 285 |
| 240 | 3300014326 | Ga0157380_10230938 | Ga0157380_102309382 | 285 |
| 241 | 3300025912 | Ga0207707_10119914 | Ga0207707_101199142 | 285 |
| 242 | 3300025913 | Ga0207695_10056295 | Ga0207695_100562955 | 285 |
| 243 | 3300025921 | Ga0207652_10198229 | Ga0207652_101982292 | 285 |
| 244 | 3300025949 | Ga0207667_10046090 | Ga0207667_100460902 | 285 |
| 245 | 3300025972 | Ga0207668_10133717 | Ga0207668_101337172 | 285 |
| 246 | 3300026041 | Ga0207639_10052277 | Ga0207639_100522773 | 285 |
| 247 | 3300026118 | Ga0207675_100354476 | Ga0207675_1003544762 | 285 |
| 248 | 3300005330 | Ga0070690_100184592 | Ga0070690_1001845922 | 286 |
| 249 | 3300005340 | Ga0070689_100252738 | Ga0070689_1002527382 | 286 |
| 250 | 3300005456 | Ga0070678_100106000 | Ga0070678_1001060002 | 286 |
| 251 | 3300005840 | Ga0068870_10065820 | Ga0068870_100658203 | 286 |
| 252 | 3300025931 | Ga0207644_10062417 | Ga0207644_100624173 | 286 |
| 253 | 3300025961 | Ga0207712_10131292 | Ga0207712_101312923 | 286 |
| 254 | 3300026121 | Ga0207683_10113791 | Ga0207683_101137912 | 286 |
| 255 | 3300037418 | Ga0395900_0000753 | Ga0395900_0000753_36778_37797 | 286 |
| 256 | 3300037466 | Ga0395898_0005579 | Ga0395898_0005579_818_1837 | 286 |
| 257 | 3300038443 | Ga0395901_0063621 | Ga0395901_0063621_98_1117 | 286 |
| 258 | 3300003215 | JGI25153J46596_10005817 | JGI25153J46596_100058172 | 287 |
| 259 | 3300005334 | Ga0068869_100024807 | Ga0068869_1000248074 | 287 |
| 260 | 3300005937 | Ga0081455_10120966 | Ga0081455_101209662 | 287 |
| 261 | 3300009545 | Ga0105237_10100467 | Ga0105237_101004671 | 287 |
| 262 | 3300025297 | Ga0209758_1002765 | Ga0209758_100276513 | 287 |
| 263 | 3300048927 | Ga0496124_0124045 | Ga0496124_0124045_124_1140 | 287 |
| 264 | 3300053177 | Ga0500636_0000232 | Ga0500636_0000232_23061_24080 | 287 |
| 265 | 3300003215 | JGI25153J46596_10005506 | JGI25153J46596_100055062 | 288 |
| 266 | 3300006943 | Ga0099822_1018262 | Ga0099822_10182622 | 288 |
| 267 | 3300025297 | Ga0209758_1003053 | Ga0209758_10030539 | 288 |
| 268 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005309 | 288 |
| 269 | 3300027361 | Ga0209489_100005 | Ga0209489_100005309 | 288 |
| 270 | 3300027363 | Ga0209700_100006 | Ga0209700_100006309 | 288 |
| 271 | 3300033180 | Ga0307510_10015767 | Ga0307510_100157675 | 288 |
| 272 | 3300037471 | Ga0395905_0006649 | Ga0395905_0006649_4951_5970 | 288 |
| 273 | 3300038443 | Ga0395901_0293763 | Ga0395901_0293763_104_1123 | 288 |
| 274 | 3300046455 | Ga0495603_0017918 | Ga0495603_0017918_1006_2022 | 288 |
| 275 | 3300046461 | Ga0495641_0054881 | Ga0495641_0054881_172_1188 | 288 |
| 276 | 3300046660 | Ga0495625_0039854 | Ga0495625_0039854_361_1365 | 288 |
| 277 | 3300048918 | Ga0496115_0197445 | Ga0496115_0197445_74_1090 | 288 |
| 278 | 3300003215 | JGI25153J46596_10002285 | JGI25153J46596_1000228510 | 289 |
| 279 | 3300003794 | Ga0055531_10021311 | Ga0055531_100213112 | 289 |
| 280 | 3300005434 | Ga0070709_10061536 | Ga0070709_100615362 | 289 |
| 281 | 3300009098 | Ga0105245_10493903 | Ga0105245_104939032 | 289 |
| 282 | 3300025295 | Ga0209564_1009335 | Ga0209564_10093355 | 289 |
| 283 | 3300025297 | Ga0209758_1000106 | Ga0209758_1000106159 | 289 |
| 284 | 3300025303 | Ga0209051_1032436 | Ga0209051_10324362 | 289 |
| 285 | 3300025304 | Ga0209257_1000684 | Ga0209257_100068427 | 289 |
| 286 | 3300025906 | Ga0207699_10003881 | Ga0207699_100038812 | 289 |
| 287 | 3300037466 | Ga0395898_0398421 | Ga0395898_0398421_182_1198 | 289 |
| 288 | 3300037471 | Ga0395905_0058930 | Ga0395905_0058930_2303_3319 | 289 |
| 289 | 3300038443 | Ga0395901_0372305 | Ga0395901_0372305_71_1087 | 289 |
| 290 | 3300053086 | Ga0500578_0165010 | Ga0500578_0165010_282_1301 | 289 |
| 291 | 3300025299 | Ga0209256_1004898 | Ga0209256_10048982 | 290 |
| 292 | 3300044901 | Ga0466960_0056191 | Ga0466960_0056191_492_1511 | 290 |
| 293 | 3300046507 | Ga0495606_0001686 | Ga0495606_0001686_9784_10791 | 290 |
| 294 | 3300048906 | Ga0496103_0125206 | Ga0496103_0125206_231_1250 | 290 |
| 295 | 3300053729 | Ga0500625_008952 | Ga0500625_008952_2771_3790 | 290 |
| 296 | 3300053730 | Ga0500645_004073 | Ga0500645_004073_2537_3553 | 290 |
| 297 | 3300005330 | Ga0070690_100190181 | Ga0070690_1001901812 | 291 |
| 298 | 3300005347 | Ga0070668_100098996 | Ga0070668_1000989962 | 291 |
| 299 | 3300005548 | Ga0070665_100157826 | Ga0070665_1001578262 | 291 |
| 300 | 3300005563 | Ga0068855_100063917 | Ga0068855_1000639174 | 291 |
| 301 | 3300005564 | Ga0070664_100233944 | Ga0070664_1002339442 | 291 |
| 302 | 3300005614 | Ga0068856_100025897 | Ga0068856_1000258975 | 291 |
| 303 | 3300005618 | Ga0068864_100037084 | Ga0068864_1000370842 | 291 |
| 304 | 3300005719 | Ga0068861_100072083 | Ga0068861_1000720832 | 291 |
| 305 | 3300005840 | Ga0068870_10024112 | Ga0068870_100241123 | 291 |
| 306 | 3300005843 | Ga0068860_100087726 | Ga0068860_1000877262 | 291 |
| 307 | 3300005844 | Ga0068862_100122064 | Ga0068862_1001220642 | 291 |
| 308 | 3300006042 | Ga0075368_10016457 | Ga0075368_100164573 | 291 |
| 309 | 3300006051 | Ga0075364_10038022 | Ga0075364_100380223 | 291 |
| 310 | 3300006178 | Ga0075367_10126702 | Ga0075367_101267022 | 291 |
| 311 | 3300006186 | Ga0075369_10104716 | Ga0075369_101047162 | 291 |
| 312 | 3300006237 | Ga0097621_100237098 | Ga0097621_1002370981 | 291 |
| 313 | 3300009098 | Ga0105245_10034045 | Ga0105245_100340452 | 291 |
| 314 | 3300009174 | Ga0105241_10047557 | Ga0105241_100475572 | 291 |
| 315 | 3300009177 | Ga0105248_10155290 | Ga0105248_101552902 | 291 |
| 316 | 3300010375 | Ga0105239_10229212 | Ga0105239_102292122 | 291 |
| 317 | 3300011119 | Ga0105246_10012004 | Ga0105246_100120043 | 291 |
| 318 | 3300013297 | Ga0157378_10073096 | Ga0157378_100730962 | 291 |
| 319 | 3300025908 | Ga0207643_10023699 | Ga0207643_100236992 | 291 |
| 320 | 3300025911 | Ga0207654_10019681 | Ga0207654_100196813 | 291 |
| 321 | 3300025920 | Ga0207649_10021842 | Ga0207649_100218424 | 291 |
| 322 | 3300025941 | Ga0207711_10104563 | Ga0207711_101045632 | 291 |
| 323 | 3300025945 | Ga0207679_10084259 | Ga0207679_100842593 | 291 |
| 324 | 3300025949 | Ga0207667_10216123 | Ga0207667_102161232 | 291 |
| 325 | 3300025972 | Ga0207668_10037794 | Ga0207668_100377943 | 291 |
| 326 | 3300025981 | Ga0207640_10098749 | Ga0207640_100987494 | 291 |
| 327 | 3300026023 | Ga0207677_10078745 | Ga0207677_100787452 | 291 |
| 328 | 3300026035 | Ga0207703_10014325 | Ga0207703_100143258 | 291 |
| 329 | 3300026088 | Ga0207641_10112364 | Ga0207641_101123642 | 291 |
| 330 | 3300026095 | Ga0207676_10036319 | Ga0207676_100363194 | 291 |
| 331 | 3300026118 | Ga0207675_100107005 | Ga0207675_1001070052 | 291 |
| 332 | 3300027866 | Ga0209813_10065617 | Ga0209813_100656171 | 291 |
| 333 | 3300028379 | Ga0268266_10020674 | Ga0268266_100206742 | 291 |
| 334 | 3300028380 | Ga0268265_10050871 | Ga0268265_100508713 | 291 |
| 335 | 3300044658 | Ga0466972_0000771 | Ga0466972_0000771_11742_12761 | 291 |
| 336 | 3300048905 | Ga0496102_0145378 | Ga0496102_0145378_53_1069 | 291 |
| 337 | 3300048907 | Ga0496104_0315126 | Ga0496104_0315126_380_1396 | 291 |
| 338 | 3300048911 | Ga0496108_0075641 | Ga0496108_0075641_230_1246 | 291 |
| 339 | 3300048918 | Ga0496115_0214663 | Ga0496115_0214663_257_1273 | 291 |
| 340 | 3300048924 | Ga0496121_0031994 | Ga0496121_0031994_2308_3324 | 291 |
| 341 | 3300048928 | Ga0496125_0179214 | Ga0496125_0179214_385_1401 | 291 |
| 342 | 3300050491 | nmdc:mga00v17_36841_c1 | nmdc:mga00v17_36841_c1_1319_2335 | 291 |
| 343 | 3300050492 | nmdc:mga0yw44_223246_c1 | nmdc:mga0yw44_223246_c1_131_1147 | 291 |
| 344 | 3300050492 | nmdc:mga0yw44_72265_c1 | nmdc:mga0yw44_72265_c1_821_1837 | 291 |
| 345 | 3300050495 | nmdc:mga04h51_84883_c1 | nmdc:mga04h51_84883_c1_35_1051 | 291 |
| 346 | 3300050496 | nmdc:mga07m45_32628_c1 | nmdc:mga07m45_32628_c1_827_1843 | 291 |
| 347 | 3300046460 | Ga0495638_0025345 | Ga0495638_0025345_544_1560 | 292 |
| 348 | 3300046492 | Ga0495585_0081204 | Ga0495585_0081204_238_1254 | 292 |
| 349 | 3300046499 | Ga0495594_0033984 | Ga0495594_0033984_135_1151 | 292 |
| 350 | 3300046518 | Ga0495631_0022621 | Ga0495631_0022621_495_1511 | 292 |
| 351 | 3300046519 | Ga0495632_0061326 | Ga0495632_0061326_695_1711 | 292 |
| 352 | 3300046691 | Ga0495670_0076468 | Ga0495670_0076468_303_1319 | 292 |
| 353 | 3300047323 | Ga0495683_0115123 | Ga0495683_0115123_244_1260 | 292 |
| 354 | 3300053091 | Ga0500647_0008273 | Ga0500647_0008273_1963_2982 | 292 |
| 355 | 3300053105 | Ga0500557_000303 | Ga0500557_000303_939_1958 | 292 |
| 356 | 3300009092 | Ga0105250_10083843 | Ga0105250_100838432 | 293 |
| 357 | 3300014325 | Ga0163163_10295461 | Ga0163163_102954612 | 293 |
| 358 | 3300026041 | Ga0207639_10190846 | Ga0207639_101908462 | 293 |
| 359 | 3300033180 | Ga0307510_10007708 | Ga0307510_100077088 | 293 |
| 360 | 3300046455 | Ga0495603_0009958 | Ga0495603_0009958_4182_5198 | 293 |
| 361 | 3300046538 | Ga0495609_0053461 | Ga0495609_0053461_161_1177 | 293 |
| 362 | 3300046558 | Ga0495633_0043207 | Ga0495633_0043207_658_1674 | 293 |
| 363 | 3300046664 | Ga0495659_0005390 | Ga0495659_0005390_2828_3844 | 293 |
| 364 | 3300046674 | Ga0495588_0004335 | Ga0495588_0004335_1081_2097 | 293 |
| 365 | 3300046691 | Ga0495670_0022116 | Ga0495670_0022116_1833_2849 | 293 |
| 366 | 3300053103 | Ga0500555_001634 | Ga0500555_001634_479_1498 | 293 |
| 367 | 3300053139 | Ga0500568_0019363 | Ga0500568_0019363_1176_2195 | 293 |
| 368 | 3300005367 | Ga0070667_100201256 | Ga0070667_1002012562 | 294 |
| 369 | 3300006195 | Ga0075366_10060813 | Ga0075366_100608132 | 294 |
| 370 | 3300006944 | Ga0099823_1029329 | Ga0099823_10293292 | 294 |
| 371 | 3300009553 | Ga0105249_10087482 | Ga0105249_100874822 | 294 |
| 372 | 3300025942 | Ga0207689_10099354 | Ga0207689_100993542 | 294 |
| 373 | 3300025972 | Ga0207668_10058342 | Ga0207668_100583422 | 294 |
| 374 | 3300026075 | Ga0207708_10102817 | Ga0207708_101028173 | 294 |
| 375 | 3300026118 | Ga0207675_100171275 | Ga0207675_1001712753 | 294 |
| 376 | 3300027296 | Ga0209389_1000016 | Ga0209389_100001651 | 294 |
| 377 | 3300027361 | Ga0209489_100063 | Ga0209489_1000639 | 294 |
| 378 | 3300027363 | Ga0209700_100012 | Ga0209700_10001252 | 294 |
| 379 | 3300033180 | Ga0307510_10079377 | Ga0307510_100793772 | 294 |
| 380 | 3300050496 | nmdc:mga07m45_20736_c1 | nmdc:mga07m45_20736_c1_2384_3403 | 294 |
| 381 | 3300010159 | Ga0099796_10047241 | Ga0099796_100472411 | 295 |
| 382 | 3300031730 | Ga0307516_10282320 | Ga0307516_102823201 | 295 |
| 383 | 3300046455 | Ga0495603_0150103 | Ga0495603_0150103_67_1083 | 295 |
| 384 | 3300048915 | Ga0496112_0331134 | Ga0496112_0331134_372_1391 | 295 |
| 385 | 3300003354 | JGI25160J50197_1005444 | JGI25160J50197_10054444 | 296 |
| 386 | 3300005367 | Ga0070667_100087287 | Ga0070667_1000872873 | 296 |
| 387 | 3300005543 | Ga0070672_100113902 | Ga0070672_1001139022 | 296 |
| 388 | 3300005548 | Ga0070665_100156929 | Ga0070665_1001569293 | 296 |
| 389 | 3300005842 | Ga0068858_100085735 | Ga0068858_1000857352 | 296 |
| 390 | 3300005843 | Ga0068860_100096524 | Ga0068860_1000965242 | 296 |
| 391 | 3300005844 | Ga0068862_100138897 | Ga0068862_1001388972 | 296 |
| 392 | 3300006173 | Ga0070716_100061025 | Ga0070716_1000610252 | 296 |
| 393 | 3300025302 | Ga0207426_1000337 | Ga0207426_100033725 | 296 |
| 394 | 3300025986 | Ga0207658_10107001 | Ga0207658_101070012 | 296 |
| 395 | 3300028379 | Ga0268266_10004322 | Ga0268266_1000432215 | 296 |
| 396 | 3300028380 | Ga0268265_10156107 | Ga0268265_101561072 | 296 |
| 397 | 3300046460 | Ga0495638_0063301 | Ga0495638_0063301_15_1034 | 296 |
| 398 | 3300048905 | Ga0496102_0443208 | Ga0496102_0443208_119_1135 | 296 |
| 399 | 3300048911 | Ga0496108_0033841 | Ga0496108_0033841_2676_3692 | 296 |
| 400 | 3300048912 | Ga0496109_0133419 | Ga0496109_0133419_937_1953 | 296 |
| 401 | 3300032002 | Ga0307416_100209239 | Ga0307416_1002092392 | 297 |
| 402 | 3300005338 | Ga0068868_100043361 | Ga0068868_1000433612 | 298 |
| 403 | 3300005844 | Ga0068862_100146834 | Ga0068862_1001468342 | 298 |
| 404 | 3300005439 | Ga0070711_100292297 | Ga0070711_1002922971 | 299 |
| 405 | 3300005455 | Ga0070663_100014544 | Ga0070663_1000145445 | 299 |
| 406 | 3300009093 | Ga0105240_10019788 | Ga0105240_100197884 | 299 |
| 407 | 3300013104 | Ga0157370_10215213 | Ga0157370_102152132 | 299 |
| 408 | 3300013105 | Ga0157369_10047829 | Ga0157369_100478294 | 299 |
| 409 | 3300025913 | Ga0207695_10036803 | Ga0207695_100368034 | 299 |
| 410 | 3300025914 | Ga0207671_10032007 | Ga0207671_100320073 | 299 |
| 411 | 3300025916 | Ga0207663_10239084 | Ga0207663_102390841 | 299 |
| 412 | 3300035086 | Ga0373934_0004936 | Ga0373934_0004936_638_1654 | 299 |
| 413 | 3300035111 | Ga0373923_0018906 | Ga0373923_0018906_858_1874 | 299 |
| 414 | 3300035117 | Ga0373953_0017673 | Ga0373953_0017673_1010_2026 | 299 |
| 415 | 3300035118 | Ga0373954_0002374 | Ga0373954_0002374_3118_4134 | 299 |
| 416 | 3300035119 | Ga0373956_0019983 | Ga0373956_0019983_558_1574 | 299 |
| 417 | 3300035120 | Ga0373957_0008219 | Ga0373957_0008219_2071_3087 | 299 |
| 418 | 3300035172 | Ga0373955_0000590 | Ga0373955_0000590_9787_10803 | 299 |
| 419 | 3300035410 | Ga0373924_0049834 | Ga0373924_0049834_549_1565 | 299 |
| 420 | 3300037312 | Ga0395899_0193077 | Ga0395899_0193077_372_1391 | 299 |
| 421 | 3300037418 | Ga0395900_0011126 | Ga0395900_0011126_3282_4301 | 299 |
| 422 | 3300037466 | Ga0395898_0029509 | Ga0395898_0029509_1382_2401 | 299 |
| 423 | 3300046454 | Ga0495592_0007391 | Ga0495592_0007391_5932_6948 | 299 |
| 424 | 3300046459 | Ga0495629_0020427 | Ga0495629_0020427_2952_3968 | 299 |
| 425 | 3300046462 | Ga0495651_0009620 | Ga0495651_0009620_1011_2027 | 299 |
| 426 | 3300046463 | Ga0495653_0017260 | Ga0495653_0017260_2073_3089 | 299 |
| 427 | 3300046514 | Ga0495618_0023387 | Ga0495618_0023387_1795_2811 | 299 |
| 428 | 3300046516 | Ga0495628_0011834 | Ga0495628_0011834_5233_6249 | 299 |
| 429 | 3300046529 | Ga0495652_0033670 | Ga0495652_0033670_1326_2342 | 299 |
| 430 | 3300046533 | Ga0495640_0009547 | Ga0495640_0009547_3561_4577 | 299 |
| 431 | 3300046536 | Ga0495587_0027506 | Ga0495587_0027506_2037_3053 | 299 |
| 432 | 3300046543 | Ga0495645_0009133 | Ga0495645_0009133_5493_6509 | 299 |
| 433 | 3300046642 | Ga0495634_0009379 | Ga0495634_0009379_3214_4230 | 299 |
| 434 | 3300046663 | Ga0495635_0007423 | Ga0495635_0007423_2984_4000 | 299 |
| 435 | 3300046675 | Ga0495657_0016949 | Ga0495657_0016949_1811_2827 | 299 |
| 436 | 3300046678 | Ga0495599_0019799 | Ga0495599_0019799_1048_2064 | 299 |
| 437 | 3300046679 | Ga0495623_0021928 | Ga0495623_0021928_2129_3145 | 299 |
| 438 | 3300046680 | Ga0495646_0030420 | Ga0495646_0030420_1795_2811 | 299 |
| 439 | 3300046809 | Ga0495600_0031062 | Ga0495600_0031062_343_1359 | 299 |
| 440 | 3300047322 | Ga0495680_0014448 | Ga0495680_0014448_2037_3053 | 299 |
| 441 | 3300047444 | Ga0495675_0063400 | Ga0495675_0063400_352_1368 | 299 |
| 442 | 3300047471 | Ga0495684_0033570 | Ga0495684_0033570_2894_3910 | 299 |
| 443 | 3300048088 | Ga0495602_0091137 | Ga0495602_0091137_503_1519 | 299 |
| 444 | 3300050512 | nmdc:mga0n895_136704_c1 | nmdc:mga0n895_136704_c1_295_1311 | 299 |
| 445 | 3300053077 | Ga0495601_0111788 | Ga0495601_0111788_27_1043 | 299 |
| 446 | 3300053078 | Ga0495612_0037631 | Ga0495612_0037631_479_1495 | 299 |
| 447 | 3300053085 | Ga0495619_0124370 | Ga0495619_0124370_27_1043 | 299 |
| 448 | 3300005262 | Ga0065165_1010731 | Ga0065165_10107312 | 300 |
| 449 | 3300037853 | Ga0436364_0683264 | Ga0436364_0683264_468_1490 | 300 |
| 450 | 3300044842 | Ga0466957_0080681 | Ga0466957_0080681_483_1502 | 300 |
| 451 | 3300037471 | Ga0395905_0531533 | Ga0395905_0531533_22_996 | 301 |
| 452 | 3300053177 | Ga0500636_0001203 | Ga0500636_0001203_2827_3846 | 301 |
| 453 | 3300006177 | Ga0075362_10072451 | Ga0075362_100724511 | 302 |
| 454 | 3300045049 | Ga0466959_0084671 | Ga0466959_0084671_1039_2058 | 302 |
| 455 | 3300039437 | Ga0436365_1737269 | Ga0436365_1737269_1337_2356 | 303 |
| 456 | 3300031344 | Ga0265316_10200092 | Ga0265316_102000922 | 304 |
| 457 | 3300031711 | Ga0265314_10022030 | Ga0265314_100220305 | 304 |
| 458 | 3300031712 | Ga0265342_10013040 | Ga0265342_100130406 | 304 |
| 459 | 3300046460 | Ga0495638_0138305 | Ga0495638_0138305_217_1206 | 304 |
| 460 | 3300013105 | Ga0157369_10175210 | Ga0157369_101752103 | 305 |
| 461 | 3300036401 | Ga0373937_0224225 | Ga0373937_0224225_409_1425 | 305 |
| 462 | 3300046462 | Ga0495651_0086272 | Ga0495651_0086272_1290_2306 | 305 |
| 463 | 3300048924 | Ga0496121_0000254 | Ga0496121_0000254_21953_22969 | 305 |
| 464 | 3300005530 | Ga0070679_100099831 | Ga0070679_1000998313 | 306 |
| 465 | 3300005983 | Ga0081540_1050413 | Ga0081540_10504132 | 306 |
| 466 | 3300009093 | Ga0105240_10261557 | Ga0105240_102615572 | 306 |
| 467 | 3300009174 | Ga0105241_10278267 | Ga0105241_102782672 | 306 |
| 468 | 3300010375 | Ga0105239_10079757 | Ga0105239_100797572 | 306 |
| 469 | 3300025913 | Ga0207695_10134917 | Ga0207695_101349172 | 306 |
| 470 | 3300031507 | Ga0307509_10006260 | Ga0307509_1000626011 | 306 |
| 471 | 3300033179 | Ga0307507_10051819 | Ga0307507_100518194 | 306 |
| 472 | 3300035116 | Ga0373945_0031078 | Ga0373945_0031078_369_1388 | 306 |
| 473 | 3300035119 | Ga0373956_0011847 | Ga0373956_0011847_2334_3353 | 306 |
| 474 | 3300035695 | Ga0373927_0008338 | Ga0373927_0008338_4271_5284 | 306 |
| 475 | 3300035724 | Ga0373933_0116885 | Ga0373933_0116885_310_1329 | 306 |
| 476 | 3300044693 | Ga0466961_0031967 | Ga0466961_0031967_1259_2278 | 306 |
| 477 | 3300044842 | Ga0466957_0090965 | Ga0466957_0090965_680_1699 | 306 |
| 478 | 3300045049 | Ga0466959_0036415 | Ga0466959_0036415_1008_2027 | 306 |
| 479 | 3300047317 | Ga0495604_0121938 | Ga0495604_0121938_681_1700 | 306 |
| 480 | 3300048909 | Ga0496106_0001280 | Ga0496106_0001280_86_1099 | 306 |
| 481 | 3300048921 | Ga0496118_0001458 | Ga0496118_0001458_16115_17128 | 306 |
| 482 | 3300048924 | Ga0496121_0000146 | Ga0496121_0000146_59977_60990 | 306 |
| 483 | 3300048927 | Ga0496124_0002217 | Ga0496124_0002217_18014_19027 | 306 |
| 484 | 3300048929 | Ga0496126_0011968 | Ga0496126_0011968_867_1880 | 306 |
| 485 | 3300053097 | Ga0500648_101140 | Ga0500648_101140_338_1351 | 306 |
| 486 | 3300053136 | Ga0500559_0007573 | Ga0500559_0007573_2420_3433 | 306 |
| 487 | 3300053140 | Ga0500573_0025041 | Ga0500573_0025041_294_1307 | 306 |
| 488 | 3300053735 | Ga0500596_001927 | Ga0500596_001927_2860_3873 | 306 |
| 489 | 3300025297 | Ga0209758_1027003 | Ga0209758_10270032 | 307 |
| 490 | 3300025929 | Ga0207664_10260461 | Ga0207664_102604611 | 307 |
| 491 | 3300026067 | Ga0207678_10041915 | Ga0207678_100419153 | 307 |
| 492 | 3300028794 | Ga0307515_10240563 | Ga0307515_102405632 | 307 |
| 493 | 3300046512 | Ga0495610_0026186 | Ga0495610_0026186_1821_2843 | 307 |
| 494 | 3300046530 | Ga0495654_0012179 | Ga0495654_0012179_328_1350 | 307 |
| 495 | 3300048921 | Ga0496118_0016977 | Ga0496118_0016977_4912_5934 | 307 |
| 496 | 3300048922 | Ga0496119_0061303 | Ga0496119_0061303_943_1965 | 307 |
| 497 | 3300048924 | Ga0496121_0009157 | Ga0496121_0009157_4653_5675 | 307 |
| 498 | 3300048928 | Ga0496125_0009421 | Ga0496125_0009421_4866_5888 | 307 |
| 499 | 3300048929 | Ga0496126_0100238 | Ga0496126_0100238_840_1859 | 307 |
| 500 | 3300053089 | Ga0500581_061300 | Ga0500581_061300_68_1090 | 307 |
| 501 | 3300053093 | Ga0500651_0091596 | Ga0500651_0091596_343_1362 | 307 |
| 502 | 3300053094 | Ga0500566_0003433 | Ga0500566_0003433_6101_7120 | 307 |
| 503 | 3300053096 | Ga0500641_0001161 | Ga0500641_0001161_2807_3829 | 307 |
| 504 | 3300053098 | Ga0500650_0025530 | Ga0500650_0025530_1227_2249 | 307 |
| 505 | 3300053104 | Ga0500556_0000035 | Ga0500556_0000035_48801_49823 | 307 |
| 506 | 3300053116 | Ga0500592_002069 | Ga0500592_002069_744_1766 | 307 |
| 507 | 3300053122 | Ga0500608_000269 | Ga0500608_000269_14438_15457 | 307 |
| 508 | 3300053130 | Ga0500642_0000027 | Ga0500642_0000027_64273_65295 | 307 |
| 509 | 3300053136 | Ga0500559_0000064 | Ga0500559_0000064_52163_53182 | 307 |
| 510 | 3300053139 | Ga0500568_0000443 | Ga0500568_0000443_17234_18256 | 307 |
| 511 | 3300053142 | Ga0500577_0011003 | Ga0500577_0011003_925_1947 | 307 |
| 512 | 3300053151 | Ga0500604_0006983 | Ga0500604_0006983_361_1383 | 307 |
| 513 | iso_pu_bacteria | 2721755755 | 2723842546 | 307 |
| 514 | 3300005983 | Ga0081540_1013150 | Ga0081540_10131505 | 308 |
| 515 | iso_pu_bacteria | 2922361189 | 2922367566 | 308 |
| 516 | iso_pu_bacteria | 8006964411 | 8006965432 | 308 |
| 517 | iso_pu_bacteria | 8006994254 | 8006999177 | 308 |
| 518 | iso_pu_bacteria | 8016557553 | 8016558702 | 308 |
| 519 | 3300005340 | Ga0070689_100073764 | Ga0070689_1000737642 | 309 |
| 520 | 3300005434 | Ga0070709_10005731 | Ga0070709_100057312 | 309 |
| 521 | 3300005435 | Ga0070714_100094816 | Ga0070714_1000948162 | 309 |
| 522 | 3300005437 | Ga0070710_10007859 | Ga0070710_100078592 | 309 |
| 523 | 3300025898 | Ga0207692_10026043 | Ga0207692_100260432 | 309 |
| 524 | 3300025906 | Ga0207699_10118520 | Ga0207699_101185202 | 309 |
| 525 | 3300025915 | Ga0207693_10003096 | Ga0207693_1000309612 | 309 |
| 526 | 3300025928 | Ga0207700_10059772 | Ga0207700_100597722 | 309 |
| 527 | 3300053087 | Ga0500643_046803 | Ga0500643_046803_34_1056 | 309 |
| 528 | 3300053153 | Ga0500616_0000054 | Ga0500616_0000054_237301_238323 | 309 |
| 529 | 3300053156 | Ga0500622_0003640 | Ga0500622_0003640_4771_5793 | 309 |
| 530 | 3300005339 | Ga0070660_100003353 | Ga0070660_10000335313 | 310 |
| 531 | 3300005341 | Ga0070691_10009236 | Ga0070691_100092365 | 310 |
| 532 | 3300005455 | Ga0070663_100161969 | Ga0070663_1001619691 | 310 |
| 533 | 3300005458 | Ga0070681_10033490 | Ga0070681_100334902 | 310 |
| 534 | 3300005535 | Ga0070684_100006286 | Ga0070684_1000062863 | 310 |
| 535 | 3300005539 | Ga0068853_100001496 | Ga0068853_10000149619 | 310 |
| 536 | 3300005577 | Ga0068857_100004210 | Ga0068857_10000421015 | 310 |
| 537 | 3300005616 | Ga0068852_100256096 | Ga0068852_1002560961 | 310 |
| 538 | 3300005834 | Ga0068851_10005600 | Ga0068851_100056003 | 310 |
| 539 | 3300009093 | Ga0105240_10009125 | Ga0105240_100091253 | 310 |
| 540 | 3300009545 | Ga0105237_10008895 | Ga0105237_1000889513 | 310 |
| 541 | 3300009551 | Ga0105238_10026375 | Ga0105238_100263753 | 310 |
| 542 | 3300010375 | Ga0105239_10008167 | Ga0105239_1000816712 | 310 |
| 543 | 3300013105 | Ga0157369_10091731 | Ga0157369_100917312 | 310 |
| 544 | 3300020070 | Ga0206356_10561849 | Ga0206356_105618492 | 310 |
| 545 | 3300025912 | Ga0207707_10001933 | Ga0207707_1000193319 | 310 |
| 546 | 3300025913 | Ga0207695_10070144 | Ga0207695_100701443 | 310 |
| 547 | 3300025914 | Ga0207671_10089412 | Ga0207671_100894122 | 310 |
| 548 | 3300025917 | Ga0207660_10009206 | Ga0207660_100092064 | 310 |
| 549 | 3300025919 | Ga0207657_10017675 | Ga0207657_100176756 | 310 |
| 550 | 3300025949 | Ga0207667_10013826 | Ga0207667_1001382613 | 310 |
| 551 | 3300026116 | Ga0207674_10004961 | Ga0207674_1000496115 | 310 |
| 552 | 3300035725 | Ga0373947_0085749 | Ga0373947_0085749_733_1755 | 310 |
| 553 | 3300045976 | Ga0466967_0198779 | Ga0466967_0198779_491_1492 | 310 |
| 554 | 3300046455 | Ga0495603_0033395 | Ga0495603_0033395_1035_2057 | 310 |
| 555 | 3300046531 | Ga0495665_0067781 | Ga0495665_0067781_711_1733 | 310 |
| 556 | 3300047321 | Ga0495676_0049592 | Ga0495676_0049592_432_1454 | 310 |
| 557 | 3300005445 | Ga0070708_100024114 | Ga0070708_1000241144 | 311 |
| 558 | 3300005467 | Ga0070706_100093394 | Ga0070706_1000933944 | 311 |
| 559 | 3300025910 | Ga0207684_10133431 | Ga0207684_101334312 | 311 |
| 560 | 3300048918 | Ga0496115_0067943 | Ga0496115_0067943_786_1808 | 311 |
| 561 | iso_pu_bacteria | 8016575299 | 8016581054 | 311 |
| 562 | 3300005983 | Ga0081540_1005016 | Ga0081540_10050165 | 312 |
| 563 | 3300026067 | Ga0207678_10027182 | Ga0207678_100271824 | 312 |
| 564 | 3300037418 | Ga0395900_0034589 | Ga0395900_0034589_1427_2446 | 312 |
| 565 | 3300060353 | Ga0501082_0239300 | Ga0501082_0239300_377_1381 | 312 |
| 566 | iso_pu_bacteria | 2791355199 | 2793078589 | 312 |
| 567 | iso_pu_bacteria | 2879110137 | 2879113503 | 312 |
| 568 | iso_pu_bacteria | 2889033259 | 2889034176 | 312 |
| 569 | iso_pu_bacteria | 8006984368 | 8006986161 | 312 |
| 570 | 3300005614 | Ga0068856_100006410 | Ga0068856_1000064108 | 313 |
| 571 | 3300006358 | Ga0068871_100052977 | Ga0068871_1000529772 | 313 |
| 572 | 3300013308 | Ga0157375_10047373 | Ga0157375_100473734 | 313 |
| 573 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014252 | 313 |
| 574 | 3300026121 | Ga0207683_10014788 | Ga0207683_100147886 | 313 |
| 575 | 3300031235 | Ga0265330_10036743 | Ga0265330_100367432 | 313 |
| 576 | iso_pu_bacteria | 2507262055 | 2507504355 | 313 |
| 577 | iso_pu_bacteria | 2508501009 | 2508545790 | 313 |
| 578 | iso_pu_bacteria | 2508501042 | 2508694616 | 313 |
| 579 | iso_pu_bacteria | 2511231028 | 2511398382 | 313 |
| 580 | iso_pu_bacteria | 2513237092 | 2513624472 | 313 |
| 581 | iso_pu_bacteria | 2513237094 | 2513638663 | 313 |
| 582 | iso_pu_bacteria | 2513237095 | 2513649946 | 313 |
| 583 | iso_pu_bacteria | 2513237096 | 2513655386 | 313 |
| 584 | iso_pu_bacteria | 2513237104 | 2513716791 | 313 |
| 585 | iso_pu_bacteria | 2513237137 | 2513860050 | 313 |
| 586 | iso_pu_bacteria | 2513237139 | 2513874241 | 313 |
| 587 | iso_pu_bacteria | 2513237145 | 2513916536 | 313 |
| 588 | iso_pu_bacteria | 2513237161 | 2514009993 | 313 |
| 589 | iso_pu_bacteria | 2515154112 | 2515624457 | 313 |
| 590 | iso_pu_bacteria | 2517093001 | 2517104616 | 313 |
| 591 | iso_pu_bacteria | 2517572143 | 2517889873 | 313 |
| 592 | iso_pu_bacteria | 2524023205 | 2524438568 | 313 |
| 593 | iso_pu_bacteria | 2524023228 | 2524532939 | 313 |
| 594 | iso_pu_bacteria | 2528768022 | 2528850421 | 313 |
| 595 | iso_pu_bacteria | 2617270735 | 2617353866 | 313 |
| 596 | iso_pu_bacteria | 2617270741 | 2617374643 | 313 |
| 597 | iso_pu_bacteria | 2667528175 | 2671121103 | 313 |
| 598 | iso_pu_bacteria | 2728368998 | 2728751732 | 313 |
| 599 | iso_pu_bacteria | 2744054633 | 2745077206 | 313 |
| 600 | iso_pu_bacteria | 2791355196 | 2793059375 | 313 |
| 601 | iso_pu_bacteria | 2791355197 | 2793073397 | 313 |
| 602 | iso_pu_bacteria | 2802429603 | 2805922131 | 313 |
| 603 | iso_pu_bacteria | 2816332527 | 2818240946 | 313 |
| 604 | iso_pu_bacteria | 2824617872 | 2824618916 | 313 |
| 605 | iso_pu_bacteria | 2824626560 | 2824632932 | 313 |
| 606 | iso_pu_bacteria | 2824635225 | 2824642631 | 313 |
| 607 | iso_pu_bacteria | 2824644064 | 2824650879 | 313 |
| 608 | iso_pu_bacteria | 2824661429 | 2824667377 | 313 |
| 609 | iso_pu_bacteria | 2824671348 | 2824675544 | 313 |
| 610 | iso_pu_bacteria | 2824679649 | 2824686557 | 313 |
| 611 | iso_pu_bacteria | 2824687955 | 2824691766 | 313 |
| 612 | iso_pu_bacteria | 2824704595 | 2824711683 | 313 |
| 613 | iso_pu_bacteria | 2824714736 | 2824720731 | 313 |
| 614 | iso_pu_bacteria | 2824723954 | 2824730675 | 313 |
| 615 | iso_pu_bacteria | 2824732956 | 2824739301 | 313 |
| 616 | iso_pu_bacteria | 2824746037 | 2824750385 | 313 |
| 617 | iso_pu_bacteria | 2824753945 | 2824761085 | 313 |
| 618 | iso_pu_bacteria | 2824763712 | 2824771798 | 313 |
| 619 | iso_pu_bacteria | 2824773399 | 2824779760 | 313 |
| 620 | iso_pu_bacteria | 2838122688 | 2838126102 | 313 |
| 621 | iso_pu_bacteria | 2841941048 | 2841942505 | 313 |
| 622 | iso_pu_bacteria | 2841949485 | 2841953145 | 313 |
| 623 | iso_pu_bacteria | 2841966195 | 2841970831 | 313 |
| 624 | iso_pu_bacteria | 2841974524 | 2841977910 | 313 |
| 625 | iso_pu_bacteria | 2841983080 | 2841984525 | 313 |
| 626 | iso_pu_bacteria | 2844315083 | 2844321364 | 313 |
| 627 | iso_pu_bacteria | 2847930680 | 2847932049 | 313 |
| 628 | iso_pu_bacteria | 2847939898 | 2847943286 | 313 |
| 629 | iso_pu_bacteria | 2849076700 | 2849077013 | 313 |
| 630 | iso_pu_bacteria | 2874620515 | 2874624249 | 313 |
| 631 | iso_pu_bacteria | 2874628541 | 2874630278 | 313 |
| 632 | iso_pu_bacteria | 2874645413 | 2874651679 | 313 |
| 633 | iso_pu_bacteria | 2876761206 | 2876767690 | 313 |
| 634 | iso_pu_bacteria | 2879142872 | 2879148543 | 313 |
| 635 | iso_pu_bacteria | 2881364244 | 2881367751 | 313 |
| 636 | iso_pu_bacteria | 2885374607 | 2885376200 | 313 |
| 637 | iso_pu_bacteria | 2885409591 | 2885411503 | 313 |
| 638 | iso_pu_bacteria | 2888378607 | 2888387660 | 313 |
| 639 | iso_pu_bacteria | 2893066018 | 2893070666 | 313 |
| 640 | iso_pu_bacteria | 2903727486 | 2903731446 | 313 |
| 641 | iso_pu_bacteria | 2903748898 | 2903749015 | 313 |
| 642 | iso_pu_bacteria | 2904666416 | 2904670960 | 313 |
| 643 | iso_pu_bacteria | 2904690495 | 2904692690 | 313 |
| 644 | iso_pu_bacteria | 2904699407 | 2904711206 | 313 |
| 645 | iso_pu_bacteria | 2904711408 | 2904713581 | 313 |
| 646 | iso_pu_bacteria | 2906602504 | 2906607978 | 313 |
| 647 | iso_pu_bacteria | 2906610324 | 2906612390 | 313 |
| 648 | iso_pu_bacteria | 2906635258 | 2906637842 | 313 |
| 649 | iso_pu_bacteria | 2906643746 | 2906647258 | 313 |
| 650 | iso_pu_bacteria | 2906660503 | 2906663431 | 313 |
| 651 | iso_pu_bacteria | 2908739725 | 2908739736 | 313 |
| 652 | iso_pu_bacteria | 2908756301 | 2908757670 | 313 |
| 653 | iso_pu_bacteria | 2908775508 | 2908777124 | 313 |
| 654 | iso_pu_bacteria | 2922368715 | 2922376647 | 313 |
| 655 | iso_pu_bacteria | 2922425934 | 2922426903 | 313 |
| 656 | iso_pu_bacteria | 2929615660 | 2929619850 | 313 |
| 657 | iso_pu_bacteria | 2929624759 | 2929629161 | 313 |
| 658 | iso_pu_bacteria | 2932794094 | 2932796627 | 313 |
| 659 | iso_pu_bacteria | 2932801729 | 2932802591 | 313 |
| 660 | iso_pu_bacteria | 2932828146 | 2932835632 | 313 |
| 661 | iso_pu_bacteria | 2933577622 | 2933581768 | 313 |
| 662 | iso_pu_bacteria | 2935616580 | 2935624594 | 313 |
| 663 | iso_pu_bacteria | 2935630451 | 2935633064 | 313 |
| 664 | iso_pu_bacteria | 2935638405 | 2935647179 | 313 |
| 665 | iso_pu_bacteria | 2935665750 | 2935674358 | 313 |
| 666 | iso_pu_bacteria | 2935675223 | 2935684239 | 313 |
| 667 | iso_pu_bacteria | 2935694250 | 2935697629 | 313 |
| 668 | iso_pu_bacteria | 2935769743 | 2935775169 | 313 |
| 669 | iso_pu_bacteria | 2935793552 | 2935798765 | 313 |
| 670 | iso_pu_bacteria | 2935801545 | 2935809867 | 313 |
| 671 | iso_pu_bacteria | 2935810662 | 2935819352 | 313 |
| 672 | iso_pu_bacteria | 2935827899 | 2935836603 | 313 |
| 673 | iso_pu_bacteria | 2935864058 | 2935868665 | 313 |
| 674 | iso_pu_bacteria | 2935873716 | 2935879439 | 313 |
| 675 | iso_pu_bacteria | 2935883170 | 2935883598 | 313 |
| 676 | iso_pu_bacteria | 2935975950 | 2935980081 | 313 |
| 677 | iso_pu_bacteria | 2935992306 | 2936000233 | 313 |
| 678 | iso_pu_bacteria | 2936037263 | 2936045975 | 313 |
| 679 | iso_pu_bacteria | 2940556831 | 2940563348 | 313 |
| 680 | iso_pu_bacteria | 2941507105 | 2941509634 | 313 |
| 681 | iso_pu_bacteria | 2941515067 | 2941517463 | 313 |
| 682 | iso_pu_bacteria | 2941523033 | 2941526584 | 313 |
| 683 | iso_pu_bacteria | 2941531003 | 2941531934 | 313 |
| 684 | iso_pu_bacteria | 2941538514 | 2941547261 | 313 |
| 685 | iso_pu_bacteria | 3005474847 | 3005476089 | 313 |
| 686 | iso_pu_bacteria | 3005506211 | 3005506644 | 313 |
| 687 | iso_pu_bacteria | 3005594810 | 3005601716 | 313 |
| 688 | iso_pu_bacteria | 3005710791 | 3005717456 | 313 |
| 689 | iso_pu_bacteria | 3005718088 | 3005724397 | 313 |
| 690 | iso_pu_bacteria | 8006973647 | 8006977431 | 313 |
| 691 | iso_pu_bacteria | 8016511872 | 8016519184 | 313 |
| 692 | iso_pu_bacteria | 8016522445 | 8016525131 | 313 |
| 693 | iso_pu_bacteria | 8016539877 | 8016542997 | 313 |
| 694 | iso_pu_bacteria | 8016566248 | 8016568397 | 313 |
| 695 | iso_pu_bacteria | 8016595262 | 8016596679 | 313 |
| 696 | iso_pu_bacteria | 8016622563 | 8016630244 | 313 |
| 697 | iso_pu_bacteria | 8017057580 | 8017066320 | 313 |
| 698 | iso_pu_bacteria | 8019530166 | 8019538382 | 313 |
| 699 | iso_pu_bacteria | 8019547302 | 8019549185 | 313 |
| 700 | iso_pu_bacteria | 8019555841 | 8019561224 | 313 |
| 701 | iso_pu_bacteria | 8019597564 | 8019605365 | 313 |
| 702 | iso_pu_bacteria | 8019608314 | 8019613177 | 313 |
| 703 | iso_pu_bacteria | 8019619141 | 8019623867 | 313 |
| 704 | iso_pu_bacteria | 8019638758 | 8019641460 | 313 |
| 705 | iso_pu_bacteria | 8019648815 | 8019651582 | 313 |
| 706 | iso_pu_bacteria | 8055742211 | 8055750398 | 313 |
| 707 | 3300003203 | JGI25406J46586_10002008 | JGI25406J46586_100020087 | 314 |
| 708 | 3300003659 | JGI25404J52841_10003298 | JGI25404J52841_100032982 | 314 |
| 709 | 3300005937 | Ga0081455_10033441 | Ga0081455_100334412 | 314 |
| 710 | 3300005983 | Ga0081540_1005788 | Ga0081540_100578810 | 314 |
| 711 | 3300005983 | Ga0081540_1015887 | Ga0081540_10158872 | 314 |
| 712 | 3300005983 | Ga0081540_1016301 | Ga0081540_10163012 | 314 |
| 713 | 3300005983 | Ga0081540_1029678 | Ga0081540_10296784 | 314 |
| 714 | 3300005985 | Ga0081539_10001098 | Ga0081539_1000109811 | 314 |
| 715 | 3300044658 | Ga0466972_0003626 | Ga0466972_0003626_955_1974 | 314 |
| 716 | 3300044683 | Ga0466965_0033173 | Ga0466965_0033173_45_1064 | 314 |
| 717 | 3300044735 | Ga0466968_0106163 | Ga0466968_0106163_78_1097 | 314 |
| 718 | 3300047315 | Ga0495581_0076665 | Ga0495581_0076665_82_1098 | 314 |
| 719 | 3300048914 | Ga0496111_0074598 | Ga0496111_0074598_1077_2099 | 314 |
| 720 | 3300048915 | Ga0496112_0303741 | Ga0496112_0303741_130_1152 | 314 |
| 721 | 3300048929 | Ga0496126_0255361 | Ga0496126_0255361_89_1105 | 314 |
| 722 | 3300049568 | Ga0501031_0000451 | Ga0501031_0000451_21513_22532 | 314 |
| 723 | 3300049569 | Ga0501032_0000196 | Ga0501032_0000196_33067_34086 | 314 |
| 724 | 3300049570 | Ga0501033_0001104 | Ga0501033_0001104_15655_16674 | 314 |
| 725 | 3300049571 | Ga0501034_0001151 | Ga0501034_0001151_33067_34086 | 314 |
| 726 | 3300049572 | Ga0501036_0000323 | Ga0501036_0000323_7160_8179 | 314 |
| 727 | 3300049573 | Ga0501037_0001204 | Ga0501037_0001204_15386_16405 | 314 |
| 728 | 3300049574 | Ga0501038_0002973 | Ga0501038_0002973_12072_13091 | 314 |
| 729 | 3300049575 | Ga0501039_0000705 | Ga0501039_0000705_12607_13626 | 314 |
| 730 | 3300049579 | Ga0501043_0000409 | Ga0501043_0000409_4572_5591 | 314 |
| 731 | 3300049580 | Ga0501046_0000181 | Ga0501046_0000181_33067_34086 | 314 |
| 732 | 3300049581 | Ga0501047_0000419 | Ga0501047_0000419_15386_16405 | 314 |
| 733 | 3300049582 | Ga0501048_0000057 | Ga0501048_0000057_33707_34726 | 314 |
| 734 | 3300049583 | Ga0501067_0000145 | Ga0501067_0000145_33010_34029 | 314 |
| 735 | 3300049584 | Ga0501068_0001512 | Ga0501068_0001512_9957_10976 | 314 |
| 736 | 3300049585 | Ga0501069_0016839 | Ga0501069_0016839_2691_3710 | 314 |
| 737 | 3300049586 | Ga0501070_0022615 | Ga0501070_0022615_2578_3597 | 314 |
| 738 | 3300049587 | Ga0501071_0014762 | Ga0501071_0014762_3830_4849 | 314 |
| 739 | 3300049588 | Ga0501072_0000643 | Ga0501072_0000643_11355_12374 | 314 |
| 740 | 3300049589 | Ga0501073_0000027 | Ga0501073_0000027_34110_35129 | 314 |
| 741 | 3300049590 | Ga0501074_0000081 | Ga0501074_0000081_36948_37967 | 314 |
| 742 | 3300049741 | Ga0501079_0003647 | Ga0501079_0003647_3293_4312 | 314 |
| 743 | 3300049742 | Ga0501080_0000883 | Ga0501080_0000883_3559_4578 | 314 |
| 744 | 3300049744 | Ga0501083_0010910 | Ga0501083_0010910_5317_6336 | 314 |
| 745 | 3300049822 | Ga0501035_0003158 | Ga0501035_0003158_12103_13122 | 314 |
| 746 | 3300049823 | Ga0501044_0001511 | Ga0501044_0001511_15514_16533 | 314 |
| 747 | 3300049824 | Ga0501045_0132444 | Ga0501045_0132444_652_1671 | 314 |
| 748 | 3300060353 | Ga0501082_0004691 | Ga0501082_0004691_3523_4542 | 314 |
| 749 | iso_pu_bacteria | 2824600985 | 2824604620 | 314 |
| 750 | iso_pu_bacteria | 2824609381 | 2824616172 | 314 |
| 751 | iso_pu_bacteria | 2824653114 | 2824658369 | 314 |
| 752 | iso_pu_bacteria | 2824696289 | 2824698995 | 314 |
| 753 | iso_pu_bacteria | 2841957949 | 2841960653 | 314 |
| 754 | iso_pu_bacteria | 2842038055 | 2842041754 | 314 |
| 755 | iso_pu_bacteria | 2842045827 | 2842049796 | 314 |
| 756 | iso_pu_bacteria | 2874590934 | 2874595689 | 314 |
| 757 | iso_pu_bacteria | 2874612657 | 2874620311 | 314 |
| 758 | iso_pu_bacteria | 2876771140 | 2876775884 | 314 |
| 759 | iso_pu_bacteria | 2876818435 | 2876821574 | 314 |
| 760 | iso_pu_bacteria | 2879074833 | 2879079975 | 314 |
| 761 | iso_pu_bacteria | 2879083081 | 2879085725 | 314 |
| 762 | iso_pu_bacteria | 2879099564 | 2879100894 | 314 |
| 763 | iso_pu_bacteria | 2879127579 | 2879134058 | 314 |
| 764 | iso_pu_bacteria | 2885366525 | 2885374458 | 314 |
| 765 | iso_pu_bacteria | 2888388044 | 2888391503 | 314 |
| 766 | iso_pu_bacteria | 2888419890 | 2888426877 | 314 |
| 767 | iso_pu_bacteria | 2906626472 | 2906633052 | 314 |
| 768 | iso_pu_bacteria | 2922393267 | 2922398594 | 314 |
| 769 | iso_pu_bacteria | 2932784394 | 2932789707 | 314 |
| 770 | iso_pu_bacteria | 2932809354 | 2932817781 | 314 |
| 771 | iso_pu_bacteria | 2932818245 | 2932827108 | 314 |
| 772 | iso_pu_bacteria | 2935608549 | 2935613230 | 314 |
| 773 | iso_pu_bacteria | 2935648319 | 2935655596 | 314 |
| 774 | iso_pu_bacteria | 2935656913 | 2935664500 | 314 |
| 775 | iso_pu_bacteria | 2935684952 | 2935689110 | 314 |
| 776 | iso_pu_bacteria | 2935703347 | 2935711347 | 314 |
| 777 | iso_pu_bacteria | 2935713505 | 2935720056 | 314 |
| 778 | iso_pu_bacteria | 2935722832 | 2935728327 | 314 |
| 779 | iso_pu_bacteria | 2935732158 | 2935737076 | 314 |
| 780 | iso_pu_bacteria | 2935741537 | 2935746863 | 314 |
| 781 | iso_pu_bacteria | 2935750917 | 2935757830 | 314 |
| 782 | iso_pu_bacteria | 2935760218 | 2935764208 | 314 |
| 783 | iso_pu_bacteria | 2935777560 | 2935780071 | 314 |
| 784 | iso_pu_bacteria | 2935785616 | 2935790193 | 314 |
| 785 | iso_pu_bacteria | 2935819856 | 2935824916 | 314 |
| 786 | iso_pu_bacteria | 2935837841 | 2935846813 | 314 |
| 787 | iso_pu_bacteria | 2935847175 | 2935852136 | 314 |
| 788 | iso_pu_bacteria | 2935855204 | 2935863196 | 314 |
| 789 | iso_pu_bacteria | 2935908558 | 2935911483 | 314 |
| 790 | iso_pu_bacteria | 2935916978 | 2935925400 | 314 |
| 791 | iso_pu_bacteria | 2935926038 | 2935928512 | 314 |
| 792 | iso_pu_bacteria | 2935934488 | 2935938157 | 314 |
| 793 | iso_pu_bacteria | 2935942939 | 2935945439 | 314 |
| 794 | iso_pu_bacteria | 2935951376 | 2935954055 | 314 |
| 795 | iso_pu_bacteria | 2935959822 | 2935965434 | 314 |
| 796 | iso_pu_bacteria | 2935967501 | 2935971677 | 314 |
| 797 | iso_pu_bacteria | 2935984226 | 2935984242 | 314 |
| 798 | iso_pu_bacteria | 2936002035 | 2936010275 | 314 |
| 799 | iso_pu_bacteria | 2936011229 | 2936018546 | 314 |
| 800 | iso_pu_bacteria | 2936019824 | 2936027064 | 314 |
| 801 | iso_pu_bacteria | 2936028420 | 2936035969 | 314 |
| 802 | iso_pu_bacteria | 2936046547 | 2936054048 | 314 |
| 803 | iso_pu_bacteria | 2936055302 | 2936055322 | 314 |
| 804 | iso_pu_bacteria | 3005483717 | 3005485980 | 314 |
| 805 | iso_pu_bacteria | 3005587118 | 3005591802 | 314 |
| 806 | iso_pu_bacteria | 8016530956 | 8016538709 | 314 |
| 807 | iso_pu_bacteria | 8016548790 | 8016550293 | 314 |
| 808 | iso_pu_bacteria | 8016603502 | 8016607554 | 314 |
| 809 | iso_pu_bacteria | 8016613128 | 8016619344 | 314 |
| 810 | iso_pu_bacteria | 8016630954 | 8016636905 | 314 |
| 811 | iso_pu_bacteria | 8019538911 | 8019541440 | 314 |
| 812 | iso_pu_bacteria | 8019576017 | 8019578298 | 314 |
| 813 | iso_pu_bacteria | 8019659431 | 8019666094 | 314 |
| 814 | iso_pu_bacteria | 8019668869 | 8019675605 | 314 |
| 815 | iso_pu_bacteria | 8019678201 | 8019680494 | 314 |
| 816 | iso_pu_bacteria | 8019687851 | 8019695264 | 314 |
| 817 | iso_pu_bacteria | 8056967851 | 8056971821 | 314 |
| 818 | 3300005434 | Ga0070709_10201390 | Ga0070709_102013902 | 315 |
| 819 | 3300005435 | Ga0070714_100032179 | Ga0070714_1000321793 | 315 |
| 820 | 3300005435 | Ga0070714_100098779 | Ga0070714_1000987792 | 315 |
| 821 | 3300005436 | Ga0070713_100024272 | Ga0070713_1000242722 | 315 |
| 822 | 3300005436 | Ga0070713_100056432 | Ga0070713_1000564325 | 315 |
| 823 | 3300005530 | Ga0070679_100106689 | Ga0070679_1001066892 | 315 |
| 824 | 3300005563 | Ga0068855_100433287 | Ga0068855_1004332872 | 315 |
| 825 | 3300005937 | Ga0081455_10047745 | Ga0081455_100477452 | 315 |
| 826 | 3300006028 | Ga0070717_10153473 | Ga0070717_101534732 | 315 |
| 827 | 3300006038 | Ga0075365_10045227 | Ga0075365_100452272 | 315 |
| 828 | 3300006048 | Ga0075363_100125860 | Ga0075363_1001258601 | 315 |
| 829 | 3300006163 | Ga0070715_10007812 | Ga0070715_100078122 | 315 |
| 830 | 3300006173 | Ga0070716_100010967 | Ga0070716_1000109673 | 315 |
| 831 | 3300006177 | Ga0075362_10079776 | Ga0075362_100797762 | 315 |
| 832 | 3300006186 | Ga0075369_10063613 | Ga0075369_100636132 | 315 |
| 833 | 3300007265 | Ga0099794_10033678 | Ga0099794_100336782 | 315 |
| 834 | 3300014325 | Ga0163163_10579047 | Ga0163163_105790471 | 315 |
| 835 | 3300014969 | Ga0157376_10018726 | Ga0157376_100187264 | 315 |
| 836 | 3300014969 | Ga0157376_10120672 | Ga0157376_101206723 | 315 |
| 837 | 3300025906 | Ga0207699_10152168 | Ga0207699_101521682 | 315 |
| 838 | 3300025912 | Ga0207707_10102500 | Ga0207707_101025002 | 315 |
| 839 | 3300025915 | Ga0207693_10020323 | Ga0207693_100203234 | 315 |
| 840 | 3300025916 | Ga0207663_10001112 | Ga0207663_1000111211 | 315 |
| 841 | 3300025928 | Ga0207700_10242362 | Ga0207700_102423621 | 315 |
| 842 | 3300025939 | Ga0207665_10000703 | Ga0207665_100007039 | 315 |
| 843 | 3300025949 | Ga0207667_10305414 | Ga0207667_103054142 | 315 |
| 844 | 3300026067 | Ga0207678_10027004 | Ga0207678_100270045 | 315 |
| 845 | 3300028379 | Ga0268266_10006723 | Ga0268266_100067234 | 315 |
| 846 | 3300028379 | Ga0268266_10168492 | Ga0268266_101684922 | 315 |
| 847 | 3300035724 | Ga0373933_0000180 | Ga0373933_0000180_36654_37694 | 315 |
| 848 | 3300035725 | Ga0373947_0090542 | Ga0373947_0090542_766_1782 | 315 |
| 849 | 3300037466 | Ga0395898_0297732 | Ga0395898_0297732_179_1195 | 315 |
| 850 | 3300046475 | Ga0495639_0034245 | Ga0495639_0034245_768_1784 | 315 |
| 851 | 3300048910 | Ga0496107_0084277 | Ga0496107_0084277_438_1454 | 315 |
| 852 | 3300048918 | Ga0496115_0142345 | Ga0496115_0142345_319_1335 | 315 |
| 853 | 3300048924 | Ga0496121_0113447 | Ga0496121_0113447_797_1813 | 315 |
| 854 | 3300048925 | Ga0496122_0050993 | Ga0496122_0050993_949_1965 | 315 |
| 855 | 3300048929 | Ga0496126_0003212 | Ga0496126_0003212_827_1843 | 315 |
| 856 | 3300048929 | Ga0496126_0004243 | Ga0496126_0004243_3254_4270 | 315 |
| 857 | 3300048929 | Ga0496126_0312858 | Ga0496126_0312858_229_1245 | 315 |
| 858 | 3300050492 | nmdc:mga0yw44_20681_c1 | nmdc:mga0yw44_20681_c1_518_1534 | 315 |
| 859 | 3300050492 | nmdc:mga0yw44_55244_c1 | nmdc:mga0yw44_55244_c1_1364_2380 | 315 |
| 860 | 3300050494 | nmdc:mga06z11_138426_c1 | nmdc:mga06z11_138426_c1_320_1336 | 315 |
| 861 | 3300050507 | nmdc:mga05p37_188753_c1 | nmdc:mga05p37_188753_c1_1017_2033 | 315 |
| 862 | 3300050516 | nmdc:mga0sz30_27845_c1 | nmdc:mga0sz30_27845_c1_507_1523 | 315 |
| 863 | 3300053077 | Ga0495601_0062415 | Ga0495601_0062415_668_1684 | 315 |
| 864 | 3300053094 | Ga0500566_0000113 | Ga0500566_0000113_16607_17623 | 315 |
| 865 | 3300053095 | Ga0500640_000015 | Ga0500640_000015_54_1070 | 315 |
| 866 | 3300053102 | Ga0500554_010459 | Ga0500554_010459_419_1435 | 315 |
| 867 | 3300053111 | Ga0500572_003927 | Ga0500572_003927_1574_2590 | 315 |
| 868 | 3300053115 | Ga0500591_019919 | Ga0500591_019919_1348_2364 | 315 |
| 869 | 3300053118 | Ga0500594_0009707 | Ga0500594_0009707_1040_2056 | 315 |
| 870 | 3300053119 | Ga0500595_000728 | Ga0500595_000728_6240_7256 | 315 |
| 871 | 3300053123 | Ga0500614_003851 | Ga0500614_003851_1873_2889 | 315 |
| 872 | 3300053136 | Ga0500559_0002132 | Ga0500559_0002132_5308_6324 | 315 |
| 873 | 3300053150 | Ga0500603_000592 | Ga0500603_000592_3184_4200 | 315 |
| 874 | 3300053150 | Ga0500603_040978 | Ga0500603_040978_27_1043 | 315 |
| 875 | 3300053159 | Ga0500630_004643 | Ga0500630_004643_4907_5923 | 315 |
| 876 | 3300053162 | Ga0500638_002418 | Ga0500638_002418_724_1740 | 315 |
| 877 | 3300053162 | Ga0500638_042194 | Ga0500638_042194_1136_2152 | 315 |
| 878 | 3300053163 | Ga0500639_000050 | Ga0500639_000050_38679_39695 | 315 |
| 879 | 3300053163 | Ga0500639_059399 | Ga0500639_059399_192_1208 | 315 |
| 880 | 3300053178 | Ga0500637_0000080 | Ga0500637_0000080_11997_13013 | 315 |
| 881 | 3300053178 | Ga0500637_0029751 | Ga0500637_0029751_1300_2316 | 315 |
| 882 | 3300053735 | Ga0500596_000478 | Ga0500596_000478_297_1313 | 315 |
| 883 | 3300053737 | Ga0500601_002207 | Ga0500601_002207_356_1372 | 315 |
| 884 | 3300055283 | Ga0500661_000271 | Ga0500661_000271_6930_7946 | 315 |
| 885 | 3300001979 | JGI24740J21852_10005984 | JGI24740J21852_100059845 | 316 |
| 886 | 3300003203 | JGI25406J46586_10000123 | JGI25406J46586_1000012328 | 316 |
| 887 | 3300005327 | Ga0070658_10045091 | Ga0070658_100450914 | 316 |
| 888 | 3300005458 | Ga0070681_10298396 | Ga0070681_102983961 | 316 |
| 889 | 3300005535 | Ga0070684_100025288 | Ga0070684_1000252885 | 316 |
| 890 | 3300005548 | Ga0070665_100470972 | Ga0070665_1004709722 | 316 |
| 891 | 3300005577 | Ga0068857_100012909 | Ga0068857_1000129097 | 316 |
| 892 | 3300005578 | Ga0068854_100028729 | Ga0068854_1000287292 | 316 |
| 893 | 3300005616 | Ga0068852_100081965 | Ga0068852_1000819652 | 316 |
| 894 | 3300005616 | Ga0068852_100225411 | Ga0068852_1002254112 | 316 |
| 895 | 3300005985 | Ga0081539_10000425 | Ga0081539_1000042532 | 316 |
| 896 | 3300009093 | Ga0105240_10046064 | Ga0105240_100460646 | 316 |
| 897 | 3300009174 | Ga0105241_10015112 | Ga0105241_100151126 | 316 |
| 898 | 3300009545 | Ga0105237_10397622 | Ga0105237_103976222 | 316 |
| 899 | 3300009551 | Ga0105238_10041248 | Ga0105238_100412482 | 316 |
| 900 | 3300010375 | Ga0105239_10063897 | Ga0105239_100638973 | 316 |
| 901 | 3300021320 | Ga0214544_1000011 | Ga0214544_100001130 | 316 |
| 902 | 3300021321 | Ga0214542_1000009 | Ga0214542_1000009212 | 316 |
| 903 | 3300021321 | Ga0214542_1024107 | Ga0214542_10241072 | 316 |
| 904 | 3300021324 | Ga0214545_1000007 | Ga0214545_100000730 | 316 |
| 905 | 3300021324 | Ga0214545_1021600 | Ga0214545_10216002 | 316 |
| 906 | 3300021327 | Ga0214543_1000020 | Ga0214543_1000020212 | 316 |
| 907 | 3300021327 | Ga0214543_1028960 | Ga0214543_10289604 | 316 |
| 908 | 3300025254 | Ga0209148_1006688 | Ga0209148_10066882 | 316 |
| 909 | 3300025272 | Ga0209455_1011648 | Ga0209455_10116482 | 316 |
| 910 | 3300025297 | Ga0209758_1002009 | Ga0209758_100200920 | 316 |
| 911 | 3300025321 | Ga0207656_10009458 | Ga0207656_100094585 | 316 |
| 912 | 3300025911 | Ga0207654_10000811 | Ga0207654_1000081118 | 316 |
| 913 | 3300025912 | Ga0207707_10012323 | Ga0207707_100123233 | 316 |
| 914 | 3300025916 | Ga0207663_10012363 | Ga0207663_100123633 | 316 |
| 915 | 3300025917 | Ga0207660_10076411 | Ga0207660_100764112 | 316 |
| 916 | 3300025919 | Ga0207657_10012730 | Ga0207657_100127302 | 316 |
| 917 | 3300025924 | Ga0207694_10001415 | Ga0207694_1000141511 | 316 |
| 918 | 3300025928 | Ga0207700_10315270 | Ga0207700_103152701 | 316 |
| 919 | 3300025944 | Ga0207661_10000171 | Ga0207661_1000017141 | 316 |
| 920 | 3300025949 | Ga0207667_10011741 | Ga0207667_100117415 | 316 |
| 921 | 3300025981 | Ga0207640_10149654 | Ga0207640_101496542 | 316 |
| 922 | 3300026041 | Ga0207639_10398623 | Ga0207639_103986232 | 316 |
| 923 | 3300026078 | Ga0207702_10000003 | Ga0207702_1000000322 | 316 |
| 924 | 3300026116 | Ga0207674_10009035 | Ga0207674_100090358 | 316 |
| 925 | 3300031595 | Ga0265313_10032460 | Ga0265313_100324603 | 316 |
| 926 | 3300035111 | Ga0373923_0023254 | Ga0373923_0023254_184_1203 | 316 |
| 927 | 3300035113 | Ga0373936_0053549 | Ga0373936_0053549_147_1166 | 316 |
| 928 | 3300035118 | Ga0373954_0011969 | Ga0373954_0011969_1466_2485 | 316 |
| 929 | 3300035118 | Ga0373954_0025175 | Ga0373954_0025175_628_1647 | 316 |
| 930 | 3300035170 | Ga0373943_0003127 | Ga0373943_0003127_888_1907 | 316 |
| 931 | 3300035171 | Ga0373946_0003423 | Ga0373946_0003423_721_1740 | 316 |
| 932 | 3300035172 | Ga0373955_0070318 | Ga0373955_0070318_139_1158 | 316 |
| 933 | 3300035410 | Ga0373924_0017284 | Ga0373924_0017284_95_1114 | 316 |
| 934 | 3300035692 | Ga0373935_0000569 | Ga0373935_0000569_12502_13521 | 316 |
| 935 | 3300035692 | Ga0373935_0020182 | Ga0373935_0020182_2983_4005 | 316 |
| 936 | 3300035695 | Ga0373927_0016947 | Ga0373927_0016947_681_1700 | 316 |
| 937 | 3300035725 | Ga0373947_0005868 | Ga0373947_0005868_4436_5455 | 316 |
| 938 | 3300036401 | Ga0373937_0014626 | Ga0373937_0014626_858_1877 | 316 |
| 939 | 3300036401 | Ga0373937_0053457 | Ga0373937_0053457_1100_2119 | 316 |
| 940 | 3300037068 | Ga0373925_0030197 | Ga0373925_0030197_946_1968 | 316 |
| 941 | 3300044694 | Ga0466963_0082772 | Ga0466963_0082772_138_1157 | 316 |
| 942 | 3300045976 | Ga0466967_0303482 | Ga0466967_0303482_74_1093 | 316 |
| 943 | 3300046455 | Ga0495603_0003935 | Ga0495603_0003935_4641_5660 | 316 |
| 944 | 3300046461 | Ga0495641_0001899 | Ga0495641_0001899_4400_5419 | 316 |
| 945 | 3300046472 | Ga0495580_0001711 | Ga0495580_0001711_12586_13605 | 316 |
| 946 | 3300046475 | Ga0495639_0000278 | Ga0495639_0000278_3064_4083 | 316 |
| 947 | 3300046475 | Ga0495639_0050147 | Ga0495639_0050147_592_1614 | 316 |
| 948 | 3300046476 | Ga0495662_0000176 | Ga0495662_0000176_12652_13671 | 316 |
| 949 | 3300046499 | Ga0495594_0000541 | Ga0495594_0000541_4634_5653 | 316 |
| 950 | 3300046516 | Ga0495628_0065962 | Ga0495628_0065962_857_1876 | 316 |
| 951 | 3300046517 | Ga0495630_0001818 | Ga0495630_0001818_1986_3005 | 316 |
| 952 | 3300046517 | Ga0495630_0020042 | Ga0495630_0020042_1533_2552 | 316 |
| 953 | 3300046529 | Ga0495652_0059010 | Ga0495652_0059010_532_1551 | 316 |
| 954 | 3300046529 | Ga0495652_0103100 | Ga0495652_0103100_853_1875 | 316 |
| 955 | 3300046531 | Ga0495665_0000408 | Ga0495665_0000408_12709_13728 | 316 |
| 956 | 3300046531 | Ga0495665_0011452 | Ga0495665_0011452_2364_3386 | 316 |
| 957 | 3300046533 | Ga0495640_0004065 | Ga0495640_0004065_4683_5702 | 316 |
| 958 | 3300046557 | Ga0495622_0003183 | Ga0495622_0003183_2544_3563 | 316 |
| 959 | 3300046642 | Ga0495634_0009077 | Ga0495634_0009077_682_1701 | 316 |
| 960 | 3300046642 | Ga0495634_0098163 | Ga0495634_0098163_264_1286 | 316 |
| 961 | 3300046663 | Ga0495635_0000883 | Ga0495635_0000883_5377_6396 | 316 |
| 962 | 3300046679 | Ga0495623_0103645 | Ga0495623_0103645_352_1374 | 316 |
| 963 | 3300046680 | Ga0495646_0037301 | Ga0495646_0037301_611_1630 | 316 |
| 964 | 3300046681 | Ga0495647_0000226 | Ga0495647_0000226_10474_11493 | 316 |
| 965 | 3300046681 | Ga0495647_0004771 | Ga0495647_0004771_1571_2593 | 316 |
| 966 | 3300046683 | Ga0495658_0000706 | Ga0495658_0000706_3191_4210 | 316 |
| 967 | 3300046683 | Ga0495658_0007799 | Ga0495658_0007799_1197_2219 | 316 |
| 968 | 3300046689 | Ga0495613_0009812 | Ga0495613_0009812_64_1083 | 316 |
| 969 | 3300047315 | Ga0495581_0036754 | Ga0495581_0036754_1363_2382 | 316 |
| 970 | 3300047319 | Ga0495674_0012843 | Ga0495674_0012843_6417_7436 | 316 |
| 971 | 3300047319 | Ga0495674_0021071 | Ga0495674_0021071_2999_4021 | 316 |
| 972 | 3300047321 | Ga0495676_0086399 | Ga0495676_0086399_444_1463 | 316 |
| 973 | 3300047471 | Ga0495684_0010341 | Ga0495684_0010341_5185_6207 | 316 |
| 974 | 3300047673 | Ga0495593_0000577 | Ga0495593_0000577_6993_8012 | 316 |
| 975 | 3300048903 | Ga0496100_0040457 | Ga0496100_0040457_134_1150 | 316 |
| 976 | 3300048905 | Ga0496102_0200208 | Ga0496102_0200208_776_1792 | 316 |
| 977 | 3300048909 | Ga0496106_0004321 | Ga0496106_0004321_3819_4835 | 316 |
| 978 | 3300048910 | Ga0496107_0062087 | Ga0496107_0062087_154_1170 | 316 |
| 979 | 3300048911 | Ga0496108_0003585 | Ga0496108_0003585_6286_7302 | 316 |
| 980 | 3300048912 | Ga0496109_0004298 | Ga0496109_0004298_6060_7076 | 316 |
| 981 | 3300048913 | Ga0496110_0024685 | Ga0496110_0024685_2290_3306 | 316 |
| 982 | 3300048915 | Ga0496112_0003249 | Ga0496112_0003249_7270_8286 | 316 |
| 983 | 3300048916 | Ga0496113_0002516 | Ga0496113_0002516_8850_9866 | 316 |
| 984 | 3300048922 | Ga0496119_0112489 | Ga0496119_0112489_228_1247 | 316 |
| 985 | 3300048924 | Ga0496121_0001525 | Ga0496121_0001525_19681_20700 | 316 |
| 986 | 3300048924 | Ga0496121_0196722 | Ga0496121_0196722_57_1076 | 316 |
| 987 | 3300048929 | Ga0496126_0023765 | Ga0496126_0023765_530_1549 | 316 |
| 988 | 3300048929 | Ga0496126_0055536 | Ga0496126_0055536_1019_2038 | 316 |
| 989 | 3300048929 | Ga0496126_0224630 | Ga0496126_0224630_219_1238 | 316 |
| 990 | 3300050492 | nmdc:mga0yw44_62945_c1 | nmdc:mga0yw44_62945_c1_41_1060 | 316 |
| 991 | 3300053087 | Ga0500643_000052 | Ga0500643_000052_86160_87179 | 316 |
| 992 | 3300053093 | Ga0500651_0046771 | Ga0500651_0046771_944_1963 | 316 |
| 993 | 3300053121 | Ga0500607_032891 | Ga0500607_032891_481_1500 | 316 |
| 994 | 3300053130 | Ga0500642_0023426 | Ga0500642_0023426_637_1656 | 316 |
| 995 | 3300053177 | Ga0500636_0006221 | Ga0500636_0006221_5813_6832 | 316 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6r5z-assembly2.cif.gz_E | 9-bladed beta-propeller formed by three 3-bladed fragments | 0.8664 | 108 | 218 |
| 5mzh-assembly1.cif.gz_A | crystal structure of oda16 from chlamydomonas reinhardtii | 0.8579 | 19 | 315 |
| 7v08-assembly1.cif.gz_x | nucleoplasmic pre-60s intermediate of the nog2 containing pre-rotation state from a spb1 d52a suppressor 3 strain | 0.8486 | 19 | 315 |
| 4wjs-assembly1.cif.gz_A | crystal structure of rsa4 from chaetomium thermophilum | 0.8403 | 18 | 315 |
| 5nnz-assembly2.cif.gz_B | crystal structure of human oda16 | 0.836 | 18 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54H44_7_161_2.40.128.630 | Mainly Beta;Beta Barrel;Lipocalin; | 0.8816 | 58 | 185 | 2.40.128.630 |
| af_O22212_162_377_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8795 | 97 | 215 | 2.130.10.10 |
| af_Q0DGP5_451_595_2.40.128.630 | Mainly Beta;Beta Barrel;Lipocalin; | 0.8784 | 98 | 217 | 2.40.128.630 |
| af_Q9D994_190_301_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.87 | 135 | 239 | 2.130.10.10 |
| af_B7Z0R7_305_459_2.110.10.10 | Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain | 0.8664 | 138 | 246 | 2.110.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527VSA3-F1-model_v4 | WD40 repeat domain-containing protein | 0.9748 | 117 | 275 |
|
| AF-A0A527GQZ9-F1-model_v4 | WD40 repeat domain-containing protein | 0.9748 | 154 | 286 |
|
| AF-A0A5R2MZY7-F1-model_v4 | WD40 repeat domain-containing protein | 0.9734 | 133 | 262 |
|
| AF-A0A529GK95-F1-model_v4 | WD40 repeat domain-containing protein | 0.9718 | 64 | 315 |
|
| AF-A0A0D7E0B5-F1-model_v4 | WD-repeat family protein | 0.9716 | 184 | 315 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar