F487774
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 996 | 344 | 1992 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10292356|Ga0163163_102923563 |
| Length | 176 |
| Sequence | MRLHILAVGFGRGTLESPLSEEFLGRAAQLGKRMGFPEVVCEEIAVSKERDVRKRMADEAERLAKRVPAGAHIILLDAKGKGMTSEDFADMLGALRDAGTKDLAFVIGGPDGLAPLPGKRAGRSLAFGPQTWPHLLVRAMLSEQIYRALTILAGHPYHRGWRRRYAQSWGYSGIGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 105 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 106 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 107 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 185 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 186 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 188 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 214 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 282 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 283 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 327 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 328 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 330 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 331 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 332 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 334 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 335 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 336 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 337 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 338 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 339 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 340 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 344 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.5 |
| Metatranscriptomes | 0.3 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.81 |
| Nodule | 0 |
| Rhizoplane | 0.8 |
| Rhizosphere | 93.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163163_10292356 | 3300014325 | Bacteria | 1681 |
| 2 | JGI24747J21853_1037014 | 3300001978 | Bacteria | 571 |
| 3 | JGI25165J46597_1000047 | 3300003214 | Bacteria | 254601 |
| 4 | JGI25165J46597_1000066 | 3300003214 | Bacteria | 199459 |
| 5 | JGI25153J46596_10003510 | 3300003215 | Bacteria | 8751 |
| 6 | rootH2_10048452 | 3300003320 | Bacteria | 17007 |
| 7 | rootH1_10213236 | 3300003323 | Bacteria | 2899 |
| 8 | Ga0006562J51391_1008604 | 3300003578 | Bacteria | 1760 |
| 9 | Ga0070658_10004407 | 3300005327 | Bacteria | 11473 |
| 10 | Ga0070658_10036793 | 3300005327 | Bacteria | 3945 |
| 11 | Ga0070658_10087273 | 3300005327 | Bacteria | 2568 |
| 12 | Ga0070658_10206018 | 3300005327 | Unclassified | 1661 |
| 13 | Ga0070658_10298341 | 3300005327 | Bacteria | 1374 |
| 14 | Ga0070658_10730507 | 3300005327 | Bacteria | 860 |
| 15 | Ga0070658_10833509 | 3300005327 | Bacteria | 801 |
| 16 | Ga0070683_100073837 | 3300005329 | Bacteria | 3184 |
| 17 | Ga0070683_100158491 | 3300005329 | Bacteria | 2147 |
| 18 | Ga0070670_100200910 | 3300005331 | Bacteria | 1732 |
| 19 | Ga0070666_10000186 | 3300005335 | Bacteria | 42661 |
| 20 | Ga0070666_10016173 | 3300005335 | Bacteria | 4769 |
| 21 | Ga0070680_100338169 | 3300005336 | Unclassified | 1279 |
| 22 | Ga0070680_100612609 | 3300005336 | Unclassified | 935 |
| 23 | Ga0070682_101339295 | 3300005337 | Unclassified | 610 |
| 24 | Ga0068868_100146063 | 3300005338 | Bacteria | 1945 |
| 25 | Ga0068868_100149671 | 3300005338 | Bacteria | 1922 |
| 26 | Ga0070660_100010072 | 3300005339 | Bacteria | 6668 |
| 27 | Ga0070660_100039636 | 3300005339 | Bacteria | 3581 |
| 28 | Ga0070660_100650468 | 3300005339 | Bacteria | 883 |
| 29 | Ga0070689_100140372 | 3300005340 | Bacteria | 1943 |
| 30 | Ga0070689_100410635 | 3300005340 | Bacteria | 1146 |
| 31 | Ga0070691_10000233 | 3300005341 | Bacteria | 18941 |
| 32 | Ga0070691_10000745 | 3300005341 | Bacteria | 12815 |
| 33 | Ga0070691_10455750 | 3300005341 | Bacteria | 731 |
| 34 | Ga0070661_100000165 | 3300005344 | Bacteria | 54127 |
| 35 | Ga0070692_10319679 | 3300005345 | Bacteria | 954 |
| 36 | Ga0070669_100503195 | 3300005353 | Bacteria | 1005 |
| 37 | Ga0070675_100144883 | 3300005354 | Bacteria | 2033 |
| 38 | Ga0070671_100025930 | 3300005355 | Bacteria | 4814 |
| 39 | Ga0070671_100383808 | 3300005355 | Bacteria | 1201 |
| 40 | Ga0070673_100021993 | 3300005364 | Bacteria | 4635 |
| 41 | Ga0070673_101014556 | 3300005364 | Bacteria | 773 |
| 42 | Ga0070659_100032854 | 3300005366 | Bacteria | 4029 |
| 43 | Ga0070659_100683006 | 3300005366 | Unclassified | 887 |
| 44 | Ga0070667_100035730 | 3300005367 | Bacteria | 4164 |
| 45 | Ga0070667_100126325 | 3300005367 | Bacteria | 2229 |
| 46 | Ga0070667_100127747 | 3300005367 | Bacteria | 2217 |
| 47 | Ga0070709_10092958 | 3300005434 | Bacteria | 1993 |
| 48 | Ga0070714_100077745 | 3300005435 | Bacteria | 2883 |
| 49 | Ga0070714_100416058 | 3300005435 | Bacteria | 1273 |
| 50 | Ga0070713_100000002 | 3300005436 | Bacteria | 245989 |
| 51 | Ga0070713_100125509 | 3300005436 | Bacteria | 2257 |
| 52 | Ga0070713_100354936 | 3300005436 | Unclassified | 1361 |
| 53 | Ga0070713_100371466 | 3300005436 | Bacteria | 1331 |
| 54 | Ga0070713_100701889 | 3300005436 | Unclassified | 966 |
| 55 | Ga0070711_100162649 | 3300005439 | Bacteria | 1693 |
| 56 | Ga0070711_100420447 | 3300005439 | Bacteria | 1089 |
| 57 | Ga0070711_100430453 | 3300005439 | Bacteria | 1077 |
| 58 | Ga0070711_101318116 | 3300005439 | Bacteria | 627 |
| 59 | Ga0070700_100138904 | 3300005441 | Bacteria | 1649 |
| 60 | Ga0070700_100170110 | 3300005441 | Bacteria | 1508 |
| 61 | Ga0070694_100963828 | 3300005444 | Bacteria | 707 |
| 62 | Ga0070663_100010410 | 3300005455 | Bacteria | 5797 |
| 63 | Ga0070663_100145180 | 3300005455 | Bacteria | 1815 |
| 64 | Ga0070663_100275941 | 3300005455 | Bacteria | 1338 |
| 65 | Ga0070678_100008084 | 3300005456 | Bacteria | 6279 |
| 66 | Ga0070678_100028781 | 3300005456 | Bacteria | 3795 |
| 67 | Ga0070678_100044373 | 3300005456 | Bacteria | 3174 |
| 68 | Ga0070662_100097136 | 3300005457 | Bacteria | 2223 |
| 69 | Ga0070681_10000014 | 3300005458 | Bacteria | 132528 |
| 70 | Ga0070681_10119942 | 3300005458 | Bacteria | 2566 |
| 71 | Ga0070681_10138798 | 3300005458 | Bacteria | 2361 |
| 72 | Ga0070681_10140087 | 3300005458 | Bacteria | 2349 |
| 73 | Ga0070681_10464866 | 3300005458 | Bacteria | 1178 |
| 74 | Ga0070681_10668315 | 3300005458 | Unclassified | 954 |
| 75 | Ga0070681_10812933 | 3300005458 | Bacteria | 852 |
| 76 | Ga0068867_100157813 | 3300005459 | Bacteria | 1787 |
| 77 | Ga0068867_100322589 | 3300005459 | Bacteria | 1280 |
| 78 | Ga0070685_10246756 | 3300005466 | Bacteria | 1181 |
| 79 | Ga0070699_100478448 | 3300005518 | Bacteria | 1130 |
| 80 | Ga0070699_101567409 | 3300005518 | Bacteria | 604 |
| 81 | Ga0070679_100003975 | 3300005530 | Bacteria | 13615 |
| 82 | Ga0070679_100036559 | 3300005530 | Bacteria | 4873 |
| 83 | Ga0070679_100046782 | 3300005530 | Bacteria | 4313 |
| 84 | Ga0070679_100350510 | 3300005530 | Unclassified | 1424 |
| 85 | Ga0070679_100383967 | 3300005530 | Bacteria | 1351 |
| 86 | Ga0070679_101858376 | 3300005530 | Unclassified | 551 |
| 87 | Ga0070684_100142656 | 3300005535 | Bacteria | 2167 |
| 88 | Ga0068853_100003994 | 3300005539 | Bacteria | 11341 |
| 89 | Ga0068853_100211317 | 3300005539 | Bacteria | 1768 |
| 90 | Ga0068853_100291717 | 3300005539 | Bacteria | 1506 |
| 91 | Ga0068853_100378984 | 3300005539 | Bacteria | 1321 |
| 92 | Ga0068853_101617218 | 3300005539 | Bacteria | 628 |
| 93 | Ga0070672_100315352 | 3300005543 | Bacteria | 1328 |
| 94 | Ga0070686_101715881 | 3300005544 | Bacteria | 533 |
| 95 | Ga0070695_100002111 | 3300005545 | Bacteria | 11372 |
| 96 | Ga0070695_100330101 | 3300005545 | Bacteria | 1137 |
| 97 | Ga0070696_101105250 | 3300005546 | Bacteria | 666 |
| 98 | Ga0070693_100220095 | 3300005547 | Bacteria | 1243 |
| 99 | Ga0070665_100001530 | 3300005548 | Bacteria | 26749 |
| 100 | Ga0070665_100051864 | 3300005548 | Bacteria | 4114 |
| 101 | Ga0070665_100077890 | 3300005548 | Bacteria | 3321 |
| 102 | Ga0070665_100111159 | 3300005548 | Bacteria | 2743 |
| 103 | Ga0070665_100121214 | 3300005548 | Bacteria | 2617 |
| 104 | Ga0070665_100122251 | 3300005548 | Bacteria | 2605 |
| 105 | Ga0070665_100151100 | 3300005548 | Bacteria | 2325 |
| 106 | Ga0070665_100633014 | 3300005548 | Bacteria | 1083 |
| 107 | Ga0070665_101366927 | 3300005548 | Unclassified | 717 |
| 108 | Ga0068855_100002193 | 3300005563 | Bacteria | 24145 |
| 109 | Ga0068855_100048766 | 3300005563 | Bacteria | 4997 |
| 110 | Ga0068855_100080088 | 3300005563 | Bacteria | 3787 |
| 111 | Ga0068855_100111048 | 3300005563 | Bacteria | 3147 |
| 112 | Ga0068855_100119698 | 3300005563 | Bacteria | 3014 |
| 113 | Ga0068855_100169874 | 3300005563 | Bacteria | 2470 |
| 114 | Ga0068855_100470750 | 3300005563 | Bacteria | 1369 |
| 115 | Ga0068857_100000488 | 3300005577 | Bacteria | 28351 |
| 116 | Ga0068857_100071060 | 3300005577 | Bacteria | 3101 |
| 117 | Ga0068854_100110573 | 3300005578 | Bacteria | 2072 |
| 118 | Ga0068854_100211766 | 3300005578 | Bacteria | 1529 |
| 119 | Ga0068854_100740836 | 3300005578 | Bacteria | 852 |
| 120 | Ga0068856_100000312 | 3300005614 | Bacteria | 53339 |
| 121 | Ga0068856_100015005 | 3300005614 | Bacteria | 7484 |
| 122 | Ga0068856_100290201 | 3300005614 | Bacteria | 1653 |
| 123 | Ga0068856_100390075 | 3300005614 | Bacteria | 1412 |
| 124 | Ga0070702_100978006 | 3300005615 | Bacteria | 668 |
| 125 | Ga0068852_100020713 | 3300005616 | Bacteria | 5232 |
| 126 | Ga0068852_100024329 | 3300005616 | Bacteria | 4893 |
| 127 | Ga0068852_100399302 | 3300005616 | Bacteria | 1352 |
| 128 | Ga0068852_100475000 | 3300005616 | Bacteria | 1241 |
| 129 | Ga0068864_100041460 | 3300005618 | Bacteria | 3937 |
| 130 | Ga0068864_100173795 | 3300005618 | Bacteria | 1966 |
| 131 | Ga0068864_100700039 | 3300005618 | Bacteria | 990 |
| 132 | Ga0068870_10050663 | 3300005840 | Bacteria | 2195 |
| 133 | Ga0068870_10192425 | 3300005840 | Bacteria | 1232 |
| 134 | Ga0068863_101378720 | 3300005841 | Bacteria | 712 |
| 135 | Ga0068858_100002481 | 3300005842 | Bacteria | 18623 |
| 136 | Ga0068858_100020836 | 3300005842 | Bacteria | 6127 |
| 137 | Ga0068858_100034722 | 3300005842 | Bacteria | 4678 |
| 138 | Ga0068858_100039125 | 3300005842 | Bacteria | 4399 |
| 139 | Ga0068858_100686734 | 3300005842 | Bacteria | 996 |
| 140 | Ga0068860_100045955 | 3300005843 | Bacteria | 4164 |
| 141 | Ga0068862_100086116 | 3300005844 | Bacteria | 2731 |
| 142 | Ga0068862_101047302 | 3300005844 | Bacteria | 809 |
| 143 | Ga0068862_101159582 | 3300005844 | Bacteria | 770 |
| 144 | Ga0081455_10025361 | 3300005937 | Bacteria | 5473 |
| 145 | Ga0070717_10047683 | 3300006028 | Bacteria | 3511 |
| 146 | Ga0070716_100432140 | 3300006173 | Bacteria | 955 |
| 147 | Ga0070712_100000045 | 3300006175 | Bacteria | 66187 |
| 148 | Ga0070712_100000272 | 3300006175 | Bacteria | 29104 |
| 149 | Ga0070712_100099290 | 3300006175 | Bacteria | 2148 |
| 150 | Ga0070712_100332087 | 3300006175 | Bacteria | 1239 |
| 151 | Ga0070712_101809077 | 3300006175 | Unclassified | 535 |
| 152 | Ga0075366_10589639 | 3300006195 | Bacteria | 689 |
| 153 | Ga0097621_100008952 | 3300006237 | Bacteria | 7240 |
| 154 | Ga0097621_100025748 | 3300006237 | Bacteria | 4606 |
| 155 | Ga0097621_100083442 | 3300006237 | Bacteria | 2663 |
| 156 | Ga0097621_100132495 | 3300006237 | Bacteria | 2123 |
| 157 | Ga0097621_100320017 | 3300006237 | Bacteria | 1374 |
| 158 | Ga0068871_100021718 | 3300006358 | Bacteria | 4939 |
| 159 | Ga0068871_100054046 | 3300006358 | Bacteria | 3257 |
| 160 | Ga0068871_100085337 | 3300006358 | Bacteria | 2622 |
| 161 | Ga0068871_100287114 | 3300006358 | Bacteria | 1441 |
| 162 | Ga0075428_101607414 | 3300006844 | Bacteria | 679 |
| 163 | Ga0075434_100049585 | 3300006871 | Bacteria | 4170 |
| 164 | Ga0075434_100111155 | 3300006871 | Bacteria | 2751 |
| 165 | Ga0068865_100076460 | 3300006881 | Bacteria | 2390 |
| 166 | Ga0068865_100406511 | 3300006881 | Bacteria | 1116 |
| 167 | Ga0068865_100767937 | 3300006881 | Bacteria | 829 |
| 168 | Ga0068865_101383753 | 3300006881 | Bacteria | 628 |
| 169 | Ga0075436_100000098 | 3300006914 | Bacteria | 51153 |
| 170 | Ga0075436_100033900 | 3300006914 | Bacteria | 3519 |
| 171 | Ga0075436_101048453 | 3300006914 | Unclassified | 613 |
| 172 | Ga0075435_100223570 | 3300007076 | Bacteria | 1599 |
| 173 | Ga0075435_100369560 | 3300007076 | Bacteria | 1231 |
| 174 | Ga0099795_10057315 | 3300007788 | Bacteria | 1436 |
| 175 | Ga0105240_10003190 | 3300009093 | Bacteria | 25760 |
| 176 | Ga0105240_10008350 | 3300009093 | Bacteria | 14823 |
| 177 | Ga0105240_10041567 | 3300009093 | Bacteria | 5867 |
| 178 | Ga0105240_10055978 | 3300009093 | Bacteria | 4936 |
| 179 | Ga0105240_10097765 | 3300009093 | Bacteria | 3577 |
| 180 | Ga0105240_10131371 | 3300009093 | Bacteria | 3003 |
| 181 | Ga0105240_10142623 | 3300009093 | Bacteria | 2863 |
| 182 | Ga0105240_10179371 | 3300009093 | Bacteria | 2501 |
| 183 | Ga0105240_10206041 | 3300009093 | Bacteria | 2302 |
| 184 | Ga0105240_10453700 | 3300009093 | Bacteria | 1434 |
| 185 | Ga0105240_10465984 | 3300009093 | Bacteria | 1411 |
| 186 | Ga0105240_10722596 | 3300009093 | Bacteria | 1085 |
| 187 | Ga0105240_10811292 | 3300009093 | Bacteria | 1013 |
| 188 | Ga0105240_10902905 | 3300009093 | Unclassified | 950 |
| 189 | Ga0105240_11255268 | 3300009093 | Bacteria | 783 |
| 190 | Ga0105240_11289482 | 3300009093 | Unclassified | 771 |
| 191 | Ga0111539_10017891 | 3300009094 | Bacteria | 8778 |
| 192 | Ga0105245_10003180 | 3300009098 | Bacteria | 14678 |
| 193 | Ga0105245_10150733 | 3300009098 | Bacteria | 2199 |
| 194 | Ga0105245_10502347 | 3300009098 | Bacteria | 1229 |
| 195 | Ga0105245_11368090 | 3300009098 | Bacteria | 758 |
| 196 | Ga0105245_11401351 | 3300009098 | Unclassified | 749 |
| 197 | Ga0105243_10001197 | 3300009148 | Bacteria | 23346 |
| 198 | Ga0105243_10197578 | 3300009148 | Bacteria | 1762 |
| 199 | Ga0105241_10021411 | 3300009174 | Bacteria | 4778 |
| 200 | Ga0105241_10023341 | 3300009174 | Bacteria | 4586 |
| 201 | Ga0105241_10032104 | 3300009174 | Bacteria | 3934 |
| 202 | Ga0105241_10037543 | 3300009174 | Bacteria | 3650 |
| 203 | Ga0105241_10083024 | 3300009174 | Bacteria | 2513 |
| 204 | Ga0105241_10092007 | 3300009174 | Bacteria | 2394 |
| 205 | Ga0105241_10897980 | 3300009174 | Bacteria | 823 |
| 206 | Ga0105241_11032134 | 3300009174 | Unclassified | 771 |
| 207 | Ga0105242_10100872 | 3300009176 | Bacteria | 2446 |
| 208 | Ga0105242_10209808 | 3300009176 | Bacteria | 1735 |
| 209 | Ga0105242_10237858 | 3300009176 | Bacteria | 1636 |
| 210 | Ga0105242_10332987 | 3300009176 | Bacteria | 1396 |
| 211 | Ga0105242_10458515 | 3300009176 | Bacteria | 1203 |
| 212 | Ga0105242_10487470 | 3300009176 | Bacteria | 1170 |
| 213 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 214 | Ga0105248_10046527 | 3300009177 | Bacteria | 4863 |
| 215 | Ga0105248_10167437 | 3300009177 | Bacteria | 2477 |
| 216 | Ga0105237_10001328 | 3300009545 | Bacteria | 32811 |
| 217 | Ga0105237_10017408 | 3300009545 | Bacteria | 7450 |
| 218 | Ga0105237_10119270 | 3300009545 | Bacteria | 2632 |
| 219 | Ga0105237_10124628 | 3300009545 | Bacteria | 2571 |
| 220 | Ga0105237_10152508 | 3300009545 | Bacteria | 2307 |
| 221 | Ga0105237_10456066 | 3300009545 | Bacteria | 1284 |
| 222 | Ga0105237_10479450 | 3300009545 | Bacteria | 1250 |
| 223 | Ga0105237_10958028 | 3300009545 | Bacteria | 863 |
| 224 | Ga0105238_10001442 | 3300009551 | Bacteria | 23898 |
| 225 | Ga0105238_10007214 | 3300009551 | Bacteria | 11124 |
| 226 | Ga0105238_10029405 | 3300009551 | Bacteria | 5597 |
| 227 | Ga0105238_10041074 | 3300009551 | Bacteria | 4686 |
| 228 | Ga0105238_10084835 | 3300009551 | Bacteria | 3156 |
| 229 | Ga0105238_10108063 | 3300009551 | Bacteria | 2763 |
| 230 | Ga0105238_10109825 | 3300009551 | Bacteria | 2739 |
| 231 | Ga0105238_10159880 | 3300009551 | Bacteria | 2228 |
| 232 | Ga0105238_10194969 | 3300009551 | Bacteria | 2001 |
| 233 | Ga0105238_10220135 | 3300009551 | Unclassified | 1874 |
| 234 | Ga0105238_10346649 | 3300009551 | Bacteria | 1474 |
| 235 | Ga0105238_10364576 | 3300009551 | Bacteria | 1435 |
| 236 | Ga0105238_10449216 | 3300009551 | Bacteria | 1286 |
| 237 | Ga0105238_10697084 | 3300009551 | Bacteria | 1027 |
| 238 | Ga0105238_10918751 | 3300009551 | Bacteria | 894 |
| 239 | Ga0105238_11159832 | 3300009551 | Unclassified | 796 |
| 240 | Ga0105238_11537992 | 3300009551 | Bacteria | 694 |
| 241 | Ga0105249_10447220 | 3300009553 | Bacteria | 1330 |
| 242 | Ga0105249_10591650 | 3300009553 | Bacteria | 1163 |
| 243 | Ga0105239_10000733 | 3300010375 | Bacteria | 46597 |
| 244 | Ga0105239_10013335 | 3300010375 | Bacteria | 9132 |
| 245 | Ga0105239_10155260 | 3300010375 | Bacteria | 2556 |
| 246 | Ga0105239_10196315 | 3300010375 | Bacteria | 2260 |
| 247 | Ga0105239_10234079 | 3300010375 | Bacteria | 2061 |
| 248 | Ga0105239_10240178 | 3300010375 | Bacteria | 2033 |
| 249 | Ga0105239_10249633 | 3300010375 | Bacteria | 1993 |
| 250 | Ga0105239_10380124 | 3300010375 | Bacteria | 1596 |
| 251 | Ga0105239_10435526 | 3300010375 | Bacteria | 1486 |
| 252 | Ga0105239_10652841 | 3300010375 | Bacteria | 1202 |
| 253 | Ga0105239_11448524 | 3300010375 | Bacteria | 793 |
| 254 | Ga0105239_11741428 | 3300010375 | Bacteria | 722 |
| 255 | Ga0105239_12822588 | 3300010375 | Unclassified | 567 |
| 256 | Ga0105246_10038893 | 3300011119 | Bacteria | 3201 |
| 257 | Ga0105246_10240577 | 3300011119 | Bacteria | 1430 |
| 258 | Ga0105246_10870075 | 3300011119 | Bacteria | 806 |
| 259 | Ga0157373_10022768 | 3300013100 | Bacteria | 4544 |
| 260 | Ga0157373_10077361 | 3300013100 | Bacteria | 2347 |
| 261 | Ga0157373_10176511 | 3300013100 | Bacteria | 1504 |
| 262 | Ga0157370_10007427 | 3300013104 | Bacteria | 11928 |
| 263 | Ga0157370_10015393 | 3300013104 | Bacteria | 7774 |
| 264 | Ga0157370_10103482 | 3300013104 | Bacteria | 2665 |
| 265 | Ga0157370_10140928 | 3300013104 | Bacteria | 2246 |
| 266 | Ga0157370_10504837 | 3300013104 | Bacteria | 1110 |
| 267 | Ga0157369_10046281 | 3300013105 | Bacteria | 4728 |
| 268 | Ga0157369_10078713 | 3300013105 | Bacteria | 3531 |
| 269 | Ga0157369_10145336 | 3300013105 | Bacteria | 2508 |
| 270 | Ga0157369_10269239 | 3300013105 | Bacteria | 1776 |
| 271 | Ga0157369_10479685 | 3300013105 | Bacteria | 1287 |
| 272 | Ga0157369_10682016 | 3300013105 | Bacteria | 1059 |
| 273 | Ga0157369_11415477 | 3300013105 | Unclassified | 708 |
| 274 | Ga0157374_10186664 | 3300013296 | Bacteria | 2027 |
| 275 | Ga0157374_10257347 | 3300013296 | Bacteria | 1719 |
| 276 | Ga0157374_11136986 | 3300013296 | Bacteria | 802 |
| 277 | Ga0157378_10027790 | 3300013297 | Bacteria | 4990 |
| 278 | Ga0157378_10153330 | 3300013297 | Bacteria | 2148 |
| 279 | Ga0157378_12083891 | 3300013297 | Unclassified | 618 |
| 280 | Ga0163162_10070776 | 3300013306 | Bacteria | 3539 |
| 281 | Ga0163162_10075656 | 3300013306 | Bacteria | 3427 |
| 282 | Ga0163162_10102916 | 3300013306 | Bacteria | 2949 |
| 283 | Ga0163162_10177304 | 3300013306 | Bacteria | 2257 |
| 284 | Ga0157372_10010958 | 3300013307 | Bacteria | 9649 |
| 285 | Ga0157372_10016824 | 3300013307 | Bacteria | 7850 |
| 286 | Ga0157372_10020242 | 3300013307 | Bacteria | 7176 |
| 287 | Ga0157372_10368401 | 3300013307 | Bacteria | 1674 |
| 288 | Ga0157375_10058531 | 3300013308 | Bacteria | 3813 |
| 289 | Ga0157375_10119739 | 3300013308 | Bacteria | 2740 |
| 290 | Ga0163163_10006118 | 3300014325 | Bacteria | 10480 |
| 291 | Ga0163163_10097247 | 3300014325 | Bacteria | 2964 |
| 292 | Ga0163163_10103553 | 3300014325 | Bacteria | 2871 |
| 293 | Ga0163163_10510237 | 3300014325 | Bacteria | 1264 |
| 294 | Ga0157380_10608657 | 3300014326 | Bacteria | 1082 |
| 295 | Ga0182008_10155742 | 3300014497 | Bacteria | 1147 |
| 296 | Ga0182008_10458552 | 3300014497 | Bacteria | 694 |
| 297 | Ga0157377_10268231 | 3300014745 | Bacteria | 1114 |
| 298 | Ga0157379_10005723 | 3300014968 | Bacteria | 10691 |
| 299 | Ga0157379_10010207 | 3300014968 | Bacteria | 8182 |
| 300 | Ga0157379_10013038 | 3300014968 | Bacteria | 7278 |
| 301 | Ga0157379_10023301 | 3300014968 | Bacteria | 5492 |
| 302 | Ga0157379_10056367 | 3300014968 | Bacteria | 3512 |
| 303 | Ga0157379_10063538 | 3300014968 | Bacteria | 3300 |
| 304 | Ga0157379_10288473 | 3300014968 | Bacteria | 1494 |
| 305 | Ga0157379_11036755 | 3300014968 | Bacteria | 783 |
| 306 | Ga0157376_10282182 | 3300014969 | Bacteria | 1565 |
| 307 | Ga0157376_10663790 | 3300014969 | Bacteria | 1044 |
| 308 | Ga0157376_12630317 | 3300014969 | Bacteria | 543 |
| 309 | Ga0182007_10032517 | 3300015262 | Bacteria | 1771 |
| 310 | Ga0182005_1006445 | 3300015265 | Bacteria | 3587 |
| 311 | Ga0163161_10084162 | 3300017792 | Bacteria | 2345 |
| 312 | Ga0213873_10069974 | 3300021358 | Unclassified | 965 |
| 313 | Ga0213876_10000388 | 3300021384 | Bacteria | 36939 |
| 314 | Ga0213876_10000483 | 3300021384 | Bacteria | 31487 |
| 315 | Ga0213876_10061775 | 3300021384 | Unclassified | 1977 |
| 316 | Ga0213875_10339657 | 3300021388 | Unclassified | 713 |
| 317 | Ga0213871_10006451 | 3300021441 | Bacteria | 2481 |
| 318 | Ga0224572_1005619 | 3300024225 | Bacteria | 2242 |
| 319 | Ga0228598_1032500 | 3300024227 | Bacteria | 1028 |
| 320 | Ga0228598_1048399 | 3300024227 | Bacteria | 842 |
| 321 | Ga0209233_1000045 | 3300025261 | Bacteria | 473379 |
| 322 | Ga0209233_1004631 | 3300025261 | Bacteria | 4649 |
| 323 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 324 | Ga0207426_1037572 | 3300025302 | Bacteria | 1530 |
| 325 | Ga0207642_10508668 | 3300025899 | Bacteria | 738 |
| 326 | Ga0207688_10116409 | 3300025901 | Bacteria | 1556 |
| 327 | Ga0207680_10002065 | 3300025903 | Bacteria | 9407 |
| 328 | Ga0207647_10083618 | 3300025904 | Bacteria | 1911 |
| 329 | Ga0207647_10253713 | 3300025904 | Bacteria | 1008 |
| 330 | Ga0207699_10000133 | 3300025906 | Bacteria | 50958 |
| 331 | Ga0207699_10083145 | 3300025906 | Bacteria | 1991 |
| 332 | Ga0207643_10045800 | 3300025908 | Bacteria | 2471 |
| 333 | Ga0207705_10000058 | 3300025909 | Bacteria | 155967 |
| 334 | Ga0207705_10009572 | 3300025909 | Bacteria | 7049 |
| 335 | Ga0207705_10063229 | 3300025909 | Bacteria | 2674 |
| 336 | Ga0207705_10198421 | 3300025909 | Bacteria | 1520 |
| 337 | Ga0207654_10026187 | 3300025911 | Bacteria | 3155 |
| 338 | Ga0207654_10030302 | 3300025911 | Bacteria | 2969 |
| 339 | Ga0207654_10279994 | 3300025911 | Bacteria | 1128 |
| 340 | Ga0207654_10392884 | 3300025911 | Bacteria | 963 |
| 341 | Ga0207654_10625563 | 3300025911 | Unclassified | 769 |
| 342 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 343 | Ga0207707_10001851 | 3300025912 | Bacteria | 19343 |
| 344 | Ga0207707_10052643 | 3300025912 | Bacteria | 3544 |
| 345 | Ga0207707_10076001 | 3300025912 | Bacteria | 2931 |
| 346 | Ga0207707_10089456 | 3300025912 | Bacteria | 2691 |
| 347 | Ga0207707_10201843 | 3300025912 | Bacteria | 1734 |
| 348 | Ga0207695_10000004 | 3300025913 | Bacteria | 1288665 |
| 349 | Ga0207695_10009649 | 3300025913 | Bacteria | 11901 |
| 350 | Ga0207695_10025972 | 3300025913 | Bacteria | 6545 |
| 351 | Ga0207695_10185467 | 3300025913 | Bacteria | 2000 |
| 352 | Ga0207695_10265172 | 3300025913 | Bacteria | 1614 |
| 353 | Ga0207695_10300514 | 3300025913 | Bacteria | 1496 |
| 354 | Ga0207695_10318130 | 3300025913 | Bacteria | 1446 |
| 355 | Ga0207695_10510702 | 3300025913 | Bacteria | 1084 |
| 356 | Ga0207695_11373346 | 3300025913 | Bacteria | 587 |
| 357 | Ga0207671_10008524 | 3300025914 | Bacteria | 8680 |
| 358 | Ga0207671_10039659 | 3300025914 | Bacteria | 3487 |
| 359 | Ga0207671_10124152 | 3300025914 | Bacteria | 1976 |
| 360 | Ga0207671_10266508 | 3300025914 | Bacteria | 1349 |
| 361 | Ga0207693_10000035 | 3300025915 | Bacteria | 110713 |
| 362 | Ga0207693_10000145 | 3300025915 | Bacteria | 65383 |
| 363 | Ga0207693_10345818 | 3300025915 | Unclassified | 1164 |
| 364 | Ga0207693_10664415 | 3300025915 | Bacteria | 809 |
| 365 | Ga0207693_11044357 | 3300025915 | Unclassified | 622 |
| 366 | Ga0207663_10132565 | 3300025916 | Bacteria | 1724 |
| 367 | Ga0207663_10409148 | 3300025916 | Bacteria | 1039 |
| 368 | Ga0207663_10444347 | 3300025916 | Bacteria | 999 |
| 369 | Ga0207663_10529375 | 3300025916 | Bacteria | 919 |
| 370 | Ga0207660_10000343 | 3300025917 | Bacteria | 30105 |
| 371 | Ga0207660_10005636 | 3300025917 | Bacteria | 8130 |
| 372 | Ga0207660_10260396 | 3300025917 | Unclassified | 1371 |
| 373 | Ga0207657_10001163 | 3300025919 | Bacteria | 27950 |
| 374 | Ga0207657_10031643 | 3300025919 | Bacteria | 4788 |
| 375 | Ga0207657_10255897 | 3300025919 | Bacteria | 1394 |
| 376 | Ga0207657_10339033 | 3300025919 | Bacteria | 1187 |
| 377 | Ga0207649_10000713 | 3300025920 | Bacteria | 21869 |
| 378 | Ga0207649_10045683 | 3300025920 | Bacteria | 2686 |
| 379 | Ga0207652_10001515 | 3300025921 | Bacteria | 20513 |
| 380 | Ga0207652_10001611 | 3300025921 | Bacteria | 19837 |
| 381 | Ga0207652_10037141 | 3300025921 | Bacteria | 4122 |
| 382 | Ga0207652_10226186 | 3300025921 | Bacteria | 1686 |
| 383 | Ga0207681_10326529 | 3300025923 | Bacteria | 1222 |
| 384 | Ga0207694_10000010 | 3300025924 | Bacteria | 439722 |
| 385 | Ga0207694_10019979 | 3300025924 | Bacteria | 5067 |
| 386 | Ga0207694_10031229 | 3300025924 | Bacteria | 4067 |
| 387 | Ga0207694_10125538 | 3300025924 | Bacteria | 2052 |
| 388 | Ga0207694_10164227 | 3300025924 | Bacteria | 1795 |
| 389 | Ga0207694_10174989 | 3300025924 | Bacteria | 1739 |
| 390 | Ga0207694_10307457 | 3300025924 | Bacteria | 1306 |
| 391 | Ga0207694_10479462 | 3300025924 | Bacteria | 1040 |
| 392 | Ga0207694_10578392 | 3300025924 | Bacteria | 944 |
| 393 | Ga0207694_10824958 | 3300025924 | Bacteria | 783 |
| 394 | Ga0207694_10893792 | 3300025924 | Bacteria | 751 |
| 395 | Ga0207650_10078032 | 3300025925 | Bacteria | 2505 |
| 396 | Ga0207650_10106481 | 3300025925 | Bacteria | 2166 |
| 397 | Ga0207659_10114725 | 3300025926 | Bacteria | 2054 |
| 398 | Ga0207687_10006441 | 3300025927 | Bacteria | 7754 |
| 399 | Ga0207687_10041918 | 3300025927 | Bacteria | 3146 |
| 400 | Ga0207700_10000887 | 3300025928 | Bacteria | 17225 |
| 401 | Ga0207700_10073149 | 3300025928 | Bacteria | 2646 |
| 402 | Ga0207700_10270732 | 3300025928 | Bacteria | 1458 |
| 403 | Ga0207664_10034382 | 3300025929 | Bacteria | 3904 |
| 404 | Ga0207664_10974179 | 3300025929 | Bacteria | 760 |
| 405 | Ga0207644_10110370 | 3300025931 | Bacteria | 2079 |
| 406 | Ga0207644_10148518 | 3300025931 | Bacteria | 1812 |
| 407 | Ga0207690_10176985 | 3300025932 | Bacteria | 1603 |
| 408 | Ga0207690_10650126 | 3300025932 | Bacteria | 864 |
| 409 | Ga0207686_10069968 | 3300025934 | Bacteria | 2253 |
| 410 | Ga0207686_10072192 | 3300025934 | Bacteria | 2223 |
| 411 | Ga0207686_10228583 | 3300025934 | Bacteria | 1347 |
| 412 | Ga0207686_10297675 | 3300025934 | Bacteria | 1197 |
| 413 | Ga0207709_10069009 | 3300025935 | Bacteria | 2236 |
| 414 | Ga0207709_10145616 | 3300025935 | Bacteria | 1634 |
| 415 | Ga0207670_10884461 | 3300025936 | Bacteria | 747 |
| 416 | Ga0207665_10399728 | 3300025939 | Bacteria | 1046 |
| 417 | Ga0207691_10255183 | 3300025940 | Bacteria | 1513 |
| 418 | Ga0207691_10322190 | 3300025940 | Bacteria | 1325 |
| 419 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 420 | Ga0207711_10103045 | 3300025941 | Bacteria | 2527 |
| 421 | Ga0207711_10157015 | 3300025941 | Bacteria | 2056 |
| 422 | Ga0207711_11854189 | 3300025941 | Bacteria | 546 |
| 423 | Ga0207661_10245798 | 3300025944 | Bacteria | 1589 |
| 424 | Ga0207661_10743783 | 3300025944 | Unclassified | 902 |
| 425 | Ga0207661_11126067 | 3300025944 | Bacteria | 723 |
| 426 | Ga0207679_10693291 | 3300025945 | Bacteria | 924 |
| 427 | Ga0207667_10000116 | 3300025949 | Bacteria | 128218 |
| 428 | Ga0207667_10010486 | 3300025949 | Bacteria | 10832 |
| 429 | Ga0207667_10051617 | 3300025949 | Bacteria | 4334 |
| 430 | Ga0207667_10054170 | 3300025949 | Bacteria | 4219 |
| 431 | Ga0207667_10280258 | 3300025949 | Bacteria | 1703 |
| 432 | Ga0207667_10415966 | 3300025949 | Bacteria | 1368 |
| 433 | Ga0207651_10060661 | 3300025960 | Bacteria | 2627 |
| 434 | Ga0207712_10175517 | 3300025961 | Bacteria | 1679 |
| 435 | Ga0207712_11345309 | 3300025961 | Unclassified | 639 |
| 436 | Ga0207640_10181371 | 3300025981 | Bacteria | 1579 |
| 437 | Ga0207640_11099119 | 3300025981 | Unclassified | 703 |
| 438 | Ga0207658_10072101 | 3300025986 | Bacteria | 2617 |
| 439 | Ga0207658_10153914 | 3300025986 | Bacteria | 1877 |
| 440 | Ga0207658_10838691 | 3300025986 | Bacteria | 835 |
| 441 | Ga0207677_10362415 | 3300026023 | Unclassified | 1218 |
| 442 | Ga0207677_10402358 | 3300026023 | Bacteria | 1161 |
| 443 | Ga0207703_10007826 | 3300026035 | Bacteria | 8451 |
| 444 | Ga0207703_10024046 | 3300026035 | Bacteria | 4794 |
| 445 | Ga0207703_10028607 | 3300026035 | Bacteria | 4395 |
| 446 | Ga0207703_10033739 | 3300026035 | Bacteria | 4060 |
| 447 | Ga0207639_10070415 | 3300026041 | Bacteria | 2732 |
| 448 | Ga0207639_10094996 | 3300026041 | Bacteria | 2395 |
| 449 | Ga0207639_10354036 | 3300026041 | Bacteria | 1312 |
| 450 | Ga0207639_10598537 | 3300026041 | Bacteria | 1016 |
| 451 | Ga0207639_10761296 | 3300026041 | Bacteria | 901 |
| 452 | Ga0207639_10993129 | 3300026041 | Bacteria | 786 |
| 453 | Ga0207678_10024654 | 3300026067 | Bacteria | 5254 |
| 454 | Ga0207678_10425809 | 3300026067 | Bacteria | 1151 |
| 455 | Ga0207702_10000007 | 3300026078 | Bacteria | 332551 |
| 456 | Ga0207702_10000012 | 3300026078 | Bacteria | 269770 |
| 457 | Ga0207702_10019910 | 3300026078 | Bacteria | 5558 |
| 458 | Ga0207702_10045111 | 3300026078 | Bacteria | 3709 |
| 459 | Ga0207702_10062926 | 3300026078 | Bacteria | 3171 |
| 460 | Ga0207702_10516094 | 3300026078 | Viruses | 1166 |
| 461 | Ga0207702_10857662 | 3300026078 | Unclassified | 899 |
| 462 | Ga0207648_10022114 | 3300026089 | Bacteria | 5713 |
| 463 | Ga0207648_10808173 | 3300026089 | Bacteria | 873 |
| 464 | Ga0207648_11565818 | 3300026089 | Bacteria | 619 |
| 465 | Ga0207676_10032252 | 3300026095 | Bacteria | 3946 |
| 466 | Ga0207676_10803188 | 3300026095 | Bacteria | 918 |
| 467 | Ga0207674_10000107 | 3300026116 | Bacteria | 95635 |
| 468 | Ga0207674_10094261 | 3300026116 | Bacteria | 2980 |
| 469 | Ga0207674_10136288 | 3300026116 | Bacteria | 2417 |
| 470 | Ga0207674_10405724 | 3300026116 | Bacteria | 1317 |
| 471 | Ga0207674_10660046 | 3300026116 | Bacteria | 1010 |
| 472 | Ga0207675_100115394 | 3300026118 | Bacteria | 2537 |
| 473 | Ga0207675_100955280 | 3300026118 | Unclassified | 875 |
| 474 | Ga0207683_10015302 | 3300026121 | Bacteria | 6531 |
| 475 | Ga0207683_10062021 | 3300026121 | Bacteria | 3292 |
| 476 | Ga0207683_10145708 | 3300026121 | Bacteria | 2135 |
| 477 | Ga0207698_10002022 | 3300026142 | Bacteria | 11968 |
| 478 | Ga0207698_10050270 | 3300026142 | Bacteria | 3179 |
| 479 | Ga0207698_10206682 | 3300026142 | Bacteria | 1763 |
| 480 | Ga0207698_10240572 | 3300026142 | Bacteria | 1649 |
| 481 | Ga0207428_10200811 | 3300027907 | Bacteria | 1500 |
| 482 | Ga0268266_10000357 | 3300028379 | Bacteria | 70858 |
| 483 | Ga0268266_10015674 | 3300028379 | Bacteria | 6493 |
| 484 | Ga0268266_10017377 | 3300028379 | Bacteria | 6137 |
| 485 | Ga0268266_10033283 | 3300028379 | Bacteria | 4382 |
| 486 | Ga0268266_10282334 | 3300028379 | Bacteria | 1544 |
| 487 | Ga0268266_10311014 | 3300028379 | Bacteria | 1472 |
| 488 | Ga0268266_10495887 | 3300028379 | Bacteria | 1165 |
| 489 | Ga0268266_10507701 | 3300028379 | Bacteria | 1152 |
| 490 | Ga0268266_10617939 | 3300028379 | Bacteria | 1041 |
| 491 | Ga0268264_10094282 | 3300028381 | Bacteria | 2587 |
| 492 | Ga0268264_10146423 | 3300028381 | Bacteria | 2112 |
| 493 | Ga0268264_10621808 | 3300028381 | Bacteria | 1066 |
| 494 | Ga0265318_10000082 | 3300028577 | Bacteria | 85943 |
| 495 | Ga0307517_10137249 | 3300028786 | Bacteria | 1734 |
| 496 | Ga0265338_10000006 | 3300028800 | Bacteria | 570804 |
| 497 | Ga0265338_10001374 | 3300028800 | Bacteria | 39593 |
| 498 | Ga0265338_10032945 | 3300028800 | Bacteria | 5042 |
| 499 | Ga0265338_10039132 | 3300028800 | Bacteria | 4480 |
| 500 | Ga0265338_10067710 | 3300028800 | Bacteria | 3082 |
| 501 | Ga0265338_10160012 | 3300028800 | Bacteria | 1740 |
| 502 | Ga0265338_10172698 | 3300028800 | Bacteria | 1656 |
| 503 | Ga0265338_10258806 | 3300028800 | Bacteria | 1280 |
| 504 | Ga0265338_10538297 | 3300028800 | Bacteria | 819 |
| 505 | Ga0265762_1022919 | 3300030760 | Bacteria | 1156 |
| 506 | Ga0265760_10065112 | 3300031090 | Bacteria | 1112 |
| 507 | Ga0265330_10017766 | 3300031235 | Bacteria | 3273 |
| 508 | Ga0265330_10020152 | 3300031235 | Bacteria | 3049 |
| 509 | Ga0265330_10117172 | 3300031235 | Bacteria | 1136 |
| 510 | Ga0265330_10126415 | 3300031235 | Bacteria | 1088 |
| 511 | Ga0265330_10264748 | 3300031235 | Bacteria | 724 |
| 512 | Ga0265332_10011438 | 3300031238 | Bacteria | 3947 |
| 513 | Ga0265332_10045629 | 3300031238 | Bacteria | 1888 |
| 514 | Ga0265332_10229408 | 3300031238 | Bacteria | 769 |
| 515 | Ga0265328_10000123 | 3300031239 | Bacteria | 37155 |
| 516 | Ga0265328_10077249 | 3300031239 | Bacteria | 1226 |
| 517 | Ga0265320_10000039 | 3300031240 | Bacteria | 134478 |
| 518 | Ga0265320_10087964 | 3300031240 | Bacteria | 1442 |
| 519 | Ga0265320_10133739 | 3300031240 | Bacteria | 1126 |
| 520 | Ga0265320_10218157 | 3300031240 | Unclassified | 850 |
| 521 | Ga0265325_10000007 | 3300031241 | Bacteria | 208874 |
| 522 | Ga0265325_10000079 | 3300031241 | Bacteria | 67833 |
| 523 | Ga0265325_10000719 | 3300031241 | Bacteria | 23911 |
| 524 | Ga0265325_10000967 | 3300031241 | Bacteria | 20649 |
| 525 | Ga0265325_10001558 | 3300031241 | Bacteria | 15979 |
| 526 | Ga0265325_10011992 | 3300031241 | Bacteria | 4966 |
| 527 | Ga0265325_10039095 | 3300031241 | Bacteria | 2500 |
| 528 | Ga0265325_10076961 | 3300031241 | Bacteria | 1664 |
| 529 | Ga0265340_10000096 | 3300031247 | Bacteria | 41553 |
| 530 | Ga0265340_10012732 | 3300031247 | Bacteria | 4441 |
| 531 | Ga0265340_10040690 | 3300031247 | Bacteria | 2288 |
| 532 | Ga0265340_10120477 | 3300031247 | Bacteria | 1207 |
| 533 | Ga0265340_10230810 | 3300031247 | Unclassified | 827 |
| 534 | Ga0265340_10287215 | 3300031247 | Bacteria | 730 |
| 535 | Ga0265339_10001422 | 3300031249 | Bacteria | 17761 |
| 536 | Ga0265339_10009647 | 3300031249 | Bacteria | 6044 |
| 537 | Ga0265339_10010793 | 3300031249 | Bacteria | 5654 |
| 538 | Ga0265339_10024789 | 3300031249 | Bacteria | 3451 |
| 539 | Ga0265339_10033205 | 3300031249 | Bacteria | 2907 |
| 540 | Ga0265339_10044716 | 3300031249 | Bacteria | 2441 |
| 541 | Ga0265339_10133225 | 3300031249 | Bacteria | 1269 |
| 542 | Ga0265339_10168870 | 3300031249 | Unclassified | 1096 |
| 543 | Ga0265331_10000009 | 3300031250 | Bacteria | 314950 |
| 544 | Ga0265331_10000026 | 3300031250 | Bacteria | 223760 |
| 545 | Ga0265331_10000212 | 3300031250 | Bacteria | 70202 |
| 546 | Ga0265331_10004939 | 3300031250 | Bacteria | 8190 |
| 547 | Ga0265331_10007849 | 3300031250 | Bacteria | 6119 |
| 548 | Ga0265331_10033930 | 3300031250 | Bacteria | 2520 |
| 549 | Ga0265331_10035419 | 3300031250 | Bacteria | 2456 |
| 550 | Ga0265331_10059058 | 3300031250 | Bacteria | 1814 |
| 551 | Ga0265331_10095890 | 3300031250 | Bacteria | 1368 |
| 552 | Ga0265327_10000007 | 3300031251 | Bacteria | 678515 |
| 553 | Ga0265327_10270709 | 3300031251 | Bacteria | 752 |
| 554 | Ga0265316_10000936 | 3300031344 | Bacteria | 31773 |
| 555 | Ga0265316_10008650 | 3300031344 | Bacteria | 9424 |
| 556 | Ga0265316_10022243 | 3300031344 | Bacteria | 5353 |
| 557 | Ga0265316_10030437 | 3300031344 | Bacteria | 4424 |
| 558 | Ga0265316_10142806 | 3300031344 | Bacteria | 1797 |
| 559 | Ga0265316_10170606 | 3300031344 | Bacteria | 1623 |
| 560 | Ga0265316_10173197 | 3300031344 | Bacteria | 1609 |
| 561 | Ga0265316_10223662 | 3300031344 | Bacteria | 1388 |
| 562 | Ga0265316_10223981 | 3300031344 | Bacteria | 1387 |
| 563 | Ga0265316_10296269 | 3300031344 | Bacteria | 1179 |
| 564 | Ga0265316_10395879 | 3300031344 | Bacteria | 995 |
| 565 | Ga0265316_10546327 | 3300031344 | Bacteria | 825 |
| 566 | Ga0265316_10598323 | 3300031344 | Unclassified | 782 |
| 567 | Ga0265316_10835927 | 3300031344 | Bacteria | 645 |
| 568 | Ga0307513_10285806 | 3300031456 | Bacteria | 1424 |
| 569 | Ga0265313_10001902 | 3300031595 | Bacteria | 18946 |
| 570 | Ga0265313_10003138 | 3300031595 | Bacteria | 13641 |
| 571 | Ga0265313_10005466 | 3300031595 | Bacteria | 9337 |
| 572 | Ga0265313_10022563 | 3300031595 | Bacteria | 3411 |
| 573 | Ga0265313_10072246 | 3300031595 | Bacteria | 1586 |
| 574 | Ga0265313_10133665 | 3300031595 | Bacteria | 1072 |
| 575 | Ga0265313_10143935 | 3300031595 | Bacteria | 1023 |
| 576 | Ga0265313_10280843 | 3300031595 | Unclassified | 673 |
| 577 | Ga0265314_10003096 | 3300031711 | Bacteria | 16371 |
| 578 | Ga0265314_10007438 | 3300031711 | Bacteria | 9501 |
| 579 | Ga0265314_10010041 | 3300031711 | Bacteria | 7935 |
| 580 | Ga0265314_10021019 | 3300031711 | Bacteria | 5030 |
| 581 | Ga0265314_10049633 | 3300031711 | Bacteria | 2936 |
| 582 | Ga0265314_10067096 | 3300031711 | Bacteria | 2418 |
| 583 | Ga0265314_10075023 | 3300031711 | Bacteria | 2251 |
| 584 | Ga0265314_10090308 | 3300031711 | Bacteria | 1996 |
| 585 | Ga0265314_10126574 | 3300031711 | Bacteria | 1599 |
| 586 | Ga0265314_10132386 | 3300031711 | Bacteria | 1553 |
| 587 | Ga0265314_10145242 | 3300031711 | Bacteria | 1462 |
| 588 | Ga0265314_10150855 | 3300031711 | Bacteria | 1425 |
| 589 | Ga0265314_10297721 | 3300031711 | Bacteria | 906 |
| 590 | Ga0265314_10359740 | 3300031711 | Bacteria | 798 |
| 591 | Ga0265342_10015572 | 3300031712 | Bacteria | 4998 |
| 592 | Ga0265342_10022757 | 3300031712 | Bacteria | 3979 |
| 593 | Ga0265342_10030960 | 3300031712 | Bacteria | 3312 |
| 594 | Ga0265342_10044100 | 3300031712 | Bacteria | 2690 |
| 595 | Ga0265342_10060617 | 3300031712 | Bacteria | 2231 |
| 596 | Ga0265342_10099607 | 3300031712 | Bacteria | 1657 |
| 597 | Ga0307516_10007154 | 3300031730 | Bacteria | 12884 |
| 598 | Ga0307516_10007941 | 3300031730 | Bacteria | 12080 |
| 599 | Ga0307406_10098051 | 3300031901 | Bacteria | 1989 |
| 600 | Ga0373926_0061795 | 3300035083 | Bacteria | 1367 |
| 601 | Ga0373929_0229211 | 3300035085 | Unclassified | 531 |
| 602 | Ga0373944_0017334 | 3300035089 | Bacteria | 2043 |
| 603 | Ga0373944_0194262 | 3300035089 | Unclassified | 733 |
| 604 | Ga0373952_0031461 | 3300035092 | Bacteria | 1180 |
| 605 | Ga0373923_0012135 | 3300035111 | Bacteria | 3177 |
| 606 | Ga0373923_0054576 | 3300035111 | Bacteria | 1682 |
| 607 | Ga0373923_0126678 | 3300035111 | Bacteria | 1145 |
| 608 | Ga0373945_0067629 | 3300035116 | Bacteria | 1345 |
| 609 | Ga0373945_0144424 | 3300035116 | Bacteria | 961 |
| 610 | Ga0373953_0050352 | 3300035117 | Bacteria | 1682 |
| 611 | Ga0373953_0241486 | 3300035117 | Bacteria | 784 |
| 612 | Ga0373954_0065479 | 3300035118 | Bacteria | 1720 |
| 613 | Ga0373954_0066270 | 3300035118 | Bacteria | 1710 |
| 614 | Ga0373954_0136386 | 3300035118 | Bacteria | 1196 |
| 615 | Ga0373956_0023081 | 3300035119 | Bacteria | 2667 |
| 616 | Ga0373956_0065371 | 3300035119 | Bacteria | 1652 |
| 617 | Ga0373956_0180208 | 3300035119 | Bacteria | 999 |
| 618 | Ga0373957_0043071 | 3300035120 | Bacteria | 1705 |
| 619 | Ga0373943_0021651 | 3300035170 | Bacteria | 2970 |
| 620 | Ga0373943_0390685 | 3300035170 | Bacteria | 802 |
| 621 | Ga0373955_0032059 | 3300035172 | Bacteria | 2755 |
| 622 | Ga0373955_0043618 | 3300035172 | Bacteria | 2413 |
| 623 | Ga0373955_0051751 | 3300035172 | Bacteria | 2238 |
| 624 | Ga0373924_0179037 | 3300035410 | Bacteria | 933 |
| 625 | Ga0373931_0029941 | 3300035691 | Bacteria | 2799 |
| 626 | Ga0373931_0633688 | 3300035691 | Bacteria | 701 |
| 627 | Ga0373935_0447515 | 3300035692 | Bacteria | 933 |
| 628 | Ga0373927_0528139 | 3300035695 | Unclassified | 780 |
| 629 | Ga0373933_0025178 | 3300035724 | Bacteria | 3411 |
| 630 | Ga0373933_0034446 | 3300035724 | Bacteria | 2951 |
| 631 | Ga0373933_0075443 | 3300035724 | Bacteria | 2058 |
| 632 | Ga0373933_0233500 | 3300035724 | Bacteria | 1182 |
| 633 | Ga0373933_0821321 | 3300035724 | Unclassified | 612 |
| 634 | Ga0373947_0011553 | 3300035725 | Bacteria | 5064 |
| 635 | Ga0373937_0009750 | 3300036401 | Bacteria | 8372 |
| 636 | Ga0373937_0010384 | 3300036401 | Bacteria | 8132 |
| 637 | Ga0373937_0060950 | 3300036401 | Bacteria | 3468 |
| 638 | Ga0373937_0071295 | 3300036401 | Bacteria | 3204 |
| 639 | Ga0373937_0789074 | 3300036401 | Bacteria | 897 |
| 640 | Ga0373937_0825298 | 3300036401 | Bacteria | 875 |
| 641 | Ga0373937_1340931 | 3300036401 | Bacteria | 663 |
| 642 | Ga0373937_2067487 | 3300036401 | Unclassified | 516 |
| 643 | Ga0373925_0031160 | 3300037068 | Bacteria | 3917 |
| 644 | Ga0373925_0044126 | 3300037068 | Bacteria | 3310 |
| 645 | Ga0373925_0054428 | 3300037068 | Bacteria | 2993 |
| 646 | Ga0373925_0213161 | 3300037068 | Bacteria | 1539 |
| 647 | Ga0373925_0236591 | 3300037068 | Bacteria | 1462 |
| 648 | Ga0373925_0473851 | 3300037068 | Bacteria | 1026 |
| 649 | Ga0373925_0740031 | 3300037068 | Unclassified | 811 |
| 650 | Ga0373925_1459805 | 3300037068 | Unclassified | 560 |
| 651 | Ga0395899_0060219 | 3300037312 | Bacteria | 2797 |
| 652 | Ga0395900_0053179 | 3300037418 | Bacteria | 4168 |
| 653 | Ga0395900_0656383 | 3300037418 | Bacteria | 985 |
| 654 | Ga0395898_0008535 | 3300037466 | Bacteria | 10824 |
| 655 | Ga0395898_0818680 | 3300037466 | Bacteria | 871 |
| 656 | Ga0395905_0953991 | 3300037471 | Bacteria | 761 |
| 657 | Ga0436364_0045683 | 3300037853 | Bacteria | 650 |
| 658 | Ga0436364_0630355 | 3300037853 | Bacteria | 2053 |
| 659 | Ga0436364_1385246 | 3300037853 | Unclassified | 1149 |
| 660 | Ga0395901_0062777 | 3300038443 | Bacteria | 3866 |
| 661 | Ga0395901_0448753 | 3300038443 | Bacteria | 1319 |
| 662 | Ga0436365_0151405 | 3300039437 | Bacteria | 11975 |
| 663 | Ga0436365_0412683 | 3300039437 | Bacteria | 137628 |
| 664 | Ga0436365_0550500 | 3300039437 | Bacteria | 3716 |
| 665 | Ga0436365_0678770 | 3300039437 | Bacteria | 2534 |
| 666 | Ga0436365_0991473 | 3300039437 | Bacteria | 77252 |
| 667 | Ga0436365_1551085 | 3300039437 | Unclassified | 758 |
| 668 | Ga0436360_0160041 | 3300039438 | Bacteria | 6302 |
| 669 | Ga0436360_0900296 | 3300039438 | Bacteria | 1275 |
| 670 | Ga0436363_0377217 | 3300039450 | Bacteria | 921 |
| 671 | Ga0436363_0857110 | 3300039450 | Bacteria | 743 |
| 672 | Ga0436363_1394367 | 3300039450 | Unclassified | 660 |
| 673 | Ga0436363_1716475 | 3300039450 | Bacteria | 12115 |
| 674 | Ga0436362_0193065 | 3300039453 | Unclassified | 1597 |
| 675 | Ga0436362_0413829 | 3300039453 | Bacteria | 1007 |
| 676 | Ga0436362_0497344 | 3300039453 | Unclassified | 504 |
| 677 | Ga0436362_0609469 | 3300039453 | Bacteria | 1351 |
| 678 | Ga0451791_0308433 | 3300041451 | Unclassified | 584 |
| 679 | Ga0451793_1177649 | 3300041452 | Bacteria | 1072 |
| 680 | Ga0451849_1436860 | 3300041505 | Bacteria | 626 |
| 681 | Ga0466957_0489198 | 3300044842 | Bacteria | 852 |
| 682 | Ga0451576_0238219 | 3300045051 | Bacteria | 1901 |
| 683 | Ga0495617_080398 | 3300046452 | Bacteria | 1068 |
| 684 | Ga0495592_0002029 | 3300046454 | Bacteria | 14254 |
| 685 | Ga0495603_0014799 | 3300046455 | Bacteria | 4718 |
| 686 | Ga0495651_0088138 | 3300046462 | Bacteria | 2332 |
| 687 | Ga0495651_0325111 | 3300046462 | Bacteria | 1024 |
| 688 | Ga0495580_0118273 | 3300046472 | Bacteria | 1840 |
| 689 | Ga0495580_0168382 | 3300046472 | Bacteria | 1515 |
| 690 | Ga0495582_0055510 | 3300046473 | Bacteria | 2183 |
| 691 | Ga0495605_0137072 | 3300046474 | Bacteria | 1100 |
| 692 | Ga0495662_0073329 | 3300046476 | Bacteria | 1660 |
| 693 | Ga0495664_0039971 | 3300046477 | Bacteria | 2772 |
| 694 | Ga0495664_0212652 | 3300046477 | Bacteria | 1171 |
| 695 | Ga0495584_0187340 | 3300046491 | Bacteria | 1051 |
| 696 | Ga0495585_0009380 | 3300046492 | Bacteria | 5870 |
| 697 | Ga0495585_0169679 | 3300046492 | Bacteria | 1128 |
| 698 | Ga0495596_0076830 | 3300046500 | Bacteria | 1297 |
| 699 | Ga0495606_0161475 | 3300046507 | Bacteria | 1307 |
| 700 | Ga0495608_0173215 | 3300046511 | Bacteria | 1368 |
| 701 | Ga0495616_0057027 | 3300046513 | Bacteria | 1927 |
| 702 | Ga0495628_0010755 | 3300046516 | Bacteria | 7750 |
| 703 | Ga0495628_0696989 | 3300046516 | Unclassified | 718 |
| 704 | Ga0495663_0058607 | 3300046525 | Bacteria | 1207 |
| 705 | Ga0495666_0084114 | 3300046526 | Bacteria | 1503 |
| 706 | Ga0495652_0035285 | 3300046529 | Bacteria | 4354 |
| 707 | Ga0495652_0051267 | 3300046529 | Bacteria | 3525 |
| 708 | Ga0495652_0080670 | 3300046529 | Bacteria | 2687 |
| 709 | Ga0495665_0136860 | 3300046531 | Bacteria | 1281 |
| 710 | Ga0495665_0332784 | 3300046531 | Bacteria | 775 |
| 711 | Ga0495587_0145848 | 3300046536 | Bacteria | 1350 |
| 712 | Ga0495598_0034670 | 3300046537 | Bacteria | 1440 |
| 713 | Ga0495621_0168074 | 3300046539 | Bacteria | 870 |
| 714 | Ga0495621_0515117 | 3300046539 | Unclassified | 517 |
| 715 | Ga0495645_0004240 | 3300046543 | Bacteria | 9791 |
| 716 | Ga0495645_0031707 | 3300046543 | Bacteria | 3851 |
| 717 | Ga0495645_0406883 | 3300046543 | Bacteria | 866 |
| 718 | Ga0495622_0002481 | 3300046557 | Bacteria | 8925 |
| 719 | Ga0495656_0007146 | 3300046615 | Bacteria | 3940 |
| 720 | Ga0495668_0254767 | 3300046616 | Bacteria | 961 |
| 721 | Ga0495611_0114925 | 3300046648 | Bacteria | 1254 |
| 722 | Ga0495625_0127072 | 3300046660 | Bacteria | 1730 |
| 723 | Ga0495635_0050975 | 3300046663 | Bacteria | 2853 |
| 724 | Ga0495659_0038061 | 3300046664 | Bacteria | 1707 |
| 725 | Ga0495661_0097010 | 3300046665 | Bacteria | 1666 |
| 726 | Ga0495661_0208571 | 3300046665 | Bacteria | 1019 |
| 727 | Ga0495588_0009480 | 3300046674 | Bacteria | 4500 |
| 728 | Ga0495657_0057811 | 3300046675 | Bacteria | 2578 |
| 729 | Ga0495657_0082257 | 3300046675 | Bacteria | 2081 |
| 730 | Ga0495599_0002546 | 3300046678 | Bacteria | 10623 |
| 731 | Ga0495599_0069790 | 3300046678 | Bacteria | 2193 |
| 732 | Ga0495623_0031161 | 3300046679 | Bacteria | 3429 |
| 733 | Ga0495646_0477610 | 3300046680 | Bacteria | 642 |
| 734 | Ga0495646_0637313 | 3300046680 | Unclassified | 539 |
| 735 | Ga0495647_0120355 | 3300046681 | Bacteria | 1104 |
| 736 | Ga0495658_0040998 | 3300046683 | Bacteria | 2576 |
| 737 | Ga0495613_0372475 | 3300046689 | Bacteria | 978 |
| 738 | Ga0495670_0010448 | 3300046691 | Bacteria | 4561 |
| 739 | Ga0495670_0405797 | 3300046691 | Bacteria | 736 |
| 740 | Ga0495589_0386033 | 3300046794 | Unclassified | 643 |
| 741 | Ga0495600_0003255 | 3300046809 | Bacteria | 9512 |
| 742 | Ga0495660_0095861 | 3300046810 | Bacteria | 1534 |
| 743 | Ga0495581_0031931 | 3300047315 | Bacteria | 3051 |
| 744 | Ga0495604_0008492 | 3300047317 | Bacteria | 8108 |
| 745 | Ga0495604_0471718 | 3300047317 | Unclassified | 817 |
| 746 | Ga0495636_0156828 | 3300047318 | Bacteria | 1024 |
| 747 | Ga0495674_0236011 | 3300047319 | Bacteria | 1508 |
| 748 | Ga0495672_0261542 | 3300047320 | Bacteria | 835 |
| 749 | Ga0495676_0045481 | 3300047321 | Bacteria | 3572 |
| 750 | Ga0495680_0009974 | 3300047322 | Bacteria | 8503 |
| 751 | Ga0495680_0186175 | 3300047322 | Bacteria | 1496 |
| 752 | Ga0495675_0079273 | 3300047444 | Bacteria | 2068 |
| 753 | Ga0495675_0080417 | 3300047444 | Bacteria | 2053 |
| 754 | Ga0495677_0105497 | 3300047445 | Bacteria | 1069 |
| 755 | Ga0495673_0084336 | 3300047469 | Bacteria | 1310 |
| 756 | Ga0495684_0139083 | 3300047471 | Bacteria | 1821 |
| 757 | Ga0495684_0568062 | 3300047471 | Bacteria | 770 |
| 758 | Ga0495602_0012502 | 3300048088 | Bacteria | 8718 |
| 759 | Ga0495602_0345175 | 3300048088 | Bacteria | 1076 |
| 760 | Ga0496101_0115020 | 3300048904 | Bacteria | 2029 |
| 761 | Ga0496104_0503965 | 3300048907 | Unclassified | 1122 |
| 762 | Ga0496109_0665898 | 3300048912 | Unclassified | 978 |
| 763 | Ga0496112_0179882 | 3300048915 | Bacteria | 2079 |
| 764 | Ga0496113_0092650 | 3300048916 | Bacteria | 2331 |
| 765 | Ga0496115_0296705 | 3300048918 | Bacteria | 1325 |
| 766 | Ga0496119_0036704 | 3300048922 | Bacteria | 3196 |
| 767 | Ga0496120_0116437 | 3300048923 | Bacteria | 1388 |
| 768 | Ga0496121_0000342 | 3300048924 | Bacteria | 97267 |
| 769 | Ga0496121_0053748 | 3300048924 | Bacteria | 3372 |
| 770 | Ga0496121_0137152 | 3300048924 | Bacteria | 1821 |
| 771 | Ga0496126_0004475 | 3300048929 | Bacteria | 16682 |
| 772 | Ga0496126_0085460 | 3300048929 | Bacteria | 2781 |
| 773 | Ga0495682_0014850 | 3300049460 | Bacteria | 2951 |
| 774 | Ga0501031_0007188 | 3300049568 | Bacteria | 7265 |
| 775 | Ga0501031_0481747 | 3300049568 | Unclassified | 801 |
| 776 | Ga0501032_0019525 | 3300049569 | Bacteria | 4740 |
| 777 | Ga0501032_0118681 | 3300049569 | Bacteria | 1749 |
| 778 | Ga0501032_0163452 | 3300049569 | Bacteria | 1461 |
| 779 | Ga0501032_0222494 | 3300049569 | Bacteria | 1228 |
| 780 | Ga0501032_0404806 | 3300049569 | Bacteria | 876 |
| 781 | Ga0501033_0009915 | 3300049570 | Bacteria | 7315 |
| 782 | Ga0501033_0035884 | 3300049570 | Bacteria | 3716 |
| 783 | Ga0501033_0042084 | 3300049570 | Bacteria | 3406 |
| 784 | Ga0501033_0090122 | 3300049570 | Bacteria | 2243 |
| 785 | Ga0501033_0110926 | 3300049570 | Bacteria | 1996 |
| 786 | Ga0501033_0129043 | 3300049570 | Bacteria | 1832 |
| 787 | Ga0501033_0170018 | 3300049570 | Bacteria | 1566 |
| 788 | Ga0501033_0189619 | 3300049570 | Bacteria | 1471 |
| 789 | Ga0501033_0208981 | 3300049570 | Bacteria | 1392 |
| 790 | Ga0501033_0310960 | 3300049570 | Bacteria | 1108 |
| 791 | Ga0501033_0337716 | 3300049570 | Unclassified | 1056 |
| 792 | Ga0501033_0362231 | 3300049570 | Bacteria | 1014 |
| 793 | Ga0501033_0803200 | 3300049570 | Bacteria | 636 |
| 794 | Ga0501033_0881066 | 3300049570 | Bacteria | 602 |
| 795 | Ga0501034_0030482 | 3300049571 | Bacteria | 5483 |
| 796 | Ga0501034_0122632 | 3300049571 | Bacteria | 2585 |
| 797 | Ga0501034_0123280 | 3300049571 | Bacteria | 2577 |
| 798 | Ga0501034_0187479 | 3300049571 | Bacteria | 2031 |
| 799 | Ga0501034_0200527 | 3300049571 | Bacteria | 1954 |
| 800 | Ga0501034_0223272 | 3300049571 | Bacteria | 1836 |
| 801 | Ga0501034_0226097 | 3300049571 | Bacteria | 1822 |
| 802 | Ga0501034_0478455 | 3300049571 | Bacteria | 1161 |
| 803 | Ga0501036_0003979 | 3300049572 | Bacteria | 11875 |
| 804 | Ga0501036_0120952 | 3300049572 | Bacteria | 2211 |
| 805 | Ga0501036_0260047 | 3300049572 | Bacteria | 1454 |
| 806 | Ga0501036_0289756 | 3300049572 | Bacteria | 1370 |
| 807 | Ga0501036_0412702 | 3300049572 | Bacteria | 1126 |
| 808 | Ga0501037_0003258 | 3300049573 | Bacteria | 11780 |
| 809 | Ga0501037_0010726 | 3300049573 | Bacteria | 6734 |
| 810 | Ga0501037_0011338 | 3300049573 | Bacteria | 6562 |
| 811 | Ga0501037_0151712 | 3300049573 | Bacteria | 1656 |
| 812 | Ga0501037_0347874 | 3300049573 | Bacteria | 1023 |
| 813 | Ga0501038_0022382 | 3300049574 | Bacteria | 5665 |
| 814 | Ga0501038_0060653 | 3300049574 | Bacteria | 3237 |
| 815 | Ga0501038_0066451 | 3300049574 | Bacteria | 3071 |
| 816 | Ga0501038_0094116 | 3300049574 | Bacteria | 2505 |
| 817 | Ga0501038_0098103 | 3300049574 | Bacteria | 2443 |
| 818 | Ga0501038_0108913 | 3300049574 | Bacteria | 2296 |
| 819 | Ga0501038_0123152 | 3300049574 | Bacteria | 2136 |
| 820 | Ga0501038_0294125 | 3300049574 | Unclassified | 1275 |
| 821 | Ga0501038_0430508 | 3300049574 | Bacteria | 1017 |
| 822 | Ga0501038_0954687 | 3300049574 | Bacteria | 631 |
| 823 | Ga0501038_0964427 | 3300049574 | Bacteria | 627 |
| 824 | Ga0501039_0000722 | 3300049575 | Bacteria | 23835 |
| 825 | Ga0501039_0200760 | 3300049575 | Bacteria | 1568 |
| 826 | Ga0501039_1137685 | 3300049575 | Bacteria | 604 |
| 827 | Ga0501040_0271842 | 3300049576 | Bacteria | 1210 |
| 828 | Ga0501040_0705447 | 3300049576 | Bacteria | 730 |
| 829 | Ga0501041_0510738 | 3300049577 | Bacteria | 765 |
| 830 | Ga0501042_0029241 | 3300049578 | Bacteria | 3886 |
| 831 | Ga0501043_0002787 | 3300049579 | Bacteria | 14605 |
| 832 | Ga0501043_0072392 | 3300049579 | Bacteria | 2707 |
| 833 | Ga0501043_0076031 | 3300049579 | Bacteria | 2638 |
| 834 | Ga0501043_0099636 | 3300049579 | Bacteria | 2284 |
| 835 | Ga0501043_0110245 | 3300049579 | Bacteria | 2161 |
| 836 | Ga0501043_0152686 | 3300049579 | Bacteria | 1807 |
| 837 | Ga0501043_0340253 | 3300049579 | Bacteria | 1141 |
| 838 | Ga0501046_0008706 | 3300049580 | Bacteria | 8820 |
| 839 | Ga0501046_0011955 | 3300049580 | Bacteria | 7405 |
| 840 | Ga0501046_0051438 | 3300049580 | Bacteria | 3250 |
| 841 | Ga0501046_0107284 | 3300049580 | Bacteria | 2136 |
| 842 | Ga0501046_0186904 | 3300049580 | Bacteria | 1547 |
| 843 | Ga0501046_0268467 | 3300049580 | Bacteria | 1252 |
| 844 | Ga0501046_0275366 | 3300049580 | Bacteria | 1234 |
| 845 | Ga0501046_1111720 | 3300049580 | Bacteria | 546 |
| 846 | Ga0501047_0002340 | 3300049581 | Bacteria | 18119 |
| 847 | Ga0501047_0010038 | 3300049581 | Bacteria | 8952 |
| 848 | Ga0501047_0011849 | 3300049581 | Bacteria | 8247 |
| 849 | Ga0501047_0016948 | 3300049581 | Bacteria | 6965 |
| 850 | Ga0501047_0025770 | 3300049581 | Bacteria | 5655 |
| 851 | Ga0501047_0027307 | 3300049581 | Bacteria | 5498 |
| 852 | Ga0501047_0065406 | 3300049581 | Bacteria | 3505 |
| 853 | Ga0501047_0088473 | 3300049581 | Bacteria | 2974 |
| 854 | Ga0501047_0117654 | 3300049581 | Bacteria | 2539 |
| 855 | Ga0501047_0186978 | 3300049581 | Bacteria | 1936 |
| 856 | Ga0501047_0255607 | 3300049581 | Bacteria | 1600 |
| 857 | Ga0501047_0266450 | 3300049581 | Bacteria | 1560 |
| 858 | Ga0501047_0271226 | 3300049581 | Bacteria | 1543 |
| 859 | Ga0501047_0431434 | 3300049581 | Unclassified | 1148 |
| 860 | Ga0501047_0447519 | 3300049581 | Bacteria | 1121 |
| 861 | Ga0501047_0478270 | 3300049581 | Unclassified | 1073 |
| 862 | Ga0501047_0615564 | 3300049581 | Bacteria | 907 |
| 863 | Ga0501047_0788681 | 3300049581 | Bacteria | 765 |
| 864 | Ga0501048_0006987 | 3300049582 | Bacteria | 8577 |
| 865 | Ga0501048_0407615 | 3300049582 | Unclassified | 972 |
| 866 | Ga0501048_0484228 | 3300049582 | Bacteria | 887 |
| 867 | Ga0501067_0000729 | 3300049583 | Bacteria | 17689 |
| 868 | Ga0501067_0134834 | 3300049583 | Bacteria | 1374 |
| 869 | Ga0501067_0263193 | 3300049583 | Bacteria | 960 |
| 870 | Ga0501067_0466790 | 3300049583 | Bacteria | 705 |
| 871 | Ga0501068_0148086 | 3300049584 | Unclassified | 1474 |
| 872 | Ga0501069_0039144 | 3300049585 | Bacteria | 2619 |
| 873 | Ga0501069_0180084 | 3300049585 | Bacteria | 1221 |
| 874 | Ga0501069_0267421 | 3300049585 | Bacteria | 999 |
| 875 | Ga0501069_0277495 | 3300049585 | Bacteria | 980 |
| 876 | Ga0501070_0000017 | 3300049586 | Bacteria | 173127 |
| 877 | Ga0501070_0024751 | 3300049586 | Bacteria | 5035 |
| 878 | Ga0501070_0081519 | 3300049586 | Bacteria | 2677 |
| 879 | Ga0501070_0222675 | 3300049586 | Bacteria | 1547 |
| 880 | Ga0501070_0285547 | 3300049586 | Bacteria | 1346 |
| 881 | Ga0501070_0292146 | 3300049586 | Unclassified | 1328 |
| 882 | Ga0501070_0446511 | 3300049586 | Bacteria | 1043 |
| 883 | Ga0501070_1173709 | 3300049586 | Unclassified | 590 |
| 884 | Ga0501071_0175322 | 3300049587 | Bacteria | 1606 |
| 885 | Ga0501071_0418340 | 3300049587 | Unclassified | 1024 |
| 886 | Ga0501072_0002615 | 3300049588 | Bacteria | 13488 |
| 887 | Ga0501072_0058798 | 3300049588 | Bacteria | 3030 |
| 888 | Ga0501073_0006141 | 3300049589 | Bacteria | 8966 |
| 889 | Ga0501073_0035606 | 3300049589 | Bacteria | 3537 |
| 890 | Ga0501073_0071784 | 3300049589 | Bacteria | 2411 |
| 891 | Ga0501073_0085950 | 3300049589 | Bacteria | 2188 |
| 892 | Ga0501073_0202618 | 3300049589 | Bacteria | 1372 |
| 893 | Ga0501073_0326227 | 3300049589 | Bacteria | 1060 |
| 894 | Ga0501073_0330280 | 3300049589 | Bacteria | 1053 |
| 895 | Ga0501073_0364440 | 3300049589 | Bacteria | 998 |
| 896 | Ga0501074_0006832 | 3300049590 | Bacteria | 8245 |
| 897 | Ga0501074_0283717 | 3300049590 | Bacteria | 1177 |
| 898 | Ga0501074_0356514 | 3300049590 | Bacteria | 1038 |
| 899 | Ga0501076_0392279 | 3300049592 | Bacteria | 1141 |
| 900 | Ga0501077_0485166 | 3300049593 | Bacteria | 792 |
| 901 | Ga0501079_0001593 | 3300049741 | Bacteria | 16128 |
| 902 | Ga0501079_0376949 | 3300049741 | Bacteria | 1112 |
| 903 | Ga0501080_0007075 | 3300049742 | Bacteria | 10134 |
| 904 | Ga0501080_0013155 | 3300049742 | Bacteria | 7603 |
| 905 | Ga0501080_0017054 | 3300049742 | Bacteria | 6706 |
| 906 | Ga0501080_0048297 | 3300049742 | Bacteria | 3961 |
| 907 | Ga0501080_0058102 | 3300049742 | Bacteria | 3601 |
| 908 | Ga0501080_0095938 | 3300049742 | Bacteria | 2753 |
| 909 | Ga0501080_0100351 | 3300049742 | Bacteria | 2686 |
| 910 | Ga0501080_0174060 | 3300049742 | Bacteria | 1984 |
| 911 | Ga0501080_0196256 | 3300049742 | Bacteria | 1854 |
| 912 | Ga0501080_0529677 | 3300049742 | Unclassified | 1051 |
| 913 | Ga0501080_1232045 | 3300049742 | Bacteria | 642 |
| 914 | Ga0501081_1149569 | 3300049743 | Bacteria | 588 |
| 915 | Ga0501083_0023338 | 3300049744 | Bacteria | 4291 |
| 916 | Ga0501083_0024773 | 3300049744 | Bacteria | 4156 |
| 917 | Ga0501083_0077501 | 3300049744 | Bacteria | 2206 |
| 918 | Ga0501083_0078000 | 3300049744 | Bacteria | 2198 |
| 919 | Ga0501083_0273322 | 3300049744 | Bacteria | 1099 |
| 920 | Ga0501035_0014379 | 3300049822 | Bacteria | 7306 |
| 921 | Ga0501035_0016715 | 3300049822 | Bacteria | 6764 |
| 922 | Ga0501035_0022936 | 3300049822 | Bacteria | 5730 |
| 923 | Ga0501035_0028207 | 3300049822 | Bacteria | 5124 |
| 924 | Ga0501035_0037918 | 3300049822 | Bacteria | 4363 |
| 925 | Ga0501035_0098978 | 3300049822 | Bacteria | 2560 |
| 926 | Ga0501035_0105807 | 3300049822 | Bacteria | 2467 |
| 927 | Ga0501035_0112035 | 3300049822 | Bacteria | 2390 |
| 928 | Ga0501035_0114126 | 3300049822 | Bacteria | 2366 |
| 929 | Ga0501035_0248775 | 3300049822 | Bacteria | 1510 |
| 930 | Ga0501035_0288201 | 3300049822 | Bacteria | 1386 |
| 931 | Ga0501035_0307956 | 3300049822 | Bacteria | 1333 |
| 932 | Ga0501035_0502871 | 3300049822 | Bacteria | 997 |
| 933 | Ga0501035_0834230 | 3300049822 | Bacteria | 734 |
| 934 | Ga0501044_0001349 | 3300049823 | Bacteria | 28836 |
| 935 | Ga0501044_0004556 | 3300049823 | Bacteria | 15500 |
| 936 | Ga0501044_0012642 | 3300049823 | Bacteria | 9140 |
| 937 | Ga0501044_0013884 | 3300049823 | Bacteria | 8704 |
| 938 | Ga0501044_0016070 | 3300049823 | Bacteria | 8045 |
| 939 | Ga0501044_0020118 | 3300049823 | Bacteria | 7126 |
| 940 | Ga0501044_0021245 | 3300049823 | Bacteria | 6929 |
| 941 | Ga0501044_0069817 | 3300049823 | Bacteria | 3576 |
| 942 | Ga0501044_0071490 | 3300049823 | Bacteria | 3528 |
| 943 | Ga0501044_0075416 | 3300049823 | Bacteria | 3424 |
| 944 | Ga0501044_0084673 | 3300049823 | Bacteria | 3204 |
| 945 | Ga0501044_0123544 | 3300049823 | Bacteria | 2587 |
| 946 | Ga0501044_0178221 | 3300049823 | Bacteria | 2093 |
| 947 | Ga0501044_0289077 | 3300049823 | Bacteria | 1571 |
| 948 | Ga0501044_0289595 | 3300049823 | Bacteria | 1569 |
| 949 | Ga0501044_0471480 | 3300049823 | Bacteria | 1159 |
| 950 | Ga0501044_1375726 | 3300049823 | Bacteria | 571 |
| 951 | Ga0501045_0117027 | 3300049824 | Bacteria | 1978 |
| 952 | nmdc:mga08y16_96655_c1 | 3300050511 | Bacteria | 3076 |
| 953 | nmdc:mga0n895_508654_c1 | 3300050512 | Bacteria | 1213 |
| 954 | nmdc:mga0rr50_41387_c1 | 3300050513 | Bacteria | 2364 |
| 955 | nmdc:mga0rr50_424049_c1 | 3300050513 | Bacteria | 1126 |
| 956 | nmdc:mga08x19_101598_c1 | 3300050514 | Bacteria | 1909 |
| 957 | nmdc:mga08x19_99_c1 | 3300050514 | Bacteria | 76277 |
| 958 | Ga0495601_0000787 | 3300053077 | Bacteria | 17135 |
| 959 | Ga0495612_0001215 | 3300053078 | Bacteria | 10624 |
| 960 | Ga0495595_0001670 | 3300053084 | Bacteria | 8684 |
| 961 | Ga0495595_0138751 | 3300053084 | Bacteria | 1192 |
| 962 | Ga0495619_0000414 | 3300053085 | Bacteria | 29022 |
| 963 | Ga0495619_0101091 | 3300053085 | Bacteria | 1963 |
| 964 | Ga0495619_0853569 | 3300053085 | Unclassified | 614 |
| 965 | Ga0500643_000006 | 3300053087 | Bacteria | 479605 |
| 966 | Ga0500646_0140566 | 3300053090 | Bacteria | 792 |
| 967 | Ga0500566_0286142 | 3300053094 | Bacteria | 783 |
| 968 | Ga0500641_0030149 | 3300053096 | Bacteria | 2129 |
| 969 | Ga0500558_167330 | 3300053106 | Bacteria | 799 |
| 970 | Ga0500593_135782 | 3300053117 | Unclassified | 975 |
| 971 | Ga0500595_013693 | 3300053119 | Bacteria | 3102 |
| 972 | Ga0500595_020325 | 3300053119 | Bacteria | 2392 |
| 973 | Ga0500595_036334 | 3300053119 | Bacteria | 1614 |
| 974 | Ga0500655_004543 | 3300053133 | Bacteria | 2498 |
| 975 | Ga0500655_030114 | 3300053133 | Bacteria | 1043 |
| 976 | Ga0500559_0008077 | 3300053136 | Bacteria | 4630 |
| 977 | Ga0500559_0316253 | 3300053136 | Bacteria | 732 |
| 978 | Ga0500559_0367583 | 3300053136 | Unclassified | 672 |
| 979 | Ga0500568_0048976 | 3300053139 | Bacteria | 1669 |
| 980 | Ga0500573_0000009 | 3300053140 | Bacteria | 230823 |
| 981 | Ga0500577_0083756 | 3300053142 | Bacteria | 1277 |
| 982 | Ga0500590_331774 | 3300053148 | Bacteria | 554 |
| 983 | Ga0500639_133685 | 3300053163 | Bacteria | 1171 |
| 984 | Ga0500645_212142 | 3300053730 | Bacteria | 520 |
| 985 | Ga0501084_0000147 | 3300054114 | Bacteria | 53278 |
| 986 | Ga0501084_0009168 | 3300054114 | Bacteria | 8184 |
| 987 | Ga0501084_0492650 | 3300054114 | Bacteria | 1036 |
| 988 | Ga0501084_1193671 | 3300054114 | Unclassified | 638 |
| 989 | Ga0501082_0008279 | 3300060353 | Bacteria | 8968 |
| 990 | Ga0501082_0131759 | 3300060353 | Bacteria | 2169 |
| 991 | Ga0501082_0357098 | 3300060353 | Bacteria | 1274 |
| 992 | Ga0501082_0388559 | 3300060353 | Bacteria | 1218 |
| 993 | Ga0501082_0391469 | 3300060353 | Bacteria | 1213 |
| 994 | Ga0501082_1141945 | 3300060353 | Bacteria | 681 |
| 995 | 2819721592 | 2818991467 | Bacteria | 5893227 |
| 996 | 2939674245 | 2939669807 | Bacteria | 5028511 |
| 997 | Ga0163163_10292356 | |||
| 998 | JGI24747J21853_1037014 | |||
| 999 | JGI25165J46597_1000047 | |||
| 1000 | JGI25165J46597_1000066 | |||
| 1001 | JGI25153J46596_10003510 | |||
| 1002 | rootH2_10048452 | |||
| 1003 | rootH1_10213236 | |||
| 1004 | Ga0006562J51391_1008604 | |||
| 1005 | Ga0070658_10004407 | |||
| 1006 | Ga0070658_10036793 | |||
| 1007 | Ga0070658_10087273 | |||
| 1008 | Ga0070658_10206018 | |||
| 1009 | Ga0070658_10298341 | |||
| 1010 | Ga0070658_10730507 | |||
| 1011 | Ga0070658_10833509 | |||
| 1012 | Ga0070683_100073837 | |||
| 1013 | Ga0070683_100158491 | |||
| 1014 | Ga0070670_100200910 | |||
| 1015 | Ga0070666_10000186 | |||
| 1016 | Ga0070666_10016173 | |||
| 1017 | Ga0070680_100338169 | |||
| 1018 | Ga0070680_100612609 | |||
| 1019 | Ga0070682_101339295 | |||
| 1020 | Ga0068868_100146063 | |||
| 1021 | Ga0068868_100149671 | |||
| 1022 | Ga0070660_100010072 | |||
| 1023 | Ga0070660_100039636 | |||
| 1024 | Ga0070660_100650468 | |||
| 1025 | Ga0070689_100140372 | |||
| 1026 | Ga0070689_100410635 | |||
| 1027 | Ga0070691_10000233 | |||
| 1028 | Ga0070691_10000745 | |||
| 1029 | Ga0070691_10455750 | |||
| 1030 | Ga0070661_100000165 | |||
| 1031 | Ga0070692_10319679 | |||
| 1032 | Ga0070669_100503195 | |||
| 1033 | Ga0070675_100144883 | |||
| 1034 | Ga0070671_100025930 | |||
| 1035 | Ga0070671_100383808 | |||
| 1036 | Ga0070673_100021993 | |||
| 1037 | Ga0070673_101014556 | |||
| 1038 | Ga0070659_100032854 | |||
| 1039 | Ga0070659_100683006 | |||
| 1040 | Ga0070667_100035730 | |||
| 1041 | Ga0070667_100126325 | |||
| 1042 | Ga0070667_100127747 | |||
| 1043 | Ga0070709_10092958 | |||
| 1044 | Ga0070714_100077745 | |||
| 1045 | Ga0070714_100416058 | |||
| 1046 | Ga0070713_100000002 | |||
| 1047 | Ga0070713_100125509 | |||
| 1048 | Ga0070713_100354936 | |||
| 1049 | Ga0070713_100371466 | |||
| 1050 | Ga0070713_100701889 | |||
| 1051 | Ga0070711_100162649 | |||
| 1052 | Ga0070711_100420447 | |||
| 1053 | Ga0070711_100430453 | |||
| 1054 | Ga0070711_101318116 | |||
| 1055 | Ga0070700_100138904 | |||
| 1056 | Ga0070700_100170110 | |||
| 1057 | Ga0070694_100963828 | |||
| 1058 | Ga0070663_100010410 | |||
| 1059 | Ga0070663_100145180 | |||
| 1060 | Ga0070663_100275941 | |||
| 1061 | Ga0070678_100008084 | |||
| 1062 | Ga0070678_100028781 | |||
| 1063 | Ga0070678_100044373 | |||
| 1064 | Ga0070662_100097136 | |||
| 1065 | Ga0070681_10000014 | |||
| 1066 | Ga0070681_10119942 | |||
| 1067 | Ga0070681_10138798 | |||
| 1068 | Ga0070681_10140087 | |||
| 1069 | Ga0070681_10464866 | |||
| 1070 | Ga0070681_10668315 | |||
| 1071 | Ga0070681_10812933 | |||
| 1072 | Ga0068867_100157813 | |||
| 1073 | Ga0068867_100322589 | |||
| 1074 | Ga0070685_10246756 | |||
| 1075 | Ga0070699_100478448 | |||
| 1076 | Ga0070699_101567409 | |||
| 1077 | Ga0070679_100003975 | |||
| 1078 | Ga0070679_100036559 | |||
| 1079 | Ga0070679_100046782 | |||
| 1080 | Ga0070679_100350510 | |||
| 1081 | Ga0070679_100383967 | |||
| 1082 | Ga0070679_101858376 | |||
| 1083 | Ga0070684_100142656 | |||
| 1084 | Ga0068853_100003994 | |||
| 1085 | Ga0068853_100211317 | |||
| 1086 | Ga0068853_100291717 | |||
| 1087 | Ga0068853_100378984 | |||
| 1088 | Ga0068853_101617218 | |||
| 1089 | Ga0070672_100315352 | |||
| 1090 | Ga0070686_101715881 | |||
| 1091 | Ga0070695_100002111 | |||
| 1092 | Ga0070695_100330101 | |||
| 1093 | Ga0070696_101105250 | |||
| 1094 | Ga0070693_100220095 | |||
| 1095 | Ga0070665_100001530 | |||
| 1096 | Ga0070665_100051864 | |||
| 1097 | Ga0070665_100077890 | |||
| 1098 | Ga0070665_100111159 | |||
| 1099 | Ga0070665_100121214 | |||
| 1100 | Ga0070665_100122251 | |||
| 1101 | Ga0070665_100151100 | |||
| 1102 | Ga0070665_100633014 | |||
| 1103 | Ga0070665_101366927 | |||
| 1104 | Ga0068855_100002193 | |||
| 1105 | Ga0068855_100048766 | |||
| 1106 | Ga0068855_100080088 | |||
| 1107 | Ga0068855_100111048 | |||
| 1108 | Ga0068855_100119698 | |||
| 1109 | Ga0068855_100169874 | |||
| 1110 | Ga0068855_100470750 | |||
| 1111 | Ga0068857_100000488 | |||
| 1112 | Ga0068857_100071060 | |||
| 1113 | Ga0068854_100110573 | |||
| 1114 | Ga0068854_100211766 | |||
| 1115 | Ga0068854_100740836 | |||
| 1116 | Ga0068856_100000312 | |||
| 1117 | Ga0068856_100015005 | |||
| 1118 | Ga0068856_100290201 | |||
| 1119 | Ga0068856_100390075 | |||
| 1120 | Ga0070702_100978006 | |||
| 1121 | Ga0068852_100020713 | |||
| 1122 | Ga0068852_100024329 | |||
| 1123 | Ga0068852_100399302 | |||
| 1124 | Ga0068852_100475000 | |||
| 1125 | Ga0068864_100041460 | |||
| 1126 | Ga0068864_100173795 | |||
| 1127 | Ga0068864_100700039 | |||
| 1128 | Ga0068870_10050663 | |||
| 1129 | Ga0068870_10192425 | |||
| 1130 | Ga0068863_101378720 | |||
| 1131 | Ga0068858_100002481 | |||
| 1132 | Ga0068858_100020836 | |||
| 1133 | Ga0068858_100034722 | |||
| 1134 | Ga0068858_100039125 | |||
| 1135 | Ga0068858_100686734 | |||
| 1136 | Ga0068860_100045955 | |||
| 1137 | Ga0068862_100086116 | |||
| 1138 | Ga0068862_101047302 | |||
| 1139 | Ga0068862_101159582 | |||
| 1140 | Ga0081455_10025361 | |||
| 1141 | Ga0070717_10047683 | |||
| 1142 | Ga0070716_100432140 | |||
| 1143 | Ga0070712_100000045 | |||
| 1144 | Ga0070712_100000272 | |||
| 1145 | Ga0070712_100099290 | |||
| 1146 | Ga0070712_100332087 | |||
| 1147 | Ga0070712_101809077 | |||
| 1148 | Ga0075366_10589639 | |||
| 1149 | Ga0097621_100008952 | |||
| 1150 | Ga0097621_100025748 | |||
| 1151 | Ga0097621_100083442 | |||
| 1152 | Ga0097621_100132495 | |||
| 1153 | Ga0097621_100320017 | |||
| 1154 | Ga0068871_100021718 | |||
| 1155 | Ga0068871_100054046 | |||
| 1156 | Ga0068871_100085337 | |||
| 1157 | Ga0068871_100287114 | |||
| 1158 | Ga0075428_101607414 | |||
| 1159 | Ga0075434_100049585 | |||
| 1160 | Ga0075434_100111155 | |||
| 1161 | Ga0068865_100076460 | |||
| 1162 | Ga0068865_100406511 | |||
| 1163 | Ga0068865_100767937 | |||
| 1164 | Ga0068865_101383753 | |||
| 1165 | Ga0075436_100000098 | |||
| 1166 | Ga0075436_100033900 | |||
| 1167 | Ga0075436_101048453 | |||
| 1168 | Ga0075435_100223570 | |||
| 1169 | Ga0075435_100369560 | |||
| 1170 | Ga0099795_10057315 | |||
| 1171 | Ga0105240_10003190 | |||
| 1172 | Ga0105240_10008350 | |||
| 1173 | Ga0105240_10041567 | |||
| 1174 | Ga0105240_10055978 | |||
| 1175 | Ga0105240_10097765 | |||
| 1176 | Ga0105240_10131371 | |||
| 1177 | Ga0105240_10142623 | |||
| 1178 | Ga0105240_10179371 | |||
| 1179 | Ga0105240_10206041 | |||
| 1180 | Ga0105240_10453700 | |||
| 1181 | Ga0105240_10465984 | |||
| 1182 | Ga0105240_10722596 | |||
| 1183 | Ga0105240_10811292 | |||
| 1184 | Ga0105240_10902905 | |||
| 1185 | Ga0105240_11255268 | |||
| 1186 | Ga0105240_11289482 | |||
| 1187 | Ga0111539_10017891 | |||
| 1188 | Ga0105245_10003180 | |||
| 1189 | Ga0105245_10150733 | |||
| 1190 | Ga0105245_10502347 | |||
| 1191 | Ga0105245_11368090 | |||
| 1192 | Ga0105245_11401351 | |||
| 1193 | Ga0105243_10001197 | |||
| 1194 | Ga0105243_10197578 | |||
| 1195 | Ga0105241_10021411 | |||
| 1196 | Ga0105241_10023341 | |||
| 1197 | Ga0105241_10032104 | |||
| 1198 | Ga0105241_10037543 | |||
| 1199 | Ga0105241_10083024 | |||
| 1200 | Ga0105241_10092007 | |||
| 1201 | Ga0105241_10897980 | |||
| 1202 | Ga0105241_11032134 | |||
| 1203 | Ga0105242_10100872 | |||
| 1204 | Ga0105242_10209808 | |||
| 1205 | Ga0105242_10237858 | |||
| 1206 | Ga0105242_10332987 | |||
| 1207 | Ga0105242_10458515 | |||
| 1208 | Ga0105242_10487470 | |||
| 1209 | Ga0105248_10000001 | |||
| 1210 | Ga0105248_10046527 | |||
| 1211 | Ga0105248_10167437 | |||
| 1212 | Ga0105237_10001328 | |||
| 1213 | Ga0105237_10017408 | |||
| 1214 | Ga0105237_10119270 | |||
| 1215 | Ga0105237_10124628 | |||
| 1216 | Ga0105237_10152508 | |||
| 1217 | Ga0105237_10456066 | |||
| 1218 | Ga0105237_10479450 | |||
| 1219 | Ga0105237_10958028 | |||
| 1220 | Ga0105238_10001442 | |||
| 1221 | Ga0105238_10007214 | |||
| 1222 | Ga0105238_10029405 | |||
| 1223 | Ga0105238_10041074 | |||
| 1224 | Ga0105238_10084835 | |||
| 1225 | Ga0105238_10108063 | |||
| 1226 | Ga0105238_10109825 | |||
| 1227 | Ga0105238_10159880 | |||
| 1228 | Ga0105238_10194969 | |||
| 1229 | Ga0105238_10220135 | |||
| 1230 | Ga0105238_10346649 | |||
| 1231 | Ga0105238_10364576 | |||
| 1232 | Ga0105238_10449216 | |||
| 1233 | Ga0105238_10697084 | |||
| 1234 | Ga0105238_10918751 | |||
| 1235 | Ga0105238_11159832 | |||
| 1236 | Ga0105238_11537992 | |||
| 1237 | Ga0105249_10447220 | |||
| 1238 | Ga0105249_10591650 | |||
| 1239 | Ga0105239_10000733 | |||
| 1240 | Ga0105239_10013335 | |||
| 1241 | Ga0105239_10155260 | |||
| 1242 | Ga0105239_10196315 | |||
| 1243 | Ga0105239_10234079 | |||
| 1244 | Ga0105239_10240178 | |||
| 1245 | Ga0105239_10249633 | |||
| 1246 | Ga0105239_10380124 | |||
| 1247 | Ga0105239_10435526 | |||
| 1248 | Ga0105239_10652841 | |||
| 1249 | Ga0105239_11448524 | |||
| 1250 | Ga0105239_11741428 | |||
| 1251 | Ga0105239_12822588 | |||
| 1252 | Ga0105246_10038893 | |||
| 1253 | Ga0105246_10240577 | |||
| 1254 | Ga0105246_10870075 | |||
| 1255 | Ga0157373_10022768 | |||
| 1256 | Ga0157373_10077361 | |||
| 1257 | Ga0157373_10176511 | |||
| 1258 | Ga0157370_10007427 | |||
| 1259 | Ga0157370_10015393 | |||
| 1260 | Ga0157370_10103482 | |||
| 1261 | Ga0157370_10140928 | |||
| 1262 | Ga0157370_10504837 | |||
| 1263 | Ga0157369_10046281 | |||
| 1264 | Ga0157369_10078713 | |||
| 1265 | Ga0157369_10145336 | |||
| 1266 | Ga0157369_10269239 | |||
| 1267 | Ga0157369_10479685 | |||
| 1268 | Ga0157369_10682016 | |||
| 1269 | Ga0157369_11415477 | |||
| 1270 | Ga0157374_10186664 | |||
| 1271 | Ga0157374_10257347 | |||
| 1272 | Ga0157374_11136986 | |||
| 1273 | Ga0157378_10027790 | |||
| 1274 | Ga0157378_10153330 | |||
| 1275 | Ga0157378_12083891 | |||
| 1276 | Ga0163162_10070776 | |||
| 1277 | Ga0163162_10075656 | |||
| 1278 | Ga0163162_10102916 | |||
| 1279 | Ga0163162_10177304 | |||
| 1280 | Ga0157372_10010958 | |||
| 1281 | Ga0157372_10016824 | |||
| 1282 | Ga0157372_10020242 | |||
| 1283 | Ga0157372_10368401 | |||
| 1284 | Ga0157375_10058531 | |||
| 1285 | Ga0157375_10119739 | |||
| 1286 | Ga0163163_10006118 | |||
| 1287 | Ga0163163_10097247 | |||
| 1288 | Ga0163163_10103553 | |||
| 1289 | Ga0163163_10510237 | |||
| 1290 | Ga0157380_10608657 | |||
| 1291 | Ga0182008_10155742 | |||
| 1292 | Ga0182008_10458552 | |||
| 1293 | Ga0157377_10268231 | |||
| 1294 | Ga0157379_10005723 | |||
| 1295 | Ga0157379_10010207 | |||
| 1296 | Ga0157379_10013038 | |||
| 1297 | Ga0157379_10023301 | |||
| 1298 | Ga0157379_10056367 | |||
| 1299 | Ga0157379_10063538 | |||
| 1300 | Ga0157379_10288473 | |||
| 1301 | Ga0157379_11036755 | |||
| 1302 | Ga0157376_10282182 | |||
| 1303 | Ga0157376_10663790 | |||
| 1304 | Ga0157376_12630317 | |||
| 1305 | Ga0182007_10032517 | |||
| 1306 | Ga0182005_1006445 | |||
| 1307 | Ga0163161_10084162 | |||
| 1308 | Ga0213873_10069974 | |||
| 1309 | Ga0213876_10000388 | |||
| 1310 | Ga0213876_10000483 | |||
| 1311 | Ga0213876_10061775 | |||
| 1312 | Ga0213875_10339657 | |||
| 1313 | Ga0213871_10006451 | |||
| 1314 | Ga0224572_1005619 | |||
| 1315 | Ga0228598_1032500 | |||
| 1316 | Ga0228598_1048399 | |||
| 1317 | Ga0209233_1000045 | |||
| 1318 | Ga0209233_1004631 | |||
| 1319 | Ga0209758_1000008 | |||
| 1320 | Ga0207426_1037572 | |||
| 1321 | Ga0207642_10508668 | |||
| 1322 | Ga0207688_10116409 | |||
| 1323 | Ga0207680_10002065 | |||
| 1324 | Ga0207647_10083618 | |||
| 1325 | Ga0207647_10253713 | |||
| 1326 | Ga0207699_10000133 | |||
| 1327 | Ga0207699_10083145 | |||
| 1328 | Ga0207643_10045800 | |||
| 1329 | Ga0207705_10000058 | |||
| 1330 | Ga0207705_10009572 | |||
| 1331 | Ga0207705_10063229 | |||
| 1332 | Ga0207705_10198421 | |||
| 1333 | Ga0207654_10026187 | |||
| 1334 | Ga0207654_10030302 | |||
| 1335 | Ga0207654_10279994 | |||
| 1336 | Ga0207654_10392884 | |||
| 1337 | Ga0207654_10625563 | |||
| 1338 | Ga0207707_10000001 | |||
| 1339 | Ga0207707_10001851 | |||
| 1340 | Ga0207707_10052643 | |||
| 1341 | Ga0207707_10076001 | |||
| 1342 | Ga0207707_10089456 | |||
| 1343 | Ga0207707_10201843 | |||
| 1344 | Ga0207695_10000004 | |||
| 1345 | Ga0207695_10009649 | |||
| 1346 | Ga0207695_10025972 | |||
| 1347 | Ga0207695_10185467 | |||
| 1348 | Ga0207695_10265172 | |||
| 1349 | Ga0207695_10300514 | |||
| 1350 | Ga0207695_10318130 | |||
| 1351 | Ga0207695_10510702 | |||
| 1352 | Ga0207695_11373346 | |||
| 1353 | Ga0207671_10008524 | |||
| 1354 | Ga0207671_10039659 | |||
| 1355 | Ga0207671_10124152 | |||
| 1356 | Ga0207671_10266508 | |||
| 1357 | Ga0207693_10000035 | |||
| 1358 | Ga0207693_10000145 | |||
| 1359 | Ga0207693_10345818 | |||
| 1360 | Ga0207693_10664415 | |||
| 1361 | Ga0207693_11044357 | |||
| 1362 | Ga0207663_10132565 | |||
| 1363 | Ga0207663_10409148 | |||
| 1364 | Ga0207663_10444347 | |||
| 1365 | Ga0207663_10529375 | |||
| 1366 | Ga0207660_10000343 | |||
| 1367 | Ga0207660_10005636 | |||
| 1368 | Ga0207660_10260396 | |||
| 1369 | Ga0207657_10001163 | |||
| 1370 | Ga0207657_10031643 | |||
| 1371 | Ga0207657_10255897 | |||
| 1372 | Ga0207657_10339033 | |||
| 1373 | Ga0207649_10000713 | |||
| 1374 | Ga0207649_10045683 | |||
| 1375 | Ga0207652_10001515 | |||
| 1376 | Ga0207652_10001611 | |||
| 1377 | Ga0207652_10037141 | |||
| 1378 | Ga0207652_10226186 | |||
| 1379 | Ga0207681_10326529 | |||
| 1380 | Ga0207694_10000010 | |||
| 1381 | Ga0207694_10019979 | |||
| 1382 | Ga0207694_10031229 | |||
| 1383 | Ga0207694_10125538 | |||
| 1384 | Ga0207694_10164227 | |||
| 1385 | Ga0207694_10174989 | |||
| 1386 | Ga0207694_10307457 | |||
| 1387 | Ga0207694_10479462 | |||
| 1388 | Ga0207694_10578392 | |||
| 1389 | Ga0207694_10824958 | |||
| 1390 | Ga0207694_10893792 | |||
| 1391 | Ga0207650_10078032 | |||
| 1392 | Ga0207650_10106481 | |||
| 1393 | Ga0207659_10114725 | |||
| 1394 | Ga0207687_10006441 | |||
| 1395 | Ga0207687_10041918 | |||
| 1396 | Ga0207700_10000887 | |||
| 1397 | Ga0207700_10073149 | |||
| 1398 | Ga0207700_10270732 | |||
| 1399 | Ga0207664_10034382 | |||
| 1400 | Ga0207664_10974179 | |||
| 1401 | Ga0207644_10110370 | |||
| 1402 | Ga0207644_10148518 | |||
| 1403 | Ga0207690_10176985 | |||
| 1404 | Ga0207690_10650126 | |||
| 1405 | Ga0207686_10069968 | |||
| 1406 | Ga0207686_10072192 | |||
| 1407 | Ga0207686_10228583 | |||
| 1408 | Ga0207686_10297675 | |||
| 1409 | Ga0207709_10069009 | |||
| 1410 | Ga0207709_10145616 | |||
| 1411 | Ga0207670_10884461 | |||
| 1412 | Ga0207665_10399728 | |||
| 1413 | Ga0207691_10255183 | |||
| 1414 | Ga0207691_10322190 | |||
| 1415 | Ga0207711_10000001 | |||
| 1416 | Ga0207711_10103045 | |||
| 1417 | Ga0207711_10157015 | |||
| 1418 | Ga0207711_11854189 | |||
| 1419 | Ga0207661_10245798 | |||
| 1420 | Ga0207661_10743783 | |||
| 1421 | Ga0207661_11126067 | |||
| 1422 | Ga0207679_10693291 | |||
| 1423 | Ga0207667_10000116 | |||
| 1424 | Ga0207667_10010486 | |||
| 1425 | Ga0207667_10051617 | |||
| 1426 | Ga0207667_10054170 | |||
| 1427 | Ga0207667_10280258 | |||
| 1428 | Ga0207667_10415966 | |||
| 1429 | Ga0207651_10060661 | |||
| 1430 | Ga0207712_10175517 | |||
| 1431 | Ga0207712_11345309 | |||
| 1432 | Ga0207640_10181371 | |||
| 1433 | Ga0207640_11099119 | |||
| 1434 | Ga0207658_10072101 | |||
| 1435 | Ga0207658_10153914 | |||
| 1436 | Ga0207658_10838691 | |||
| 1437 | Ga0207677_10362415 | |||
| 1438 | Ga0207677_10402358 | |||
| 1439 | Ga0207703_10007826 | |||
| 1440 | Ga0207703_10024046 | |||
| 1441 | Ga0207703_10028607 | |||
| 1442 | Ga0207703_10033739 | |||
| 1443 | Ga0207639_10070415 | |||
| 1444 | Ga0207639_10094996 | |||
| 1445 | Ga0207639_10354036 | |||
| 1446 | Ga0207639_10598537 | |||
| 1447 | Ga0207639_10761296 | |||
| 1448 | Ga0207639_10993129 | |||
| 1449 | Ga0207678_10024654 | |||
| 1450 | Ga0207678_10425809 | |||
| 1451 | Ga0207702_10000007 | |||
| 1452 | Ga0207702_10000012 | |||
| 1453 | Ga0207702_10019910 | |||
| 1454 | Ga0207702_10045111 | |||
| 1455 | Ga0207702_10062926 | |||
| 1456 | Ga0207702_10516094 | |||
| 1457 | Ga0207702_10857662 | |||
| 1458 | Ga0207648_10022114 | |||
| 1459 | Ga0207648_10808173 | |||
| 1460 | Ga0207648_11565818 | |||
| 1461 | Ga0207676_10032252 | |||
| 1462 | Ga0207676_10803188 | |||
| 1463 | Ga0207674_10000107 | |||
| 1464 | Ga0207674_10094261 | |||
| 1465 | Ga0207674_10136288 | |||
| 1466 | Ga0207674_10405724 | |||
| 1467 | Ga0207674_10660046 | |||
| 1468 | Ga0207675_100115394 | |||
| 1469 | Ga0207675_100955280 | |||
| 1470 | Ga0207683_10015302 | |||
| 1471 | Ga0207683_10062021 | |||
| 1472 | Ga0207683_10145708 | |||
| 1473 | Ga0207698_10002022 | |||
| 1474 | Ga0207698_10050270 | |||
| 1475 | Ga0207698_10206682 | |||
| 1476 | Ga0207698_10240572 | |||
| 1477 | Ga0207428_10200811 | |||
| 1478 | Ga0268266_10000357 | |||
| 1479 | Ga0268266_10015674 | |||
| 1480 | Ga0268266_10017377 | |||
| 1481 | Ga0268266_10033283 | |||
| 1482 | Ga0268266_10282334 | |||
| 1483 | Ga0268266_10311014 | |||
| 1484 | Ga0268266_10495887 | |||
| 1485 | Ga0268266_10507701 | |||
| 1486 | Ga0268266_10617939 | |||
| 1487 | Ga0268264_10094282 | |||
| 1488 | Ga0268264_10146423 | |||
| 1489 | Ga0268264_10621808 | |||
| 1490 | Ga0265318_10000082 | |||
| 1491 | Ga0307517_10137249 | |||
| 1492 | Ga0265338_10000006 | |||
| 1493 | Ga0265338_10001374 | |||
| 1494 | Ga0265338_10032945 | |||
| 1495 | Ga0265338_10039132 | |||
| 1496 | Ga0265338_10067710 | |||
| 1497 | Ga0265338_10160012 | |||
| 1498 | Ga0265338_10172698 | |||
| 1499 | Ga0265338_10258806 | |||
| 1500 | Ga0265338_10538297 | |||
| 1501 | Ga0265762_1022919 | |||
| 1502 | Ga0265760_10065112 | |||
| 1503 | Ga0265330_10017766 | |||
| 1504 | Ga0265330_10020152 | |||
| 1505 | Ga0265330_10117172 | |||
| 1506 | Ga0265330_10126415 | |||
| 1507 | Ga0265330_10264748 | |||
| 1508 | Ga0265332_10011438 | |||
| 1509 | Ga0265332_10045629 | |||
| 1510 | Ga0265332_10229408 | |||
| 1511 | Ga0265328_10000123 | |||
| 1512 | Ga0265328_10077249 | |||
| 1513 | Ga0265320_10000039 | |||
| 1514 | Ga0265320_10087964 | |||
| 1515 | Ga0265320_10133739 | |||
| 1516 | Ga0265320_10218157 | |||
| 1517 | Ga0265325_10000007 | |||
| 1518 | Ga0265325_10000079 | |||
| 1519 | Ga0265325_10000719 | |||
| 1520 | Ga0265325_10000967 | |||
| 1521 | Ga0265325_10001558 | |||
| 1522 | Ga0265325_10011992 | |||
| 1523 | Ga0265325_10039095 | |||
| 1524 | Ga0265325_10076961 | |||
| 1525 | Ga0265340_10000096 | |||
| 1526 | Ga0265340_10012732 | |||
| 1527 | Ga0265340_10040690 | |||
| 1528 | Ga0265340_10120477 | |||
| 1529 | Ga0265340_10230810 | |||
| 1530 | Ga0265340_10287215 | |||
| 1531 | Ga0265339_10001422 | |||
| 1532 | Ga0265339_10009647 | |||
| 1533 | Ga0265339_10010793 | |||
| 1534 | Ga0265339_10024789 | |||
| 1535 | Ga0265339_10033205 | |||
| 1536 | Ga0265339_10044716 | |||
| 1537 | Ga0265339_10133225 | |||
| 1538 | Ga0265339_10168870 | |||
| 1539 | Ga0265331_10000009 | |||
| 1540 | Ga0265331_10000026 | |||
| 1541 | Ga0265331_10000212 | |||
| 1542 | Ga0265331_10004939 | |||
| 1543 | Ga0265331_10007849 | |||
| 1544 | Ga0265331_10033930 | |||
| 1545 | Ga0265331_10035419 | |||
| 1546 | Ga0265331_10059058 | |||
| 1547 | Ga0265331_10095890 | |||
| 1548 | Ga0265327_10000007 | |||
| 1549 | Ga0265327_10270709 | |||
| 1550 | Ga0265316_10000936 | |||
| 1551 | Ga0265316_10008650 | |||
| 1552 | Ga0265316_10022243 | |||
| 1553 | Ga0265316_10030437 | |||
| 1554 | Ga0265316_10142806 | |||
| 1555 | Ga0265316_10170606 | |||
| 1556 | Ga0265316_10173197 | |||
| 1557 | Ga0265316_10223662 | |||
| 1558 | Ga0265316_10223981 | |||
| 1559 | Ga0265316_10296269 | |||
| 1560 | Ga0265316_10395879 | |||
| 1561 | Ga0265316_10546327 | |||
| 1562 | Ga0265316_10598323 | |||
| 1563 | Ga0265316_10835927 | |||
| 1564 | Ga0307513_10285806 | |||
| 1565 | Ga0265313_10001902 | |||
| 1566 | Ga0265313_10003138 | |||
| 1567 | Ga0265313_10005466 | |||
| 1568 | Ga0265313_10022563 | |||
| 1569 | Ga0265313_10072246 | |||
| 1570 | Ga0265313_10133665 | |||
| 1571 | Ga0265313_10143935 | |||
| 1572 | Ga0265313_10280843 | |||
| 1573 | Ga0265314_10003096 | |||
| 1574 | Ga0265314_10007438 | |||
| 1575 | Ga0265314_10010041 | |||
| 1576 | Ga0265314_10021019 | |||
| 1577 | Ga0265314_10049633 | |||
| 1578 | Ga0265314_10067096 | |||
| 1579 | Ga0265314_10075023 | |||
| 1580 | Ga0265314_10090308 | |||
| 1581 | Ga0265314_10126574 | |||
| 1582 | Ga0265314_10132386 | |||
| 1583 | Ga0265314_10145242 | |||
| 1584 | Ga0265314_10150855 | |||
| 1585 | Ga0265314_10297721 | |||
| 1586 | Ga0265314_10359740 | |||
| 1587 | Ga0265342_10015572 | |||
| 1588 | Ga0265342_10022757 | |||
| 1589 | Ga0265342_10030960 | |||
| 1590 | Ga0265342_10044100 | |||
| 1591 | Ga0265342_10060617 | |||
| 1592 | Ga0265342_10099607 | |||
| 1593 | Ga0307516_10007154 | |||
| 1594 | Ga0307516_10007941 | |||
| 1595 | Ga0307406_10098051 | |||
| 1596 | Ga0373926_0061795 | |||
| 1597 | Ga0373929_0229211 | |||
| 1598 | Ga0373944_0017334 | |||
| 1599 | Ga0373944_0194262 | |||
| 1600 | Ga0373952_0031461 | |||
| 1601 | Ga0373923_0012135 | |||
| 1602 | Ga0373923_0054576 | |||
| 1603 | Ga0373923_0126678 | |||
| 1604 | Ga0373945_0067629 | |||
| 1605 | Ga0373945_0144424 | |||
| 1606 | Ga0373953_0050352 | |||
| 1607 | Ga0373953_0241486 | |||
| 1608 | Ga0373954_0065479 | |||
| 1609 | Ga0373954_0066270 | |||
| 1610 | Ga0373954_0136386 | |||
| 1611 | Ga0373956_0023081 | |||
| 1612 | Ga0373956_0065371 | |||
| 1613 | Ga0373956_0180208 | |||
| 1614 | Ga0373957_0043071 | |||
| 1615 | Ga0373943_0021651 | |||
| 1616 | Ga0373943_0390685 | |||
| 1617 | Ga0373955_0032059 | |||
| 1618 | Ga0373955_0043618 | |||
| 1619 | Ga0373955_0051751 | |||
| 1620 | Ga0373924_0179037 | |||
| 1621 | Ga0373931_0029941 | |||
| 1622 | Ga0373931_0633688 | |||
| 1623 | Ga0373935_0447515 | |||
| 1624 | Ga0373927_0528139 | |||
| 1625 | Ga0373933_0025178 | |||
| 1626 | Ga0373933_0034446 | |||
| 1627 | Ga0373933_0075443 | |||
| 1628 | Ga0373933_0233500 | |||
| 1629 | Ga0373933_0821321 | |||
| 1630 | Ga0373947_0011553 | |||
| 1631 | Ga0373937_0009750 | |||
| 1632 | Ga0373937_0010384 | |||
| 1633 | Ga0373937_0060950 | |||
| 1634 | Ga0373937_0071295 | |||
| 1635 | Ga0373937_0789074 | |||
| 1636 | Ga0373937_0825298 | |||
| 1637 | Ga0373937_1340931 | |||
| 1638 | Ga0373937_2067487 | |||
| 1639 | Ga0373925_0031160 | |||
| 1640 | Ga0373925_0044126 | |||
| 1641 | Ga0373925_0054428 | |||
| 1642 | Ga0373925_0213161 | |||
| 1643 | Ga0373925_0236591 | |||
| 1644 | Ga0373925_0473851 | |||
| 1645 | Ga0373925_0740031 | |||
| 1646 | Ga0373925_1459805 | |||
| 1647 | Ga0395899_0060219 | |||
| 1648 | Ga0395900_0053179 | |||
| 1649 | Ga0395900_0656383 | |||
| 1650 | Ga0395898_0008535 | |||
| 1651 | Ga0395898_0818680 | |||
| 1652 | Ga0395905_0953991 | |||
| 1653 | Ga0436364_0045683 | |||
| 1654 | Ga0436364_0630355 | |||
| 1655 | Ga0436364_1385246 | |||
| 1656 | Ga0395901_0062777 | |||
| 1657 | Ga0395901_0448753 | |||
| 1658 | Ga0436365_0151405 | |||
| 1659 | Ga0436365_0412683 | |||
| 1660 | Ga0436365_0550500 | |||
| 1661 | Ga0436365_0678770 | |||
| 1662 | Ga0436365_0991473 | |||
| 1663 | Ga0436365_1551085 | |||
| 1664 | Ga0436360_0160041 | |||
| 1665 | Ga0436360_0900296 | |||
| 1666 | Ga0436363_0377217 | |||
| 1667 | Ga0436363_0857110 | |||
| 1668 | Ga0436363_1394367 | |||
| 1669 | Ga0436363_1716475 | |||
| 1670 | Ga0436362_0193065 | |||
| 1671 | Ga0436362_0413829 | |||
| 1672 | Ga0436362_0497344 | |||
| 1673 | Ga0436362_0609469 | |||
| 1674 | Ga0451791_0308433 | |||
| 1675 | Ga0451793_1177649 | |||
| 1676 | Ga0451849_1436860 | |||
| 1677 | Ga0466957_0489198 | |||
| 1678 | Ga0451576_0238219 | |||
| 1679 | Ga0495617_080398 | |||
| 1680 | Ga0495592_0002029 | |||
| 1681 | Ga0495603_0014799 | |||
| 1682 | Ga0495651_0088138 | |||
| 1683 | Ga0495651_0325111 | |||
| 1684 | Ga0495580_0118273 | |||
| 1685 | Ga0495580_0168382 | |||
| 1686 | Ga0495582_0055510 | |||
| 1687 | Ga0495605_0137072 | |||
| 1688 | Ga0495662_0073329 | |||
| 1689 | Ga0495664_0039971 | |||
| 1690 | Ga0495664_0212652 | |||
| 1691 | Ga0495584_0187340 | |||
| 1692 | Ga0495585_0009380 | |||
| 1693 | Ga0495585_0169679 | |||
| 1694 | Ga0495596_0076830 | |||
| 1695 | Ga0495606_0161475 | |||
| 1696 | Ga0495608_0173215 | |||
| 1697 | Ga0495616_0057027 | |||
| 1698 | Ga0495628_0010755 | |||
| 1699 | Ga0495628_0696989 | |||
| 1700 | Ga0495663_0058607 | |||
| 1701 | Ga0495666_0084114 | |||
| 1702 | Ga0495652_0035285 | |||
| 1703 | Ga0495652_0051267 | |||
| 1704 | Ga0495652_0080670 | |||
| 1705 | Ga0495665_0136860 | |||
| 1706 | Ga0495665_0332784 | |||
| 1707 | Ga0495587_0145848 | |||
| 1708 | Ga0495598_0034670 | |||
| 1709 | Ga0495621_0168074 | |||
| 1710 | Ga0495621_0515117 | |||
| 1711 | Ga0495645_0004240 | |||
| 1712 | Ga0495645_0031707 | |||
| 1713 | Ga0495645_0406883 | |||
| 1714 | Ga0495622_0002481 | |||
| 1715 | Ga0495656_0007146 | |||
| 1716 | Ga0495668_0254767 | |||
| 1717 | Ga0495611_0114925 | |||
| 1718 | Ga0495625_0127072 | |||
| 1719 | Ga0495635_0050975 | |||
| 1720 | Ga0495659_0038061 | |||
| 1721 | Ga0495661_0097010 | |||
| 1722 | Ga0495661_0208571 | |||
| 1723 | Ga0495588_0009480 | |||
| 1724 | Ga0495657_0057811 | |||
| 1725 | Ga0495657_0082257 | |||
| 1726 | Ga0495599_0002546 | |||
| 1727 | Ga0495599_0069790 | |||
| 1728 | Ga0495623_0031161 | |||
| 1729 | Ga0495646_0477610 | |||
| 1730 | Ga0495646_0637313 | |||
| 1731 | Ga0495647_0120355 | |||
| 1732 | Ga0495658_0040998 | |||
| 1733 | Ga0495613_0372475 | |||
| 1734 | Ga0495670_0010448 | |||
| 1735 | Ga0495670_0405797 | |||
| 1736 | Ga0495589_0386033 | |||
| 1737 | Ga0495600_0003255 | |||
| 1738 | Ga0495660_0095861 | |||
| 1739 | Ga0495581_0031931 | |||
| 1740 | Ga0495604_0008492 | |||
| 1741 | Ga0495604_0471718 | |||
| 1742 | Ga0495636_0156828 | |||
| 1743 | Ga0495674_0236011 | |||
| 1744 | Ga0495672_0261542 | |||
| 1745 | Ga0495676_0045481 | |||
| 1746 | Ga0495680_0009974 | |||
| 1747 | Ga0495680_0186175 | |||
| 1748 | Ga0495675_0079273 | |||
| 1749 | Ga0495675_0080417 | |||
| 1750 | Ga0495677_0105497 | |||
| 1751 | Ga0495673_0084336 | |||
| 1752 | Ga0495684_0139083 | |||
| 1753 | Ga0495684_0568062 | |||
| 1754 | Ga0495602_0012502 | |||
| 1755 | Ga0495602_0345175 | |||
| 1756 | Ga0496101_0115020 | |||
| 1757 | Ga0496104_0503965 | |||
| 1758 | Ga0496109_0665898 | |||
| 1759 | Ga0496112_0179882 | |||
| 1760 | Ga0496113_0092650 | |||
| 1761 | Ga0496115_0296705 | |||
| 1762 | Ga0496119_0036704 | |||
| 1763 | Ga0496120_0116437 | |||
| 1764 | Ga0496121_0000342 | |||
| 1765 | Ga0496121_0053748 | |||
| 1766 | Ga0496121_0137152 | |||
| 1767 | Ga0496126_0004475 | |||
| 1768 | Ga0496126_0085460 | |||
| 1769 | Ga0495682_0014850 | |||
| 1770 | Ga0501031_0007188 | |||
| 1771 | Ga0501031_0481747 | |||
| 1772 | Ga0501032_0019525 | |||
| 1773 | Ga0501032_0118681 | |||
| 1774 | Ga0501032_0163452 | |||
| 1775 | Ga0501032_0222494 | |||
| 1776 | Ga0501032_0404806 | |||
| 1777 | Ga0501033_0009915 | |||
| 1778 | Ga0501033_0035884 | |||
| 1779 | Ga0501033_0042084 | |||
| 1780 | Ga0501033_0090122 | |||
| 1781 | Ga0501033_0110926 | |||
| 1782 | Ga0501033_0129043 | |||
| 1783 | Ga0501033_0170018 | |||
| 1784 | Ga0501033_0189619 | |||
| 1785 | Ga0501033_0208981 | |||
| 1786 | Ga0501033_0310960 | |||
| 1787 | Ga0501033_0337716 | |||
| 1788 | Ga0501033_0362231 | |||
| 1789 | Ga0501033_0803200 | |||
| 1790 | Ga0501033_0881066 | |||
| 1791 | Ga0501034_0030482 | |||
| 1792 | Ga0501034_0122632 | |||
| 1793 | Ga0501034_0123280 | |||
| 1794 | Ga0501034_0187479 | |||
| 1795 | Ga0501034_0200527 | |||
| 1796 | Ga0501034_0223272 | |||
| 1797 | Ga0501034_0226097 | |||
| 1798 | Ga0501034_0478455 | |||
| 1799 | Ga0501036_0003979 | |||
| 1800 | Ga0501036_0120952 | |||
| 1801 | Ga0501036_0260047 | |||
| 1802 | Ga0501036_0289756 | |||
| 1803 | Ga0501036_0412702 | |||
| 1804 | Ga0501037_0003258 | |||
| 1805 | Ga0501037_0010726 | |||
| 1806 | Ga0501037_0011338 | |||
| 1807 | Ga0501037_0151712 | |||
| 1808 | Ga0501037_0347874 | |||
| 1809 | Ga0501038_0022382 | |||
| 1810 | Ga0501038_0060653 | |||
| 1811 | Ga0501038_0066451 | |||
| 1812 | Ga0501038_0094116 | |||
| 1813 | Ga0501038_0098103 | |||
| 1814 | Ga0501038_0108913 | |||
| 1815 | Ga0501038_0123152 | |||
| 1816 | Ga0501038_0294125 | |||
| 1817 | Ga0501038_0430508 | |||
| 1818 | Ga0501038_0954687 | |||
| 1819 | Ga0501038_0964427 | |||
| 1820 | Ga0501039_0000722 | |||
| 1821 | Ga0501039_0200760 | |||
| 1822 | Ga0501039_1137685 | |||
| 1823 | Ga0501040_0271842 | |||
| 1824 | Ga0501040_0705447 | |||
| 1825 | Ga0501041_0510738 | |||
| 1826 | Ga0501042_0029241 | |||
| 1827 | Ga0501043_0002787 | |||
| 1828 | Ga0501043_0072392 | |||
| 1829 | Ga0501043_0076031 | |||
| 1830 | Ga0501043_0099636 | |||
| 1831 | Ga0501043_0110245 | |||
| 1832 | Ga0501043_0152686 | |||
| 1833 | Ga0501043_0340253 | |||
| 1834 | Ga0501046_0008706 | |||
| 1835 | Ga0501046_0011955 | |||
| 1836 | Ga0501046_0051438 | |||
| 1837 | Ga0501046_0107284 | |||
| 1838 | Ga0501046_0186904 | |||
| 1839 | Ga0501046_0268467 | |||
| 1840 | Ga0501046_0275366 | |||
| 1841 | Ga0501046_1111720 | |||
| 1842 | Ga0501047_0002340 | |||
| 1843 | Ga0501047_0010038 | |||
| 1844 | Ga0501047_0011849 | |||
| 1845 | Ga0501047_0016948 | |||
| 1846 | Ga0501047_0025770 | |||
| 1847 | Ga0501047_0027307 | |||
| 1848 | Ga0501047_0065406 | |||
| 1849 | Ga0501047_0088473 | |||
| 1850 | Ga0501047_0117654 | |||
| 1851 | Ga0501047_0186978 | |||
| 1852 | Ga0501047_0255607 | |||
| 1853 | Ga0501047_0266450 | |||
| 1854 | Ga0501047_0271226 | |||
| 1855 | Ga0501047_0431434 | |||
| 1856 | Ga0501047_0447519 | |||
| 1857 | Ga0501047_0478270 | |||
| 1858 | Ga0501047_0615564 | |||
| 1859 | Ga0501047_0788681 | |||
| 1860 | Ga0501048_0006987 | |||
| 1861 | Ga0501048_0407615 | |||
| 1862 | Ga0501048_0484228 | |||
| 1863 | Ga0501067_0000729 | |||
| 1864 | Ga0501067_0134834 | |||
| 1865 | Ga0501067_0263193 | |||
| 1866 | Ga0501067_0466790 | |||
| 1867 | Ga0501068_0148086 | |||
| 1868 | Ga0501069_0039144 | |||
| 1869 | Ga0501069_0180084 | |||
| 1870 | Ga0501069_0267421 | |||
| 1871 | Ga0501069_0277495 | |||
| 1872 | Ga0501070_0000017 | |||
| 1873 | Ga0501070_0024751 | |||
| 1874 | Ga0501070_0081519 | |||
| 1875 | Ga0501070_0222675 | |||
| 1876 | Ga0501070_0285547 | |||
| 1877 | Ga0501070_0292146 | |||
| 1878 | Ga0501070_0446511 | |||
| 1879 | Ga0501070_1173709 | |||
| 1880 | Ga0501071_0175322 | |||
| 1881 | Ga0501071_0418340 | |||
| 1882 | Ga0501072_0002615 | |||
| 1883 | Ga0501072_0058798 | |||
| 1884 | Ga0501073_0006141 | |||
| 1885 | Ga0501073_0035606 | |||
| 1886 | Ga0501073_0071784 | |||
| 1887 | Ga0501073_0085950 | |||
| 1888 | Ga0501073_0202618 | |||
| 1889 | Ga0501073_0326227 | |||
| 1890 | Ga0501073_0330280 | |||
| 1891 | Ga0501073_0364440 | |||
| 1892 | Ga0501074_0006832 | |||
| 1893 | Ga0501074_0283717 | |||
| 1894 | Ga0501074_0356514 | |||
| 1895 | Ga0501076_0392279 | |||
| 1896 | Ga0501077_0485166 | |||
| 1897 | Ga0501079_0001593 | |||
| 1898 | Ga0501079_0376949 | |||
| 1899 | Ga0501080_0007075 | |||
| 1900 | Ga0501080_0013155 | |||
| 1901 | Ga0501080_0017054 | |||
| 1902 | Ga0501080_0048297 | |||
| 1903 | Ga0501080_0058102 | |||
| 1904 | Ga0501080_0095938 | |||
| 1905 | Ga0501080_0100351 | |||
| 1906 | Ga0501080_0174060 | |||
| 1907 | Ga0501080_0196256 | |||
| 1908 | Ga0501080_0529677 | |||
| 1909 | Ga0501080_1232045 | |||
| 1910 | Ga0501081_1149569 | |||
| 1911 | Ga0501083_0023338 | |||
| 1912 | Ga0501083_0024773 | |||
| 1913 | Ga0501083_0077501 | |||
| 1914 | Ga0501083_0078000 | |||
| 1915 | Ga0501083_0273322 | |||
| 1916 | Ga0501035_0014379 | |||
| 1917 | Ga0501035_0016715 | |||
| 1918 | Ga0501035_0022936 | |||
| 1919 | Ga0501035_0028207 | |||
| 1920 | Ga0501035_0037918 | |||
| 1921 | Ga0501035_0098978 | |||
| 1922 | Ga0501035_0105807 | |||
| 1923 | Ga0501035_0112035 | |||
| 1924 | Ga0501035_0114126 | |||
| 1925 | Ga0501035_0248775 | |||
| 1926 | Ga0501035_0288201 | |||
| 1927 | Ga0501035_0307956 | |||
| 1928 | Ga0501035_0502871 | |||
| 1929 | Ga0501035_0834230 | |||
| 1930 | Ga0501044_0001349 | |||
| 1931 | Ga0501044_0004556 | |||
| 1932 | Ga0501044_0012642 | |||
| 1933 | Ga0501044_0013884 | |||
| 1934 | Ga0501044_0016070 | |||
| 1935 | Ga0501044_0020118 | |||
| 1936 | Ga0501044_0021245 | |||
| 1937 | Ga0501044_0069817 | |||
| 1938 | Ga0501044_0071490 | |||
| 1939 | Ga0501044_0075416 | |||
| 1940 | Ga0501044_0084673 | |||
| 1941 | Ga0501044_0123544 | |||
| 1942 | Ga0501044_0178221 | |||
| 1943 | Ga0501044_0289077 | |||
| 1944 | Ga0501044_0289595 | |||
| 1945 | Ga0501044_0471480 | |||
| 1946 | Ga0501044_1375726 | |||
| 1947 | Ga0501045_0117027 | |||
| 1948 | nmdc:mga08y16_96655_c1 | |||
| 1949 | nmdc:mga0n895_508654_c1 | |||
| 1950 | nmdc:mga0rr50_41387_c1 | |||
| 1951 | nmdc:mga0rr50_424049_c1 | |||
| 1952 | nmdc:mga08x19_101598_c1 | |||
| 1953 | nmdc:mga08x19_99_c1 | |||
| 1954 | Ga0495601_0000787 | |||
| 1955 | Ga0495612_0001215 | |||
| 1956 | Ga0495595_0001670 | |||
| 1957 | Ga0495595_0138751 | |||
| 1958 | Ga0495619_0000414 | |||
| 1959 | Ga0495619_0101091 | |||
| 1960 | Ga0495619_0853569 | |||
| 1961 | Ga0500643_000006 | |||
| 1962 | Ga0500646_0140566 | |||
| 1963 | Ga0500566_0286142 | |||
| 1964 | Ga0500641_0030149 | |||
| 1965 | Ga0500558_167330 | |||
| 1966 | Ga0500593_135782 | |||
| 1967 | Ga0500595_013693 | |||
| 1968 | Ga0500595_020325 | |||
| 1969 | Ga0500595_036334 | |||
| 1970 | Ga0500655_004543 | |||
| 1971 | Ga0500655_030114 | |||
| 1972 | Ga0500559_0008077 | |||
| 1973 | Ga0500559_0316253 | |||
| 1974 | Ga0500559_0367583 | |||
| 1975 | Ga0500568_0048976 | |||
| 1976 | Ga0500573_0000009 | |||
| 1977 | Ga0500577_0083756 | |||
| 1978 | Ga0500590_331774 | |||
| 1979 | Ga0500639_133685 | |||
| 1980 | Ga0500645_212142 | |||
| 1981 | Ga0501084_0000147 | |||
| 1982 | Ga0501084_0009168 | |||
| 1983 | Ga0501084_0492650 | |||
| 1984 | Ga0501084_1193671 | |||
| 1985 | Ga0501082_0008279 | |||
| 1986 | Ga0501082_0131759 | |||
| 1987 | Ga0501082_0357098 | |||
| 1988 | Ga0501082_0388559 | |||
| 1989 | Ga0501082_0391469 | |||
| 1990 | Ga0501082_1141945 | |||
| 1991 | 2819721592 | |||
| 1992 | 2939674245 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1to0-assembly4.cif.gz_G | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.9269 | 1 | 157 |
| 1to0-assembly2.cif.gz_C | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.9221 | 1 | 155 |
| 1to0-assembly3.cif.gz_F | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.921 | 1 | 152 |
| 1to0-assembly4.cif.gz_G | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.921 | 1 | 157 |
| 1to0-assembly2.cif.gz_C | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.9162 | 1 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1to0F00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9222 | 3 | 152 | 3.40.1280.10 |
| af_I1M9Q9_28_183_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9171 | 1 | 159 | 3.40.1280.10 |
| af_I1M9Q9_28_183_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.906 | 1 | 159 | 3.40.1280.10 |
| 1to0F00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8968 | 3 | 152 | 3.40.1280.10 |
| 1o6dA00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.885 | 1 | 155 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3JP34-F1-model_v4 | deleted | 0.9891 | 1 | 160 |
|
| AF-A0A7Y2EG16-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9583 | 1 | 160 |
GO:0005737
GO:0070038 |
| AF-A0A7V2WNM6-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9563 | 1 | 160 |
GO:0005737
GO:0070038 |
| AF-A0A1H8W7Y8-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9541 | 1 | 160 |
GO:0005737
GO:0070038 |
| AF-A0A7C9VJD1-F1-model_v4 | 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH | 0.954 | 21 | 160 |
GO:0006364
GO:0008168 GO:0032259 |