F487774

General Info

Members Datasets Scaffolds Average Seq Length
996 344 1992 159

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10292356|Ga0163163_102923563
Length 176
Sequence MRLHILAVGFGRGTLESPLSEEFLGRAAQLGKRMGFPEVVCEEIAVSKERDVRKRMADEAERLAKRVPAGAHIILLDAKGKGMTSEDFADMLGALRDAGTKDLAFVIGGPDGLAPLPGKRAGRSLAFGPQTWPHLLVRAMLSEQIYRALTILAGHPYHRGWRRRYAQSWGYSGIGD

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
215 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
216 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
331 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
332 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
333 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
337 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
338 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
339 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 2818991467 Bosea vestrisii 3192 Isolate Unclassified
344 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.3
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.81
Nodule 0
Rhizoplane 0.8
Rhizosphere 93.07
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10292356 3300014325 Bacteria 1681
2 JGI24747J21853_1037014 3300001978 Bacteria 571
3 JGI25165J46597_1000047 3300003214 Bacteria 254601
4 JGI25165J46597_1000066 3300003214 Bacteria 199459
5 JGI25153J46596_10003510 3300003215 Bacteria 8751
6 rootH2_10048452 3300003320 Bacteria 17007
7 rootH1_10213236 3300003323 Bacteria 2899
8 Ga0006562J51391_1008604 3300003578 Bacteria 1760
9 Ga0070658_10004407 3300005327 Bacteria 11473
10 Ga0070658_10036793 3300005327 Bacteria 3945
11 Ga0070658_10087273 3300005327 Bacteria 2568
12 Ga0070658_10206018 3300005327 Unclassified 1661
13 Ga0070658_10298341 3300005327 Bacteria 1374
14 Ga0070658_10730507 3300005327 Bacteria 860
15 Ga0070658_10833509 3300005327 Bacteria 801
16 Ga0070683_100073837 3300005329 Bacteria 3184
17 Ga0070683_100158491 3300005329 Bacteria 2147
18 Ga0070670_100200910 3300005331 Bacteria 1732
19 Ga0070666_10000186 3300005335 Bacteria 42661
20 Ga0070666_10016173 3300005335 Bacteria 4769
21 Ga0070680_100338169 3300005336 Unclassified 1279
22 Ga0070680_100612609 3300005336 Unclassified 935
23 Ga0070682_101339295 3300005337 Unclassified 610
24 Ga0068868_100146063 3300005338 Bacteria 1945
25 Ga0068868_100149671 3300005338 Bacteria 1922
26 Ga0070660_100010072 3300005339 Bacteria 6668
27 Ga0070660_100039636 3300005339 Bacteria 3581
28 Ga0070660_100650468 3300005339 Bacteria 883
29 Ga0070689_100140372 3300005340 Bacteria 1943
30 Ga0070689_100410635 3300005340 Bacteria 1146
31 Ga0070691_10000233 3300005341 Bacteria 18941
32 Ga0070691_10000745 3300005341 Bacteria 12815
33 Ga0070691_10455750 3300005341 Bacteria 731
34 Ga0070661_100000165 3300005344 Bacteria 54127
35 Ga0070692_10319679 3300005345 Bacteria 954
36 Ga0070669_100503195 3300005353 Bacteria 1005
37 Ga0070675_100144883 3300005354 Bacteria 2033
38 Ga0070671_100025930 3300005355 Bacteria 4814
39 Ga0070671_100383808 3300005355 Bacteria 1201
40 Ga0070673_100021993 3300005364 Bacteria 4635
41 Ga0070673_101014556 3300005364 Bacteria 773
42 Ga0070659_100032854 3300005366 Bacteria 4029
43 Ga0070659_100683006 3300005366 Unclassified 887
44 Ga0070667_100035730 3300005367 Bacteria 4164
45 Ga0070667_100126325 3300005367 Bacteria 2229
46 Ga0070667_100127747 3300005367 Bacteria 2217
47 Ga0070709_10092958 3300005434 Bacteria 1993
48 Ga0070714_100077745 3300005435 Bacteria 2883
49 Ga0070714_100416058 3300005435 Bacteria 1273
50 Ga0070713_100000002 3300005436 Bacteria 245989
51 Ga0070713_100125509 3300005436 Bacteria 2257
52 Ga0070713_100354936 3300005436 Unclassified 1361
53 Ga0070713_100371466 3300005436 Bacteria 1331
54 Ga0070713_100701889 3300005436 Unclassified 966
55 Ga0070711_100162649 3300005439 Bacteria 1693
56 Ga0070711_100420447 3300005439 Bacteria 1089
57 Ga0070711_100430453 3300005439 Bacteria 1077
58 Ga0070711_101318116 3300005439 Bacteria 627
59 Ga0070700_100138904 3300005441 Bacteria 1649
60 Ga0070700_100170110 3300005441 Bacteria 1508
61 Ga0070694_100963828 3300005444 Bacteria 707
62 Ga0070663_100010410 3300005455 Bacteria 5797
63 Ga0070663_100145180 3300005455 Bacteria 1815
64 Ga0070663_100275941 3300005455 Bacteria 1338
65 Ga0070678_100008084 3300005456 Bacteria 6279
66 Ga0070678_100028781 3300005456 Bacteria 3795
67 Ga0070678_100044373 3300005456 Bacteria 3174
68 Ga0070662_100097136 3300005457 Bacteria 2223
69 Ga0070681_10000014 3300005458 Bacteria 132528
70 Ga0070681_10119942 3300005458 Bacteria 2566
71 Ga0070681_10138798 3300005458 Bacteria 2361
72 Ga0070681_10140087 3300005458 Bacteria 2349
73 Ga0070681_10464866 3300005458 Bacteria 1178
74 Ga0070681_10668315 3300005458 Unclassified 954
75 Ga0070681_10812933 3300005458 Bacteria 852
76 Ga0068867_100157813 3300005459 Bacteria 1787
77 Ga0068867_100322589 3300005459 Bacteria 1280
78 Ga0070685_10246756 3300005466 Bacteria 1181
79 Ga0070699_100478448 3300005518 Bacteria 1130
80 Ga0070699_101567409 3300005518 Bacteria 604
81 Ga0070679_100003975 3300005530 Bacteria 13615
82 Ga0070679_100036559 3300005530 Bacteria 4873
83 Ga0070679_100046782 3300005530 Bacteria 4313
84 Ga0070679_100350510 3300005530 Unclassified 1424
85 Ga0070679_100383967 3300005530 Bacteria 1351
86 Ga0070679_101858376 3300005530 Unclassified 551
87 Ga0070684_100142656 3300005535 Bacteria 2167
88 Ga0068853_100003994 3300005539 Bacteria 11341
89 Ga0068853_100211317 3300005539 Bacteria 1768
90 Ga0068853_100291717 3300005539 Bacteria 1506
91 Ga0068853_100378984 3300005539 Bacteria 1321
92 Ga0068853_101617218 3300005539 Bacteria 628
93 Ga0070672_100315352 3300005543 Bacteria 1328
94 Ga0070686_101715881 3300005544 Bacteria 533
95 Ga0070695_100002111 3300005545 Bacteria 11372
96 Ga0070695_100330101 3300005545 Bacteria 1137
97 Ga0070696_101105250 3300005546 Bacteria 666
98 Ga0070693_100220095 3300005547 Bacteria 1243
99 Ga0070665_100001530 3300005548 Bacteria 26749
100 Ga0070665_100051864 3300005548 Bacteria 4114
101 Ga0070665_100077890 3300005548 Bacteria 3321
102 Ga0070665_100111159 3300005548 Bacteria 2743
103 Ga0070665_100121214 3300005548 Bacteria 2617
104 Ga0070665_100122251 3300005548 Bacteria 2605
105 Ga0070665_100151100 3300005548 Bacteria 2325
106 Ga0070665_100633014 3300005548 Bacteria 1083
107 Ga0070665_101366927 3300005548 Unclassified 717
108 Ga0068855_100002193 3300005563 Bacteria 24145
109 Ga0068855_100048766 3300005563 Bacteria 4997
110 Ga0068855_100080088 3300005563 Bacteria 3787
111 Ga0068855_100111048 3300005563 Bacteria 3147
112 Ga0068855_100119698 3300005563 Bacteria 3014
113 Ga0068855_100169874 3300005563 Bacteria 2470
114 Ga0068855_100470750 3300005563 Bacteria 1369
115 Ga0068857_100000488 3300005577 Bacteria 28351
116 Ga0068857_100071060 3300005577 Bacteria 3101
117 Ga0068854_100110573 3300005578 Bacteria 2072
118 Ga0068854_100211766 3300005578 Bacteria 1529
119 Ga0068854_100740836 3300005578 Bacteria 852
120 Ga0068856_100000312 3300005614 Bacteria 53339
121 Ga0068856_100015005 3300005614 Bacteria 7484
122 Ga0068856_100290201 3300005614 Bacteria 1653
123 Ga0068856_100390075 3300005614 Bacteria 1412
124 Ga0070702_100978006 3300005615 Bacteria 668
125 Ga0068852_100020713 3300005616 Bacteria 5232
126 Ga0068852_100024329 3300005616 Bacteria 4893
127 Ga0068852_100399302 3300005616 Bacteria 1352
128 Ga0068852_100475000 3300005616 Bacteria 1241
129 Ga0068864_100041460 3300005618 Bacteria 3937
130 Ga0068864_100173795 3300005618 Bacteria 1966
131 Ga0068864_100700039 3300005618 Bacteria 990
132 Ga0068870_10050663 3300005840 Bacteria 2195
133 Ga0068870_10192425 3300005840 Bacteria 1232
134 Ga0068863_101378720 3300005841 Bacteria 712
135 Ga0068858_100002481 3300005842 Bacteria 18623
136 Ga0068858_100020836 3300005842 Bacteria 6127
137 Ga0068858_100034722 3300005842 Bacteria 4678
138 Ga0068858_100039125 3300005842 Bacteria 4399
139 Ga0068858_100686734 3300005842 Bacteria 996
140 Ga0068860_100045955 3300005843 Bacteria 4164
141 Ga0068862_100086116 3300005844 Bacteria 2731
142 Ga0068862_101047302 3300005844 Bacteria 809
143 Ga0068862_101159582 3300005844 Bacteria 770
144 Ga0081455_10025361 3300005937 Bacteria 5473
145 Ga0070717_10047683 3300006028 Bacteria 3511
146 Ga0070716_100432140 3300006173 Bacteria 955
147 Ga0070712_100000045 3300006175 Bacteria 66187
148 Ga0070712_100000272 3300006175 Bacteria 29104
149 Ga0070712_100099290 3300006175 Bacteria 2148
150 Ga0070712_100332087 3300006175 Bacteria 1239
151 Ga0070712_101809077 3300006175 Unclassified 535
152 Ga0075366_10589639 3300006195 Bacteria 689
153 Ga0097621_100008952 3300006237 Bacteria 7240
154 Ga0097621_100025748 3300006237 Bacteria 4606
155 Ga0097621_100083442 3300006237 Bacteria 2663
156 Ga0097621_100132495 3300006237 Bacteria 2123
157 Ga0097621_100320017 3300006237 Bacteria 1374
158 Ga0068871_100021718 3300006358 Bacteria 4939
159 Ga0068871_100054046 3300006358 Bacteria 3257
160 Ga0068871_100085337 3300006358 Bacteria 2622
161 Ga0068871_100287114 3300006358 Bacteria 1441
162 Ga0075428_101607414 3300006844 Bacteria 679
163 Ga0075434_100049585 3300006871 Bacteria 4170
164 Ga0075434_100111155 3300006871 Bacteria 2751
165 Ga0068865_100076460 3300006881 Bacteria 2390
166 Ga0068865_100406511 3300006881 Bacteria 1116
167 Ga0068865_100767937 3300006881 Bacteria 829
168 Ga0068865_101383753 3300006881 Bacteria 628
169 Ga0075436_100000098 3300006914 Bacteria 51153
170 Ga0075436_100033900 3300006914 Bacteria 3519
171 Ga0075436_101048453 3300006914 Unclassified 613
172 Ga0075435_100223570 3300007076 Bacteria 1599
173 Ga0075435_100369560 3300007076 Bacteria 1231
174 Ga0099795_10057315 3300007788 Bacteria 1436
175 Ga0105240_10003190 3300009093 Bacteria 25760
176 Ga0105240_10008350 3300009093 Bacteria 14823
177 Ga0105240_10041567 3300009093 Bacteria 5867
178 Ga0105240_10055978 3300009093 Bacteria 4936
179 Ga0105240_10097765 3300009093 Bacteria 3577
180 Ga0105240_10131371 3300009093 Bacteria 3003
181 Ga0105240_10142623 3300009093 Bacteria 2863
182 Ga0105240_10179371 3300009093 Bacteria 2501
183 Ga0105240_10206041 3300009093 Bacteria 2302
184 Ga0105240_10453700 3300009093 Bacteria 1434
185 Ga0105240_10465984 3300009093 Bacteria 1411
186 Ga0105240_10722596 3300009093 Bacteria 1085
187 Ga0105240_10811292 3300009093 Bacteria 1013
188 Ga0105240_10902905 3300009093 Unclassified 950
189 Ga0105240_11255268 3300009093 Bacteria 783
190 Ga0105240_11289482 3300009093 Unclassified 771
191 Ga0111539_10017891 3300009094 Bacteria 8778
192 Ga0105245_10003180 3300009098 Bacteria 14678
193 Ga0105245_10150733 3300009098 Bacteria 2199
194 Ga0105245_10502347 3300009098 Bacteria 1229
195 Ga0105245_11368090 3300009098 Bacteria 758
196 Ga0105245_11401351 3300009098 Unclassified 749
197 Ga0105243_10001197 3300009148 Bacteria 23346
198 Ga0105243_10197578 3300009148 Bacteria 1762
199 Ga0105241_10021411 3300009174 Bacteria 4778
200 Ga0105241_10023341 3300009174 Bacteria 4586
201 Ga0105241_10032104 3300009174 Bacteria 3934
202 Ga0105241_10037543 3300009174 Bacteria 3650
203 Ga0105241_10083024 3300009174 Bacteria 2513
204 Ga0105241_10092007 3300009174 Bacteria 2394
205 Ga0105241_10897980 3300009174 Bacteria 823
206 Ga0105241_11032134 3300009174 Unclassified 771
207 Ga0105242_10100872 3300009176 Bacteria 2446
208 Ga0105242_10209808 3300009176 Bacteria 1735
209 Ga0105242_10237858 3300009176 Bacteria 1636
210 Ga0105242_10332987 3300009176 Bacteria 1396
211 Ga0105242_10458515 3300009176 Bacteria 1203
212 Ga0105242_10487470 3300009176 Bacteria 1170
213 Ga0105248_10000001 3300009177 Bacteria 1881304
214 Ga0105248_10046527 3300009177 Bacteria 4863
215 Ga0105248_10167437 3300009177 Bacteria 2477
216 Ga0105237_10001328 3300009545 Bacteria 32811
217 Ga0105237_10017408 3300009545 Bacteria 7450
218 Ga0105237_10119270 3300009545 Bacteria 2632
219 Ga0105237_10124628 3300009545 Bacteria 2571
220 Ga0105237_10152508 3300009545 Bacteria 2307
221 Ga0105237_10456066 3300009545 Bacteria 1284
222 Ga0105237_10479450 3300009545 Bacteria 1250
223 Ga0105237_10958028 3300009545 Bacteria 863
224 Ga0105238_10001442 3300009551 Bacteria 23898
225 Ga0105238_10007214 3300009551 Bacteria 11124
226 Ga0105238_10029405 3300009551 Bacteria 5597
227 Ga0105238_10041074 3300009551 Bacteria 4686
228 Ga0105238_10084835 3300009551 Bacteria 3156
229 Ga0105238_10108063 3300009551 Bacteria 2763
230 Ga0105238_10109825 3300009551 Bacteria 2739
231 Ga0105238_10159880 3300009551 Bacteria 2228
232 Ga0105238_10194969 3300009551 Bacteria 2001
233 Ga0105238_10220135 3300009551 Unclassified 1874
234 Ga0105238_10346649 3300009551 Bacteria 1474
235 Ga0105238_10364576 3300009551 Bacteria 1435
236 Ga0105238_10449216 3300009551 Bacteria 1286
237 Ga0105238_10697084 3300009551 Bacteria 1027
238 Ga0105238_10918751 3300009551 Bacteria 894
239 Ga0105238_11159832 3300009551 Unclassified 796
240 Ga0105238_11537992 3300009551 Bacteria 694
241 Ga0105249_10447220 3300009553 Bacteria 1330
242 Ga0105249_10591650 3300009553 Bacteria 1163
243 Ga0105239_10000733 3300010375 Bacteria 46597
244 Ga0105239_10013335 3300010375 Bacteria 9132
245 Ga0105239_10155260 3300010375 Bacteria 2556
246 Ga0105239_10196315 3300010375 Bacteria 2260
247 Ga0105239_10234079 3300010375 Bacteria 2061
248 Ga0105239_10240178 3300010375 Bacteria 2033
249 Ga0105239_10249633 3300010375 Bacteria 1993
250 Ga0105239_10380124 3300010375 Bacteria 1596
251 Ga0105239_10435526 3300010375 Bacteria 1486
252 Ga0105239_10652841 3300010375 Bacteria 1202
253 Ga0105239_11448524 3300010375 Bacteria 793
254 Ga0105239_11741428 3300010375 Bacteria 722
255 Ga0105239_12822588 3300010375 Unclassified 567
256 Ga0105246_10038893 3300011119 Bacteria 3201
257 Ga0105246_10240577 3300011119 Bacteria 1430
258 Ga0105246_10870075 3300011119 Bacteria 806
259 Ga0157373_10022768 3300013100 Bacteria 4544
260 Ga0157373_10077361 3300013100 Bacteria 2347
261 Ga0157373_10176511 3300013100 Bacteria 1504
262 Ga0157370_10007427 3300013104 Bacteria 11928
263 Ga0157370_10015393 3300013104 Bacteria 7774
264 Ga0157370_10103482 3300013104 Bacteria 2665
265 Ga0157370_10140928 3300013104 Bacteria 2246
266 Ga0157370_10504837 3300013104 Bacteria 1110
267 Ga0157369_10046281 3300013105 Bacteria 4728
268 Ga0157369_10078713 3300013105 Bacteria 3531
269 Ga0157369_10145336 3300013105 Bacteria 2508
270 Ga0157369_10269239 3300013105 Bacteria 1776
271 Ga0157369_10479685 3300013105 Bacteria 1287
272 Ga0157369_10682016 3300013105 Bacteria 1059
273 Ga0157369_11415477 3300013105 Unclassified 708
274 Ga0157374_10186664 3300013296 Bacteria 2027
275 Ga0157374_10257347 3300013296 Bacteria 1719
276 Ga0157374_11136986 3300013296 Bacteria 802
277 Ga0157378_10027790 3300013297 Bacteria 4990
278 Ga0157378_10153330 3300013297 Bacteria 2148
279 Ga0157378_12083891 3300013297 Unclassified 618
280 Ga0163162_10070776 3300013306 Bacteria 3539
281 Ga0163162_10075656 3300013306 Bacteria 3427
282 Ga0163162_10102916 3300013306 Bacteria 2949
283 Ga0163162_10177304 3300013306 Bacteria 2257
284 Ga0157372_10010958 3300013307 Bacteria 9649
285 Ga0157372_10016824 3300013307 Bacteria 7850
286 Ga0157372_10020242 3300013307 Bacteria 7176
287 Ga0157372_10368401 3300013307 Bacteria 1674
288 Ga0157375_10058531 3300013308 Bacteria 3813
289 Ga0157375_10119739 3300013308 Bacteria 2740
290 Ga0163163_10006118 3300014325 Bacteria 10480
291 Ga0163163_10097247 3300014325 Bacteria 2964
292 Ga0163163_10103553 3300014325 Bacteria 2871
293 Ga0163163_10510237 3300014325 Bacteria 1264
294 Ga0157380_10608657 3300014326 Bacteria 1082
295 Ga0182008_10155742 3300014497 Bacteria 1147
296 Ga0182008_10458552 3300014497 Bacteria 694
297 Ga0157377_10268231 3300014745 Bacteria 1114
298 Ga0157379_10005723 3300014968 Bacteria 10691
299 Ga0157379_10010207 3300014968 Bacteria 8182
300 Ga0157379_10013038 3300014968 Bacteria 7278
301 Ga0157379_10023301 3300014968 Bacteria 5492
302 Ga0157379_10056367 3300014968 Bacteria 3512
303 Ga0157379_10063538 3300014968 Bacteria 3300
304 Ga0157379_10288473 3300014968 Bacteria 1494
305 Ga0157379_11036755 3300014968 Bacteria 783
306 Ga0157376_10282182 3300014969 Bacteria 1565
307 Ga0157376_10663790 3300014969 Bacteria 1044
308 Ga0157376_12630317 3300014969 Bacteria 543
309 Ga0182007_10032517 3300015262 Bacteria 1771
310 Ga0182005_1006445 3300015265 Bacteria 3587
311 Ga0163161_10084162 3300017792 Bacteria 2345
312 Ga0213873_10069974 3300021358 Unclassified 965
313 Ga0213876_10000388 3300021384 Bacteria 36939
314 Ga0213876_10000483 3300021384 Bacteria 31487
315 Ga0213876_10061775 3300021384 Unclassified 1977
316 Ga0213875_10339657 3300021388 Unclassified 713
317 Ga0213871_10006451 3300021441 Bacteria 2481
318 Ga0224572_1005619 3300024225 Bacteria 2242
319 Ga0228598_1032500 3300024227 Bacteria 1028
320 Ga0228598_1048399 3300024227 Bacteria 842
321 Ga0209233_1000045 3300025261 Bacteria 473379
322 Ga0209233_1004631 3300025261 Bacteria 4649
323 Ga0209758_1000008 3300025297 Bacteria 1215263
324 Ga0207426_1037572 3300025302 Bacteria 1530
325 Ga0207642_10508668 3300025899 Bacteria 738
326 Ga0207688_10116409 3300025901 Bacteria 1556
327 Ga0207680_10002065 3300025903 Bacteria 9407
328 Ga0207647_10083618 3300025904 Bacteria 1911
329 Ga0207647_10253713 3300025904 Bacteria 1008
330 Ga0207699_10000133 3300025906 Bacteria 50958
331 Ga0207699_10083145 3300025906 Bacteria 1991
332 Ga0207643_10045800 3300025908 Bacteria 2471
333 Ga0207705_10000058 3300025909 Bacteria 155967
334 Ga0207705_10009572 3300025909 Bacteria 7049
335 Ga0207705_10063229 3300025909 Bacteria 2674
336 Ga0207705_10198421 3300025909 Bacteria 1520
337 Ga0207654_10026187 3300025911 Bacteria 3155
338 Ga0207654_10030302 3300025911 Bacteria 2969
339 Ga0207654_10279994 3300025911 Bacteria 1128
340 Ga0207654_10392884 3300025911 Bacteria 963
341 Ga0207654_10625563 3300025911 Unclassified 769
342 Ga0207707_10000001 3300025912 Bacteria 1212482
343 Ga0207707_10001851 3300025912 Bacteria 19343
344 Ga0207707_10052643 3300025912 Bacteria 3544
345 Ga0207707_10076001 3300025912 Bacteria 2931
346 Ga0207707_10089456 3300025912 Bacteria 2691
347 Ga0207707_10201843 3300025912 Bacteria 1734
348 Ga0207695_10000004 3300025913 Bacteria 1288665
349 Ga0207695_10009649 3300025913 Bacteria 11901
350 Ga0207695_10025972 3300025913 Bacteria 6545
351 Ga0207695_10185467 3300025913 Bacteria 2000
352 Ga0207695_10265172 3300025913 Bacteria 1614
353 Ga0207695_10300514 3300025913 Bacteria 1496
354 Ga0207695_10318130 3300025913 Bacteria 1446
355 Ga0207695_10510702 3300025913 Bacteria 1084
356 Ga0207695_11373346 3300025913 Bacteria 587
357 Ga0207671_10008524 3300025914 Bacteria 8680
358 Ga0207671_10039659 3300025914 Bacteria 3487
359 Ga0207671_10124152 3300025914 Bacteria 1976
360 Ga0207671_10266508 3300025914 Bacteria 1349
361 Ga0207693_10000035 3300025915 Bacteria 110713
362 Ga0207693_10000145 3300025915 Bacteria 65383
363 Ga0207693_10345818 3300025915 Unclassified 1164
364 Ga0207693_10664415 3300025915 Bacteria 809
365 Ga0207693_11044357 3300025915 Unclassified 622
366 Ga0207663_10132565 3300025916 Bacteria 1724
367 Ga0207663_10409148 3300025916 Bacteria 1039
368 Ga0207663_10444347 3300025916 Bacteria 999
369 Ga0207663_10529375 3300025916 Bacteria 919
370 Ga0207660_10000343 3300025917 Bacteria 30105
371 Ga0207660_10005636 3300025917 Bacteria 8130
372 Ga0207660_10260396 3300025917 Unclassified 1371
373 Ga0207657_10001163 3300025919 Bacteria 27950
374 Ga0207657_10031643 3300025919 Bacteria 4788
375 Ga0207657_10255897 3300025919 Bacteria 1394
376 Ga0207657_10339033 3300025919 Bacteria 1187
377 Ga0207649_10000713 3300025920 Bacteria 21869
378 Ga0207649_10045683 3300025920 Bacteria 2686
379 Ga0207652_10001515 3300025921 Bacteria 20513
380 Ga0207652_10001611 3300025921 Bacteria 19837
381 Ga0207652_10037141 3300025921 Bacteria 4122
382 Ga0207652_10226186 3300025921 Bacteria 1686
383 Ga0207681_10326529 3300025923 Bacteria 1222
384 Ga0207694_10000010 3300025924 Bacteria 439722
385 Ga0207694_10019979 3300025924 Bacteria 5067
386 Ga0207694_10031229 3300025924 Bacteria 4067
387 Ga0207694_10125538 3300025924 Bacteria 2052
388 Ga0207694_10164227 3300025924 Bacteria 1795
389 Ga0207694_10174989 3300025924 Bacteria 1739
390 Ga0207694_10307457 3300025924 Bacteria 1306
391 Ga0207694_10479462 3300025924 Bacteria 1040
392 Ga0207694_10578392 3300025924 Bacteria 944
393 Ga0207694_10824958 3300025924 Bacteria 783
394 Ga0207694_10893792 3300025924 Bacteria 751
395 Ga0207650_10078032 3300025925 Bacteria 2505
396 Ga0207650_10106481 3300025925 Bacteria 2166
397 Ga0207659_10114725 3300025926 Bacteria 2054
398 Ga0207687_10006441 3300025927 Bacteria 7754
399 Ga0207687_10041918 3300025927 Bacteria 3146
400 Ga0207700_10000887 3300025928 Bacteria 17225
401 Ga0207700_10073149 3300025928 Bacteria 2646
402 Ga0207700_10270732 3300025928 Bacteria 1458
403 Ga0207664_10034382 3300025929 Bacteria 3904
404 Ga0207664_10974179 3300025929 Bacteria 760
405 Ga0207644_10110370 3300025931 Bacteria 2079
406 Ga0207644_10148518 3300025931 Bacteria 1812
407 Ga0207690_10176985 3300025932 Bacteria 1603
408 Ga0207690_10650126 3300025932 Bacteria 864
409 Ga0207686_10069968 3300025934 Bacteria 2253
410 Ga0207686_10072192 3300025934 Bacteria 2223
411 Ga0207686_10228583 3300025934 Bacteria 1347
412 Ga0207686_10297675 3300025934 Bacteria 1197
413 Ga0207709_10069009 3300025935 Bacteria 2236
414 Ga0207709_10145616 3300025935 Bacteria 1634
415 Ga0207670_10884461 3300025936 Bacteria 747
416 Ga0207665_10399728 3300025939 Bacteria 1046
417 Ga0207691_10255183 3300025940 Bacteria 1513
418 Ga0207691_10322190 3300025940 Bacteria 1325
419 Ga0207711_10000001 3300025941 Bacteria 1325674
420 Ga0207711_10103045 3300025941 Bacteria 2527
421 Ga0207711_10157015 3300025941 Bacteria 2056
422 Ga0207711_11854189 3300025941 Bacteria 546
423 Ga0207661_10245798 3300025944 Bacteria 1589
424 Ga0207661_10743783 3300025944 Unclassified 902
425 Ga0207661_11126067 3300025944 Bacteria 723
426 Ga0207679_10693291 3300025945 Bacteria 924
427 Ga0207667_10000116 3300025949 Bacteria 128218
428 Ga0207667_10010486 3300025949 Bacteria 10832
429 Ga0207667_10051617 3300025949 Bacteria 4334
430 Ga0207667_10054170 3300025949 Bacteria 4219
431 Ga0207667_10280258 3300025949 Bacteria 1703
432 Ga0207667_10415966 3300025949 Bacteria 1368
433 Ga0207651_10060661 3300025960 Bacteria 2627
434 Ga0207712_10175517 3300025961 Bacteria 1679
435 Ga0207712_11345309 3300025961 Unclassified 639
436 Ga0207640_10181371 3300025981 Bacteria 1579
437 Ga0207640_11099119 3300025981 Unclassified 703
438 Ga0207658_10072101 3300025986 Bacteria 2617
439 Ga0207658_10153914 3300025986 Bacteria 1877
440 Ga0207658_10838691 3300025986 Bacteria 835
441 Ga0207677_10362415 3300026023 Unclassified 1218
442 Ga0207677_10402358 3300026023 Bacteria 1161
443 Ga0207703_10007826 3300026035 Bacteria 8451
444 Ga0207703_10024046 3300026035 Bacteria 4794
445 Ga0207703_10028607 3300026035 Bacteria 4395
446 Ga0207703_10033739 3300026035 Bacteria 4060
447 Ga0207639_10070415 3300026041 Bacteria 2732
448 Ga0207639_10094996 3300026041 Bacteria 2395
449 Ga0207639_10354036 3300026041 Bacteria 1312
450 Ga0207639_10598537 3300026041 Bacteria 1016
451 Ga0207639_10761296 3300026041 Bacteria 901
452 Ga0207639_10993129 3300026041 Bacteria 786
453 Ga0207678_10024654 3300026067 Bacteria 5254
454 Ga0207678_10425809 3300026067 Bacteria 1151
455 Ga0207702_10000007 3300026078 Bacteria 332551
456 Ga0207702_10000012 3300026078 Bacteria 269770
457 Ga0207702_10019910 3300026078 Bacteria 5558
458 Ga0207702_10045111 3300026078 Bacteria 3709
459 Ga0207702_10062926 3300026078 Bacteria 3171
460 Ga0207702_10516094 3300026078 Viruses 1166
461 Ga0207702_10857662 3300026078 Unclassified 899
462 Ga0207648_10022114 3300026089 Bacteria 5713
463 Ga0207648_10808173 3300026089 Bacteria 873
464 Ga0207648_11565818 3300026089 Bacteria 619
465 Ga0207676_10032252 3300026095 Bacteria 3946
466 Ga0207676_10803188 3300026095 Bacteria 918
467 Ga0207674_10000107 3300026116 Bacteria 95635
468 Ga0207674_10094261 3300026116 Bacteria 2980
469 Ga0207674_10136288 3300026116 Bacteria 2417
470 Ga0207674_10405724 3300026116 Bacteria 1317
471 Ga0207674_10660046 3300026116 Bacteria 1010
472 Ga0207675_100115394 3300026118 Bacteria 2537
473 Ga0207675_100955280 3300026118 Unclassified 875
474 Ga0207683_10015302 3300026121 Bacteria 6531
475 Ga0207683_10062021 3300026121 Bacteria 3292
476 Ga0207683_10145708 3300026121 Bacteria 2135
477 Ga0207698_10002022 3300026142 Bacteria 11968
478 Ga0207698_10050270 3300026142 Bacteria 3179
479 Ga0207698_10206682 3300026142 Bacteria 1763
480 Ga0207698_10240572 3300026142 Bacteria 1649
481 Ga0207428_10200811 3300027907 Bacteria 1500
482 Ga0268266_10000357 3300028379 Bacteria 70858
483 Ga0268266_10015674 3300028379 Bacteria 6493
484 Ga0268266_10017377 3300028379 Bacteria 6137
485 Ga0268266_10033283 3300028379 Bacteria 4382
486 Ga0268266_10282334 3300028379 Bacteria 1544
487 Ga0268266_10311014 3300028379 Bacteria 1472
488 Ga0268266_10495887 3300028379 Bacteria 1165
489 Ga0268266_10507701 3300028379 Bacteria 1152
490 Ga0268266_10617939 3300028379 Bacteria 1041
491 Ga0268264_10094282 3300028381 Bacteria 2587
492 Ga0268264_10146423 3300028381 Bacteria 2112
493 Ga0268264_10621808 3300028381 Bacteria 1066
494 Ga0265318_10000082 3300028577 Bacteria 85943
495 Ga0307517_10137249 3300028786 Bacteria 1734
496 Ga0265338_10000006 3300028800 Bacteria 570804
497 Ga0265338_10001374 3300028800 Bacteria 39593
498 Ga0265338_10032945 3300028800 Bacteria 5042
499 Ga0265338_10039132 3300028800 Bacteria 4480
500 Ga0265338_10067710 3300028800 Bacteria 3082
501 Ga0265338_10160012 3300028800 Bacteria 1740
502 Ga0265338_10172698 3300028800 Bacteria 1656
503 Ga0265338_10258806 3300028800 Bacteria 1280
504 Ga0265338_10538297 3300028800 Bacteria 819
505 Ga0265762_1022919 3300030760 Bacteria 1156
506 Ga0265760_10065112 3300031090 Bacteria 1112
507 Ga0265330_10017766 3300031235 Bacteria 3273
508 Ga0265330_10020152 3300031235 Bacteria 3049
509 Ga0265330_10117172 3300031235 Bacteria 1136
510 Ga0265330_10126415 3300031235 Bacteria 1088
511 Ga0265330_10264748 3300031235 Bacteria 724
512 Ga0265332_10011438 3300031238 Bacteria 3947
513 Ga0265332_10045629 3300031238 Bacteria 1888
514 Ga0265332_10229408 3300031238 Bacteria 769
515 Ga0265328_10000123 3300031239 Bacteria 37155
516 Ga0265328_10077249 3300031239 Bacteria 1226
517 Ga0265320_10000039 3300031240 Bacteria 134478
518 Ga0265320_10087964 3300031240 Bacteria 1442
519 Ga0265320_10133739 3300031240 Bacteria 1126
520 Ga0265320_10218157 3300031240 Unclassified 850
521 Ga0265325_10000007 3300031241 Bacteria 208874
522 Ga0265325_10000079 3300031241 Bacteria 67833
523 Ga0265325_10000719 3300031241 Bacteria 23911
524 Ga0265325_10000967 3300031241 Bacteria 20649
525 Ga0265325_10001558 3300031241 Bacteria 15979
526 Ga0265325_10011992 3300031241 Bacteria 4966
527 Ga0265325_10039095 3300031241 Bacteria 2500
528 Ga0265325_10076961 3300031241 Bacteria 1664
529 Ga0265340_10000096 3300031247 Bacteria 41553
530 Ga0265340_10012732 3300031247 Bacteria 4441
531 Ga0265340_10040690 3300031247 Bacteria 2288
532 Ga0265340_10120477 3300031247 Bacteria 1207
533 Ga0265340_10230810 3300031247 Unclassified 827
534 Ga0265340_10287215 3300031247 Bacteria 730
535 Ga0265339_10001422 3300031249 Bacteria 17761
536 Ga0265339_10009647 3300031249 Bacteria 6044
537 Ga0265339_10010793 3300031249 Bacteria 5654
538 Ga0265339_10024789 3300031249 Bacteria 3451
539 Ga0265339_10033205 3300031249 Bacteria 2907
540 Ga0265339_10044716 3300031249 Bacteria 2441
541 Ga0265339_10133225 3300031249 Bacteria 1269
542 Ga0265339_10168870 3300031249 Unclassified 1096
543 Ga0265331_10000009 3300031250 Bacteria 314950
544 Ga0265331_10000026 3300031250 Bacteria 223760
545 Ga0265331_10000212 3300031250 Bacteria 70202
546 Ga0265331_10004939 3300031250 Bacteria 8190
547 Ga0265331_10007849 3300031250 Bacteria 6119
548 Ga0265331_10033930 3300031250 Bacteria 2520
549 Ga0265331_10035419 3300031250 Bacteria 2456
550 Ga0265331_10059058 3300031250 Bacteria 1814
551 Ga0265331_10095890 3300031250 Bacteria 1368
552 Ga0265327_10000007 3300031251 Bacteria 678515
553 Ga0265327_10270709 3300031251 Bacteria 752
554 Ga0265316_10000936 3300031344 Bacteria 31773
555 Ga0265316_10008650 3300031344 Bacteria 9424
556 Ga0265316_10022243 3300031344 Bacteria 5353
557 Ga0265316_10030437 3300031344 Bacteria 4424
558 Ga0265316_10142806 3300031344 Bacteria 1797
559 Ga0265316_10170606 3300031344 Bacteria 1623
560 Ga0265316_10173197 3300031344 Bacteria 1609
561 Ga0265316_10223662 3300031344 Bacteria 1388
562 Ga0265316_10223981 3300031344 Bacteria 1387
563 Ga0265316_10296269 3300031344 Bacteria 1179
564 Ga0265316_10395879 3300031344 Bacteria 995
565 Ga0265316_10546327 3300031344 Bacteria 825
566 Ga0265316_10598323 3300031344 Unclassified 782
567 Ga0265316_10835927 3300031344 Bacteria 645
568 Ga0307513_10285806 3300031456 Bacteria 1424
569 Ga0265313_10001902 3300031595 Bacteria 18946
570 Ga0265313_10003138 3300031595 Bacteria 13641
571 Ga0265313_10005466 3300031595 Bacteria 9337
572 Ga0265313_10022563 3300031595 Bacteria 3411
573 Ga0265313_10072246 3300031595 Bacteria 1586
574 Ga0265313_10133665 3300031595 Bacteria 1072
575 Ga0265313_10143935 3300031595 Bacteria 1023
576 Ga0265313_10280843 3300031595 Unclassified 673
577 Ga0265314_10003096 3300031711 Bacteria 16371
578 Ga0265314_10007438 3300031711 Bacteria 9501
579 Ga0265314_10010041 3300031711 Bacteria 7935
580 Ga0265314_10021019 3300031711 Bacteria 5030
581 Ga0265314_10049633 3300031711 Bacteria 2936
582 Ga0265314_10067096 3300031711 Bacteria 2418
583 Ga0265314_10075023 3300031711 Bacteria 2251
584 Ga0265314_10090308 3300031711 Bacteria 1996
585 Ga0265314_10126574 3300031711 Bacteria 1599
586 Ga0265314_10132386 3300031711 Bacteria 1553
587 Ga0265314_10145242 3300031711 Bacteria 1462
588 Ga0265314_10150855 3300031711 Bacteria 1425
589 Ga0265314_10297721 3300031711 Bacteria 906
590 Ga0265314_10359740 3300031711 Bacteria 798
591 Ga0265342_10015572 3300031712 Bacteria 4998
592 Ga0265342_10022757 3300031712 Bacteria 3979
593 Ga0265342_10030960 3300031712 Bacteria 3312
594 Ga0265342_10044100 3300031712 Bacteria 2690
595 Ga0265342_10060617 3300031712 Bacteria 2231
596 Ga0265342_10099607 3300031712 Bacteria 1657
597 Ga0307516_10007154 3300031730 Bacteria 12884
598 Ga0307516_10007941 3300031730 Bacteria 12080
599 Ga0307406_10098051 3300031901 Bacteria 1989
600 Ga0373926_0061795 3300035083 Bacteria 1367
601 Ga0373929_0229211 3300035085 Unclassified 531
602 Ga0373944_0017334 3300035089 Bacteria 2043
603 Ga0373944_0194262 3300035089 Unclassified 733
604 Ga0373952_0031461 3300035092 Bacteria 1180
605 Ga0373923_0012135 3300035111 Bacteria 3177
606 Ga0373923_0054576 3300035111 Bacteria 1682
607 Ga0373923_0126678 3300035111 Bacteria 1145
608 Ga0373945_0067629 3300035116 Bacteria 1345
609 Ga0373945_0144424 3300035116 Bacteria 961
610 Ga0373953_0050352 3300035117 Bacteria 1682
611 Ga0373953_0241486 3300035117 Bacteria 784
612 Ga0373954_0065479 3300035118 Bacteria 1720
613 Ga0373954_0066270 3300035118 Bacteria 1710
614 Ga0373954_0136386 3300035118 Bacteria 1196
615 Ga0373956_0023081 3300035119 Bacteria 2667
616 Ga0373956_0065371 3300035119 Bacteria 1652
617 Ga0373956_0180208 3300035119 Bacteria 999
618 Ga0373957_0043071 3300035120 Bacteria 1705
619 Ga0373943_0021651 3300035170 Bacteria 2970
620 Ga0373943_0390685 3300035170 Bacteria 802
621 Ga0373955_0032059 3300035172 Bacteria 2755
622 Ga0373955_0043618 3300035172 Bacteria 2413
623 Ga0373955_0051751 3300035172 Bacteria 2238
624 Ga0373924_0179037 3300035410 Bacteria 933
625 Ga0373931_0029941 3300035691 Bacteria 2799
626 Ga0373931_0633688 3300035691 Bacteria 701
627 Ga0373935_0447515 3300035692 Bacteria 933
628 Ga0373927_0528139 3300035695 Unclassified 780
629 Ga0373933_0025178 3300035724 Bacteria 3411
630 Ga0373933_0034446 3300035724 Bacteria 2951
631 Ga0373933_0075443 3300035724 Bacteria 2058
632 Ga0373933_0233500 3300035724 Bacteria 1182
633 Ga0373933_0821321 3300035724 Unclassified 612
634 Ga0373947_0011553 3300035725 Bacteria 5064
635 Ga0373937_0009750 3300036401 Bacteria 8372
636 Ga0373937_0010384 3300036401 Bacteria 8132
637 Ga0373937_0060950 3300036401 Bacteria 3468
638 Ga0373937_0071295 3300036401 Bacteria 3204
639 Ga0373937_0789074 3300036401 Bacteria 897
640 Ga0373937_0825298 3300036401 Bacteria 875
641 Ga0373937_1340931 3300036401 Bacteria 663
642 Ga0373937_2067487 3300036401 Unclassified 516
643 Ga0373925_0031160 3300037068 Bacteria 3917
644 Ga0373925_0044126 3300037068 Bacteria 3310
645 Ga0373925_0054428 3300037068 Bacteria 2993
646 Ga0373925_0213161 3300037068 Bacteria 1539
647 Ga0373925_0236591 3300037068 Bacteria 1462
648 Ga0373925_0473851 3300037068 Bacteria 1026
649 Ga0373925_0740031 3300037068 Unclassified 811
650 Ga0373925_1459805 3300037068 Unclassified 560
651 Ga0395899_0060219 3300037312 Bacteria 2797
652 Ga0395900_0053179 3300037418 Bacteria 4168
653 Ga0395900_0656383 3300037418 Bacteria 985
654 Ga0395898_0008535 3300037466 Bacteria 10824
655 Ga0395898_0818680 3300037466 Bacteria 871
656 Ga0395905_0953991 3300037471 Bacteria 761
657 Ga0436364_0045683 3300037853 Bacteria 650
658 Ga0436364_0630355 3300037853 Bacteria 2053
659 Ga0436364_1385246 3300037853 Unclassified 1149
660 Ga0395901_0062777 3300038443 Bacteria 3866
661 Ga0395901_0448753 3300038443 Bacteria 1319
662 Ga0436365_0151405 3300039437 Bacteria 11975
663 Ga0436365_0412683 3300039437 Bacteria 137628
664 Ga0436365_0550500 3300039437 Bacteria 3716
665 Ga0436365_0678770 3300039437 Bacteria 2534
666 Ga0436365_0991473 3300039437 Bacteria 77252
667 Ga0436365_1551085 3300039437 Unclassified 758
668 Ga0436360_0160041 3300039438 Bacteria 6302
669 Ga0436360_0900296 3300039438 Bacteria 1275
670 Ga0436363_0377217 3300039450 Bacteria 921
671 Ga0436363_0857110 3300039450 Bacteria 743
672 Ga0436363_1394367 3300039450 Unclassified 660
673 Ga0436363_1716475 3300039450 Bacteria 12115
674 Ga0436362_0193065 3300039453 Unclassified 1597
675 Ga0436362_0413829 3300039453 Bacteria 1007
676 Ga0436362_0497344 3300039453 Unclassified 504
677 Ga0436362_0609469 3300039453 Bacteria 1351
678 Ga0451791_0308433 3300041451 Unclassified 584
679 Ga0451793_1177649 3300041452 Bacteria 1072
680 Ga0451849_1436860 3300041505 Bacteria 626
681 Ga0466957_0489198 3300044842 Bacteria 852
682 Ga0451576_0238219 3300045051 Bacteria 1901
683 Ga0495617_080398 3300046452 Bacteria 1068
684 Ga0495592_0002029 3300046454 Bacteria 14254
685 Ga0495603_0014799 3300046455 Bacteria 4718
686 Ga0495651_0088138 3300046462 Bacteria 2332
687 Ga0495651_0325111 3300046462 Bacteria 1024
688 Ga0495580_0118273 3300046472 Bacteria 1840
689 Ga0495580_0168382 3300046472 Bacteria 1515
690 Ga0495582_0055510 3300046473 Bacteria 2183
691 Ga0495605_0137072 3300046474 Bacteria 1100
692 Ga0495662_0073329 3300046476 Bacteria 1660
693 Ga0495664_0039971 3300046477 Bacteria 2772
694 Ga0495664_0212652 3300046477 Bacteria 1171
695 Ga0495584_0187340 3300046491 Bacteria 1051
696 Ga0495585_0009380 3300046492 Bacteria 5870
697 Ga0495585_0169679 3300046492 Bacteria 1128
698 Ga0495596_0076830 3300046500 Bacteria 1297
699 Ga0495606_0161475 3300046507 Bacteria 1307
700 Ga0495608_0173215 3300046511 Bacteria 1368
701 Ga0495616_0057027 3300046513 Bacteria 1927
702 Ga0495628_0010755 3300046516 Bacteria 7750
703 Ga0495628_0696989 3300046516 Unclassified 718
704 Ga0495663_0058607 3300046525 Bacteria 1207
705 Ga0495666_0084114 3300046526 Bacteria 1503
706 Ga0495652_0035285 3300046529 Bacteria 4354
707 Ga0495652_0051267 3300046529 Bacteria 3525
708 Ga0495652_0080670 3300046529 Bacteria 2687
709 Ga0495665_0136860 3300046531 Bacteria 1281
710 Ga0495665_0332784 3300046531 Bacteria 775
711 Ga0495587_0145848 3300046536 Bacteria 1350
712 Ga0495598_0034670 3300046537 Bacteria 1440
713 Ga0495621_0168074 3300046539 Bacteria 870
714 Ga0495621_0515117 3300046539 Unclassified 517
715 Ga0495645_0004240 3300046543 Bacteria 9791
716 Ga0495645_0031707 3300046543 Bacteria 3851
717 Ga0495645_0406883 3300046543 Bacteria 866
718 Ga0495622_0002481 3300046557 Bacteria 8925
719 Ga0495656_0007146 3300046615 Bacteria 3940
720 Ga0495668_0254767 3300046616 Bacteria 961
721 Ga0495611_0114925 3300046648 Bacteria 1254
722 Ga0495625_0127072 3300046660 Bacteria 1730
723 Ga0495635_0050975 3300046663 Bacteria 2853
724 Ga0495659_0038061 3300046664 Bacteria 1707
725 Ga0495661_0097010 3300046665 Bacteria 1666
726 Ga0495661_0208571 3300046665 Bacteria 1019
727 Ga0495588_0009480 3300046674 Bacteria 4500
728 Ga0495657_0057811 3300046675 Bacteria 2578
729 Ga0495657_0082257 3300046675 Bacteria 2081
730 Ga0495599_0002546 3300046678 Bacteria 10623
731 Ga0495599_0069790 3300046678 Bacteria 2193
732 Ga0495623_0031161 3300046679 Bacteria 3429
733 Ga0495646_0477610 3300046680 Bacteria 642
734 Ga0495646_0637313 3300046680 Unclassified 539
735 Ga0495647_0120355 3300046681 Bacteria 1104
736 Ga0495658_0040998 3300046683 Bacteria 2576
737 Ga0495613_0372475 3300046689 Bacteria 978
738 Ga0495670_0010448 3300046691 Bacteria 4561
739 Ga0495670_0405797 3300046691 Bacteria 736
740 Ga0495589_0386033 3300046794 Unclassified 643
741 Ga0495600_0003255 3300046809 Bacteria 9512
742 Ga0495660_0095861 3300046810 Bacteria 1534
743 Ga0495581_0031931 3300047315 Bacteria 3051
744 Ga0495604_0008492 3300047317 Bacteria 8108
745 Ga0495604_0471718 3300047317 Unclassified 817
746 Ga0495636_0156828 3300047318 Bacteria 1024
747 Ga0495674_0236011 3300047319 Bacteria 1508
748 Ga0495672_0261542 3300047320 Bacteria 835
749 Ga0495676_0045481 3300047321 Bacteria 3572
750 Ga0495680_0009974 3300047322 Bacteria 8503
751 Ga0495680_0186175 3300047322 Bacteria 1496
752 Ga0495675_0079273 3300047444 Bacteria 2068
753 Ga0495675_0080417 3300047444 Bacteria 2053
754 Ga0495677_0105497 3300047445 Bacteria 1069
755 Ga0495673_0084336 3300047469 Bacteria 1310
756 Ga0495684_0139083 3300047471 Bacteria 1821
757 Ga0495684_0568062 3300047471 Bacteria 770
758 Ga0495602_0012502 3300048088 Bacteria 8718
759 Ga0495602_0345175 3300048088 Bacteria 1076
760 Ga0496101_0115020 3300048904 Bacteria 2029
761 Ga0496104_0503965 3300048907 Unclassified 1122
762 Ga0496109_0665898 3300048912 Unclassified 978
763 Ga0496112_0179882 3300048915 Bacteria 2079
764 Ga0496113_0092650 3300048916 Bacteria 2331
765 Ga0496115_0296705 3300048918 Bacteria 1325
766 Ga0496119_0036704 3300048922 Bacteria 3196
767 Ga0496120_0116437 3300048923 Bacteria 1388
768 Ga0496121_0000342 3300048924 Bacteria 97267
769 Ga0496121_0053748 3300048924 Bacteria 3372
770 Ga0496121_0137152 3300048924 Bacteria 1821
771 Ga0496126_0004475 3300048929 Bacteria 16682
772 Ga0496126_0085460 3300048929 Bacteria 2781
773 Ga0495682_0014850 3300049460 Bacteria 2951
774 Ga0501031_0007188 3300049568 Bacteria 7265
775 Ga0501031_0481747 3300049568 Unclassified 801
776 Ga0501032_0019525 3300049569 Bacteria 4740
777 Ga0501032_0118681 3300049569 Bacteria 1749
778 Ga0501032_0163452 3300049569 Bacteria 1461
779 Ga0501032_0222494 3300049569 Bacteria 1228
780 Ga0501032_0404806 3300049569 Bacteria 876
781 Ga0501033_0009915 3300049570 Bacteria 7315
782 Ga0501033_0035884 3300049570 Bacteria 3716
783 Ga0501033_0042084 3300049570 Bacteria 3406
784 Ga0501033_0090122 3300049570 Bacteria 2243
785 Ga0501033_0110926 3300049570 Bacteria 1996
786 Ga0501033_0129043 3300049570 Bacteria 1832
787 Ga0501033_0170018 3300049570 Bacteria 1566
788 Ga0501033_0189619 3300049570 Bacteria 1471
789 Ga0501033_0208981 3300049570 Bacteria 1392
790 Ga0501033_0310960 3300049570 Bacteria 1108
791 Ga0501033_0337716 3300049570 Unclassified 1056
792 Ga0501033_0362231 3300049570 Bacteria 1014
793 Ga0501033_0803200 3300049570 Bacteria 636
794 Ga0501033_0881066 3300049570 Bacteria 602
795 Ga0501034_0030482 3300049571 Bacteria 5483
796 Ga0501034_0122632 3300049571 Bacteria 2585
797 Ga0501034_0123280 3300049571 Bacteria 2577
798 Ga0501034_0187479 3300049571 Bacteria 2031
799 Ga0501034_0200527 3300049571 Bacteria 1954
800 Ga0501034_0223272 3300049571 Bacteria 1836
801 Ga0501034_0226097 3300049571 Bacteria 1822
802 Ga0501034_0478455 3300049571 Bacteria 1161
803 Ga0501036_0003979 3300049572 Bacteria 11875
804 Ga0501036_0120952 3300049572 Bacteria 2211
805 Ga0501036_0260047 3300049572 Bacteria 1454
806 Ga0501036_0289756 3300049572 Bacteria 1370
807 Ga0501036_0412702 3300049572 Bacteria 1126
808 Ga0501037_0003258 3300049573 Bacteria 11780
809 Ga0501037_0010726 3300049573 Bacteria 6734
810 Ga0501037_0011338 3300049573 Bacteria 6562
811 Ga0501037_0151712 3300049573 Bacteria 1656
812 Ga0501037_0347874 3300049573 Bacteria 1023
813 Ga0501038_0022382 3300049574 Bacteria 5665
814 Ga0501038_0060653 3300049574 Bacteria 3237
815 Ga0501038_0066451 3300049574 Bacteria 3071
816 Ga0501038_0094116 3300049574 Bacteria 2505
817 Ga0501038_0098103 3300049574 Bacteria 2443
818 Ga0501038_0108913 3300049574 Bacteria 2296
819 Ga0501038_0123152 3300049574 Bacteria 2136
820 Ga0501038_0294125 3300049574 Unclassified 1275
821 Ga0501038_0430508 3300049574 Bacteria 1017
822 Ga0501038_0954687 3300049574 Bacteria 631
823 Ga0501038_0964427 3300049574 Bacteria 627
824 Ga0501039_0000722 3300049575 Bacteria 23835
825 Ga0501039_0200760 3300049575 Bacteria 1568
826 Ga0501039_1137685 3300049575 Bacteria 604
827 Ga0501040_0271842 3300049576 Bacteria 1210
828 Ga0501040_0705447 3300049576 Bacteria 730
829 Ga0501041_0510738 3300049577 Bacteria 765
830 Ga0501042_0029241 3300049578 Bacteria 3886
831 Ga0501043_0002787 3300049579 Bacteria 14605
832 Ga0501043_0072392 3300049579 Bacteria 2707
833 Ga0501043_0076031 3300049579 Bacteria 2638
834 Ga0501043_0099636 3300049579 Bacteria 2284
835 Ga0501043_0110245 3300049579 Bacteria 2161
836 Ga0501043_0152686 3300049579 Bacteria 1807
837 Ga0501043_0340253 3300049579 Bacteria 1141
838 Ga0501046_0008706 3300049580 Bacteria 8820
839 Ga0501046_0011955 3300049580 Bacteria 7405
840 Ga0501046_0051438 3300049580 Bacteria 3250
841 Ga0501046_0107284 3300049580 Bacteria 2136
842 Ga0501046_0186904 3300049580 Bacteria 1547
843 Ga0501046_0268467 3300049580 Bacteria 1252
844 Ga0501046_0275366 3300049580 Bacteria 1234
845 Ga0501046_1111720 3300049580 Bacteria 546
846 Ga0501047_0002340 3300049581 Bacteria 18119
847 Ga0501047_0010038 3300049581 Bacteria 8952
848 Ga0501047_0011849 3300049581 Bacteria 8247
849 Ga0501047_0016948 3300049581 Bacteria 6965
850 Ga0501047_0025770 3300049581 Bacteria 5655
851 Ga0501047_0027307 3300049581 Bacteria 5498
852 Ga0501047_0065406 3300049581 Bacteria 3505
853 Ga0501047_0088473 3300049581 Bacteria 2974
854 Ga0501047_0117654 3300049581 Bacteria 2539
855 Ga0501047_0186978 3300049581 Bacteria 1936
856 Ga0501047_0255607 3300049581 Bacteria 1600
857 Ga0501047_0266450 3300049581 Bacteria 1560
858 Ga0501047_0271226 3300049581 Bacteria 1543
859 Ga0501047_0431434 3300049581 Unclassified 1148
860 Ga0501047_0447519 3300049581 Bacteria 1121
861 Ga0501047_0478270 3300049581 Unclassified 1073
862 Ga0501047_0615564 3300049581 Bacteria 907
863 Ga0501047_0788681 3300049581 Bacteria 765
864 Ga0501048_0006987 3300049582 Bacteria 8577
865 Ga0501048_0407615 3300049582 Unclassified 972
866 Ga0501048_0484228 3300049582 Bacteria 887
867 Ga0501067_0000729 3300049583 Bacteria 17689
868 Ga0501067_0134834 3300049583 Bacteria 1374
869 Ga0501067_0263193 3300049583 Bacteria 960
870 Ga0501067_0466790 3300049583 Bacteria 705
871 Ga0501068_0148086 3300049584 Unclassified 1474
872 Ga0501069_0039144 3300049585 Bacteria 2619
873 Ga0501069_0180084 3300049585 Bacteria 1221
874 Ga0501069_0267421 3300049585 Bacteria 999
875 Ga0501069_0277495 3300049585 Bacteria 980
876 Ga0501070_0000017 3300049586 Bacteria 173127
877 Ga0501070_0024751 3300049586 Bacteria 5035
878 Ga0501070_0081519 3300049586 Bacteria 2677
879 Ga0501070_0222675 3300049586 Bacteria 1547
880 Ga0501070_0285547 3300049586 Bacteria 1346
881 Ga0501070_0292146 3300049586 Unclassified 1328
882 Ga0501070_0446511 3300049586 Bacteria 1043
883 Ga0501070_1173709 3300049586 Unclassified 590
884 Ga0501071_0175322 3300049587 Bacteria 1606
885 Ga0501071_0418340 3300049587 Unclassified 1024
886 Ga0501072_0002615 3300049588 Bacteria 13488
887 Ga0501072_0058798 3300049588 Bacteria 3030
888 Ga0501073_0006141 3300049589 Bacteria 8966
889 Ga0501073_0035606 3300049589 Bacteria 3537
890 Ga0501073_0071784 3300049589 Bacteria 2411
891 Ga0501073_0085950 3300049589 Bacteria 2188
892 Ga0501073_0202618 3300049589 Bacteria 1372
893 Ga0501073_0326227 3300049589 Bacteria 1060
894 Ga0501073_0330280 3300049589 Bacteria 1053
895 Ga0501073_0364440 3300049589 Bacteria 998
896 Ga0501074_0006832 3300049590 Bacteria 8245
897 Ga0501074_0283717 3300049590 Bacteria 1177
898 Ga0501074_0356514 3300049590 Bacteria 1038
899 Ga0501076_0392279 3300049592 Bacteria 1141
900 Ga0501077_0485166 3300049593 Bacteria 792
901 Ga0501079_0001593 3300049741 Bacteria 16128
902 Ga0501079_0376949 3300049741 Bacteria 1112
903 Ga0501080_0007075 3300049742 Bacteria 10134
904 Ga0501080_0013155 3300049742 Bacteria 7603
905 Ga0501080_0017054 3300049742 Bacteria 6706
906 Ga0501080_0048297 3300049742 Bacteria 3961
907 Ga0501080_0058102 3300049742 Bacteria 3601
908 Ga0501080_0095938 3300049742 Bacteria 2753
909 Ga0501080_0100351 3300049742 Bacteria 2686
910 Ga0501080_0174060 3300049742 Bacteria 1984
911 Ga0501080_0196256 3300049742 Bacteria 1854
912 Ga0501080_0529677 3300049742 Unclassified 1051
913 Ga0501080_1232045 3300049742 Bacteria 642
914 Ga0501081_1149569 3300049743 Bacteria 588
915 Ga0501083_0023338 3300049744 Bacteria 4291
916 Ga0501083_0024773 3300049744 Bacteria 4156
917 Ga0501083_0077501 3300049744 Bacteria 2206
918 Ga0501083_0078000 3300049744 Bacteria 2198
919 Ga0501083_0273322 3300049744 Bacteria 1099
920 Ga0501035_0014379 3300049822 Bacteria 7306
921 Ga0501035_0016715 3300049822 Bacteria 6764
922 Ga0501035_0022936 3300049822 Bacteria 5730
923 Ga0501035_0028207 3300049822 Bacteria 5124
924 Ga0501035_0037918 3300049822 Bacteria 4363
925 Ga0501035_0098978 3300049822 Bacteria 2560
926 Ga0501035_0105807 3300049822 Bacteria 2467
927 Ga0501035_0112035 3300049822 Bacteria 2390
928 Ga0501035_0114126 3300049822 Bacteria 2366
929 Ga0501035_0248775 3300049822 Bacteria 1510
930 Ga0501035_0288201 3300049822 Bacteria 1386
931 Ga0501035_0307956 3300049822 Bacteria 1333
932 Ga0501035_0502871 3300049822 Bacteria 997
933 Ga0501035_0834230 3300049822 Bacteria 734
934 Ga0501044_0001349 3300049823 Bacteria 28836
935 Ga0501044_0004556 3300049823 Bacteria 15500
936 Ga0501044_0012642 3300049823 Bacteria 9140
937 Ga0501044_0013884 3300049823 Bacteria 8704
938 Ga0501044_0016070 3300049823 Bacteria 8045
939 Ga0501044_0020118 3300049823 Bacteria 7126
940 Ga0501044_0021245 3300049823 Bacteria 6929
941 Ga0501044_0069817 3300049823 Bacteria 3576
942 Ga0501044_0071490 3300049823 Bacteria 3528
943 Ga0501044_0075416 3300049823 Bacteria 3424
944 Ga0501044_0084673 3300049823 Bacteria 3204
945 Ga0501044_0123544 3300049823 Bacteria 2587
946 Ga0501044_0178221 3300049823 Bacteria 2093
947 Ga0501044_0289077 3300049823 Bacteria 1571
948 Ga0501044_0289595 3300049823 Bacteria 1569
949 Ga0501044_0471480 3300049823 Bacteria 1159
950 Ga0501044_1375726 3300049823 Bacteria 571
951 Ga0501045_0117027 3300049824 Bacteria 1978
952 nmdc:mga08y16_96655_c1 3300050511 Bacteria 3076
953 nmdc:mga0n895_508654_c1 3300050512 Bacteria 1213
954 nmdc:mga0rr50_41387_c1 3300050513 Bacteria 2364
955 nmdc:mga0rr50_424049_c1 3300050513 Bacteria 1126
956 nmdc:mga08x19_101598_c1 3300050514 Bacteria 1909
957 nmdc:mga08x19_99_c1 3300050514 Bacteria 76277
958 Ga0495601_0000787 3300053077 Bacteria 17135
959 Ga0495612_0001215 3300053078 Bacteria 10624
960 Ga0495595_0001670 3300053084 Bacteria 8684
961 Ga0495595_0138751 3300053084 Bacteria 1192
962 Ga0495619_0000414 3300053085 Bacteria 29022
963 Ga0495619_0101091 3300053085 Bacteria 1963
964 Ga0495619_0853569 3300053085 Unclassified 614
965 Ga0500643_000006 3300053087 Bacteria 479605
966 Ga0500646_0140566 3300053090 Bacteria 792
967 Ga0500566_0286142 3300053094 Bacteria 783
968 Ga0500641_0030149 3300053096 Bacteria 2129
969 Ga0500558_167330 3300053106 Bacteria 799
970 Ga0500593_135782 3300053117 Unclassified 975
971 Ga0500595_013693 3300053119 Bacteria 3102
972 Ga0500595_020325 3300053119 Bacteria 2392
973 Ga0500595_036334 3300053119 Bacteria 1614
974 Ga0500655_004543 3300053133 Bacteria 2498
975 Ga0500655_030114 3300053133 Bacteria 1043
976 Ga0500559_0008077 3300053136 Bacteria 4630
977 Ga0500559_0316253 3300053136 Bacteria 732
978 Ga0500559_0367583 3300053136 Unclassified 672
979 Ga0500568_0048976 3300053139 Bacteria 1669
980 Ga0500573_0000009 3300053140 Bacteria 230823
981 Ga0500577_0083756 3300053142 Bacteria 1277
982 Ga0500590_331774 3300053148 Bacteria 554
983 Ga0500639_133685 3300053163 Bacteria 1171
984 Ga0500645_212142 3300053730 Bacteria 520
985 Ga0501084_0000147 3300054114 Bacteria 53278
986 Ga0501084_0009168 3300054114 Bacteria 8184
987 Ga0501084_0492650 3300054114 Bacteria 1036
988 Ga0501084_1193671 3300054114 Unclassified 638
989 Ga0501082_0008279 3300060353 Bacteria 8968
990 Ga0501082_0131759 3300060353 Bacteria 2169
991 Ga0501082_0357098 3300060353 Bacteria 1274
992 Ga0501082_0388559 3300060353 Bacteria 1218
993 Ga0501082_0391469 3300060353 Bacteria 1213
994 Ga0501082_1141945 3300060353 Bacteria 681
995 2819721592 2818991467 Bacteria 5893227
996 2939674245 2939669807 Bacteria 5028511
997 Ga0163163_10292356
998 JGI24747J21853_1037014
999 JGI25165J46597_1000047
1000 JGI25165J46597_1000066
1001 JGI25153J46596_10003510
1002 rootH2_10048452
1003 rootH1_10213236
1004 Ga0006562J51391_1008604
1005 Ga0070658_10004407
1006 Ga0070658_10036793
1007 Ga0070658_10087273
1008 Ga0070658_10206018
1009 Ga0070658_10298341
1010 Ga0070658_10730507
1011 Ga0070658_10833509
1012 Ga0070683_100073837
1013 Ga0070683_100158491
1014 Ga0070670_100200910
1015 Ga0070666_10000186
1016 Ga0070666_10016173
1017 Ga0070680_100338169
1018 Ga0070680_100612609
1019 Ga0070682_101339295
1020 Ga0068868_100146063
1021 Ga0068868_100149671
1022 Ga0070660_100010072
1023 Ga0070660_100039636
1024 Ga0070660_100650468
1025 Ga0070689_100140372
1026 Ga0070689_100410635
1027 Ga0070691_10000233
1028 Ga0070691_10000745
1029 Ga0070691_10455750
1030 Ga0070661_100000165
1031 Ga0070692_10319679
1032 Ga0070669_100503195
1033 Ga0070675_100144883
1034 Ga0070671_100025930
1035 Ga0070671_100383808
1036 Ga0070673_100021993
1037 Ga0070673_101014556
1038 Ga0070659_100032854
1039 Ga0070659_100683006
1040 Ga0070667_100035730
1041 Ga0070667_100126325
1042 Ga0070667_100127747
1043 Ga0070709_10092958
1044 Ga0070714_100077745
1045 Ga0070714_100416058
1046 Ga0070713_100000002
1047 Ga0070713_100125509
1048 Ga0070713_100354936
1049 Ga0070713_100371466
1050 Ga0070713_100701889
1051 Ga0070711_100162649
1052 Ga0070711_100420447
1053 Ga0070711_100430453
1054 Ga0070711_101318116
1055 Ga0070700_100138904
1056 Ga0070700_100170110
1057 Ga0070694_100963828
1058 Ga0070663_100010410
1059 Ga0070663_100145180
1060 Ga0070663_100275941
1061 Ga0070678_100008084
1062 Ga0070678_100028781
1063 Ga0070678_100044373
1064 Ga0070662_100097136
1065 Ga0070681_10000014
1066 Ga0070681_10119942
1067 Ga0070681_10138798
1068 Ga0070681_10140087
1069 Ga0070681_10464866
1070 Ga0070681_10668315
1071 Ga0070681_10812933
1072 Ga0068867_100157813
1073 Ga0068867_100322589
1074 Ga0070685_10246756
1075 Ga0070699_100478448
1076 Ga0070699_101567409
1077 Ga0070679_100003975
1078 Ga0070679_100036559
1079 Ga0070679_100046782
1080 Ga0070679_100350510
1081 Ga0070679_100383967
1082 Ga0070679_101858376
1083 Ga0070684_100142656
1084 Ga0068853_100003994
1085 Ga0068853_100211317
1086 Ga0068853_100291717
1087 Ga0068853_100378984
1088 Ga0068853_101617218
1089 Ga0070672_100315352
1090 Ga0070686_101715881
1091 Ga0070695_100002111
1092 Ga0070695_100330101
1093 Ga0070696_101105250
1094 Ga0070693_100220095
1095 Ga0070665_100001530
1096 Ga0070665_100051864
1097 Ga0070665_100077890
1098 Ga0070665_100111159
1099 Ga0070665_100121214
1100 Ga0070665_100122251
1101 Ga0070665_100151100
1102 Ga0070665_100633014
1103 Ga0070665_101366927
1104 Ga0068855_100002193
1105 Ga0068855_100048766
1106 Ga0068855_100080088
1107 Ga0068855_100111048
1108 Ga0068855_100119698
1109 Ga0068855_100169874
1110 Ga0068855_100470750
1111 Ga0068857_100000488
1112 Ga0068857_100071060
1113 Ga0068854_100110573
1114 Ga0068854_100211766
1115 Ga0068854_100740836
1116 Ga0068856_100000312
1117 Ga0068856_100015005
1118 Ga0068856_100290201
1119 Ga0068856_100390075
1120 Ga0070702_100978006
1121 Ga0068852_100020713
1122 Ga0068852_100024329
1123 Ga0068852_100399302
1124 Ga0068852_100475000
1125 Ga0068864_100041460
1126 Ga0068864_100173795
1127 Ga0068864_100700039
1128 Ga0068870_10050663
1129 Ga0068870_10192425
1130 Ga0068863_101378720
1131 Ga0068858_100002481
1132 Ga0068858_100020836
1133 Ga0068858_100034722
1134 Ga0068858_100039125
1135 Ga0068858_100686734
1136 Ga0068860_100045955
1137 Ga0068862_100086116
1138 Ga0068862_101047302
1139 Ga0068862_101159582
1140 Ga0081455_10025361
1141 Ga0070717_10047683
1142 Ga0070716_100432140
1143 Ga0070712_100000045
1144 Ga0070712_100000272
1145 Ga0070712_100099290
1146 Ga0070712_100332087
1147 Ga0070712_101809077
1148 Ga0075366_10589639
1149 Ga0097621_100008952
1150 Ga0097621_100025748
1151 Ga0097621_100083442
1152 Ga0097621_100132495
1153 Ga0097621_100320017
1154 Ga0068871_100021718
1155 Ga0068871_100054046
1156 Ga0068871_100085337
1157 Ga0068871_100287114
1158 Ga0075428_101607414
1159 Ga0075434_100049585
1160 Ga0075434_100111155
1161 Ga0068865_100076460
1162 Ga0068865_100406511
1163 Ga0068865_100767937
1164 Ga0068865_101383753
1165 Ga0075436_100000098
1166 Ga0075436_100033900
1167 Ga0075436_101048453
1168 Ga0075435_100223570
1169 Ga0075435_100369560
1170 Ga0099795_10057315
1171 Ga0105240_10003190
1172 Ga0105240_10008350
1173 Ga0105240_10041567
1174 Ga0105240_10055978
1175 Ga0105240_10097765
1176 Ga0105240_10131371
1177 Ga0105240_10142623
1178 Ga0105240_10179371
1179 Ga0105240_10206041
1180 Ga0105240_10453700
1181 Ga0105240_10465984
1182 Ga0105240_10722596
1183 Ga0105240_10811292
1184 Ga0105240_10902905
1185 Ga0105240_11255268
1186 Ga0105240_11289482
1187 Ga0111539_10017891
1188 Ga0105245_10003180
1189 Ga0105245_10150733
1190 Ga0105245_10502347
1191 Ga0105245_11368090
1192 Ga0105245_11401351
1193 Ga0105243_10001197
1194 Ga0105243_10197578
1195 Ga0105241_10021411
1196 Ga0105241_10023341
1197 Ga0105241_10032104
1198 Ga0105241_10037543
1199 Ga0105241_10083024
1200 Ga0105241_10092007
1201 Ga0105241_10897980
1202 Ga0105241_11032134
1203 Ga0105242_10100872
1204 Ga0105242_10209808
1205 Ga0105242_10237858
1206 Ga0105242_10332987
1207 Ga0105242_10458515
1208 Ga0105242_10487470
1209 Ga0105248_10000001
1210 Ga0105248_10046527
1211 Ga0105248_10167437
1212 Ga0105237_10001328
1213 Ga0105237_10017408
1214 Ga0105237_10119270
1215 Ga0105237_10124628
1216 Ga0105237_10152508
1217 Ga0105237_10456066
1218 Ga0105237_10479450
1219 Ga0105237_10958028
1220 Ga0105238_10001442
1221 Ga0105238_10007214
1222 Ga0105238_10029405
1223 Ga0105238_10041074
1224 Ga0105238_10084835
1225 Ga0105238_10108063
1226 Ga0105238_10109825
1227 Ga0105238_10159880
1228 Ga0105238_10194969
1229 Ga0105238_10220135
1230 Ga0105238_10346649
1231 Ga0105238_10364576
1232 Ga0105238_10449216
1233 Ga0105238_10697084
1234 Ga0105238_10918751
1235 Ga0105238_11159832
1236 Ga0105238_11537992
1237 Ga0105249_10447220
1238 Ga0105249_10591650
1239 Ga0105239_10000733
1240 Ga0105239_10013335
1241 Ga0105239_10155260
1242 Ga0105239_10196315
1243 Ga0105239_10234079
1244 Ga0105239_10240178
1245 Ga0105239_10249633
1246 Ga0105239_10380124
1247 Ga0105239_10435526
1248 Ga0105239_10652841
1249 Ga0105239_11448524
1250 Ga0105239_11741428
1251 Ga0105239_12822588
1252 Ga0105246_10038893
1253 Ga0105246_10240577
1254 Ga0105246_10870075
1255 Ga0157373_10022768
1256 Ga0157373_10077361
1257 Ga0157373_10176511
1258 Ga0157370_10007427
1259 Ga0157370_10015393
1260 Ga0157370_10103482
1261 Ga0157370_10140928
1262 Ga0157370_10504837
1263 Ga0157369_10046281
1264 Ga0157369_10078713
1265 Ga0157369_10145336
1266 Ga0157369_10269239
1267 Ga0157369_10479685
1268 Ga0157369_10682016
1269 Ga0157369_11415477
1270 Ga0157374_10186664
1271 Ga0157374_10257347
1272 Ga0157374_11136986
1273 Ga0157378_10027790
1274 Ga0157378_10153330
1275 Ga0157378_12083891
1276 Ga0163162_10070776
1277 Ga0163162_10075656
1278 Ga0163162_10102916
1279 Ga0163162_10177304
1280 Ga0157372_10010958
1281 Ga0157372_10016824
1282 Ga0157372_10020242
1283 Ga0157372_10368401
1284 Ga0157375_10058531
1285 Ga0157375_10119739
1286 Ga0163163_10006118
1287 Ga0163163_10097247
1288 Ga0163163_10103553
1289 Ga0163163_10510237
1290 Ga0157380_10608657
1291 Ga0182008_10155742
1292 Ga0182008_10458552
1293 Ga0157377_10268231
1294 Ga0157379_10005723
1295 Ga0157379_10010207
1296 Ga0157379_10013038
1297 Ga0157379_10023301
1298 Ga0157379_10056367
1299 Ga0157379_10063538
1300 Ga0157379_10288473
1301 Ga0157379_11036755
1302 Ga0157376_10282182
1303 Ga0157376_10663790
1304 Ga0157376_12630317
1305 Ga0182007_10032517
1306 Ga0182005_1006445
1307 Ga0163161_10084162
1308 Ga0213873_10069974
1309 Ga0213876_10000388
1310 Ga0213876_10000483
1311 Ga0213876_10061775
1312 Ga0213875_10339657
1313 Ga0213871_10006451
1314 Ga0224572_1005619
1315 Ga0228598_1032500
1316 Ga0228598_1048399
1317 Ga0209233_1000045
1318 Ga0209233_1004631
1319 Ga0209758_1000008
1320 Ga0207426_1037572
1321 Ga0207642_10508668
1322 Ga0207688_10116409
1323 Ga0207680_10002065
1324 Ga0207647_10083618
1325 Ga0207647_10253713
1326 Ga0207699_10000133
1327 Ga0207699_10083145
1328 Ga0207643_10045800
1329 Ga0207705_10000058
1330 Ga0207705_10009572
1331 Ga0207705_10063229
1332 Ga0207705_10198421
1333 Ga0207654_10026187
1334 Ga0207654_10030302
1335 Ga0207654_10279994
1336 Ga0207654_10392884
1337 Ga0207654_10625563
1338 Ga0207707_10000001
1339 Ga0207707_10001851
1340 Ga0207707_10052643
1341 Ga0207707_10076001
1342 Ga0207707_10089456
1343 Ga0207707_10201843
1344 Ga0207695_10000004
1345 Ga0207695_10009649
1346 Ga0207695_10025972
1347 Ga0207695_10185467
1348 Ga0207695_10265172
1349 Ga0207695_10300514
1350 Ga0207695_10318130
1351 Ga0207695_10510702
1352 Ga0207695_11373346
1353 Ga0207671_10008524
1354 Ga0207671_10039659
1355 Ga0207671_10124152
1356 Ga0207671_10266508
1357 Ga0207693_10000035
1358 Ga0207693_10000145
1359 Ga0207693_10345818
1360 Ga0207693_10664415
1361 Ga0207693_11044357
1362 Ga0207663_10132565
1363 Ga0207663_10409148
1364 Ga0207663_10444347
1365 Ga0207663_10529375
1366 Ga0207660_10000343
1367 Ga0207660_10005636
1368 Ga0207660_10260396
1369 Ga0207657_10001163
1370 Ga0207657_10031643
1371 Ga0207657_10255897
1372 Ga0207657_10339033
1373 Ga0207649_10000713
1374 Ga0207649_10045683
1375 Ga0207652_10001515
1376 Ga0207652_10001611
1377 Ga0207652_10037141
1378 Ga0207652_10226186
1379 Ga0207681_10326529
1380 Ga0207694_10000010
1381 Ga0207694_10019979
1382 Ga0207694_10031229
1383 Ga0207694_10125538
1384 Ga0207694_10164227
1385 Ga0207694_10174989
1386 Ga0207694_10307457
1387 Ga0207694_10479462
1388 Ga0207694_10578392
1389 Ga0207694_10824958
1390 Ga0207694_10893792
1391 Ga0207650_10078032
1392 Ga0207650_10106481
1393 Ga0207659_10114725
1394 Ga0207687_10006441
1395 Ga0207687_10041918
1396 Ga0207700_10000887
1397 Ga0207700_10073149
1398 Ga0207700_10270732
1399 Ga0207664_10034382
1400 Ga0207664_10974179
1401 Ga0207644_10110370
1402 Ga0207644_10148518
1403 Ga0207690_10176985
1404 Ga0207690_10650126
1405 Ga0207686_10069968
1406 Ga0207686_10072192
1407 Ga0207686_10228583
1408 Ga0207686_10297675
1409 Ga0207709_10069009
1410 Ga0207709_10145616
1411 Ga0207670_10884461
1412 Ga0207665_10399728
1413 Ga0207691_10255183
1414 Ga0207691_10322190
1415 Ga0207711_10000001
1416 Ga0207711_10103045
1417 Ga0207711_10157015
1418 Ga0207711_11854189
1419 Ga0207661_10245798
1420 Ga0207661_10743783
1421 Ga0207661_11126067
1422 Ga0207679_10693291
1423 Ga0207667_10000116
1424 Ga0207667_10010486
1425 Ga0207667_10051617
1426 Ga0207667_10054170
1427 Ga0207667_10280258
1428 Ga0207667_10415966
1429 Ga0207651_10060661
1430 Ga0207712_10175517
1431 Ga0207712_11345309
1432 Ga0207640_10181371
1433 Ga0207640_11099119
1434 Ga0207658_10072101
1435 Ga0207658_10153914
1436 Ga0207658_10838691
1437 Ga0207677_10362415
1438 Ga0207677_10402358
1439 Ga0207703_10007826
1440 Ga0207703_10024046
1441 Ga0207703_10028607
1442 Ga0207703_10033739
1443 Ga0207639_10070415
1444 Ga0207639_10094996
1445 Ga0207639_10354036
1446 Ga0207639_10598537
1447 Ga0207639_10761296
1448 Ga0207639_10993129
1449 Ga0207678_10024654
1450 Ga0207678_10425809
1451 Ga0207702_10000007
1452 Ga0207702_10000012
1453 Ga0207702_10019910
1454 Ga0207702_10045111
1455 Ga0207702_10062926
1456 Ga0207702_10516094
1457 Ga0207702_10857662
1458 Ga0207648_10022114
1459 Ga0207648_10808173
1460 Ga0207648_11565818
1461 Ga0207676_10032252
1462 Ga0207676_10803188
1463 Ga0207674_10000107
1464 Ga0207674_10094261
1465 Ga0207674_10136288
1466 Ga0207674_10405724
1467 Ga0207674_10660046
1468 Ga0207675_100115394
1469 Ga0207675_100955280
1470 Ga0207683_10015302
1471 Ga0207683_10062021
1472 Ga0207683_10145708
1473 Ga0207698_10002022
1474 Ga0207698_10050270
1475 Ga0207698_10206682
1476 Ga0207698_10240572
1477 Ga0207428_10200811
1478 Ga0268266_10000357
1479 Ga0268266_10015674
1480 Ga0268266_10017377
1481 Ga0268266_10033283
1482 Ga0268266_10282334
1483 Ga0268266_10311014
1484 Ga0268266_10495887
1485 Ga0268266_10507701
1486 Ga0268266_10617939
1487 Ga0268264_10094282
1488 Ga0268264_10146423
1489 Ga0268264_10621808
1490 Ga0265318_10000082
1491 Ga0307517_10137249
1492 Ga0265338_10000006
1493 Ga0265338_10001374
1494 Ga0265338_10032945
1495 Ga0265338_10039132
1496 Ga0265338_10067710
1497 Ga0265338_10160012
1498 Ga0265338_10172698
1499 Ga0265338_10258806
1500 Ga0265338_10538297
1501 Ga0265762_1022919
1502 Ga0265760_10065112
1503 Ga0265330_10017766
1504 Ga0265330_10020152
1505 Ga0265330_10117172
1506 Ga0265330_10126415
1507 Ga0265330_10264748
1508 Ga0265332_10011438
1509 Ga0265332_10045629
1510 Ga0265332_10229408
1511 Ga0265328_10000123
1512 Ga0265328_10077249
1513 Ga0265320_10000039
1514 Ga0265320_10087964
1515 Ga0265320_10133739
1516 Ga0265320_10218157
1517 Ga0265325_10000007
1518 Ga0265325_10000079
1519 Ga0265325_10000719
1520 Ga0265325_10000967
1521 Ga0265325_10001558
1522 Ga0265325_10011992
1523 Ga0265325_10039095
1524 Ga0265325_10076961
1525 Ga0265340_10000096
1526 Ga0265340_10012732
1527 Ga0265340_10040690
1528 Ga0265340_10120477
1529 Ga0265340_10230810
1530 Ga0265340_10287215
1531 Ga0265339_10001422
1532 Ga0265339_10009647
1533 Ga0265339_10010793
1534 Ga0265339_10024789
1535 Ga0265339_10033205
1536 Ga0265339_10044716
1537 Ga0265339_10133225
1538 Ga0265339_10168870
1539 Ga0265331_10000009
1540 Ga0265331_10000026
1541 Ga0265331_10000212
1542 Ga0265331_10004939
1543 Ga0265331_10007849
1544 Ga0265331_10033930
1545 Ga0265331_10035419
1546 Ga0265331_10059058
1547 Ga0265331_10095890
1548 Ga0265327_10000007
1549 Ga0265327_10270709
1550 Ga0265316_10000936
1551 Ga0265316_10008650
1552 Ga0265316_10022243
1553 Ga0265316_10030437
1554 Ga0265316_10142806
1555 Ga0265316_10170606
1556 Ga0265316_10173197
1557 Ga0265316_10223662
1558 Ga0265316_10223981
1559 Ga0265316_10296269
1560 Ga0265316_10395879
1561 Ga0265316_10546327
1562 Ga0265316_10598323
1563 Ga0265316_10835927
1564 Ga0307513_10285806
1565 Ga0265313_10001902
1566 Ga0265313_10003138
1567 Ga0265313_10005466
1568 Ga0265313_10022563
1569 Ga0265313_10072246
1570 Ga0265313_10133665
1571 Ga0265313_10143935
1572 Ga0265313_10280843
1573 Ga0265314_10003096
1574 Ga0265314_10007438
1575 Ga0265314_10010041
1576 Ga0265314_10021019
1577 Ga0265314_10049633
1578 Ga0265314_10067096
1579 Ga0265314_10075023
1580 Ga0265314_10090308
1581 Ga0265314_10126574
1582 Ga0265314_10132386
1583 Ga0265314_10145242
1584 Ga0265314_10150855
1585 Ga0265314_10297721
1586 Ga0265314_10359740
1587 Ga0265342_10015572
1588 Ga0265342_10022757
1589 Ga0265342_10030960
1590 Ga0265342_10044100
1591 Ga0265342_10060617
1592 Ga0265342_10099607
1593 Ga0307516_10007154
1594 Ga0307516_10007941
1595 Ga0307406_10098051
1596 Ga0373926_0061795
1597 Ga0373929_0229211
1598 Ga0373944_0017334
1599 Ga0373944_0194262
1600 Ga0373952_0031461
1601 Ga0373923_0012135
1602 Ga0373923_0054576
1603 Ga0373923_0126678
1604 Ga0373945_0067629
1605 Ga0373945_0144424
1606 Ga0373953_0050352
1607 Ga0373953_0241486
1608 Ga0373954_0065479
1609 Ga0373954_0066270
1610 Ga0373954_0136386
1611 Ga0373956_0023081
1612 Ga0373956_0065371
1613 Ga0373956_0180208
1614 Ga0373957_0043071
1615 Ga0373943_0021651
1616 Ga0373943_0390685
1617 Ga0373955_0032059
1618 Ga0373955_0043618
1619 Ga0373955_0051751
1620 Ga0373924_0179037
1621 Ga0373931_0029941
1622 Ga0373931_0633688
1623 Ga0373935_0447515
1624 Ga0373927_0528139
1625 Ga0373933_0025178
1626 Ga0373933_0034446
1627 Ga0373933_0075443
1628 Ga0373933_0233500
1629 Ga0373933_0821321
1630 Ga0373947_0011553
1631 Ga0373937_0009750
1632 Ga0373937_0010384
1633 Ga0373937_0060950
1634 Ga0373937_0071295
1635 Ga0373937_0789074
1636 Ga0373937_0825298
1637 Ga0373937_1340931
1638 Ga0373937_2067487
1639 Ga0373925_0031160
1640 Ga0373925_0044126
1641 Ga0373925_0054428
1642 Ga0373925_0213161
1643 Ga0373925_0236591
1644 Ga0373925_0473851
1645 Ga0373925_0740031
1646 Ga0373925_1459805
1647 Ga0395899_0060219
1648 Ga0395900_0053179
1649 Ga0395900_0656383
1650 Ga0395898_0008535
1651 Ga0395898_0818680
1652 Ga0395905_0953991
1653 Ga0436364_0045683
1654 Ga0436364_0630355
1655 Ga0436364_1385246
1656 Ga0395901_0062777
1657 Ga0395901_0448753
1658 Ga0436365_0151405
1659 Ga0436365_0412683
1660 Ga0436365_0550500
1661 Ga0436365_0678770
1662 Ga0436365_0991473
1663 Ga0436365_1551085
1664 Ga0436360_0160041
1665 Ga0436360_0900296
1666 Ga0436363_0377217
1667 Ga0436363_0857110
1668 Ga0436363_1394367
1669 Ga0436363_1716475
1670 Ga0436362_0193065
1671 Ga0436362_0413829
1672 Ga0436362_0497344
1673 Ga0436362_0609469
1674 Ga0451791_0308433
1675 Ga0451793_1177649
1676 Ga0451849_1436860
1677 Ga0466957_0489198
1678 Ga0451576_0238219
1679 Ga0495617_080398
1680 Ga0495592_0002029
1681 Ga0495603_0014799
1682 Ga0495651_0088138
1683 Ga0495651_0325111
1684 Ga0495580_0118273
1685 Ga0495580_0168382
1686 Ga0495582_0055510
1687 Ga0495605_0137072
1688 Ga0495662_0073329
1689 Ga0495664_0039971
1690 Ga0495664_0212652
1691 Ga0495584_0187340
1692 Ga0495585_0009380
1693 Ga0495585_0169679
1694 Ga0495596_0076830
1695 Ga0495606_0161475
1696 Ga0495608_0173215
1697 Ga0495616_0057027
1698 Ga0495628_0010755
1699 Ga0495628_0696989
1700 Ga0495663_0058607
1701 Ga0495666_0084114
1702 Ga0495652_0035285
1703 Ga0495652_0051267
1704 Ga0495652_0080670
1705 Ga0495665_0136860
1706 Ga0495665_0332784
1707 Ga0495587_0145848
1708 Ga0495598_0034670
1709 Ga0495621_0168074
1710 Ga0495621_0515117
1711 Ga0495645_0004240
1712 Ga0495645_0031707
1713 Ga0495645_0406883
1714 Ga0495622_0002481
1715 Ga0495656_0007146
1716 Ga0495668_0254767
1717 Ga0495611_0114925
1718 Ga0495625_0127072
1719 Ga0495635_0050975
1720 Ga0495659_0038061
1721 Ga0495661_0097010
1722 Ga0495661_0208571
1723 Ga0495588_0009480
1724 Ga0495657_0057811
1725 Ga0495657_0082257
1726 Ga0495599_0002546
1727 Ga0495599_0069790
1728 Ga0495623_0031161
1729 Ga0495646_0477610
1730 Ga0495646_0637313
1731 Ga0495647_0120355
1732 Ga0495658_0040998
1733 Ga0495613_0372475
1734 Ga0495670_0010448
1735 Ga0495670_0405797
1736 Ga0495589_0386033
1737 Ga0495600_0003255
1738 Ga0495660_0095861
1739 Ga0495581_0031931
1740 Ga0495604_0008492
1741 Ga0495604_0471718
1742 Ga0495636_0156828
1743 Ga0495674_0236011
1744 Ga0495672_0261542
1745 Ga0495676_0045481
1746 Ga0495680_0009974
1747 Ga0495680_0186175
1748 Ga0495675_0079273
1749 Ga0495675_0080417
1750 Ga0495677_0105497
1751 Ga0495673_0084336
1752 Ga0495684_0139083
1753 Ga0495684_0568062
1754 Ga0495602_0012502
1755 Ga0495602_0345175
1756 Ga0496101_0115020
1757 Ga0496104_0503965
1758 Ga0496109_0665898
1759 Ga0496112_0179882
1760 Ga0496113_0092650
1761 Ga0496115_0296705
1762 Ga0496119_0036704
1763 Ga0496120_0116437
1764 Ga0496121_0000342
1765 Ga0496121_0053748
1766 Ga0496121_0137152
1767 Ga0496126_0004475
1768 Ga0496126_0085460
1769 Ga0495682_0014850
1770 Ga0501031_0007188
1771 Ga0501031_0481747
1772 Ga0501032_0019525
1773 Ga0501032_0118681
1774 Ga0501032_0163452
1775 Ga0501032_0222494
1776 Ga0501032_0404806
1777 Ga0501033_0009915
1778 Ga0501033_0035884
1779 Ga0501033_0042084
1780 Ga0501033_0090122
1781 Ga0501033_0110926
1782 Ga0501033_0129043
1783 Ga0501033_0170018
1784 Ga0501033_0189619
1785 Ga0501033_0208981
1786 Ga0501033_0310960
1787 Ga0501033_0337716
1788 Ga0501033_0362231
1789 Ga0501033_0803200
1790 Ga0501033_0881066
1791 Ga0501034_0030482
1792 Ga0501034_0122632
1793 Ga0501034_0123280
1794 Ga0501034_0187479
1795 Ga0501034_0200527
1796 Ga0501034_0223272
1797 Ga0501034_0226097
1798 Ga0501034_0478455
1799 Ga0501036_0003979
1800 Ga0501036_0120952
1801 Ga0501036_0260047
1802 Ga0501036_0289756
1803 Ga0501036_0412702
1804 Ga0501037_0003258
1805 Ga0501037_0010726
1806 Ga0501037_0011338
1807 Ga0501037_0151712
1808 Ga0501037_0347874
1809 Ga0501038_0022382
1810 Ga0501038_0060653
1811 Ga0501038_0066451
1812 Ga0501038_0094116
1813 Ga0501038_0098103
1814 Ga0501038_0108913
1815 Ga0501038_0123152
1816 Ga0501038_0294125
1817 Ga0501038_0430508
1818 Ga0501038_0954687
1819 Ga0501038_0964427
1820 Ga0501039_0000722
1821 Ga0501039_0200760
1822 Ga0501039_1137685
1823 Ga0501040_0271842
1824 Ga0501040_0705447
1825 Ga0501041_0510738
1826 Ga0501042_0029241
1827 Ga0501043_0002787
1828 Ga0501043_0072392
1829 Ga0501043_0076031
1830 Ga0501043_0099636
1831 Ga0501043_0110245
1832 Ga0501043_0152686
1833 Ga0501043_0340253
1834 Ga0501046_0008706
1835 Ga0501046_0011955
1836 Ga0501046_0051438
1837 Ga0501046_0107284
1838 Ga0501046_0186904
1839 Ga0501046_0268467
1840 Ga0501046_0275366
1841 Ga0501046_1111720
1842 Ga0501047_0002340
1843 Ga0501047_0010038
1844 Ga0501047_0011849
1845 Ga0501047_0016948
1846 Ga0501047_0025770
1847 Ga0501047_0027307
1848 Ga0501047_0065406
1849 Ga0501047_0088473
1850 Ga0501047_0117654
1851 Ga0501047_0186978
1852 Ga0501047_0255607
1853 Ga0501047_0266450
1854 Ga0501047_0271226
1855 Ga0501047_0431434
1856 Ga0501047_0447519
1857 Ga0501047_0478270
1858 Ga0501047_0615564
1859 Ga0501047_0788681
1860 Ga0501048_0006987
1861 Ga0501048_0407615
1862 Ga0501048_0484228
1863 Ga0501067_0000729
1864 Ga0501067_0134834
1865 Ga0501067_0263193
1866 Ga0501067_0466790
1867 Ga0501068_0148086
1868 Ga0501069_0039144
1869 Ga0501069_0180084
1870 Ga0501069_0267421
1871 Ga0501069_0277495
1872 Ga0501070_0000017
1873 Ga0501070_0024751
1874 Ga0501070_0081519
1875 Ga0501070_0222675
1876 Ga0501070_0285547
1877 Ga0501070_0292146
1878 Ga0501070_0446511
1879 Ga0501070_1173709
1880 Ga0501071_0175322
1881 Ga0501071_0418340
1882 Ga0501072_0002615
1883 Ga0501072_0058798
1884 Ga0501073_0006141
1885 Ga0501073_0035606
1886 Ga0501073_0071784
1887 Ga0501073_0085950
1888 Ga0501073_0202618
1889 Ga0501073_0326227
1890 Ga0501073_0330280
1891 Ga0501073_0364440
1892 Ga0501074_0006832
1893 Ga0501074_0283717
1894 Ga0501074_0356514
1895 Ga0501076_0392279
1896 Ga0501077_0485166
1897 Ga0501079_0001593
1898 Ga0501079_0376949
1899 Ga0501080_0007075
1900 Ga0501080_0013155
1901 Ga0501080_0017054
1902 Ga0501080_0048297
1903 Ga0501080_0058102
1904 Ga0501080_0095938
1905 Ga0501080_0100351
1906 Ga0501080_0174060
1907 Ga0501080_0196256
1908 Ga0501080_0529677
1909 Ga0501080_1232045
1910 Ga0501081_1149569
1911 Ga0501083_0023338
1912 Ga0501083_0024773
1913 Ga0501083_0077501
1914 Ga0501083_0078000
1915 Ga0501083_0273322
1916 Ga0501035_0014379
1917 Ga0501035_0016715
1918 Ga0501035_0022936
1919 Ga0501035_0028207
1920 Ga0501035_0037918
1921 Ga0501035_0098978
1922 Ga0501035_0105807
1923 Ga0501035_0112035
1924 Ga0501035_0114126
1925 Ga0501035_0248775
1926 Ga0501035_0288201
1927 Ga0501035_0307956
1928 Ga0501035_0502871
1929 Ga0501035_0834230
1930 Ga0501044_0001349
1931 Ga0501044_0004556
1932 Ga0501044_0012642
1933 Ga0501044_0013884
1934 Ga0501044_0016070
1935 Ga0501044_0020118
1936 Ga0501044_0021245
1937 Ga0501044_0069817
1938 Ga0501044_0071490
1939 Ga0501044_0075416
1940 Ga0501044_0084673
1941 Ga0501044_0123544
1942 Ga0501044_0178221
1943 Ga0501044_0289077
1944 Ga0501044_0289595
1945 Ga0501044_0471480
1946 Ga0501044_1375726
1947 Ga0501045_0117027
1948 nmdc:mga08y16_96655_c1
1949 nmdc:mga0n895_508654_c1
1950 nmdc:mga0rr50_41387_c1
1951 nmdc:mga0rr50_424049_c1
1952 nmdc:mga08x19_101598_c1
1953 nmdc:mga08x19_99_c1
1954 Ga0495601_0000787
1955 Ga0495612_0001215
1956 Ga0495595_0001670
1957 Ga0495595_0138751
1958 Ga0495619_0000414
1959 Ga0495619_0101091
1960 Ga0495619_0853569
1961 Ga0500643_000006
1962 Ga0500646_0140566
1963 Ga0500566_0286142
1964 Ga0500641_0030149
1965 Ga0500558_167330
1966 Ga0500593_135782
1967 Ga0500595_013693
1968 Ga0500595_020325
1969 Ga0500595_036334
1970 Ga0500655_004543
1971 Ga0500655_030114
1972 Ga0500559_0008077
1973 Ga0500559_0316253
1974 Ga0500559_0367583
1975 Ga0500568_0048976
1976 Ga0500573_0000009
1977 Ga0500577_0083756
1978 Ga0500590_331774
1979 Ga0500639_133685
1980 Ga0500645_212142
1981 Ga0501084_0000147
1982 Ga0501084_0009168
1983 Ga0501084_0492650
1984 Ga0501084_1193671
1985 Ga0501082_0008279
1986 Ga0501082_0131759
1987 Ga0501082_0357098
1988 Ga0501082_0388559
1989 Ga0501082_0391469
1990 Ga0501082_1141945
1991 2819721592
1992 2939674245

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02590

SPOUT_MTase

Predicted SPOUT methyltransferase

1

158

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1to0-assembly4.cif.gz_G x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9269 1 157
1to0-assembly2.cif.gz_C x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9221 1 155
1to0-assembly3.cif.gz_F x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.921 1 152
1to0-assembly4.cif.gz_G x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.921 1 157
1to0-assembly2.cif.gz_C x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9162 1 155
ID Description Score Start End Superfamily
1to0F00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9222 3 152 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9171 1 159 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.906 1 159 3.40.1280.10
1to0F00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8968 3 152 3.40.1280.10
1o6dA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.885 1 155 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A1Q3JP34-F1-model_v4 deleted 0.9891 1 160
AF-A0A7Y2EG16-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9583 1 160 GO:0005737
GO:0070038
AF-A0A7V2WNM6-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9563 1 160 GO:0005737
GO:0070038
AF-A0A1H8W7Y8-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9541 1 160 GO:0005737
GO:0070038
AF-A0A7C9VJD1-F1-model_v4 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH 0.954 21 160 GO:0006364
GO:0008168
GO:0032259

Map