F487876

General Info

Members Datasets Scaffolds Average Seq Length
1000 460 993 385

Family's Representative Sequence

Representative Sequence 3300035088|Ga0373940_0019540|Ga0373940_0019540_292_1620
Length 442
Sequence MKKGGIAAALFIADVRINQVQATPRRLLRRKYGLAVTLPSRNYPRRMLEGECMSKAFRRMTVGIAALAFAAATVAAEAKDKVKVGFIGPLTGGVSVNGLGGRNSADLAVRLRNADPNAKYEYELVVLDDECKPNVAVQVATKMAADKDVIAGATHYCSATAIATVDTYHKFGFPVIVWGAVLPDITYRNKYEEVHRVNGTMINQNDANAELISKLGYKTVAVIHDTTDYGKGHNEYFSKSLAKIGKANIVGTFGVTAEQQDFTGELTKIKALNPEVIYFGGLTPIGVRIRSQMDKLGINAVFDGTSGIVSDAYIQGLGPLAEGTLAFREGAPTEKLPGGKFFMEKYNAQKYDNPPEAYGAFAFAAMDMILDTIEKVGPDRKKVIAALADVKDRDSIVGKITFDDHGQNTVPVITKYVVQDGKFVEWDDSEYAAGKRKLPGQK

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2643221651 Afipia sp. Root123D2 Isolate Unclassified
4 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
5 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
6 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
7 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
8 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
9 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
10 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
11 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
12 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
13 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
14 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
30 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
109 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
164 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
167 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
239 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
244 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
248 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
249 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
250 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
251 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
252 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
255 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
256 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
257 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
258 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
259 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
260 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
261 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
262 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
263 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
264 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
267 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
268 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
269 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
270 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
271 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
273 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
275 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
276 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
277 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
281 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
282 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
285 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
286 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
287 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
288 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
289 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
299 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
300 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
301 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
302 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
303 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
309 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
310 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
311 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
312 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
313 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
314 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
315 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
316 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
317 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
318 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
319 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
320 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
321 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
324 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
325 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
326 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
327 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
328 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
329 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
330 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
331 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
332 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
333 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
334 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
335 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
336 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
337 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
338 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
339 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
340 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
341 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
342 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
343 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
344 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
345 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
346 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
347 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
348 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
349 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
350 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
351 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
352 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
353 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
354 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
355 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
356 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
357 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
358 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
359 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
360 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
361 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
362 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
363 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
364 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
365 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
366 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
367 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
368 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
369 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
370 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
371 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
372 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
373 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
374 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
375 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
376 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
377 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
378 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
379 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
380 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
381 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
382 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
383 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
384 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
385 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
386 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
387 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
388 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
389 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
390 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
391 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
392 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
393 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
394 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
395 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
396 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
397 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
398 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
399 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
400 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
401 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
402 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
405 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
406 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
407 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
408 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
409 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
410 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
411 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
412 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
413 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
414 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
415 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
416 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
429 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
430 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
431 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
432 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
433 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
434 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
435 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
436 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
437 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
438 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
439 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
442 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
443 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
444 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
445 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
446 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
447 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
448 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
449 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
450 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
451 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
452 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
453 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
454 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
455 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
456 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
457 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
458 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
459 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
460 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0.3
Rhizoplane 6
Rhizosphere 91.2
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214739665 2209111006 Bacteria 3872
2 ARcpr5oldR_c000054 3300000041 Bacteria 21079
3 ARSoilYngRDRAFT_c00400 3300000042 Bacteria 5645
4 ARcpr5yngRDRAFT_c000351 3300000043 Bacteria 6138
5 ARSoilOldRDRAFT_c000055 3300000044 Bacteria 23615
6 ARCol0oldRDRAFT_c00497 3300000045 Bacteria 3637
7 ARCol0yngRDRAFT_1000044 3300000652 Bacteria 21392
8 JGI24746J21847_1000489 3300001977 Bacteria 5929
9 JGI24737J22298_10000632 3300001990 Bacteria 12387
10 JGI24737J22298_10019755 3300001990 Bacteria 2154
11 JGI24748J21848_1000669 3300002074 Bacteria 3686
12 JGI24738J21930_10000039 3300002075 Bacteria 25206
13 JGI24749J21850_1000363 3300002076 Bacteria 6752
14 JGI24744J21845_10003566 3300002077 Bacteria 3205
15 JGI24035J26624_1000189 3300002126 Bacteria 5706
16 JGI24034J26672_10009055 3300002239 Bacteria 1464
17 JGI24742J22300_10000085 3300002244 Bacteria 13624
18 JGI24742J22300_10004309 3300002244 Bacteria 2326
19 JGI24751J29686_10013822 3300002459 Bacteria 1666
20 JGI25151J46595_10007003 3300003187 Bacteria 5582
21 JGI25406J46586_10000035 3300003203 Bacteria 61904
22 JGI25153J46596_10010546 3300003215 Bacteria 4170
23 Ga0055526_1000300 3300003771 Bacteria 41235
24 Ga0065717_1002729 3300005276 Bacteria 1667
25 Ga0065716_1002257 3300005277 Bacteria 2011
26 Ga0065704_10082675 3300005289 Bacteria 3563
27 Ga0065715_10000340 3300005293 Bacteria 13818
28 Ga0070658_10020743 3300005327 Bacteria 5265
29 Ga0070676_10000016 3300005328 Bacteria 52098
30 Ga0070683_100000075 3300005329 Bacteria 67998
31 Ga0070683_100061281 3300005329 Bacteria 3498
32 Ga0070683_100094509 3300005329 Bacteria 2809
33 Ga0070690_100000713 3300005330 Bacteria 17071
34 Ga0070690_100132786 3300005330 Bacteria 1683
35 Ga0070670_100102194 3300005331 Bacteria 2468
36 Ga0070677_10000005 3300005333 Bacteria 79035
37 Ga0068869_100000124 3300005334 Bacteria 36988
38 Ga0070666_10025518 3300005335 Bacteria 3854
39 Ga0070666_10184167 3300005335 Bacteria 1466
40 Ga0070680_100007119 3300005336 Bacteria 8526
41 Ga0070680_100008506 3300005336 Bacteria 7861
42 Ga0070680_100087580 3300005336 Bacteria 2575
43 Ga0070680_100092537 3300005336 Bacteria 2504
44 Ga0070680_100129119 3300005336 Bacteria 2113
45 Ga0070682_100001022 3300005337 Bacteria 16156
46 Ga0070682_100003502 3300005337 Bacteria 8682
47 Ga0068868_100002137 3300005338 Bacteria 13641
48 Ga0070660_100000153 3300005339 Bacteria 44533
49 Ga0070660_100037042 3300005339 Bacteria 3697
50 Ga0070660_100164961 3300005339 Bacteria 1787
51 Ga0070660_100264316 3300005339 Bacteria 1405
52 Ga0070689_100001013 3300005340 Bacteria 17615
53 Ga0070689_100003632 3300005340 Bacteria 10290
54 Ga0070689_100055590 3300005340 Bacteria 3068
55 Ga0070691_10019041 3300005341 Bacteria 3165
56 Ga0070687_100000346 3300005343 Bacteria 15773
57 Ga0070661_100000315 3300005344 Bacteria 39060
58 Ga0070661_100153535 3300005344 Bacteria 1741
59 Ga0070692_10001032 3300005345 Bacteria 9598
60 Ga0070692_10001066 3300005345 Bacteria 9511
61 Ga0070692_10036722 3300005345 Bacteria 2488
62 Ga0070668_100000824 3300005347 Bacteria 21386
63 Ga0070669_100000145 3300005353 Bacteria 63377
64 Ga0070669_100025592 3300005353 Bacteria 4239
65 Ga0070669_100069934 3300005353 Bacteria 2594
66 Ga0070675_100001417 3300005354 Bacteria 17615
67 Ga0070675_100089134 3300005354 Bacteria 2582
68 Ga0070671_100000267 3300005355 Bacteria 35238
69 Ga0070671_100004618 3300005355 Bacteria 10922
70 Ga0070671_100101185 3300005355 Bacteria 2418
71 Ga0070674_100001317 3300005356 Bacteria 13052
72 Ga0070674_100001510 3300005356 Bacteria 12405
73 Ga0070673_100000125 3300005364 Bacteria 35606
74 Ga0070673_100032842 3300005364 Bacteria 3913
75 Ga0070673_100129842 3300005364 Bacteria 2113
76 Ga0070688_100000075 3300005365 Bacteria 49279
77 Ga0070688_100019720 3300005365 Bacteria 3909
78 Ga0070688_100034653 3300005365 Bacteria 3060
79 Ga0070659_100001342 3300005366 Bacteria 17717
80 Ga0070659_100037181 3300005366 Bacteria 3795
81 Ga0070659_100064864 3300005366 Bacteria 2891
82 Ga0070659_100067952 3300005366 Bacteria 2826
83 Ga0070659_100282162 3300005366 Bacteria 1382
84 Ga0070667_100002562 3300005367 Bacteria 15789
85 Ga0070667_100023818 3300005367 Bacteria 5083
86 Ga0070667_100162130 3300005367 Bacteria 1970
87 Ga0070703_10016942 3300005406 Bacteria 2097
88 Ga0070709_10014282 3300005434 Bacteria 4490
89 Ga0070714_100019685 3300005435 Bacteria 5502
90 Ga0070714_100058800 3300005435 Bacteria 3295
91 Ga0070713_100070174 3300005436 Bacteria 2957
92 Ga0070713_100263595 3300005436 Bacteria 1575
93 Ga0070710_10010584 3300005437 Bacteria 4533
94 Ga0070710_10035887 3300005437 Bacteria 2706
95 Ga0070710_10112910 3300005437 Bacteria 1635
96 Ga0070710_10115561 3300005437 Bacteria 1617
97 Ga0070701_10000658 3300005438 Bacteria 12115
98 Ga0070701_10023479 3300005438 Bacteria 2971
99 Ga0070711_100005516 3300005439 Bacteria 7573
100 Ga0070711_100039067 3300005439 Bacteria 3194
101 Ga0070711_100174145 3300005439 Bacteria 1642
102 Ga0070711_100262835 3300005439 Bacteria 1358
103 Ga0070705_100000926 3300005440 Bacteria 16411
104 Ga0070705_100002812 3300005440 Bacteria 8678
105 Ga0070705_100037811 3300005440 Bacteria 2726
106 Ga0070700_100000613 3300005441 Bacteria 17749
107 Ga0070700_100006104 3300005441 Bacteria 6418
108 Ga0070700_100029592 3300005441 Bacteria 3267
109 Ga0070700_100096888 3300005441 Bacteria 1936
110 Ga0070694_100000041 3300005444 Bacteria 59039
111 Ga0070694_100006032 3300005444 Bacteria 7352
112 Ga0070694_100053384 3300005444 Bacteria 2735
113 Ga0070694_100056792 3300005444 Bacteria 2659
114 Ga0070708_100001512 3300005445 Bacteria 17752
115 Ga0070708_100009486 3300005445 Bacteria 7845
116 Ga0070708_100066756 3300005445 Bacteria 3229
117 Ga0070708_100085056 3300005445 Bacteria 2870
118 Ga0070708_100121559 3300005445 Bacteria 2409
119 Ga0070663_100000260 3300005455 Bacteria 26472
120 Ga0070663_100003392 3300005455 Bacteria 9201
121 Ga0070663_100030281 3300005455 Bacteria 3707
122 Ga0070663_100053153 3300005455 Bacteria 2891
123 Ga0070663_100250881 3300005455 Bacteria 1400
124 Ga0070662_100023831 3300005457 Bacteria 4209
125 Ga0070681_10000525 3300005458 Bacteria 31394
126 Ga0070681_10003118 3300005458 Bacteria 15399
127 Ga0070681_10003404 3300005458 Bacteria 14891
128 Ga0070681_10019233 3300005458 Bacteria 6834
129 Ga0070681_10059346 3300005458 Bacteria 3805
130 Ga0070681_10093921 3300005458 Bacteria 2948
131 Ga0070681_10120122 3300005458 Bacteria 2563
132 Ga0070681_10269010 3300005458 Bacteria 1616
133 Ga0068867_100003207 3300005459 Bacteria 11527
134 Ga0068867_100005713 3300005459 Bacteria 8822
135 Ga0070685_10005160 3300005466 Bacteria 6622
136 Ga0070685_10031138 3300005466 Bacteria 2978
137 Ga0070685_10163742 3300005466 Bacteria 1420
138 Ga0070706_100000058 3300005467 Bacteria 133347
139 Ga0070706_100035941 3300005467 Bacteria 4575
140 Ga0070706_100181558 3300005467 Bacteria 1965
141 Ga0070707_100007827 3300005468 Bacteria 9924
142 Ga0070707_100340643 3300005468 Bacteria 1456
143 Ga0070698_100184843 3300005471 Bacteria 2022
144 Ga0070699_100003539 3300005518 Bacteria 13809
145 Ga0070699_100212718 3300005518 Bacteria 1721
146 Ga0070699_100252818 3300005518 Bacteria 1575
147 Ga0070679_100000464 3300005530 Bacteria 34507
148 Ga0070679_100002575 3300005530 Bacteria 16471
149 Ga0070679_100086972 3300005530 Bacteria 3112
150 Ga0070679_100111652 3300005530 Bacteria 2720
151 Ga0070679_100187460 3300005530 Bacteria 2038
152 Ga0070684_100001338 3300005535 Bacteria 17638
153 Ga0070684_100152977 3300005535 Bacteria 2091
154 Ga0070697_100005197 3300005536 Bacteria 9998
155 Ga0070697_100016032 3300005536 Bacteria 5892
156 Ga0070697_100023289 3300005536 Bacteria 4925
157 Ga0070697_100048096 3300005536 Bacteria 3458
158 Ga0068853_100002117 3300005539 Bacteria 14743
159 Ga0068853_100026561 3300005539 Bacteria 4862
160 Ga0068853_100046770 3300005539 Bacteria 3712
161 Ga0070672_100002280 3300005543 Bacteria 12115
162 Ga0070686_100001401 3300005544 Bacteria 13603
163 Ga0070686_100015930 3300005544 Bacteria 4366
164 Ga0070686_100173839 3300005544 Bacteria 1525
165 Ga0070695_100000720 3300005545 Bacteria 17638
166 Ga0070695_100011357 3300005545 Bacteria 5328
167 Ga0070695_100050067 3300005545 Bacteria 2676
168 Ga0070696_100005203 3300005546 Bacteria 8698
169 Ga0070696_100009677 3300005546 Bacteria 6448
170 Ga0070696_100025374 3300005546 Bacteria 4029
171 Ga0070696_100071433 3300005546 Bacteria 2442
172 Ga0070693_100010486 3300005547 Bacteria 4645
173 Ga0070693_100011021 3300005547 Bacteria 4545
174 Ga0070693_100087117 3300005547 Bacteria 1875
175 Ga0070665_100013399 3300005548 Bacteria 8250
176 Ga0070665_100151089 3300005548 Bacteria 2325
177 Ga0070704_100007447 3300005549 Bacteria 6521
178 Ga0070704_100035355 3300005549 Bacteria 3395
179 Ga0070704_100037540 3300005549 Bacteria 3310
180 Ga0068855_100013780 3300005563 Bacteria 9746
181 Ga0068855_100281530 3300005563 Bacteria 1846
182 Ga0070664_100056205 3300005564 Bacteria 3344
183 Ga0068857_100000122 3300005577 Bacteria 46603
184 Ga0068857_100013592 3300005577 Bacteria 7092
185 Ga0068857_100018049 3300005577 Bacteria 6189
186 Ga0068857_100114345 3300005577 Bacteria 2427
187 Ga0068854_100001039 3300005578 Bacteria 16664
188 Ga0068856_100001112 3300005614 Bacteria 28418
189 Ga0068856_100098612 3300005614 Bacteria 2912
190 Ga0068856_100342804 3300005614 Bacteria 1512
191 Ga0070702_100000908 3300005615 Bacteria 11553
192 Ga0070702_100041521 3300005615 Bacteria 2581
193 Ga0070702_100051843 3300005615 Bacteria 2351
194 Ga0070702_100083125 3300005615 Bacteria 1923
195 Ga0068852_100001884 3300005616 Bacteria 14287
196 Ga0068852_100008946 3300005616 Bacteria 7411
197 Ga0068852_100142758 3300005616 Bacteria 2218
198 Ga0068859_100000365 3300005617 Bacteria 45011
199 Ga0068859_100008214 3300005617 Bacteria 10590
200 Ga0068859_100087315 3300005617 Bacteria 3167
201 Ga0068859_100107876 3300005617 Bacteria 2845
202 Ga0068864_100000271 3300005618 Bacteria 46062
203 Ga0068864_100269749 3300005618 Bacteria 1585
204 Ga0068866_10000525 3300005718 Bacteria 17642
205 Ga0068861_100001852 3300005719 Bacteria 13612
206 Ga0068861_100034799 3300005719 Bacteria 3726
207 Ga0068851_10003770 3300005834 Bacteria 6779
208 Ga0068870_10000263 3300005840 Bacteria 19418
209 Ga0068863_100000372 3300005841 Bacteria 45645
210 Ga0068863_100026295 3300005841 Bacteria 5553
211 Ga0068858_100005253 3300005842 Bacteria 12688
212 Ga0068858_100028586 3300005842 Bacteria 5178
213 Ga0068858_100184288 3300005842 Bacteria 1972
214 Ga0068860_100020260 3300005843 Bacteria 6443
215 Ga0068860_100108710 3300005843 Bacteria 2650
216 Ga0068860_100142840 3300005843 Bacteria 2301
217 Ga0068862_100010491 3300005844 Bacteria 7651
218 Ga0068862_100037922 3300005844 Bacteria 4086
219 Ga0081455_10000007 3300005937 Bacteria 269394
220 Ga0081455_10012925 3300005937 Bacteria 8282
221 Ga0081538_10082541 3300005981 Bacteria 1703
222 Ga0081540_1000257 3300005983 Bacteria 55989
223 Ga0081539_10000113 3300005985 Bacteria 189418
224 Ga0070717_10012854 3300006028 Bacteria 6393
225 Ga0070717_10073713 3300006028 Bacteria 2854
226 Ga0075432_10011926 3300006058 Bacteria 2954
227 Ga0070715_10010738 3300006163 Bacteria 3273
228 Ga0070716_100026747 3300006173 Bacteria 3092
229 Ga0070712_100025560 3300006175 Bacteria 3926
230 Ga0070712_100245332 3300006175 Bacteria 1428
231 Ga0075427_10000069 3300006194 Bacteria 7998
232 Ga0075366_10084604 3300006195 Bacteria 1896
233 Ga0097621_100000047 3300006237 Bacteria 63910
234 Ga0097621_100035900 3300006237 Bacteria 3962
235 Ga0097621_100222381 3300006237 Bacteria 1646
236 Ga0068871_100000721 3300006358 Bacteria 22411
237 Ga0068871_100021627 3300006358 Bacteria 4947
238 Ga0075428_100101896 3300006844 Bacteria 3130
239 Ga0075428_100106622 3300006844 Bacteria 3055
240 Ga0075428_100196518 3300006844 Bacteria 2181
241 Ga0075428_100314720 3300006844 Bacteria 1682
242 Ga0075430_100000070 3300006846 Bacteria 55805
243 Ga0075430_100030966 3300006846 Bacteria 4543
244 Ga0075431_100012360 3300006847 Bacteria 8616
245 Ga0075431_100019547 3300006847 Bacteria 6909
246 Ga0075431_100100834 3300006847 Bacteria 2979
247 Ga0075431_100143838 3300006847 Bacteria 2457
248 Ga0075433_10004877 3300006852 Bacteria 10495
249 Ga0075433_10016738 3300006852 Bacteria 6053
250 Ga0075433_10021597 3300006852 Bacteria 5399
251 Ga0075433_10078464 3300006852 Bacteria 2909
252 Ga0075434_100001558 3300006871 Bacteria 19441
253 Ga0075434_100001839 3300006871 Bacteria 18321
254 Ga0075434_100317828 3300006871 Bacteria 1577
255 Ga0075429_100001678 3300006880 Bacteria 18316
256 Ga0075429_100130495 3300006880 Bacteria 2198
257 Ga0075429_100149931 3300006880 Bacteria 2042
258 Ga0075429_100348390 3300006880 Bacteria 1297
259 Ga0075436_100000428 3300006914 Bacteria 26958
260 Ga0075436_100023731 3300006914 Bacteria 4214
261 Ga0097620_100000365 3300006931 Bacteria 45011
262 Ga0097620_100008214 3300006931 Bacteria 10590
263 Ga0097620_100087318 3300006931 Bacteria 3167
264 Ga0097620_100107884 3300006931 Bacteria 2845
265 Ga0099826_10000023 3300006948 Bacteria 154989
266 Ga0075435_100020291 3300007076 Bacteria 5088
267 Ga0075435_100040034 3300007076 Bacteria 3742
268 Ga0075435_100047070 3300007076 Bacteria 3462
269 Ga0075435_100231281 3300007076 Bacteria 1571
270 Ga0099794_10000089 3300007265 Bacteria 33900
271 Ga0099794_10000711 3300007265 Bacteria 11201
272 Ga0099794_10002341 3300007265 Bacteria 6964
273 Ga0105251_10014854 3300009011 Bacteria 4280
274 Ga0105251_10026344 3300009011 Bacteria 2960
275 Ga0105240_10061672 3300009093 Bacteria 4672
276 Ga0105240_10106121 3300009093 Bacteria 3408
277 Ga0111539_10000185 3300009094 Bacteria 72688
278 Ga0111539_10001287 3300009094 Bacteria 33486
279 Ga0111539_10003613 3300009094 Bacteria 20380
280 Ga0105245_10000213 3300009098 Bacteria 55096
281 Ga0105245_10019072 3300009098 Bacteria 6004
282 Ga0105247_10002058 3300009101 Bacteria 13924
283 Ga0105247_10014638 3300009101 Bacteria 4702
284 Ga0105247_10072297 3300009101 Bacteria 2159
285 Ga0114129_10005426 3300009147 Bacteria 18011
286 Ga0114129_10019580 3300009147 Bacteria 9634
287 Ga0114129_10140383 3300009147 Bacteria 3312
288 Ga0114129_10188675 3300009147 Bacteria 2801
289 Ga0105243_10000175 3300009148 Bacteria 73728
290 Ga0105243_10111941 3300009148 Bacteria 2286
291 Ga0105241_10000734 3300009174 Bacteria 24869
292 Ga0105241_10089568 3300009174 Bacteria 2424
293 Ga0105242_10000170 3300009176 Bacteria 49285
294 Ga0105242_10006360 3300009176 Bacteria 9093
295 Ga0105248_10003499 3300009177 Bacteria 17428
296 Ga0105248_10041608 3300009177 Bacteria 5152
297 Ga0105237_10003191 3300009545 Bacteria 19674
298 Ga0105237_10277457 3300009545 Bacteria 1678
299 Ga0105238_10024404 3300009551 Bacteria 6164
300 Ga0105238_10044753 3300009551 Bacteria 4474
301 Ga0105238_10114492 3300009551 Bacteria 2676
302 Ga0105249_10000200 3300009553 Bacteria 68748
303 Ga0105249_10001979 3300009553 Bacteria 17784
304 Ga0105249_10031218 3300009553 Bacteria 4817
305 Ga0105249_10097718 3300009553 Bacteria 2757
306 Ga0105028_101008 3300009993 Bacteria 2963
307 Ga0099796_10018771 3300010159 Bacteria 2084
308 Ga0105239_10000834 3300010375 Bacteria 43762
309 Ga0105239_10072309 3300010375 Bacteria 3791
310 Ga0105239_10139482 3300010375 Bacteria 2701
311 Ga0105246_10000050 3300011119 Bacteria 46833
312 Ga0105246_10011442 3300011119 Bacteria 5506
313 Ga0105246_10034114 3300011119 Bacteria 3387
314 Ga0105246_10057597 3300011119 Bacteria 2689
315 Ga0105246_10125434 3300011119 Bacteria 1909
316 Ga0157373_10017166 3300013100 Bacteria 5270
317 Ga0157373_10018018 3300013100 Bacteria 5142
318 Ga0157371_10007981 3300013102 Bacteria 8489
319 Ga0157370_10109350 3300013104 Bacteria 2584
320 Ga0157369_10021427 3300013105 Bacteria 7230
321 Ga0157369_10169139 3300013105 Bacteria 2304
322 Ga0157374_10001431 3300013296 Bacteria 20169
323 Ga0157374_10088930 3300013296 Bacteria 2942
324 Ga0157378_10006074 3300013297 Bacteria 10583
325 Ga0157378_10129703 3300013297 Bacteria 2333
326 Ga0163162_10000222 3300013306 Bacteria 52141
327 Ga0163162_10035770 3300013306 Bacteria 4947
328 Ga0163162_10121040 3300013306 Bacteria 2722
329 Ga0163162_10347773 3300013306 Bacteria 1615
330 Ga0157372_10001777 3300013307 Bacteria 23400
331 Ga0157372_10021316 3300013307 Bacteria 7000
332 Ga0157372_10243511 3300013307 Bacteria 2087
333 Ga0157375_10001098 3300013308 Bacteria 23463
334 Ga0157375_10018638 3300013308 Bacteria 6298
335 Ga0163163_10027403 3300014325 Bacteria 5458
336 Ga0163163_10053639 3300014325 Bacteria 3980
337 Ga0163163_10088724 3300014325 Bacteria 3104
338 Ga0157380_10000361 3300014326 Bacteria 27316
339 Ga0157377_10004957 3300014745 Bacteria 6205
340 Ga0157377_10023608 3300014745 Bacteria 3262
341 Ga0157379_10000036 3300014968 Bacteria 81888
342 Ga0157379_10057748 3300014968 Bacteria 3468
343 Ga0157379_10067881 3300014968 Bacteria 3188
344 Ga0157376_10000062 3300014969 Bacteria 89308
345 Ga0157376_10030914 3300014969 Bacteria 4282
346 Ga0157376_10212831 3300014969 Bacteria 1785
347 Ga0163161_10001820 3300017792 Bacteria 15566
348 Ga0228598_1000942 3300024227 Bacteria 6333
349 Ga0209565_1003492 3300025263 Bacteria 5055
350 Ga0207666_1000015 3300025271 Bacteria 41241
351 Ga0207673_1000090 3300025290 Bacteria 8154
352 Ga0209675_1005245 3300025291 Bacteria 5481
353 Ga0209025_1000342 3300025294 Bacteria 102758
354 Ga0209564_1000192 3300025295 Bacteria 142456
355 Ga0209758_1000686 3300025297 Bacteria 50478
356 Ga0209256_1000544 3300025299 Bacteria 54207
357 Ga0209051_1016947 3300025303 Bacteria 3272
358 Ga0209051_1029224 3300025303 Bacteria 2161
359 Ga0207697_10000088 3300025315 Bacteria 41270
360 Ga0207697_10005807 3300025315 Bacteria 5682
361 Ga0207713_1022956 3300025735 Bacteria 2948
362 Ga0207653_10002386 3300025885 Bacteria 5988
363 Ga0207653_10012179 3300025885 Bacteria 2686
364 Ga0207682_10000004 3300025893 Bacteria 104760
365 Ga0207692_10026808 3300025898 Bacteria 2707
366 Ga0207642_10000417 3300025899 Bacteria 12856
367 Ga0207688_10000042 3300025901 Bacteria 44479
368 Ga0207647_10000417 3300025904 Bacteria 35010
369 Ga0207685_10003166 3300025905 Bacteria 3947
370 Ga0207685_10037396 3300025905 Bacteria 1787
371 Ga0207699_10020174 3300025906 Bacteria 3567
372 Ga0207645_10000061 3300025907 Bacteria 77457
373 Ga0207645_10077287 3300025907 Bacteria 2133
374 Ga0207645_10090234 3300025907 Bacteria 1971
375 Ga0207643_10000012 3300025908 Bacteria 133318
376 Ga0207684_10000066 3300025910 Bacteria 193406
377 Ga0207684_10219800 3300025910 Bacteria 1640
378 Ga0207654_10000581 3300025911 Bacteria 20669
379 Ga0207654_10053761 3300025911 Bacteria 2326
380 Ga0207707_10001928 3300025912 Bacteria 18863
381 Ga0207707_10009733 3300025912 Bacteria 8338
382 Ga0207707_10029378 3300025912 Bacteria 4805
383 Ga0207707_10040883 3300025912 Bacteria 4049
384 Ga0207707_10057798 3300025912 Bacteria 3375
385 Ga0207695_10247441 3300025913 Bacteria 1683
386 Ga0207671_10003107 3300025914 Bacteria 16888
387 Ga0207671_10216255 3300025914 Bacteria 1500
388 Ga0207693_10012950 3300025915 Bacteria 6731
389 Ga0207693_10047664 3300025915 Bacteria 3366
390 Ga0207693_10059037 3300025915 Bacteria 3005
391 Ga0207693_10075663 3300025915 Bacteria 2636
392 Ga0207663_10004390 3300025916 Bacteria 7002
393 Ga0207663_10077058 3300025916 Bacteria 2169
394 Ga0207660_10000008 3300025917 Bacteria 98521
395 Ga0207660_10035859 3300025917 Bacteria 3445
396 Ga0207660_10053316 3300025917 Bacteria 2882
397 Ga0207660_10062872 3300025917 Bacteria 2675
398 Ga0207662_10000097 3300025918 Bacteria 41243
399 Ga0207662_10008531 3300025918 Bacteria 5615
400 Ga0207657_10000503 3300025919 Bacteria 41249
401 Ga0207657_10002034 3300025919 Bacteria 21867
402 Ga0207657_10005565 3300025919 Bacteria 13156
403 Ga0207657_10006399 3300025919 Bacteria 12225
404 Ga0207657_10050796 3300025919 Bacteria 3606
405 Ga0207649_10000099 3300025920 Bacteria 71350
406 Ga0207649_10062359 3300025920 Bacteria 2350
407 Ga0207649_10124387 3300025920 Bacteria 1743
408 Ga0207652_10001041 3300025921 Bacteria 25403
409 Ga0207652_10036225 3300025921 Bacteria 4171
410 Ga0207652_10075246 3300025921 Bacteria 2942
411 Ga0207652_10088968 3300025921 Bacteria 2710
412 Ga0207652_10093513 3300025921 Bacteria 2646
413 Ga0207681_10000141 3300025923 Bacteria 59951
414 Ga0207681_10027920 3300025923 Bacteria 3654
415 Ga0207694_10067329 3300025924 Bacteria 2795
416 Ga0207694_10106056 3300025924 Bacteria 2231
417 Ga0207694_10148905 3300025924 Bacteria 1885
418 Ga0207650_10037187 3300025925 Bacteria 3546
419 Ga0207659_10000023 3300025926 Bacteria 142947
420 Ga0207659_10069445 3300025926 Bacteria 2566
421 Ga0207687_10000319 3300025927 Bacteria 32748
422 Ga0207687_10234373 3300025927 Bacteria 1451
423 Ga0207700_10001421 3300025928 Bacteria 13591
424 Ga0207700_10187398 3300025928 Bacteria 1736
425 Ga0207664_10077373 3300025929 Bacteria 2695
426 Ga0207664_10259902 3300025929 Bacteria 1518
427 Ga0207644_10002839 3300025931 Bacteria 11173
428 Ga0207644_10020120 3300025931 Bacteria 4534
429 Ga0207644_10040702 3300025931 Bacteria 3285
430 Ga0207644_10140094 3300025931 Bacteria 1862
431 Ga0207690_10000105 3300025932 Bacteria 68515
432 Ga0207690_10011305 3300025932 Bacteria 5334
433 Ga0207690_10066808 3300025932 Bacteria 2464
434 Ga0207690_10092272 3300025932 Bacteria 2142
435 Ga0207690_10206635 3300025932 Bacteria 1495
436 Ga0207706_10000438 3300025933 Bacteria 44481
437 Ga0207706_10005771 3300025933 Bacteria 11519
438 Ga0207706_10018772 3300025933 Bacteria 6220
439 Ga0207686_10000140 3300025934 Bacteria 56605
440 Ga0207686_10081326 3300025934 Bacteria 2114
441 Ga0207686_10183869 3300025934 Bacteria 1484
442 Ga0207709_10000555 3300025935 Bacteria 31887
443 Ga0207670_10000108 3300025936 Bacteria 56906
444 Ga0207670_10020222 3300025936 Bacteria 4086
445 Ga0207670_10137775 3300025936 Bacteria 1796
446 Ga0207669_10000110 3300025937 Bacteria 40953
447 Ga0207704_10000311 3300025938 Bacteria 22858
448 Ga0207704_10031084 3300025938 Bacteria 3002
449 Ga0207704_10132763 3300025938 Bacteria 1728
450 Ga0207665_10039314 3300025939 Bacteria 3154
451 Ga0207665_10062505 3300025939 Bacteria 2526
452 Ga0207665_10064480 3300025939 Bacteria 2489
453 Ga0207665_10065992 3300025939 Bacteria 2462
454 Ga0207691_10002227 3300025940 Bacteria 18970
455 Ga0207691_10012621 3300025940 Bacteria 8097
456 Ga0207691_10253084 3300025940 Bacteria 1520
457 Ga0207711_10029896 3300025941 Bacteria 4595
458 Ga0207711_10039174 3300025941 Bacteria 4031
459 Ga0207711_10076263 3300025941 Bacteria 2919
460 Ga0207711_10106289 3300025941 Bacteria 2490
461 Ga0207689_10000008 3300025942 Bacteria 127942
462 Ga0207689_10015683 3300025942 Bacteria 6415
463 Ga0207689_10087951 3300025942 Bacteria 2552
464 Ga0207661_10000053 3300025944 Bacteria 90600
465 Ga0207661_10025579 3300025944 Bacteria 4489
466 Ga0207661_10139930 3300025944 Bacteria 2082
467 Ga0207679_10000053 3300025945 Bacteria 109038
468 Ga0207679_10039419 3300025945 Bacteria 3373
469 Ga0207667_10015140 3300025949 Bacteria 8771
470 Ga0207667_10083412 3300025949 Bacteria 3309
471 Ga0207667_10192987 3300025949 Bacteria 2090
472 Ga0207667_10454537 3300025949 Bacteria 1301
473 Ga0207651_10000068 3300025960 Bacteria 46552
474 Ga0207651_10014018 3300025960 Bacteria 4613
475 Ga0207712_10000156 3300025961 Bacteria 70300
476 Ga0207712_10001652 3300025961 Bacteria 15007
477 Ga0207712_10049589 3300025961 Bacteria 2926
478 Ga0207668_10000160 3300025972 Bacteria 47008
479 Ga0207668_10028914 3300025972 Bacteria 3629
480 Ga0207640_10000325 3300025981 Bacteria 31933
481 Ga0207640_10043437 3300025981 Bacteria 2873
482 Ga0207658_10002013 3300025986 Bacteria 15161
483 Ga0207677_10000725 3300026023 Bacteria 19286
484 Ga0207703_10010327 3300026035 Bacteria 7311
485 Ga0207703_10040038 3300026035 Bacteria 3749
486 Ga0207703_10098851 3300026035 Bacteria 2469
487 Ga0207639_10001357 3300026041 Bacteria 16508
488 Ga0207678_10000185 3300026067 Bacteria 53359
489 Ga0207678_10016922 3300026067 Bacteria 6401
490 Ga0207678_10036524 3300026067 Bacteria 4276
491 Ga0207678_10037864 3300026067 Bacteria 4194
492 Ga0207678_10081605 3300026067 Bacteria 2768
493 Ga0207708_10000263 3300026075 Bacteria 41243
494 Ga0207708_10005100 3300026075 Bacteria 9690
495 Ga0207708_10012235 3300026075 Bacteria 6398
496 Ga0207702_10003403 3300026078 Bacteria 14564
497 Ga0207702_10047122 3300026078 Bacteria 3631
498 Ga0207702_10116208 3300026078 Bacteria 2387
499 Ga0207641_10002301 3300026088 Bacteria 17758
500 Ga0207641_10050621 3300026088 Bacteria 3515
501 Ga0207641_10174707 3300026088 Bacteria 1963
502 Ga0207648_10000469 3300026089 Bacteria 45034
503 Ga0207648_10015456 3300026089 Bacteria 7019
504 Ga0207676_10000627 3300026095 Bacteria 28676
505 Ga0207676_10011543 3300026095 Bacteria 6318
506 Ga0207674_10148116 3300026116 Bacteria 2305
507 Ga0207675_100000342 3300026118 Bacteria 44471
508 Ga0207675_100029898 3300026118 Bacteria 5072
509 Ga0207683_10000006 3300026121 Bacteria 181260
510 Ga0207683_10011184 3300026121 Bacteria 7652
511 Ga0207683_10087706 3300026121 Bacteria 2767
512 Ga0207683_10208565 3300026121 Bacteria 1778
513 Ga0207698_10005210 3300026142 Bacteria 7997
514 Ga0209179_1001657 3300027512 Bacteria 2811
515 Ga0209282_1000047 3300027666 Bacteria 114735
516 Ga0209588_1000010 3300027671 Bacteria 159025
517 Ga0209588_1001995 3300027671 Bacteria 5488
518 Ga0209588_1011821 3300027671 Bacteria 2643
519 Ga0209588_1039425 3300027671 Bacteria 1523
520 Ga0209966_1001571 3300027695 Bacteria 3939
521 Ga0209998_10000664 3300027717 Bacteria 9175
522 Ga0209974_10003275 3300027876 Bacteria 5852
523 Ga0207428_10000075 3300027907 Bacteria 137887
524 Ga0207428_10000112 3300027907 Bacteria 110733
525 Ga0207428_10000480 3300027907 Bacteria 48240
526 Ga0268266_10105519 3300028379 Bacteria 2489
527 Ga0268266_10221057 3300028379 Bacteria 1741
528 Ga0268265_10000257 3300028380 Bacteria 60485
529 Ga0268265_10009421 3300028380 Bacteria 6595
530 Ga0268265_10048114 3300028380 Bacteria 3199
531 Ga0268265_10064443 3300028380 Bacteria 2823
532 Ga0268264_10002039 3300028381 Bacteria 18053
533 Ga0268264_10011002 3300028381 Bacteria 7469
534 Ga0268264_10070956 3300028381 Bacteria 2950
535 Ga0268264_10130404 3300028381 Bacteria 2227
536 Ga0265325_10000034 3300031241 Bacteria 99371
537 Ga0265313_10016591 3300031595 Bacteria 4227
538 Ga0265314_10036528 3300031711 Bacteria 3569
539 Ga0265314_10144430 3300031711 Bacteria 1467
540 Ga0265342_10000548 3300031712 Bacteria 39664
541 Ga0316576_10083808 3300031727 Bacteria 2369
542 Ga0316578_10047930 3300031728 Bacteria 2494
543 Ga0307409_100238099 3300031995 Bacteria 1655
544 Ga0307411_10204415 3300032005 Bacteria 1520
545 Ga0316583_10027828 3300032133 Bacteria 2018
546 Ga0373930_0000060 3300034816 Bacteria 10351
547 Ga0373948_0000125 3300034817 Bacteria 8042
548 Ga0373948_0019439 3300034817 Bacteria 1285
549 Ga0373950_0000139 3300034818 Bacteria 12047
550 Ga0373958_0000692 3300034819 Bacteria 4276
551 Ga0373959_0010573 3300034820 Bacteria 1614
552 Ga0373938_0000349 3300034957 Bacteria 7321
553 Ga0373926_0006426 3300035083 Bacteria 3904
554 Ga0373926_0047993 3300035083 Bacteria 1535
555 Ga0373928_0001321 3300035084 Bacteria 4863
556 Ga0373929_0000087 3300035085 Bacteria 15309
557 Ga0373929_0002044 3300035085 Bacteria 3754
558 Ga0373934_0009030 3300035086 Bacteria 3728
559 Ga0373940_0004502 3300035088 Bacteria 2948
560 Ga0373940_0019540 3300035088 Bacteria 1713
561 Ga0373944_0032387 3300035089 Bacteria 1578
562 Ga0373949_0001366 3300035090 Bacteria 7017
563 Ga0373949_0012705 3300035090 Bacteria 1864
564 Ga0373949_0017573 3300035090 Bacteria 1614
565 Ga0373951_0004558 3300035091 Bacteria 3282
566 Ga0373951_0011265 3300035091 Bacteria 2007
567 Ga0373951_0013149 3300035091 Bacteria 1861
568 Ga0373952_0000321 3300035092 Bacteria 8064
569 Ga0373952_0000488 3300035092 Bacteria 6914
570 Ga0373923_0017242 3300035111 Bacteria 2759
571 Ga0373923_0088357 3300035111 Bacteria 1353
572 Ga0373932_0000929 3300035112 Bacteria 8564
573 Ga0373932_0007849 3300035112 Bacteria 2546
574 Ga0373932_0008954 3300035112 Bacteria 2399
575 Ga0373936_0009253 3300035113 Bacteria 3713
576 Ga0373939_0001497 3300035114 Bacteria 5664
577 Ga0373939_0002435 3300035114 Bacteria 4388
578 Ga0373939_0026430 3300035114 Bacteria 1636
579 Ga0373941_0000030 3300035115 Bacteria 21511
580 Ga0373941_0003622 3300035115 Bacteria 3519
581 Ga0373945_0010659 3300035116 Bacteria 3031
582 Ga0373945_0052714 3300035116 Bacteria 1499
583 Ga0373953_0009712 3300035117 Bacteria 3322
584 Ga0373954_0029211 3300035118 Bacteria 2538
585 Ga0373956_0019944 3300035119 Bacteria 2848
586 Ga0373956_0027433 3300035119 Bacteria 2472
587 Ga0373960_0000466 3300035121 Bacteria 7999
588 Ga0373960_0027645 3300035121 Bacteria 1559
589 Ga0373943_0000781 3300035170 Bacteria 13925
590 Ga0373943_0044727 3300035170 Bacteria 2155
591 Ga0373946_0015707 3300035171 Bacteria 2875
592 Ga0373955_0051287 3300035172 Bacteria 2247
593 Ga0373942_0000232 3300035207 Bacteria 14790
594 Ga0373961_0000887 3300035241 Bacteria 10058
595 Ga0373962_0001028 3300035242 Bacteria 6456
596 Ga0373962_0003491 3300035242 Bacteria 3777
597 Ga0373962_0014269 3300035242 Bacteria 2023
598 Ga0316574_0005325 3300035398 Bacteria 6855
599 Ga0373931_0000084 3300035691 Bacteria 44377
600 Ga0373931_0003622 3300035691 Bacteria 6976
601 Ga0373931_0004555 3300035691 Bacteria 6342
602 Ga0373931_0004664 3300035691 Bacteria 6272
603 Ga0373931_0006426 3300035691 Bacteria 5491
604 Ga0373931_0041086 3300035691 Bacteria 2428
605 Ga0373935_0081768 3300035692 Bacteria 2101
606 Ga0373935_0082180 3300035692 Bacteria 2095
607 Ga0373927_0000968 3300035695 Bacteria 21802
608 Ga0373927_0017152 3300035695 Bacteria 4771
609 Ga0373927_0053980 3300035695 Bacteria 2599
610 Ga0373927_0068067 3300035695 Bacteria 2304
611 Ga0373933_0009993 3300035724 Bacteria 5196
612 Ga0373933_0013538 3300035724 Bacteria 4523
613 Ga0373947_0008044 3300035725 Bacteria 6083
614 Ga0373947_0032192 3300035725 Bacteria 3089
615 Ga0373947_0037935 3300035725 Bacteria 2860
616 Ga0373937_0009714 3300036401 Bacteria 8387
617 Ga0373937_0022169 3300036401 Bacteria 5706
618 Ga0373937_0034178 3300036401 Bacteria 4624
619 Ga0373937_0140640 3300036401 Bacteria 2258
620 Ga0373937_0245070 3300036401 Bacteria 1689
621 Ga0316584_0003417 3300036712 Bacteria 10301
622 Ga0373925_0006677 3300037068 Bacteria 8462
623 Ga0373925_0021394 3300037068 Bacteria 4712
624 Ga0373925_0142403 3300037068 Bacteria 1877
625 Ga0395900_0023743 3300037418 Bacteria 6273
626 Ga0395901_0102198 3300038443 Bacteria 3008
627 Ga0439441_009034 3300042001 Bacteria 1642
628 Ga0439448_0046737 3300042005 Bacteria 1411
629 Ga0439435_0029198 3300042436 Bacteria 1487
630 Ga0466963_0032976 3300044694 Bacteria 3358
631 Ga0451576_0279840 3300045051 Bacteria 1744
632 Ga0466958_0022175 3300045836 Bacteria 3718
633 Ga0466967_0059363 3300045976 Bacteria 3385
634 Ga0466967_0249303 3300045976 Bacteria 1696
635 Ga0495627_043794 3300046453 Bacteria 1367
636 Ga0495592_0048841 3300046454 Bacteria 3146
637 Ga0495592_0061350 3300046454 Bacteria 2763
638 Ga0495603_0002293 3300046455 Bacteria 11243
639 Ga0495603_0005366 3300046455 Bacteria 7643
640 Ga0495603_0010934 3300046455 Bacteria 5505
641 Ga0495603_0020881 3300046455 Bacteria 3964
642 Ga0495591_000044 3300046458 Bacteria 145782
643 Ga0495591_038988 3300046458 Bacteria 1364
644 Ga0495629_0001364 3300046459 Bacteria 19250
645 Ga0495629_0002564 3300046459 Bacteria 13928
646 Ga0495629_0002876 3300046459 Bacteria 13160
647 Ga0495629_0026084 3300046459 Bacteria 4153
648 Ga0495629_0108131 3300046459 Bacteria 1939
649 Ga0495641_0006473 3300046461 Bacteria 7578
650 Ga0495641_0010975 3300046461 Bacteria 5201
651 Ga0495641_0038439 3300046461 Bacteria 2236
652 Ga0495651_0002023 3300046462 Bacteria 15661
653 Ga0495651_0031770 3300046462 Bacteria 4115
654 Ga0495651_0045157 3300046462 Bacteria 3414
655 Ga0495653_0004459 3300046463 Bacteria 11307
656 Ga0495653_0021421 3300046463 Bacteria 5237
657 Ga0495653_0096499 3300046463 Bacteria 2149
658 Ga0495650_0002409 3300046471 Bacteria 15230
659 Ga0495580_0005184 3300046472 Bacteria 10831
660 Ga0495580_0005516 3300046472 Bacteria 10443
661 Ga0495580_0111760 3300046472 Bacteria 1897
662 Ga0495582_0001095 3300046473 Bacteria 15194
663 Ga0495582_0003419 3300046473 Bacteria 8939
664 Ga0495582_0008108 3300046473 Bacteria 5800
665 Ga0495605_0000036 3300046474 Bacteria 203902
666 Ga0495605_0000319 3300046474 Bacteria 50232
667 Ga0495605_0003147 3300046474 Bacteria 9933
668 Ga0495639_0000941 3300046475 Bacteria 13166
669 Ga0495662_0002531 3300046476 Bacteria 9221
670 Ga0495662_0025584 3300046476 Bacteria 2850
671 Ga0495664_0000979 3300046477 Bacteria 14686
672 Ga0495664_0008006 3300046477 Bacteria 5884
673 Ga0495664_0050000 3300046477 Bacteria 2481
674 Ga0495664_0141863 3300046477 Bacteria 1457
675 Ga0495584_0011697 3300046491 Bacteria 4489
676 Ga0495584_0012196 3300046491 Bacteria 4391
677 Ga0495584_0025149 3300046491 Bacteria 3018
678 Ga0495585_0000899 3300046492 Bacteria 25182
679 Ga0495585_0002650 3300046492 Bacteria 12574
680 Ga0495585_0013050 3300046492 Bacteria 4874
681 Ga0495594_0005004 3300046499 Bacteria 6820
682 Ga0495594_0028196 3300046499 Bacteria 3028
683 Ga0495594_0031578 3300046499 Bacteria 2872
684 Ga0495594_0060733 3300046499 Bacteria 2091
685 Ga0495594_0077807 3300046499 Bacteria 1850
686 Ga0495596_0000011 3300046500 Bacteria 129089
687 Ga0495596_0011112 3300046500 Bacteria 3894
688 Ga0495607_0000033 3300046501 Bacteria 149382
689 Ga0495607_0000082 3300046501 Bacteria 96822
690 Ga0495607_0012207 3300046501 Bacteria 5679
691 Ga0495583_0000028 3300046506 Bacteria 255787
692 Ga0495583_0011248 3300046506 Bacteria 5151
693 Ga0495583_0055560 3300046506 Bacteria 1789
694 Ga0495608_0001643 3300046511 Bacteria 16062
695 Ga0495608_0026473 3300046511 Bacteria 3953
696 Ga0495608_0032300 3300046511 Bacteria 3538
697 Ga0495610_0000335 3300046512 Bacteria 49783
698 Ga0495610_0002063 3300046512 Bacteria 17146
699 Ga0495616_0003531 3300046513 Bacteria 9994
700 Ga0495618_0043626 3300046514 Bacteria 2829
701 Ga0495620_0000073 3300046515 Bacteria 83446
702 Ga0495628_0006647 3300046516 Bacteria 10080
703 Ga0495628_0043855 3300046516 Bacteria 3560
704 Ga0495628_0079987 3300046516 Bacteria 2541
705 Ga0495628_0118039 3300046516 Bacteria 2037
706 Ga0495630_0002437 3300046517 Bacteria 12871
707 Ga0495630_0054346 3300046517 Bacteria 3000
708 Ga0495630_0169213 3300046517 Bacteria 1664
709 Ga0495631_0007352 3300046518 Bacteria 5608
710 Ga0495631_0028388 3300046518 Bacteria 2552
711 Ga0495637_0003222 3300046520 Bacteria 8711
712 Ga0495637_0097548 3300046520 Bacteria 1152
713 Ga0495643_0002991 3300046522 Bacteria 12766
714 Ga0495644_0000445 3300046523 Bacteria 18207
715 Ga0495648_0000560 3300046524 Bacteria 39735
716 Ga0495648_0006076 3300046524 Bacteria 9906
717 Ga0495648_0007025 3300046524 Bacteria 9075
718 Ga0495648_0010336 3300046524 Bacteria 7118
719 Ga0495663_0020250 3300046525 Bacteria 1908
720 Ga0495666_0007830 3300046526 Bacteria 5351
721 Ga0495666_0022256 3300046526 Bacteria 3138
722 Ga0495652_0022462 3300046529 Bacteria 5598
723 Ga0495652_0082426 3300046529 Bacteria 2650
724 Ga0495654_0000246 3300046530 Bacteria 50620
725 Ga0495665_0001379 3300046531 Bacteria 13002
726 Ga0495665_0004404 3300046531 Bacteria 7604
727 Ga0495640_0004511 3300046533 Bacteria 11101
728 Ga0495640_0090454 3300046533 Bacteria 2020
729 Ga0495586_0046796 3300046535 Bacteria 2333
730 Ga0495587_0001373 3300046536 Bacteria 16173
731 Ga0495587_0009992 3300046536 Bacteria 6060
732 Ga0495587_0018377 3300046536 Bacteria 4337
733 Ga0495609_0000115 3300046538 Bacteria 93419
734 Ga0495609_0000559 3300046538 Bacteria 29353
735 Ga0495609_0001063 3300046538 Bacteria 19233
736 Ga0495609_0009594 3300046538 Bacteria 4679
737 Ga0495621_0017424 3300046539 Bacteria 2322
738 Ga0495597_0000008 3300046542 Bacteria 232976
739 Ga0495597_0000635 3300046542 Bacteria 28659
740 Ga0495645_0002459 3300046543 Bacteria 12577
741 Ga0495645_0064572 3300046543 Bacteria 2648
742 Ga0495622_0036011 3300046557 Bacteria 2308
743 Ga0495622_0038051 3300046557 Bacteria 2240
744 Ga0495633_0000028 3300046558 Bacteria 203214
745 Ga0495633_0013577 3300046558 Bacteria 4286
746 Ga0495633_0030713 3300046558 Bacteria 2608
747 Ga0495667_0005892 3300046559 Bacteria 8299
748 Ga0495667_0047496 3300046559 Bacteria 2836
749 Ga0495656_0006622 3300046615 Bacteria 4067
750 Ga0495634_0002678 3300046642 Bacteria 14633
751 Ga0495634_0008593 3300046642 Bacteria 7584
752 Ga0495634_0080629 3300046642 Bacteria 2129
753 Ga0495611_0003757 3300046648 Bacteria 6629
754 Ga0495611_0005320 3300046648 Bacteria 5510
755 Ga0495611_0032581 3300046648 Bacteria 2297
756 Ga0495611_0087073 3300046648 Bacteria 1441
757 Ga0495625_0017966 3300046660 Bacteria 5528
758 Ga0495625_0128154 3300046660 Bacteria 1721
759 Ga0495635_0006445 3300046663 Bacteria 8183
760 Ga0495635_0007625 3300046663 Bacteria 7553
761 Ga0495635_0019101 3300046663 Bacteria 4784
762 Ga0495635_0033323 3300046663 Bacteria 3573
763 Ga0495659_0005289 3300046664 Bacteria 4061
764 Ga0495661_0000211 3300046665 Bacteria 67481
765 Ga0495661_0004192 3300046665 Bacteria 10483
766 Ga0495661_0009431 3300046665 Bacteria 6699
767 Ga0495661_0107314 3300046665 Bacteria 1561
768 Ga0495588_0012960 3300046674 Bacteria 3958
769 Ga0495588_0017586 3300046674 Bacteria 3476
770 Ga0495599_0002224 3300046678 Bacteria 11291
771 Ga0495599_0024296 3300046678 Bacteria 3790
772 Ga0495599_0044135 3300046678 Bacteria 2796
773 Ga0495599_0076830 3300046678 Bacteria 2085
774 Ga0495623_0003831 3300046679 Bacteria 9913
775 Ga0495623_0005546 3300046679 Bacteria 8244
776 Ga0495646_0001750 3300046680 Bacteria 13032
777 Ga0495646_0028182 3300046680 Bacteria 3518
778 Ga0495647_0004940 3300046681 Bacteria 4366
779 Ga0495647_0006480 3300046681 Bacteria 3880
780 Ga0495658_0001147 3300046683 Bacteria 13988
781 Ga0495613_0003816 3300046689 Bacteria 11289
782 Ga0495613_0018669 3300046689 Bacteria 5171
783 Ga0495613_0060939 3300046689 Bacteria 2763
784 Ga0495613_0241970 3300046689 Unclassified 1261
785 Ga0495624_0007846 3300046690 Bacteria 7490
786 Ga0495624_0013237 3300046690 Bacteria 5623
787 Ga0495624_0091329 3300046690 Bacteria 1878
788 Ga0495670_0001286 3300046691 Bacteria 12255
789 Ga0495670_0019359 3300046691 Bacteria 3353
790 Ga0495670_0059085 3300046691 Bacteria 1925
791 Ga0495671_0000179 3300046692 Bacteria 56305
792 Ga0495671_0071420 3300046692 Bacteria 1705
793 Ga0495649_0001931 3300046694 Bacteria 15113
794 Ga0495649_0065973 3300046694 Bacteria 1943
795 Ga0495589_0009823 3300046794 Bacteria 4969
796 Ga0495600_0002906 3300046809 Bacteria 9980
797 Ga0495600_0020354 3300046809 Bacteria 4244
798 Ga0495600_0020460 3300046809 Bacteria 4232
799 Ga0495600_0054673 3300046809 Bacteria 2608
800 Ga0495660_0001015 3300046810 Bacteria 20407
801 Ga0495660_0002289 3300046810 Bacteria 12310
802 Ga0495581_0005187 3300047315 Bacteria 7538
803 Ga0495581_0071021 3300047315 Bacteria 2014
804 Ga0495581_0075967 3300047315 Bacteria 1943
805 Ga0495581_0141111 3300047315 Bacteria 1405
806 Ga0495604_0004474 3300047317 Bacteria 11072
807 Ga0495604_0007920 3300047317 Bacteria 8416
808 Ga0495604_0030565 3300047317 Bacteria 4277
809 Ga0495636_0031170 3300047318 Bacteria 2184
810 Ga0495636_0055328 3300047318 Bacteria 1669
811 Ga0495674_0006076 3300047319 Bacteria 11590
812 Ga0495672_0017357 3300047320 Bacteria 4815
813 Ga0495672_0035475 3300047320 Bacteria 3072
814 Ga0495676_0008485 3300047321 Bacteria 9414
815 Ga0495676_0048913 3300047321 Bacteria 3404
816 Ga0495676_0058169 3300047321 Bacteria 3043
817 Ga0495676_0149108 3300047321 Bacteria 1667
818 Ga0495680_0001681 3300047322 Bacteria 23530
819 Ga0495680_0006455 3300047322 Bacteria 10892
820 Ga0495680_0012029 3300047322 Bacteria 7635
821 Ga0495680_0032432 3300047322 Bacteria 4240
822 Ga0495680_0080454 3300047322 Bacteria 2462
823 Ga0495683_0000091 3300047323 Bacteria 91313
824 Ga0495683_0113847 3300047323 Bacteria 1289
825 Ga0495687_000002 3300047443 Bacteria 1085770
826 Ga0495675_0009789 3300047444 Bacteria 5977
827 Ga0495679_000083 3300047446 Bacteria 87051
828 Ga0495679_002640 3300047446 Bacteria 9002
829 Ga0495685_061532 3300047447 Bacteria 1264
830 Ga0495673_0012965 3300047469 Bacteria 4393
831 Ga0495673_0027281 3300047469 Bacteria 2720
832 Ga0495681_0009092 3300047470 Bacteria 6157
833 Ga0495684_0016404 3300047471 Bacteria 5704
834 Ga0495593_0000213 3300047673 Bacteria 30598
835 Ga0495593_0002662 3300047673 Bacteria 10743
836 Ga0495602_0026191 3300048088 Bacteria 5628
837 Ga0495602_0067255 3300048088 Bacteria 3083
838 Ga0495602_0184897 3300048088 Bacteria 1603
839 Ga0495614_0002734 3300048089 Bacteria 7845
840 Ga0495614_0074068 3300048089 Bacteria 1470
841 Ga0495626_0023131 3300048091 Bacteria 3063
842 Ga0496100_0002401 3300048903 Bacteria 9490
843 Ga0496100_0011288 3300048903 Bacteria 5082
844 Ga0496100_0015342 3300048903 Bacteria 4473
845 Ga0496100_0023500 3300048903 Bacteria 3746
846 Ga0496100_0049331 3300048903 Bacteria 2721
847 Ga0496101_0000360 3300048904 Bacteria 30528
848 Ga0496101_0034661 3300048904 Bacteria 3566
849 Ga0496102_0013402 3300048905 Bacteria 7101
850 Ga0496102_0021629 3300048905 Bacteria 5690
851 Ga0496102_0029699 3300048905 Bacteria 4892
852 Ga0496102_0070994 3300048905 Bacteria 3198
853 Ga0496102_0173607 3300048905 Bacteria 2029
854 Ga0496102_0472319 3300048905 Bacteria 1175
855 Ga0496103_0001517 3300048906 Bacteria 15519
856 Ga0496103_0026444 3300048906 Bacteria 3513
857 Ga0496103_0090279 3300048906 Bacteria 1933
858 Ga0496104_0022869 3300048907 Bacteria 5743
859 Ga0496104_0081924 3300048907 Bacteria 3077
860 Ga0496104_0105690 3300048907 Bacteria 2697
861 Ga0496104_0125578 3300048907 Bacteria 2464
862 Ga0496105_0003179 3300048908 Bacteria 12107
863 Ga0496105_0012959 3300048908 Bacteria 6606
864 Ga0496105_0042530 3300048908 Bacteria 3745
865 Ga0496106_0000679 3300048909 Bacteria 24408
866 Ga0496106_0004879 3300048909 Bacteria 9930
867 Ga0496106_0065356 3300048909 Bacteria 2769
868 Ga0496106_0128690 3300048909 Bacteria 1984
869 Ga0496106_0197995 3300048909 Bacteria 1598
870 Ga0496107_0000386 3300048910 Bacteria 23962
871 Ga0496107_0007583 3300048910 Bacteria 7488
872 Ga0496107_0019793 3300048910 Bacteria 4751
873 Ga0496107_0070523 3300048910 Bacteria 2537
874 Ga0496108_0011200 3300048911 Bacteria 7288
875 Ga0496108_0091346 3300048911 Bacteria 2588
876 Ga0496108_0107114 3300048911 Bacteria 2387
877 Ga0496108_0261005 3300048911 Bacteria 1507
878 Ga0496109_0007323 3300048912 Bacteria 9331
879 Ga0496109_0018945 3300048912 Bacteria 6060
880 Ga0496109_0041883 3300048912 Bacteria 4148
881 Ga0496109_0087652 3300048912 Bacteria 2875
882 Ga0496109_0104430 3300048912 Bacteria 2631
883 Ga0496109_0143345 3300048912 Bacteria 2234
884 Ga0496110_0013940 3300048913 Bacteria 6660
885 Ga0496110_0031751 3300048913 Bacteria 4559
886 Ga0496110_0052111 3300048913 Bacteria 3596
887 Ga0496110_0305637 3300048913 Bacteria 1449
888 Ga0496111_0067605 3300048914 Bacteria 2596
889 Ga0496111_0123973 3300048914 Bacteria 1909
890 Ga0496112_0000017 3300048915 Bacteria 191284
891 Ga0496112_0022724 3300048915 Bacteria 5982
892 Ga0496112_0050647 3300048915 Bacteria 4073
893 Ga0496112_0111560 3300048915 Bacteria 2704
894 Ga0496112_0156680 3300048915 Bacteria 2244
895 Ga0496113_0113326 3300048916 Bacteria 2113
896 Ga0496114_0006840 3300048917 Bacteria 8982
897 Ga0496114_0032476 3300048917 Bacteria 4296
898 Ga0496114_0224754 3300048917 Bacteria 1648
899 Ga0496115_0018716 3300048918 Bacteria 5324
900 Ga0496115_0033229 3300048918 Bacteria 4071
901 Ga0496115_0206352 3300048918 Bacteria 1623
902 Ga0496116_0001641 3300048919 Bacteria 24629
903 Ga0496121_0004777 3300048924 Bacteria 17872
904 Ga0496122_0143010 3300048925 Bacteria 1492
905 Ga0496123_0000340 3300048926 Bacteria 88113
906 Ga0496125_0004305 3300048928 Bacteria 16526
907 Ga0496125_0134661 3300048928 Bacteria 1731
908 Ga0496126_0147413 3300048929 Bacteria 2020
909 Ga0495678_000020 3300049459 Bacteria 253654
910 Ga0501032_0020697 3300049569 Bacteria 4580
911 Ga0501034_0000439 3300049571 Bacteria 68932
912 Ga0501034_0005470 3300049571 Bacteria 13871
913 Ga0501034_0014991 3300049571 Bacteria 7973
914 Ga0501034_0201518 3300049571 Bacteria 1948
915 Ga0501034_0209403 3300049571 Bacteria 1905
916 Ga0501036_0313163 3300049572 Bacteria 1312
917 Ga0501037_0044470 3300049573 Bacteria 3261
918 Ga0501038_0021068 3300049574 Bacteria 5855
919 Ga0501039_0162645 3300049575 Bacteria 1755
920 Ga0501040_0107608 3300049576 Bacteria 1949
921 Ga0501041_0022442 3300049577 Bacteria 3779
922 Ga0501042_0142079 3300049578 Bacteria 1731
923 Ga0501046_0037085 3300049580 Bacteria 3919
924 Ga0501046_0246865 3300049580 Bacteria 1315
925 Ga0501047_0007433 3300049581 Bacteria 10312
926 Ga0501047_0015501 3300049581 Bacteria 7262
927 Ga0501048_0055678 3300049582 Bacteria 2807
928 Ga0501068_0016141 3300049584 Bacteria 4302
929 Ga0501068_0102849 3300049584 Bacteria 1771
930 Ga0501069_0030851 3300049585 Bacteria 2945
931 Ga0501070_0025724 3300049586 Bacteria 4937
932 Ga0501071_0094480 3300049587 Bacteria 2199
933 Ga0501072_0100920 3300049588 Bacteria 2294
934 Ga0501072_0241325 3300049588 Bacteria 1439
935 Ga0501074_0216582 3300049590 Bacteria 1364
936 Ga0501074_0238856 3300049590 Unclassified 1293
937 Ga0501075_0084985 3300049591 Bacteria 2397
938 Ga0501079_0020754 3300049741 Bacteria 5024
939 Ga0501079_0099656 3300049741 Bacteria 2252
940 Ga0501080_0009456 3300049742 Bacteria 8891
941 Ga0501080_0053356 3300049742 Bacteria 3763
942 Ga0501080_0119726 3300049742 Bacteria 2441
943 Ga0501081_0015200 3300049743 Bacteria 5078
944 Ga0501081_0096055 3300049743 Bacteria 2090
945 Ga0501083_0029362 3300049744 Bacteria 3783
946 Ga0501083_0115042 3300049744 Bacteria 1766
947 Ga0501035_0025138 3300049822 Bacteria 5460
948 Ga0501044_0035910 3300049823 Bacteria 5187
949 Ga0501045_0040220 3300049824 Bacteria 3403
950 nmdc:mga0k408_24978_c1 3300050493 Bacteria 3381
951 nmdc:mga06z11_120557_c2 3300050494 Bacteria 1155
952 nmdc:mga05p37_183054_c1 3300050507 Bacteria 2548
953 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
954 nmdc:mga05p37_82732_c1 3300050507 Bacteria 3956
955 nmdc:mga09592_104072_c1 3300050508 Bacteria 2432
956 nmdc:mga09592_3106_c1 3300050508 Bacteria 13485
957 nmdc:mga09592_62290_c1 3300050508 Bacteria 3156
958 nmdc:mga0qj67_1076_c1 3300050509 Bacteria 18902
959 nmdc:mga0qj67_25768_c1 3300050509 Bacteria 4548
960 nmdc:mga06r32_1541_c1 3300050510 Bacteria 20758
961 nmdc:mga06r32_1900_c1 3300050510 Bacteria 18601
962 nmdc:mga08y16_2892_c1 3300050511 Bacteria 17659
963 nmdc:mga08y16_377484_c1 3300050511 Bacteria 1453
964 nmdc:mga08y16_68965_c1 3300050511 Bacteria 3687
965 nmdc:mga0n895_1533_c1 3300050512 Bacteria 17365
966 nmdc:mga0n895_196240_c1 3300050512 Bacteria 2050
967 nmdc:mga0n895_4346_c1 3300050512 Bacteria 11615
968 nmdc:mga0rr50_1688_c1 3300050513 Bacteria 4280
969 nmdc:mga0rr50_75230_c1 3300050513 Bacteria 2588
970 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
971 nmdc:mga08x19_261_c1 3300050514 Bacteria 40081
972 nmdc:mga08x19_27532_c1 3300050514 Bacteria 3555
973 nmdc:mga08x19_59084_c1 3300050514 Bacteria 2482
974 nmdc:mga0a205_17203_c1 3300050515 Bacteria 6772
975 nmdc:mga0a205_19478_c1 3300050515 Bacteria 6398
976 nmdc:mga0a205_3714_c1 3300050515 Bacteria 13666
977 Ga0495601_0002962 3300053077 Bacteria 9658
978 Ga0495601_0031125 3300053077 Bacteria 3315
979 Ga0495601_0045485 3300053077 Bacteria 2760
980 Ga0495601_0060299 3300053077 Bacteria 2407
981 Ga0495601_0122809 3300053077 Bacteria 1688
982 Ga0495612_0002607 3300053078 Bacteria 7439
983 Ga0495612_0044417 3300053078 Bacteria 1818
984 Ga0495595_0003556 3300053084 Bacteria 6184
985 Ga0495595_0006128 3300053084 Bacteria 4887
986 Ga0495619_0003525 3300053085 Bacteria 10092
987 Ga0500593_004153 3300053117 Bacteria 5572
988 Ga0501084_0067166 3300054114 Bacteria 3001
989 Ga0501084_0101208 3300054114 Bacteria 2420
990 Ga0501082_0084114 3300060353 Bacteria 2744
991 Ga0530510_0025809 3300061734 Bacteria 4203
992 Ga0530510_0042593 3300061734 Bacteria 3280
993 Ga0530510_0425297 3300061734 Bacteria 1003

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0030713 Ga0495633_0030713_1642_2592 306
2 3300047323 Ga0495683_0113847 Ga0495683_0113847_17_967 306
3 3300046477 Ga0495664_0050000 Ga0495664_0050000_11_970 309
4 3300048905 Ga0496102_0472319 Ga0496102_0472319_200_1159 309
5 3300050494 nmdc:mga06z11_120557_c2 nmdc:mga06z11_120557_c2_37_996 309
6 3300061734 Ga0530510_0425297 Ga0530510_0425297_20_979 309
7 3300049741 Ga0501079_0020754 Ga0501079_0020754_65_1051 313
8 3300025942 Ga0207689_10087951 Ga0207689_100879513 323
9 3300049580 Ga0501046_0037085 Ga0501046_0037085_2348_3358 326
10 3300046520 Ga0495637_0097548 Ga0495637_0097548_14_1072 342
11 3300049587 Ga0501071_0094480 Ga0501071_0094480_816_1973 342
12 3300049588 Ga0501072_0241325 Ga0501072_0241325_142_1299 342
13 3300049742 Ga0501080_0009456 Ga0501080_0009456_337_1494 342
14 3300048911 Ga0496108_0107114 Ga0496108_0107114_403_1512 345
15 3300005336 Ga0070680_100129119 Ga0070680_1001291192 351
16 3300005366 Ga0070659_100067952 Ga0070659_1000679521 351
17 3300005614 Ga0068856_100342804 Ga0068856_1003428042 351
18 3300005616 Ga0068852_100008946 Ga0068852_1000089464 351
19 3300013105 Ga0157369_10169139 Ga0157369_101691392 351
20 3300025913 Ga0207695_10247441 Ga0207695_102474411 351
21 3300025919 Ga0207657_10005565 Ga0207657_100055654 351
22 3300025921 Ga0207652_10075246 Ga0207652_100752461 351
23 3300025932 Ga0207690_10206635 Ga0207690_102066352 351
24 3300025981 Ga0207640_10043437 Ga0207640_100434372 351
25 3300031595 Ga0265313_10016591 Ga0265313_100165913 351
26 3300031711 Ga0265314_10144430 Ga0265314_101444302 351
27 3300031712 Ga0265342_10000548 Ga0265342_1000054829 351
28 3300042005 Ga0439448_0046737 Ga0439448_0046737_16_1182 351
29 3300049581 Ga0501047_0007433 Ga0501047_0007433_1496_2662 351
30 3300050510 nmdc:mga06r32_1541_c1 nmdc:mga06r32_1541_c1_10018_11187 352
31 3300025939 Ga0207665_10064480 Ga0207665_100644802 353
32 3300061734 Ga0530510_0042593 Ga0530510_0042593_710_1879 354
33 3300035172 Ga0373955_0051287 Ga0373955_0051287_359_1609 355
34 3300005336 Ga0070680_100092537 Ga0070680_1000925372 356
35 3300005339 Ga0070660_100164961 Ga0070660_1001649611 356
36 3300005444 Ga0070694_100053384 Ga0070694_1000533842 356
37 3300005457 Ga0070662_100023831 Ga0070662_1000238312 356
38 3300005458 Ga0070681_10019233 Ga0070681_100192336 356
39 3300005546 Ga0070696_100025374 Ga0070696_1000253744 356
40 3300005547 Ga0070693_100010486 Ga0070693_1000104862 356
41 3300005615 Ga0070702_100041521 Ga0070702_1000415211 356
42 3300025911 Ga0207654_10053761 Ga0207654_100537611 356
43 3300025919 Ga0207657_10050796 Ga0207657_100507962 356
44 3300025933 Ga0207706_10018772 Ga0207706_100187726 356
45 3300026067 Ga0207678_10037864 Ga0207678_100378642 356
46 3300035090 Ga0373949_0017573 Ga0373949_0017573_317_1486 356
47 3300046690 Ga0495624_0091329 Ga0495624_0091329_462_1631 356
48 3300048910 Ga0496107_0070523 Ga0496107_0070523_1310_2479 356
49 3300054114 Ga0501084_0101208 Ga0501084_0101208_1269_2402 356
50 3300005329 Ga0070683_100061281 Ga0070683_1000612813 357
51 3300005437 Ga0070710_10010584 Ga0070710_100105843 357
52 3300005439 Ga0070711_100174145 Ga0070711_1001741452 357
53 3300005458 Ga0070681_10120122 Ga0070681_101201222 357
54 3300007076 Ga0075435_100020291 Ga0075435_1000202915 357
55 3300025912 Ga0207707_10057798 Ga0207707_100577982 357
56 3300025929 Ga0207664_10259902 Ga0207664_102599021 357
57 3300025939 Ga0207665_10065992 Ga0207665_100659922 357
58 3300025944 Ga0207661_10139930 Ga0207661_101399301 357
59 3300025949 Ga0207667_10454537 Ga0207667_104545371 357
60 3300026078 Ga0207702_10116208 Ga0207702_101162082 357
61 3300046463 Ga0495653_0004459 Ga0495653_0004459_4806_5978 357
62 3300050514 nmdc:mga08x19_22_c1 nmdc:mga08x19_22_c1_252510_253682 357
63 3300005458 Ga0070681_10000525 Ga0070681_100005253 358
64 3300006844 Ga0075428_100106622 Ga0075428_1001066222 358
65 3300006847 Ga0075431_100012360 Ga0075431_1000123608 358
66 3300013307 Ga0157372_10243511 Ga0157372_102435112 358
67 3300035691 Ga0373931_0004555 Ga0373931_0004555_2929_4083 358
68 3300042001 Ga0439441_009034 Ga0439441_009034_22_1128 358
69 3300046462 Ga0495651_0031770 Ga0495651_0031770_2750_4000 358
70 3300046477 Ga0495664_0141863 Ga0495664_0141863_180_1352 358
71 3300046516 Ga0495628_0043855 Ga0495628_0043855_185_1435 358
72 3300048088 Ga0495602_0067255 Ga0495602_0067255_58_1308 358
73 3300053077 Ga0495601_0031125 Ga0495601_0031125_473_1645 358
74 3300006948 Ga0099826_10000023 Ga0099826_1000002389 359
75 3300027666 Ga0209282_1000047 Ga0209282_100004740 359
76 3300031995 Ga0307409_100238099 Ga0307409_1002380992 359
77 3300035119 Ga0373956_0019944 Ga0373956_0019944_1565_2740 359
78 3300035724 Ga0373933_0009993 Ga0373933_0009993_2724_3899 359
79 3300036401 Ga0373937_0022169 Ga0373937_0022169_4505_5680 359
80 3300046462 Ga0495651_0045157 Ga0495651_0045157_392_1567 359
81 3300046511 Ga0495608_0026473 Ga0495608_0026473_88_1263 359
82 3300046809 Ga0495600_0020460 Ga0495600_0020460_1157_2332 359
83 3300047322 Ga0495680_0012029 Ga0495680_0012029_3974_5149 359
84 3300048088 Ga0495602_0184897 Ga0495602_0184897_361_1536 359
85 3300050514 nmdc:mga08x19_27532_c1 nmdc:mga08x19_27532_c1_1345_2490 359
86 3300053077 Ga0495601_0002962 Ga0495601_0002962_8323_9498 359
87 3300005327 Ga0070658_10020743 Ga0070658_100207434 360
88 3300005530 Ga0070679_100086972 Ga0070679_1000869722 360
89 3300005563 Ga0068855_100013780 Ga0068855_1000137802 360
90 3300009551 Ga0105238_10024404 Ga0105238_100244043 360
91 3300025924 Ga0207694_10067329 Ga0207694_100673291 360
92 3300026078 Ga0207702_10047122 Ga0207702_100471221 360
93 3300027671 Ga0209588_1000010 Ga0209588_100001065 360
94 3300048929 Ga0496126_0147413 Ga0496126_0147413_790_1962 360
95 3300049571 Ga0501034_0014991 Ga0501034_0014991_5526_6698 360
96 3300049572 Ga0501036_0313163 Ga0501036_0313163_81_1253 360
97 3300049586 Ga0501070_0025724 Ga0501070_0025724_3106_4278 360
98 3300009011 Ga0105251_10026344 Ga0105251_100263443 361
99 3300046474 Ga0495605_0003147 Ga0495605_0003147_798_1973 361
100 3300046491 Ga0495584_0011697 Ga0495584_0011697_1571_2746 361
101 3300046500 Ga0495596_0000011 Ga0495596_0000011_78921_80096 361
102 3300046512 Ga0495610_0000335 Ga0495610_0000335_41239_42414 361
103 3300046513 Ga0495616_0003531 Ga0495616_0003531_4507_5682 361
104 3300046524 Ga0495648_0010336 Ga0495648_0010336_5655_6830 361
105 3300046538 Ga0495609_0001063 Ga0495609_0001063_17753_18928 361
106 3300046615 Ga0495656_0006622 Ga0495656_0006622_276_1451 361
107 3300046692 Ga0495671_0000179 Ga0495671_0000179_8978_10153 361
108 3300046694 Ga0495649_0001931 Ga0495649_0001931_2605_3780 361
109 3300048905 Ga0496102_0070994 Ga0496102_0070994_93_1250 361
110 3300048919 Ga0496116_0001641 Ga0496116_0001641_8251_9426 361
111 3300048924 Ga0496121_0004777 Ga0496121_0004777_10523_11698 361
112 3300048926 Ga0496123_0000340 Ga0496123_0000340_78012_79187 361
113 3300048928 Ga0496125_0134661 Ga0496125_0134661_83_1258 361
114 3300050508 nmdc:mga09592_62290_c1 nmdc:mga09592_62290_c1_1157_2272 361
115 3300024227 Ga0228598_1000942 Ga0228598_10009422 362
116 3300046459 Ga0495629_0108131 Ga0495629_0108131_133_1302 362
117 3300046678 Ga0495599_0076830 Ga0495599_0076830_296_1549 362
118 3300046809 Ga0495600_0054673 Ga0495600_0054673_370_1623 362
119 3300048928 Ga0496125_0004305 Ga0496125_0004305_523_1644 362
120 3300049571 Ga0501034_0000439 Ga0501034_0000439_41301_42470 362
121 3300049585 Ga0501069_0030851 Ga0501069_0030851_1577_2746 363
122 3300060353 Ga0501082_0084114 Ga0501082_0084114_500_1669 363
123 3300006194 Ga0075427_10000069 Ga0075427_100000696 364
124 3300006844 Ga0075428_100101896 Ga0075428_1001018962 364
125 3300006846 Ga0075430_100000070 Ga0075430_1000000703 364
126 3300006847 Ga0075431_100019547 Ga0075431_1000195473 364
127 3300006852 Ga0075433_10004877 Ga0075433_100048772 364
128 3300006871 Ga0075434_100001839 Ga0075434_1000018391 364
129 3300006880 Ga0075429_100001678 Ga0075429_10000167813 364
130 3300009094 Ga0111539_10003613 Ga0111539_100036136 364
131 3300009147 Ga0114129_10005426 Ga0114129_100054266 364
132 3300009993 Ga0105028_101008 Ga0105028_1010082 364
133 3300027907 Ga0207428_10000075 Ga0207428_1000007534 364
134 3300050507 nmdc:mga05p37_32_c1 nmdc:mga05p37_32_c1_87429_88646 364
135 3300050508 nmdc:mga09592_3106_c1 nmdc:mga09592_3106_c1_8522_9739 364
136 3300050509 nmdc:mga0qj67_1076_c1 nmdc:mga0qj67_1076_c1_6509_7726 364
137 3300050510 nmdc:mga06r32_1900_c1 nmdc:mga06r32_1900_c1_2250_3467 364
138 3300050512 nmdc:mga0n895_1533_c1 nmdc:mga0n895_1533_c1_10378_11595 364
139 3300050513 nmdc:mga0rr50_1688_c1 nmdc:mga0rr50_1688_c1_44_1261 364
140 3300050515 nmdc:mga0a205_3714_c1 nmdc:mga0a205_3714_c1_6637_7854 364
141 3300005335 Ga0070666_10025518 Ga0070666_100255182 365
142 3300009093 Ga0105240_10061672 Ga0105240_100616722 365
143 3300009551 Ga0105238_10044753 Ga0105238_100447532 365
144 3300010375 Ga0105239_10072309 Ga0105239_100723092 365
145 3300013105 Ga0157369_10021427 Ga0157369_100214274 365
146 3300046501 Ga0495607_0000082 Ga0495607_0000082_9825_10958 365
147 3300046524 Ga0495648_0006076 Ga0495648_0006076_8101_9285 365
148 3300049569 Ga0501032_0020697 Ga0501032_0020697_1157_2341 365
149 3300049573 Ga0501037_0044470 Ga0501037_0044470_935_2119 365
150 3300049574 Ga0501038_0021068 Ga0501038_0021068_1105_2289 365
151 3300049575 Ga0501039_0162645 Ga0501039_0162645_94_1278 365
152 3300049581 Ga0501047_0015501 Ga0501047_0015501_4951_6135 365
153 3300049584 Ga0501068_0016141 Ga0501068_0016141_1311_2495 365
154 3300049823 Ga0501044_0035910 Ga0501044_0035910_1956_3140 365
155 3300005455 Ga0070663_100053153 Ga0070663_1000531532 366
156 3300009147 Ga0114129_10188675 Ga0114129_101886752 366
157 3300026067 Ga0207678_10016922 Ga0207678_100169222 366
158 3300046492 Ga0495585_0000899 Ga0495585_0000899_8807_10024 366
159 3300049571 Ga0501034_0201518 Ga0501034_0201518_338_1510 366
160 3300049571 Ga0501034_0209403 Ga0501034_0209403_524_1693 366
161 3300049744 Ga0501083_0115042 Ga0501083_0115042_546_1715 366
162 3300050511 nmdc:mga08y16_377484_c1 nmdc:mga08y16_377484_c1_303_1433 366
163 3300006852 Ga0075433_10078464 Ga0075433_100784642 367
164 3300006880 Ga0075429_100348390 Ga0075429_1003483901 367
165 3300006914 Ga0075436_100023731 Ga0075436_1000237312 367
166 3300007076 Ga0075435_100231281 Ga0075435_1002312811 367
167 3300013297 Ga0157378_10129703 Ga0157378_101297032 367
168 3300025263 Ga0209565_1003492 Ga0209565_10034925 367
169 3300025291 Ga0209675_1005245 Ga0209675_10052453 367
170 3300025299 Ga0209256_1000544 Ga0209256_100054445 367
171 3300025303 Ga0209051_1016947 Ga0209051_10169473 367
172 3300050512 nmdc:mga0n895_196240_c1 nmdc:mga0n895_196240_c1_486_1661 367
173 3300050513 nmdc:mga0rr50_75230_c1 nmdc:mga0rr50_75230_c1_1126_2301 367
174 3300005329 Ga0070683_100094509 Ga0070683_1000945093 368
175 3300005336 Ga0070680_100087580 Ga0070680_1000875802 368
176 3300005339 Ga0070660_100037042 Ga0070660_1000370422 368
177 3300005344 Ga0070661_100153535 Ga0070661_1001535352 368
178 3300005439 Ga0070711_100039067 Ga0070711_1000390672 368
179 3300005445 Ga0070708_100001512 Ga0070708_10000151212 368
180 3300005445 Ga0070708_100085056 Ga0070708_1000850563 368
181 3300005467 Ga0070706_100035941 Ga0070706_1000359412 368
182 3300005518 Ga0070699_100252818 Ga0070699_1002528181 368
183 3300005535 Ga0070684_100152977 Ga0070684_1001529771 368
184 3300005536 Ga0070697_100005197 Ga0070697_1000051979 368
185 3300005536 Ga0070697_100048096 Ga0070697_1000480962 368
186 3300005539 Ga0068853_100026561 Ga0068853_1000265612 368
187 3300005577 Ga0068857_100114345 Ga0068857_1001143452 368
188 3300005834 Ga0068851_10003770 Ga0068851_100037705 368
189 3300006846 Ga0075430_100030966 Ga0075430_1000309664 368
190 3300006847 Ga0075431_100100834 Ga0075431_1001008343 368
191 3300006880 Ga0075429_100149931 Ga0075429_1001499313 368
192 3300007265 Ga0099794_10000089 Ga0099794_1000008910 368
193 3300009147 Ga0114129_10019580 Ga0114129_100195803 368
194 3300009551 Ga0105238_10114492 Ga0105238_101144922 368
195 3300025912 Ga0207707_10029378 Ga0207707_100293783 368
196 3300025916 Ga0207663_10077058 Ga0207663_100770582 368
197 3300025917 Ga0207660_10035859 Ga0207660_100358593 368
198 3300025919 Ga0207657_10002034 Ga0207657_100020346 368
199 3300025920 Ga0207649_10124387 Ga0207649_101243872 368
200 3300025921 Ga0207652_10036225 Ga0207652_100362254 368
201 3300025944 Ga0207661_10025579 Ga0207661_100255793 368
202 3300025949 Ga0207667_10083412 Ga0207667_100834123 368
203 3300026116 Ga0207674_10148116 Ga0207674_101481162 368
204 3300027671 Ga0209588_1039425 Ga0209588_10394252 368
205 3300045976 Ga0466967_0249303 Ga0466967_0249303_432_1607 368
206 3300047446 Ga0495679_002640 Ga0495679_002640_7840_8982 368
207 3300048905 Ga0496102_0173607 Ga0496102_0173607_593_1732 368
208 3300048915 Ga0496112_0156680 Ga0496112_0156680_207_1346 368
209 3300049576 Ga0501040_0107608 Ga0501040_0107608_514_1683 368
210 3300049591 Ga0501075_0084985 Ga0501075_0084985_1166_2335 368
211 3300050507 nmdc:mga05p37_82732_c1 nmdc:mga05p37_82732_c1_1076_2215 368
212 3300050515 nmdc:mga0a205_17203_c1 nmdc:mga0a205_17203_c1_2046_3185 368
213 iso_pu_bacteria 2881927736 2881928966 368
214 3300005981 Ga0081538_10082541 Ga0081538_100825412 369
215 3300006847 Ga0075431_100143838 Ga0075431_1001438381 369
216 3300035114 Ga0373939_0002435 Ga0373939_0002435_835_2007 369
217 3300050508 nmdc:mga09592_104072_c1 nmdc:mga09592_104072_c1_1111_2280 369
218 iso_pu_bacteria 2887375801 2887376690 369
219 3300005339 Ga0070660_100264316 Ga0070660_1002643162 370
220 3300006852 Ga0075433_10021597 Ga0075433_100215973 370
221 3300007076 Ga0075435_100040034 Ga0075435_1000400341 370
222 3300007076 Ga0075435_100047070 Ga0075435_1000470702 370
223 3300007265 Ga0099794_10000711 Ga0099794_100007118 370
224 3300009174 Ga0105241_10089568 Ga0105241_100895682 370
225 3300027671 Ga0209588_1011821 Ga0209588_10118213 370
226 3300048903 Ga0496100_0049331 Ga0496100_0049331_1322_2467 370
227 3300048904 Ga0496101_0034661 Ga0496101_0034661_1292_2437 370
228 3300048907 Ga0496104_0081924 Ga0496104_0081924_120_1265 370
229 3300048908 Ga0496105_0003179 Ga0496105_0003179_2054_3199 370
230 3300048909 Ga0496106_0065356 Ga0496106_0065356_495_1640 370
231 3300048910 Ga0496107_0007583 Ga0496107_0007583_39_1184 370
232 3300048911 Ga0496108_0261005 Ga0496108_0261005_120_1265 370
233 3300048912 Ga0496109_0007323 Ga0496109_0007323_5267_6412 370
234 3300048912 Ga0496109_0143345 Ga0496109_0143345_24_1169 370
235 3300048913 Ga0496110_0052111 Ga0496110_0052111_1322_2467 370
236 3300048915 Ga0496112_0022724 Ga0496112_0022724_4799_5944 370
237 3300048917 Ga0496114_0032476 Ga0496114_0032476_243_1388 370
238 3300050514 nmdc:mga08x19_59084_c1 nmdc:mga08x19_59084_c1_203_1348 370
239 3300003771 Ga0055526_1000300 Ga0055526_10003001 371
240 3300005983 Ga0081540_1000257 Ga0081540_100025733 371
241 3300025295 Ga0209564_1000192 Ga0209564_100019235 371
242 3300034817 Ga0373948_0019439 Ga0373948_0019439_16_1161 371
243 3300035085 Ga0373929_0002044 Ga0373929_0002044_1373_2518 371
244 3300035111 Ga0373923_0088357 Ga0373923_0088357_182_1333 371
245 3300006914 Ga0075436_100000428 Ga0075436_1000004287 372
246 3300025303 Ga0209051_1029224 Ga0209051_10292242 372
247 3300035083 Ga0373926_0006426 Ga0373926_0006426_2486_3637 372
248 3300035086 Ga0373934_0009030 Ga0373934_0009030_130_1281 372
249 3300035089 Ga0373944_0032387 Ga0373944_0032387_147_1298 372
250 3300035091 Ga0373951_0011265 Ga0373951_0011265_485_1636 372
251 3300035112 Ga0373932_0007849 Ga0373932_0007849_511_1662 372
252 3300035116 Ga0373945_0052714 Ga0373945_0052714_51_1202 372
253 3300035118 Ga0373954_0029211 Ga0373954_0029211_266_1417 372
254 3300035121 Ga0373960_0027645 Ga0373960_0027645_215_1366 372
255 3300035170 Ga0373943_0000781 Ga0373943_0000781_11636_12787 372
256 3300035170 Ga0373943_0044727 Ga0373943_0044727_298_1449 372
257 3300035171 Ga0373946_0015707 Ga0373946_0015707_1491_2642 372
258 3300035242 Ga0373962_0014269 Ga0373962_0014269_134_1285 372
259 3300035691 Ga0373931_0003622 Ga0373931_0003622_3705_4856 372
260 3300035692 Ga0373935_0082180 Ga0373935_0082180_108_1259 372
261 3300035695 Ga0373927_0053980 Ga0373927_0053980_1083_2234 372
262 3300035695 Ga0373927_0068067 Ga0373927_0068067_235_1392 372
263 3300035724 Ga0373933_0013538 Ga0373933_0013538_25_1176 372
264 3300035725 Ga0373947_0008044 Ga0373947_0008044_189_1340 372
265 3300037068 Ga0373925_0021394 Ga0373925_0021394_2357_3508 372
266 3300046455 Ga0495603_0002293 Ga0495603_0002293_3917_5068 372
267 3300046455 Ga0495603_0020881 Ga0495603_0020881_1460_2611 372
268 3300046458 Ga0495591_038988 Ga0495591_038988_169_1320 372
269 3300046459 Ga0495629_0001364 Ga0495629_0001364_1650_2801 372
270 3300046459 Ga0495629_0026084 Ga0495629_0026084_319_1470 372
271 3300046461 Ga0495641_0006473 Ga0495641_0006473_1628_2779 372
272 3300046461 Ga0495641_0038439 Ga0495641_0038439_884_2035 372
273 3300046463 Ga0495653_0096499 Ga0495653_0096499_693_1844 372
274 3300046472 Ga0495580_0111760 Ga0495580_0111760_433_1584 372
275 3300046473 Ga0495582_0003419 Ga0495582_0003419_4353_5504 372
276 3300046476 Ga0495662_0025584 Ga0495662_0025584_1448_2599 372
277 3300046477 Ga0495664_0008006 Ga0495664_0008006_1966_3117 372
278 3300046491 Ga0495584_0012196 Ga0495584_0012196_2083_3258 372
279 3300046491 Ga0495584_0025149 Ga0495584_0025149_156_1307 372
280 3300046492 Ga0495585_0002650 Ga0495585_0002650_3534_4685 372
281 3300046499 Ga0495594_0031578 Ga0495594_0031578_1334_2485 372
282 3300046499 Ga0495594_0077807 Ga0495594_0077807_240_1391 372
283 3300046500 Ga0495596_0011112 Ga0495596_0011112_1829_3004 372
284 3300046501 Ga0495607_0012207 Ga0495607_0012207_2774_3925 372
285 3300046511 Ga0495608_0032300 Ga0495608_0032300_957_2108 372
286 3300046516 Ga0495628_0079987 Ga0495628_0079987_308_1459 372
287 3300046517 Ga0495630_0169213 Ga0495630_0169213_473_1624 372
288 3300046518 Ga0495631_0007352 Ga0495631_0007352_2084_3259 372
289 3300046522 Ga0495643_0002991 Ga0495643_0002991_9069_10244 372
290 3300046523 Ga0495644_0000445 Ga0495644_0000445_2334_3485 372
291 3300046526 Ga0495666_0022256 Ga0495666_0022256_1279_2430 372
292 3300046529 Ga0495652_0082426 Ga0495652_0082426_791_1942 372
293 3300046531 Ga0495665_0004404 Ga0495665_0004404_473_1624 372
294 3300046535 Ga0495586_0046796 Ga0495586_0046796_836_1987 372
295 3300046536 Ga0495587_0018377 Ga0495587_0018377_817_1968 372
296 3300046538 Ga0495609_0009594 Ga0495609_0009594_805_1980 372
297 3300046557 Ga0495622_0036011 Ga0495622_0036011_623_1774 372
298 3300046558 Ga0495633_0013577 Ga0495633_0013577_1231_2382 372
299 3300046559 Ga0495667_0005892 Ga0495667_0005892_3342_4493 372
300 3300046642 Ga0495634_0080629 Ga0495634_0080629_672_1823 372
301 3300046648 Ga0495611_0005320 Ga0495611_0005320_161_1312 372
302 3300046663 Ga0495635_0019101 Ga0495635_0019101_775_1926 372
303 3300046664 Ga0495659_0005289 Ga0495659_0005289_2645_3796 372
304 3300046665 Ga0495661_0009431 Ga0495661_0009431_476_1651 372
305 3300046674 Ga0495588_0012960 Ga0495588_0012960_64_1215 372
306 3300046678 Ga0495599_0024296 Ga0495599_0024296_2486_3637 372
307 3300046680 Ga0495646_0028182 Ga0495646_0028182_1096_2247 372
308 3300046681 Ga0495647_0004940 Ga0495647_0004940_2932_4083 372
309 3300046681 Ga0495647_0006480 Ga0495647_0006480_1027_2178 372
310 3300046683 Ga0495658_0001147 Ga0495658_0001147_6794_7945 372
311 3300046689 Ga0495613_0060939 Ga0495613_0060939_1125_2276 372
312 3300046690 Ga0495624_0007846 Ga0495624_0007846_5546_6697 372
313 3300046691 Ga0495670_0001286 Ga0495670_0001286_3914_5065 372
314 3300046809 Ga0495600_0020354 Ga0495600_0020354_724_1875 372
315 3300047315 Ga0495581_0071021 Ga0495581_0071021_558_1709 372
316 3300047315 Ga0495581_0141111 Ga0495581_0141111_226_1377 372
317 3300047317 Ga0495604_0030565 Ga0495604_0030565_2768_3919 372
318 3300047320 Ga0495672_0017357 Ga0495672_0017357_3503_4678 372
319 3300047321 Ga0495676_0008485 Ga0495676_0008485_3706_4857 372
320 3300047321 Ga0495676_0048913 Ga0495676_0048913_866_2017 372
321 3300047322 Ga0495680_0032432 Ga0495680_0032432_1129_2280 372
322 3300047322 Ga0495680_0080454 Ga0495680_0080454_98_1249 372
323 3300047443 Ga0495687_000002 Ga0495687_000002_346249_347424 372
324 3300047469 Ga0495673_0027281 Ga0495673_0027281_1280_2455 372
325 3300048089 Ga0495614_0074068 Ga0495614_0074068_157_1308 372
326 3300048091 Ga0495626_0023131 Ga0495626_0023131_1266_2441 372
327 3300048907 Ga0496104_0105690 Ga0496104_0105690_269_1420 372
328 3300048915 Ga0496112_0050647 Ga0496112_0050647_373_1524 372
329 3300049824 Ga0501045_0040220 Ga0501045_0040220_1020_2177 372
330 3300050514 nmdc:mga08x19_261_c1 nmdc:mga08x19_261_c1_7416_8576 372
331 3300053078 Ga0495612_0002607 Ga0495612_0002607_3229_4380 372
332 3300053084 Ga0495595_0003556 Ga0495595_0003556_4269_5420 372
333 3300053085 Ga0495619_0003525 Ga0495619_0003525_6384_7535 372
334 3300005364 Ga0070673_100032842 Ga0070673_1000328423 373
335 3300009011 Ga0105251_10014854 Ga0105251_100148543 373
336 3300025735 Ga0207713_1022956 Ga0207713_10229562 373
337 3300046453 Ga0495627_043794 Ga0495627_043794_118_1287 373
338 3300046458 Ga0495591_000044 Ga0495591_000044_96318_97487 373
339 3300046471 Ga0495650_0002409 Ga0495650_0002409_1459_2628 373
340 3300046474 Ga0495605_0000036 Ga0495605_0000036_85447_86616 373
341 3300046474 Ga0495605_0000319 Ga0495605_0000319_17879_19048 373
342 3300046499 Ga0495594_0028196 Ga0495594_0028196_1663_2832 373
343 3300046501 Ga0495607_0000033 Ga0495607_0000033_112691_113860 373
344 3300046506 Ga0495583_0000028 Ga0495583_0000028_98696_99865 373
345 3300046512 Ga0495610_0002063 Ga0495610_0002063_5398_6567 373
346 3300046515 Ga0495620_0000073 Ga0495620_0000073_27060_28229 373
347 3300046518 Ga0495631_0028388 Ga0495631_0028388_1344_2513 373
348 3300046520 Ga0495637_0003222 Ga0495637_0003222_4357_5526 373
349 3300046524 Ga0495648_0000560 Ga0495648_0000560_11146_12315 373
350 3300046530 Ga0495654_0000246 Ga0495654_0000246_8537_9706 373
351 3300046538 Ga0495609_0000115 Ga0495609_0000115_85448_86617 373
352 3300046542 Ga0495597_0000008 Ga0495597_0000008_183497_184666 373
353 3300046542 Ga0495597_0000635 Ga0495597_0000635_12752_13921 373
354 3300046558 Ga0495633_0000028 Ga0495633_0000028_147149_148318 373
355 3300046648 Ga0495611_0003757 Ga0495611_0003757_4187_5356 373
356 3300046665 Ga0495661_0000211 Ga0495661_0000211_10925_12094 373
357 3300046691 Ga0495670_0019359 Ga0495670_0019359_1689_2858 373
358 3300046794 Ga0495589_0009823 Ga0495589_0009823_402_1571 373
359 3300046810 Ga0495660_0001015 Ga0495660_0001015_5757_6926 373
360 3300046810 Ga0495660_0002289 Ga0495660_0002289_4852_6021 373
361 3300047320 Ga0495672_0035475 Ga0495672_0035475_1604_2773 373
362 3300047323 Ga0495683_0000091 Ga0495683_0000091_34943_36112 373
363 3300047446 Ga0495679_000083 Ga0495679_000083_30975_32144 373
364 3300047469 Ga0495673_0012965 Ga0495673_0012965_1457_2626 373
365 3300047470 Ga0495681_0009092 Ga0495681_0009092_4469_5638 373
366 3300048925 Ga0496122_0143010 Ga0496122_0143010_68_1237 373
367 3300049459 Ga0495678_000020 Ga0495678_000020_96799_97968 373
368 3300049744 Ga0501083_0029362 Ga0501083_0029362_86_1246 373
369 iso_pu_bacteria 2513237101 2513693941 373
370 iso_pu_bacteria 2643221651 2644289144 373
371 iso_pu_bacteria 2885409591 2885413836 373
372 iso_pu_bacteria 2906643746 2906651131 373
373 3300005340 Ga0070689_100003632 Ga0070689_1000036323 374
374 3300005458 Ga0070681_10269010 Ga0070681_102690102 374
375 3300005617 Ga0068859_100087315 Ga0068859_1000873154 374
376 3300006237 Ga0097621_100222381 Ga0097621_1002223812 374
377 3300006931 Ga0097620_100087318 Ga0097620_1000873182 374
378 3300009101 Ga0105247_10072297 Ga0105247_100722972 374
379 3300014325 Ga0163163_10053639 Ga0163163_100536395 374
380 3300014969 Ga0157376_10212831 Ga0157376_102128312 374
381 3300025905 Ga0207685_10037396 Ga0207685_100373962 374
382 3300025926 Ga0207659_10069445 Ga0207659_100694452 374
383 3300025936 Ga0207670_10020222 Ga0207670_100202221 374
384 3300025938 Ga0207704_10132763 Ga0207704_101327632 374
385 3300025940 Ga0207691_10253084 Ga0207691_102530841 374
386 3300025941 Ga0207711_10029896 Ga0207711_100298965 374
387 3300026035 Ga0207703_10098851 Ga0207703_100988512 374
388 3300026121 Ga0207683_10087706 Ga0207683_100877062 374
389 3300028380 Ga0268265_10064443 Ga0268265_100644431 374
390 3300035091 Ga0373951_0013149 Ga0373951_0013149_572_1735 374
391 3300035691 Ga0373931_0004664 Ga0373931_0004664_1054_2217 374
392 3300035691 Ga0373931_0006426 Ga0373931_0006426_2437_3600 374
393 3300035692 Ga0373935_0081768 Ga0373935_0081768_527_1690 374
394 3300042436 Ga0439435_0029198 Ga0439435_0029198_225_1388 374
395 3300048903 Ga0496100_0015342 Ga0496100_0015342_1952_3115 374
396 3300048907 Ga0496104_0022869 Ga0496104_0022869_3701_4864 374
397 3300048908 Ga0496105_0042530 Ga0496105_0042530_1421_2584 374
398 3300048912 Ga0496109_0018945 Ga0496109_0018945_1499_2662 374
399 3300048913 Ga0496110_0013940 Ga0496110_0013940_4569_5732 374
400 3300048914 Ga0496111_0123973 Ga0496111_0123973_456_1619 374
401 3300048918 Ga0496115_0033229 Ga0496115_0033229_858_2021 374
402 3300049571 Ga0501034_0005470 Ga0501034_0005470_10912_12144 374
403 3300049577 Ga0501041_0022442 Ga0501041_0022442_143_1312 374
404 3300049578 Ga0501042_0142079 Ga0501042_0142079_42_1211 374
405 3300049590 Ga0501074_0216582 Ga0501074_0216582_70_1239 374
406 3300049742 Ga0501080_0119726 Ga0501080_0119726_294_1463 374
407 3300049822 Ga0501035_0025138 Ga0501035_0025138_4152_5321 374
408 3300053077 Ga0495601_0060299 Ga0495601_0060299_859_2022 374
409 3300053078 Ga0495612_0044417 Ga0495612_0044417_532_1695 374
410 3300003187 JGI25151J46595_10007003 JGI25151J46595_100070035 375
411 3300005466 Ga0070685_10163742 Ga0070685_101637421 375
412 3300025294 Ga0209025_1000342 Ga0209025_100034267 375
413 3300031727 Ga0316576_10083808 Ga0316576_100838081 375
414 3300031728 Ga0316578_10047930 Ga0316578_100479301 375
415 3300032005 Ga0307411_10204415 Ga0307411_102044152 375
416 3300032133 Ga0316583_10027828 Ga0316583_100278281 375
417 3300035398 Ga0316574_0005325 Ga0316574_0005325_5293_6465 375
418 3300036712 Ga0316584_0003417 Ga0316584_0003417_470_1642 375
419 3300045976 Ga0466967_0059363 Ga0466967_0059363_1615_2778 375
420 3300046454 Ga0495592_0048841 Ga0495592_0048841_1572_2747 375
421 3300046455 Ga0495603_0005366 Ga0495603_0005366_5960_7135 375
422 3300046459 Ga0495629_0002564 Ga0495629_0002564_1491_2666 375
423 3300046461 Ga0495641_0010975 Ga0495641_0010975_2669_3844 375
424 3300046463 Ga0495653_0021421 Ga0495653_0021421_2420_3595 375
425 3300046472 Ga0495580_0005516 Ga0495580_0005516_7840_9015 375
426 3300046473 Ga0495582_0008108 Ga0495582_0008108_1401_2576 375
427 3300046477 Ga0495664_0000979 Ga0495664_0000979_1766_2941 375
428 3300046492 Ga0495585_0013050 Ga0495585_0013050_2471_3685 375
429 3300046499 Ga0495594_0060733 Ga0495594_0060733_818_1993 375
430 3300046506 Ga0495583_0011248 Ga0495583_0011248_1739_2953 375
431 3300046514 Ga0495618_0043626 Ga0495618_0043626_1374_2549 375
432 3300046516 Ga0495628_0006647 Ga0495628_0006647_1381_2556 375
433 3300046517 Ga0495630_0002437 Ga0495630_0002437_8091_9266 375
434 3300046524 Ga0495648_0007025 Ga0495648_0007025_5832_7007 375
435 3300046526 Ga0495666_0007830 Ga0495666_0007830_1770_2945 375
436 3300046536 Ga0495587_0009992 Ga0495587_0009992_3377_4552 375
437 3300046538 Ga0495609_0000559 Ga0495609_0000559_1262_2476 375
438 3300046543 Ga0495645_0002459 Ga0495645_0002459_1973_3148 375
439 3300046642 Ga0495634_0002678 Ga0495634_0002678_12052_13227 375
440 3300046648 Ga0495611_0032581 Ga0495611_0032581_571_1746 375
441 3300046660 Ga0495625_0017966 Ga0495625_0017966_958_2172 375
442 3300046663 Ga0495635_0007625 Ga0495635_0007625_3956_5131 375
443 3300046665 Ga0495661_0004192 Ga0495661_0004192_7715_8890 375
444 3300046665 Ga0495661_0107314 Ga0495661_0107314_214_1428 375
445 3300046674 Ga0495588_0017586 Ga0495588_0017586_1639_2814 375
446 3300046678 Ga0495599_0044135 Ga0495599_0044135_150_1325 375
447 3300046679 Ga0495623_0005546 Ga0495623_0005546_3635_4810 375
448 3300046680 Ga0495646_0001750 Ga0495646_0001750_10431_11606 375
449 3300046689 Ga0495613_0003816 Ga0495613_0003816_2051_3226 375
450 3300046690 Ga0495624_0013237 Ga0495624_0013237_1381_2556 375
451 3300047315 Ga0495581_0075967 Ga0495581_0075967_82_1257 375
452 3300047317 Ga0495604_0007920 Ga0495604_0007920_5825_7000 375
453 3300047318 Ga0495636_0055328 Ga0495636_0055328_153_1367 375
454 3300047321 Ga0495676_0058169 Ga0495676_0058169_226_1401 375
455 3300047322 Ga0495680_0006455 Ga0495680_0006455_1663_2838 375
456 3300047444 Ga0495675_0009789 Ga0495675_0009789_3684_4859 375
457 3300047471 Ga0495684_0016404 Ga0495684_0016404_2890_4065 375
458 3300047673 Ga0495593_0002662 Ga0495593_0002662_8065_9240 375
459 3300048089 Ga0495614_0002734 Ga0495614_0002734_4905_6080 375
460 3300049584 Ga0501068_0102849 Ga0501068_0102849_338_1507 375
461 3300049588 Ga0501072_0100920 Ga0501072_0100920_629_1792 375
462 3300049743 Ga0501081_0096055 Ga0501081_0096055_603_1766 375
463 3300005355 Ga0070671_100004618 Ga0070671_10000461810 376
464 3300005364 Ga0070673_100129842 Ga0070673_1001298422 376
465 3300005365 Ga0070688_100019720 Ga0070688_1000197203 376
466 3300005434 Ga0070709_10014282 Ga0070709_100142822 376
467 3300005435 Ga0070714_100019685 Ga0070714_1000196855 376
468 3300005435 Ga0070714_100058800 Ga0070714_1000588002 376
469 3300005436 Ga0070713_100070174 Ga0070713_1000701743 376
470 3300005437 Ga0070710_10115561 Ga0070710_101155612 376
471 3300005439 Ga0070711_100262835 Ga0070711_1002628351 376
472 3300005467 Ga0070706_100000058 Ga0070706_1000000587 376
473 3300005468 Ga0070707_100007827 Ga0070707_1000078277 376
474 3300005471 Ga0070698_100184843 Ga0070698_1001848432 376
475 3300005536 Ga0070697_100023289 Ga0070697_1000232895 376
476 3300005547 Ga0070693_100087117 Ga0070693_1000871172 376
477 3300005548 Ga0070665_100151089 Ga0070665_1001510892 376
478 3300005615 Ga0070702_100083125 Ga0070702_1000831252 376
479 3300005618 Ga0068864_100269749 Ga0068864_1002697492 376
480 3300006028 Ga0070717_10012854 Ga0070717_100128543 376
481 3300006175 Ga0070712_100025560 Ga0070712_1000255602 376
482 3300011119 Ga0105246_10057597 Ga0105246_100575972 376
483 3300014325 Ga0163163_10088724 Ga0163163_100887241 376
484 3300025898 Ga0207692_10026808 Ga0207692_100268082 376
485 3300025906 Ga0207699_10020174 Ga0207699_100201743 376
486 3300025907 Ga0207645_10077287 Ga0207645_100772872 376
487 3300025910 Ga0207684_10000066 Ga0207684_10000066111 376
488 3300025915 Ga0207693_10047664 Ga0207693_100476642 376
489 3300025915 Ga0207693_10059037 Ga0207693_100590373 376
490 3300025915 Ga0207693_10075663 Ga0207693_100756632 376
491 3300025920 Ga0207649_10062359 Ga0207649_100623592 376
492 3300025924 Ga0207694_10106056 Ga0207694_101060562 376
493 3300025925 Ga0207650_10037187 Ga0207650_100371872 376
494 3300025927 Ga0207687_10234373 Ga0207687_102343731 376
495 3300025928 Ga0207700_10001421 Ga0207700_100014218 376
496 3300025928 Ga0207700_10187398 Ga0207700_101873982 376
497 3300025931 Ga0207644_10002839 Ga0207644_100028398 376
498 3300025931 Ga0207644_10020120 Ga0207644_100201202 376
499 3300025934 Ga0207686_10183869 Ga0207686_101838692 376
500 3300025939 Ga0207665_10062505 Ga0207665_100625052 376
501 3300025941 Ga0207711_10106289 Ga0207711_101062892 376
502 3300026035 Ga0207703_10040038 Ga0207703_100400382 376
503 3300026088 Ga0207641_10174707 Ga0207641_101747072 376
504 3300026121 Ga0207683_10208565 Ga0207683_102085652 376
505 3300028379 Ga0268266_10105519 Ga0268266_101055192 376
506 3300037418 Ga0395900_0023743 Ga0395900_0023743_1282_2517 376
507 3300048913 Ga0496110_0305637 Ga0496110_0305637_249_1415 376
508 iso_pu_bacteria 2721755763 2723876003 376
509 3300002239 JGI24034J26672_10009055 JGI24034J26672_100090551 377
510 3300002244 JGI24742J22300_10004309 JGI24742J22300_100043093 377
511 3300005336 Ga0070680_100008506 Ga0070680_1000085063 377
512 3300005337 Ga0070682_100003502 Ga0070682_1000035026 377
513 3300005340 Ga0070689_100055590 Ga0070689_1000555902 377
514 3300005341 Ga0070691_10019041 Ga0070691_100190411 377
515 3300005345 Ga0070692_10036722 Ga0070692_100367222 377
516 3300005353 Ga0070669_100025592 Ga0070669_1000255923 377
517 3300005355 Ga0070671_100101185 Ga0070671_1001011852 377
518 3300005356 Ga0070674_100001317 Ga0070674_1000013177 377
519 3300005365 Ga0070688_100034653 Ga0070688_1000346533 377
520 3300005366 Ga0070659_100037181 Ga0070659_1000371811 377
521 3300005366 Ga0070659_100282162 Ga0070659_1002821621 377
522 3300005367 Ga0070667_100162130 Ga0070667_1001621302 377
523 3300005406 Ga0070703_10016942 Ga0070703_100169422 377
524 3300005436 Ga0070713_100263595 Ga0070713_1002635952 377
525 3300005438 Ga0070701_10023479 Ga0070701_100234792 377
526 3300005440 Ga0070705_100002812 Ga0070705_1000028124 377
527 3300005441 Ga0070700_100006104 Ga0070700_1000061045 377
528 3300005441 Ga0070700_100029592 Ga0070700_1000295923 377
529 3300005444 Ga0070694_100006032 Ga0070694_1000060327 377
530 3300005445 Ga0070708_100121559 Ga0070708_1001215591 377
531 3300005455 Ga0070663_100003392 Ga0070663_1000033928 377
532 3300005458 Ga0070681_10003118 Ga0070681_1000311811 377
533 3300005458 Ga0070681_10059346 Ga0070681_100593462 377
534 3300005459 Ga0068867_100005713 Ga0068867_1000057134 377
535 3300005466 Ga0070685_10031138 Ga0070685_100311382 377
536 3300005467 Ga0070706_100181558 Ga0070706_1001815581 377
537 3300005518 Ga0070699_100003539 Ga0070699_10000353910 377
538 3300005530 Ga0070679_100002575 Ga0070679_10000257513 377
539 3300005530 Ga0070679_100111652 Ga0070679_1001116522 377
540 3300005536 Ga0070697_100016032 Ga0070697_1000160321 377
541 3300005539 Ga0068853_100002117 Ga0068853_10000211713 377
542 3300005544 Ga0070686_100015930 Ga0070686_1000159302 377
543 3300005545 Ga0070695_100011357 Ga0070695_1000113574 377
544 3300005546 Ga0070696_100009677 Ga0070696_1000096775 377
545 3300005548 Ga0070665_100013399 Ga0070665_1000133993 377
546 3300005549 Ga0070704_100007447 Ga0070704_1000074478 377
547 3300005549 Ga0070704_100037540 Ga0070704_1000375402 377
548 3300005563 Ga0068855_100281530 Ga0068855_1002815301 377
549 3300005577 Ga0068857_100013592 Ga0068857_1000135925 377
550 3300005577 Ga0068857_100018049 Ga0068857_1000180493 377
551 3300005615 Ga0070702_100051843 Ga0070702_1000518433 377
552 3300005616 Ga0068852_100142758 Ga0068852_1001427582 377
553 3300005617 Ga0068859_100008214 Ga0068859_1000082148 377
554 3300005841 Ga0068863_100026295 Ga0068863_1000262952 377
555 3300005842 Ga0068858_100028586 Ga0068858_1000285863 377
556 3300005842 Ga0068858_100184288 Ga0068858_1001842882 377
557 3300005843 Ga0068860_100020260 Ga0068860_1000202604 377
558 3300005843 Ga0068860_100108710 Ga0068860_1001087102 377
559 3300005844 Ga0068862_100010491 Ga0068862_1000104916 377
560 3300005844 Ga0068862_100037922 Ga0068862_1000379222 377
561 3300006028 Ga0070717_10073713 Ga0070717_100737133 377
562 3300006058 Ga0075432_10011926 Ga0075432_100119262 377
563 3300006173 Ga0070716_100026747 Ga0070716_1000267472 377
564 3300006175 Ga0070712_100245332 Ga0070712_1002453321 377
565 3300006195 Ga0075366_10084604 Ga0075366_100846042 377
566 3300006237 Ga0097621_100035900 Ga0097621_1000359002 377
567 3300006844 Ga0075428_100196518 Ga0075428_1001965183 377
568 3300006844 Ga0075428_100314720 Ga0075428_1003147202 377
569 3300006880 Ga0075429_100130495 Ga0075429_1001304951 377
570 3300006931 Ga0097620_100008214 Ga0097620_1000082148 377
571 3300007265 Ga0099794_10002341 Ga0099794_100023416 377
572 3300009147 Ga0114129_10140383 Ga0114129_101403833 377
573 3300009176 Ga0105242_10006360 Ga0105242_100063607 377
574 3300009545 Ga0105237_10277457 Ga0105237_102774571 377
575 3300009553 Ga0105249_10001979 Ga0105249_1000197910 377
576 3300009553 Ga0105249_10031218 Ga0105249_100312184 377
577 3300010159 Ga0099796_10018771 Ga0099796_100187712 377
578 3300010375 Ga0105239_10139482 Ga0105239_101394822 377
579 3300011119 Ga0105246_10011442 Ga0105246_100114422 377
580 3300011119 Ga0105246_10034114 Ga0105246_100341142 377
581 3300013100 Ga0157373_10017166 Ga0157373_100171663 377
582 3300013297 Ga0157378_10006074 Ga0157378_100060742 377
583 3300013306 Ga0163162_10035770 Ga0163162_100357702 377
584 3300013306 Ga0163162_10347773 Ga0163162_103477732 377
585 3300013307 Ga0157372_10021316 Ga0157372_100213166 377
586 3300013308 Ga0157375_10018638 Ga0157375_100186385 377
587 3300014745 Ga0157377_10023608 Ga0157377_100236081 377
588 3300014968 Ga0157379_10057748 Ga0157379_100577483 377
589 3300014969 Ga0157376_10030914 Ga0157376_100309143 377
590 3300017792 Ga0163161_10001820 Ga0163161_100018208 377
591 3300025885 Ga0207653_10012179 Ga0207653_100121792 377
592 3300025907 Ga0207645_10090234 Ga0207645_100902341 377
593 3300025910 Ga0207684_10219800 Ga0207684_102198002 377
594 3300025912 Ga0207707_10009733 Ga0207707_100097337 377
595 3300025912 Ga0207707_10040883 Ga0207707_100408833 377
596 3300025914 Ga0207671_10216255 Ga0207671_102162552 377
597 3300025915 Ga0207693_10012950 Ga0207693_100129503 377
598 3300025917 Ga0207660_10062872 Ga0207660_100628722 377
599 3300025921 Ga0207652_10093513 Ga0207652_100935132 377
600 3300025929 Ga0207664_10077373 Ga0207664_100773731 377
601 3300025931 Ga0207644_10140094 Ga0207644_101400941 377
602 3300025932 Ga0207690_10011305 Ga0207690_100113054 377
603 3300025932 Ga0207690_10092272 Ga0207690_100922722 377
604 3300025933 Ga0207706_10005771 Ga0207706_100057715 377
605 3300025934 Ga0207686_10081326 Ga0207686_100813262 377
606 3300025936 Ga0207670_10137775 Ga0207670_101377751 377
607 3300025938 Ga0207704_10031084 Ga0207704_100310842 377
608 3300025939 Ga0207665_10039314 Ga0207665_100393142 377
609 3300025940 Ga0207691_10012621 Ga0207691_100126212 377
610 3300025942 Ga0207689_10015683 Ga0207689_100156831 377
611 3300025949 Ga0207667_10192987 Ga0207667_101929871 377
612 3300025960 Ga0207651_10014018 Ga0207651_100140181 377
613 3300025961 Ga0207712_10001652 Ga0207712_1000165210 377
614 3300026067 Ga0207678_10036524 Ga0207678_100365243 377
615 3300026075 Ga0207708_10005100 Ga0207708_100051008 377
616 3300026075 Ga0207708_10012235 Ga0207708_100122355 377
617 3300026088 Ga0207641_10050621 Ga0207641_100506213 377
618 3300026089 Ga0207648_10015456 Ga0207648_100154564 377
619 3300026095 Ga0207676_10011543 Ga0207676_100115435 377
620 3300027512 Ga0209179_1001657 Ga0209179_10016572 377
621 3300027671 Ga0209588_1001995 Ga0209588_10019953 377
622 3300028380 Ga0268265_10009421 Ga0268265_100094216 377
623 3300028380 Ga0268265_10048114 Ga0268265_100481143 377
624 3300028381 Ga0268264_10002039 Ga0268264_1000203916 377
625 3300028381 Ga0268264_10070956 Ga0268264_100709561 377
626 3300035083 Ga0373926_0047993 Ga0373926_0047993_338_1510 377
627 3300035113 Ga0373936_0009253 Ga0373936_0009253_1299_2471 377
628 3300035116 Ga0373945_0010659 Ga0373945_0010659_793_1965 377
629 3300035695 Ga0373927_0000968 Ga0373927_0000968_10479_11651 377
630 3300035695 Ga0373927_0017152 Ga0373927_0017152_928_2100 377
631 3300035725 Ga0373947_0032192 Ga0373947_0032192_932_2104 377
632 3300035725 Ga0373947_0037935 Ga0373947_0037935_226_1398 377
633 3300036401 Ga0373937_0034178 Ga0373937_0034178_932_2104 377
634 3300037068 Ga0373925_0006677 Ga0373925_0006677_2633_3805 377
635 3300038443 Ga0395901_0102198 Ga0395901_0102198_1367_2536 377
636 3300044694 Ga0466963_0032976 Ga0466963_0032976_1133_2302 377
637 3300046455 Ga0495603_0010934 Ga0495603_0010934_2276_3448 377
638 3300046459 Ga0495629_0002876 Ga0495629_0002876_7306_8478 377
639 3300046472 Ga0495580_0005184 Ga0495580_0005184_6249_7421 377
640 3300046473 Ga0495582_0001095 Ga0495582_0001095_10140_11312 377
641 3300046475 Ga0495639_0000941 Ga0495639_0000941_4683_5855 377
642 3300046476 Ga0495662_0002531 Ga0495662_0002531_4625_5797 377
643 3300046499 Ga0495594_0005004 Ga0495594_0005004_1007_2179 377
644 3300046506 Ga0495583_0055560 Ga0495583_0055560_75_1247 377
645 3300046516 Ga0495628_0118039 Ga0495628_0118039_541_1713 377
646 3300046517 Ga0495630_0054346 Ga0495630_0054346_832_2004 377
647 3300046525 Ga0495663_0020250 Ga0495663_0020250_74_1246 377
648 3300046529 Ga0495652_0022462 Ga0495652_0022462_2890_4062 377
649 3300046531 Ga0495665_0001379 Ga0495665_0001379_7120_8292 377
650 3300046533 Ga0495640_0004511 Ga0495640_0004511_4700_5872 377
651 3300046539 Ga0495621_0017424 Ga0495621_0017424_597_1769 377
652 3300046557 Ga0495622_0038051 Ga0495622_0038051_141_1313 377
653 3300046642 Ga0495634_0008593 Ga0495634_0008593_1814_2986 377
654 3300046648 Ga0495611_0087073 Ga0495611_0087073_256_1428 377
655 3300046660 Ga0495625_0128154 Ga0495625_0128154_273_1445 377
656 3300046663 Ga0495635_0006445 Ga0495635_0006445_6001_7173 377
657 3300046689 Ga0495613_0018669 Ga0495613_0018669_3033_4205 377
658 3300046689 Ga0495613_0241970 Ga0495613_0241970_28_1200 377
659 3300046691 Ga0495670_0059085 Ga0495670_0059085_40_1212 377
660 3300046692 Ga0495671_0071420 Ga0495671_0071420_504_1676 377
661 3300046694 Ga0495649_0065973 Ga0495649_0065973_162_1334 377
662 3300047315 Ga0495581_0005187 Ga0495581_0005187_4687_5859 377
663 3300047318 Ga0495636_0031170 Ga0495636_0031170_119_1291 377
664 3300047319 Ga0495674_0006076 Ga0495674_0006076_7291_8463 377
665 3300047321 Ga0495676_0149108 Ga0495676_0149108_231_1403 377
666 3300047447 Ga0495685_061532 Ga0495685_061532_20_1192 377
667 3300047673 Ga0495593_0000213 Ga0495593_0000213_23723_24895 377
668 3300048905 Ga0496102_0021629 Ga0496102_0021629_1173_2342 377
669 3300048905 Ga0496102_0029699 Ga0496102_0029699_1884_3056 377
670 3300048906 Ga0496103_0026444 Ga0496103_0026444_316_1485 377
671 3300048909 Ga0496106_0004879 Ga0496106_0004879_4693_5862 377
672 3300048910 Ga0496107_0019793 Ga0496107_0019793_3058_4227 377
673 3300048912 Ga0496109_0104430 Ga0496109_0104430_503_1672 377
674 3300048917 Ga0496114_0224754 Ga0496114_0224754_230_1402 377
675 3300048918 Ga0496115_0206352 Ga0496115_0206352_154_1323 377
676 3300049580 Ga0501046_0246865 Ga0501046_0246865_111_1280 377
677 3300049582 Ga0501048_0055678 Ga0501048_0055678_579_1748 377
678 3300049590 Ga0501074_0238856 Ga0501074_0238856_19_1188 377
679 3300049741 Ga0501079_0099656 Ga0501079_0099656_312_1481 377
680 3300049742 Ga0501080_0053356 Ga0501080_0053356_1725_2894 377
681 3300049743 Ga0501081_0015200 Ga0501081_0015200_218_1387 377
682 3300050493 nmdc:mga0k408_24978_c1 nmdc:mga0k408_24978_c1_156_1325 377
683 3300050507 nmdc:mga05p37_183054_c1 nmdc:mga05p37_183054_c1_920_2089 377
684 3300050509 nmdc:mga0qj67_25768_c1 nmdc:mga0qj67_25768_c1_2135_3304 377
685 3300053077 Ga0495601_0122809 Ga0495601_0122809_466_1638 377
686 3300053117 Ga0500593_004153 Ga0500593_004153_3932_5107 377
687 3300054114 Ga0501084_0067166 Ga0501084_0067166_1437_2606 377
688 3300061734 Ga0530510_0025809 Ga0530510_0025809_1960_3129 377
689 2209111006 2214739665 2213746912 378
690 3300000041 ARcpr5oldR_c000054 ARcpr5oldR_0000543 378
691 3300000042 ARSoilYngRDRAFT_c00400 ARSoilYngRDRAFT_004002 378
692 3300000043 ARcpr5yngRDRAFT_c000351 ARcpr5yngRDRAFT_0003513 378
693 3300000044 ARSoilOldRDRAFT_c000055 ARSoilOldRDRAFT_00005520 378
694 3300000045 ARCol0oldRDRAFT_c00497 ARCol0oldRDRAFT_004973 378
695 3300000652 ARCol0yngRDRAFT_1000044 ARCol0yngRDRAFT_10000443 378
696 3300001977 JGI24746J21847_1000489 JGI24746J21847_10004896 378
697 3300001990 JGI24737J22298_10000632 JGI24737J22298_100006327 378
698 3300001990 JGI24737J22298_10019755 JGI24737J22298_100197552 378
699 3300002074 JGI24748J21848_1000669 JGI24748J21848_10006692 378
700 3300002075 JGI24738J21930_10000039 JGI24738J21930_100000396 378
701 3300002076 JGI24749J21850_1000363 JGI24749J21850_10003632 378
702 3300002077 JGI24744J21845_10003566 JGI24744J21845_100035663 378
703 3300002126 JGI24035J26624_1000189 JGI24035J26624_10001896 378
704 3300002244 JGI24742J22300_10000085 JGI24742J22300_100000859 378
705 3300002459 JGI24751J29686_10013822 JGI24751J29686_100138221 378
706 3300003203 JGI25406J46586_10000035 JGI25406J46586_1000003528 378
707 3300003215 JGI25153J46596_10010546 JGI25153J46596_100105462 378
708 3300005276 Ga0065717_1002729 Ga0065717_10027292 378
709 3300005277 Ga0065716_1002257 Ga0065716_10022573 378
710 3300005289 Ga0065704_10082675 Ga0065704_100826751 378
711 3300005293 Ga0065715_10000340 Ga0065715_100003406 378
712 3300005328 Ga0070676_10000016 Ga0070676_1000001642 378
713 3300005329 Ga0070683_100000075 Ga0070683_10000007550 378
714 3300005330 Ga0070690_100000713 Ga0070690_1000007134 378
715 3300005330 Ga0070690_100132786 Ga0070690_1001327862 378
716 3300005331 Ga0070670_100102194 Ga0070670_1001021941 378
717 3300005333 Ga0070677_10000005 Ga0070677_1000000548 378
718 3300005334 Ga0068869_100000124 Ga0068869_10000012429 378
719 3300005335 Ga0070666_10184167 Ga0070666_101841671 378
720 3300005336 Ga0070680_100007119 Ga0070680_1000071191 378
721 3300005337 Ga0070682_100001022 Ga0070682_1000010227 378
722 3300005338 Ga0068868_100002137 Ga0068868_1000021374 378
723 3300005339 Ga0070660_100000153 Ga0070660_10000015340 378
724 3300005340 Ga0070689_100001013 Ga0070689_1000010137 378
725 3300005343 Ga0070687_100000346 Ga0070687_1000003465 378
726 3300005344 Ga0070661_100000315 Ga0070661_10000031510 378
727 3300005345 Ga0070692_10001032 Ga0070692_100010329 378
728 3300005345 Ga0070692_10001066 Ga0070692_100010666 378
729 3300005347 Ga0070668_100000824 Ga0070668_1000008246 378
730 3300005353 Ga0070669_100000145 Ga0070669_10000014549 378
731 3300005353 Ga0070669_100069934 Ga0070669_1000699343 378
732 3300005354 Ga0070675_100001417 Ga0070675_1000014177 378
733 3300005354 Ga0070675_100089134 Ga0070675_1000891341 378
734 3300005355 Ga0070671_100000267 Ga0070671_1000002676 378
735 3300005356 Ga0070674_100001510 Ga0070674_1000015107 378
736 3300005364 Ga0070673_100000125 Ga0070673_10000012516 378
737 3300005365 Ga0070688_100000075 Ga0070688_1000000755 378
738 3300005366 Ga0070659_100001342 Ga0070659_1000013427 378
739 3300005366 Ga0070659_100064864 Ga0070659_1000648643 378
740 3300005367 Ga0070667_100002562 Ga0070667_1000025625 378
741 3300005367 Ga0070667_100023818 Ga0070667_1000238183 378
742 3300005437 Ga0070710_10035887 Ga0070710_100358872 378
743 3300005437 Ga0070710_10112910 Ga0070710_101129101 378
744 3300005438 Ga0070701_10000658 Ga0070701_100006587 378
745 3300005439 Ga0070711_100005516 Ga0070711_1000055167 378
746 3300005440 Ga0070705_100000926 Ga0070705_10000092616 378
747 3300005440 Ga0070705_100037811 Ga0070705_1000378113 378
748 3300005441 Ga0070700_100000613 Ga0070700_10000061310 378
749 3300005441 Ga0070700_100096888 Ga0070700_1000968882 378
750 3300005444 Ga0070694_100000041 Ga0070694_1000000413 378
751 3300005444 Ga0070694_100056792 Ga0070694_1000567923 378
752 3300005445 Ga0070708_100009486 Ga0070708_1000094864 378
753 3300005445 Ga0070708_100066756 Ga0070708_1000667563 378
754 3300005455 Ga0070663_100000260 Ga0070663_10000026010 378
755 3300005455 Ga0070663_100030281 Ga0070663_1000302812 378
756 3300005455 Ga0070663_100250881 Ga0070663_1002508811 378
757 3300005458 Ga0070681_10003404 Ga0070681_100034048 378
758 3300005458 Ga0070681_10093921 Ga0070681_100939212 378
759 3300005459 Ga0068867_100003207 Ga0068867_1000032073 378
760 3300005466 Ga0070685_10005160 Ga0070685_100051606 378
761 3300005468 Ga0070707_100340643 Ga0070707_1003406431 378
762 3300005518 Ga0070699_100212718 Ga0070699_1002127182 378
763 3300005530 Ga0070679_100000464 Ga0070679_1000004646 378
764 3300005530 Ga0070679_100187460 Ga0070679_1001874602 378
765 3300005535 Ga0070684_100001338 Ga0070684_1000013387 378
766 3300005539 Ga0068853_100046770 Ga0068853_1000467701 378
767 3300005543 Ga0070672_100002280 Ga0070672_1000022805 378
768 3300005544 Ga0070686_100001401 Ga0070686_1000014017 378
769 3300005544 Ga0070686_100173839 Ga0070686_1001738391 378
770 3300005545 Ga0070695_100000720 Ga0070695_1000007207 378
771 3300005545 Ga0070695_100050067 Ga0070695_1000500672 378
772 3300005546 Ga0070696_100005203 Ga0070696_1000052036 378
773 3300005546 Ga0070696_100071433 Ga0070696_1000714332 378
774 3300005547 Ga0070693_100011021 Ga0070693_1000110212 378
775 3300005549 Ga0070704_100035355 Ga0070704_1000353553 378
776 3300005564 Ga0070664_100056205 Ga0070664_1000562052 378
777 3300005577 Ga0068857_100000122 Ga0068857_1000001222 378
778 3300005578 Ga0068854_100001039 Ga0068854_1000010396 378
779 3300005614 Ga0068856_100001112 Ga0068856_10000111217 378
780 3300005614 Ga0068856_100098612 Ga0068856_1000986123 378
781 3300005615 Ga0070702_100000908 Ga0070702_10000090810 378
782 3300005616 Ga0068852_100001884 Ga0068852_1000018848 378
783 3300005617 Ga0068859_100000365 Ga0068859_10000036534 378
784 3300005617 Ga0068859_100107876 Ga0068859_1001078763 378
785 3300005618 Ga0068864_100000271 Ga0068864_1000002712 378
786 3300005718 Ga0068866_10000525 Ga0068866_100005257 378
787 3300005719 Ga0068861_100001852 Ga0068861_1000018527 378
788 3300005719 Ga0068861_100034799 Ga0068861_1000347993 378
789 3300005840 Ga0068870_10000263 Ga0068870_1000026310 378
790 3300005841 Ga0068863_100000372 Ga0068863_10000037240 378
791 3300005842 Ga0068858_100005253 Ga0068858_10000525312 378
792 3300005843 Ga0068860_100142840 Ga0068860_1001428402 378
793 3300005937 Ga0081455_10000007 Ga0081455_10000007112 378
794 3300005937 Ga0081455_10012925 Ga0081455_100129252 378
795 3300005985 Ga0081539_10000113 Ga0081539_1000011390 378
796 3300006163 Ga0070715_10010738 Ga0070715_100107382 378
797 3300006237 Ga0097621_100000047 Ga0097621_10000004752 378
798 3300006358 Ga0068871_100000721 Ga0068871_1000007216 378
799 3300006358 Ga0068871_100021627 Ga0068871_1000216275 378
800 3300006852 Ga0075433_10016738 Ga0075433_100167383 378
801 3300006871 Ga0075434_100001558 Ga0075434_1000015583 378
802 3300006871 Ga0075434_100317828 Ga0075434_1003178282 378
803 3300006931 Ga0097620_100000365 Ga0097620_10000036510 378
804 3300006931 Ga0097620_100107884 Ga0097620_1001078843 378
805 3300009093 Ga0105240_10106121 Ga0105240_101061212 378
806 3300009094 Ga0111539_10000185 Ga0111539_1000018554 378
807 3300009094 Ga0111539_10001287 Ga0111539_1000128733 378
808 3300009098 Ga0105245_10000213 Ga0105245_100002132 378
809 3300009098 Ga0105245_10019072 Ga0105245_100190724 378
810 3300009101 Ga0105247_10002058 Ga0105247_1000205813 378
811 3300009101 Ga0105247_10014638 Ga0105247_100146383 378
812 3300009148 Ga0105243_10000175 Ga0105243_1000017556 378
813 3300009148 Ga0105243_10111941 Ga0105243_101119412 378
814 3300009174 Ga0105241_10000734 Ga0105241_1000073414 378
815 3300009176 Ga0105242_10000170 Ga0105242_1000017042 378
816 3300009177 Ga0105248_10003499 Ga0105248_1000349912 378
817 3300009177 Ga0105248_10041608 Ga0105248_100416081 378
818 3300009545 Ga0105237_10003191 Ga0105237_1000319112 378
819 3300009553 Ga0105249_10000200 Ga0105249_1000020051 378
820 3300009553 Ga0105249_10097718 Ga0105249_100977182 378
821 3300010375 Ga0105239_10000834 Ga0105239_1000083440 378
822 3300011119 Ga0105246_10000050 Ga0105246_1000005039 378
823 3300011119 Ga0105246_10125434 Ga0105246_101254342 378
824 3300013100 Ga0157373_10018018 Ga0157373_100180183 378
825 3300013102 Ga0157371_10007981 Ga0157371_100079812 378
826 3300013104 Ga0157370_10109350 Ga0157370_101093503 378
827 3300013296 Ga0157374_10001431 Ga0157374_1000143120 378
828 3300013296 Ga0157374_10088930 Ga0157374_100889302 378
829 3300013306 Ga0163162_10000222 Ga0163162_1000022243 378
830 3300013306 Ga0163162_10121040 Ga0163162_101210402 378
831 3300013307 Ga0157372_10001777 Ga0157372_100017779 378
832 3300013308 Ga0157375_10001098 Ga0157375_1000109817 378
833 3300014325 Ga0163163_10027403 Ga0163163_100274033 378
834 3300014326 Ga0157380_10000361 Ga0157380_1000036120 378
835 3300014745 Ga0157377_10004957 Ga0157377_100049572 378
836 3300014968 Ga0157379_10000036 Ga0157379_100000366 378
837 3300014968 Ga0157379_10067881 Ga0157379_100678812 378
838 3300014969 Ga0157376_10000062 Ga0157376_1000006255 378
839 3300025271 Ga0207666_1000015 Ga0207666_10000156 378
840 3300025290 Ga0207673_1000090 Ga0207673_10000902 378
841 3300025297 Ga0209758_1000686 Ga0209758_10006865 378
842 3300025315 Ga0207697_10000088 Ga0207697_100000886 378
843 3300025315 Ga0207697_10005807 Ga0207697_100058072 378
844 3300025885 Ga0207653_10002386 Ga0207653_100023862 378
845 3300025893 Ga0207682_10000004 Ga0207682_1000000441 378
846 3300025899 Ga0207642_10000417 Ga0207642_100004172 378
847 3300025901 Ga0207688_10000042 Ga0207688_100000426 378
848 3300025904 Ga0207647_10000417 Ga0207647_1000041734 378
849 3300025905 Ga0207685_10003166 Ga0207685_100031662 378
850 3300025907 Ga0207645_10000061 Ga0207645_1000006110 378
851 3300025908 Ga0207643_10000012 Ga0207643_1000001269 378
852 3300025911 Ga0207654_10000581 Ga0207654_100005815 378
853 3300025912 Ga0207707_10001928 Ga0207707_1000192814 378
854 3300025914 Ga0207671_10003107 Ga0207671_1000310711 378
855 3300025916 Ga0207663_10004390 Ga0207663_100043904 378
856 3300025917 Ga0207660_10000008 Ga0207660_1000000851 378
857 3300025917 Ga0207660_10053316 Ga0207660_100533162 378
858 3300025918 Ga0207662_10000097 Ga0207662_100000976 378
859 3300025918 Ga0207662_10008531 Ga0207662_100085316 378
860 3300025919 Ga0207657_10000503 Ga0207657_100005036 378
861 3300025919 Ga0207657_10006399 Ga0207657_100063996 378
862 3300025920 Ga0207649_10000099 Ga0207649_1000009938 378
863 3300025921 Ga0207652_10001041 Ga0207652_100010418 378
864 3300025921 Ga0207652_10088968 Ga0207652_100889682 378
865 3300025923 Ga0207681_10000141 Ga0207681_100001419 378
866 3300025923 Ga0207681_10027920 Ga0207681_100279204 378
867 3300025924 Ga0207694_10148905 Ga0207694_101489052 378
868 3300025926 Ga0207659_10000023 Ga0207659_1000002351 378
869 3300025927 Ga0207687_10000319 Ga0207687_1000031931 378
870 3300025931 Ga0207644_10040702 Ga0207644_100407024 378
871 3300025932 Ga0207690_10000105 Ga0207690_1000010557 378
872 3300025932 Ga0207690_10066808 Ga0207690_100668082 378
873 3300025933 Ga0207706_10000438 Ga0207706_100004386 378
874 3300025934 Ga0207686_10000140 Ga0207686_1000014043 378
875 3300025935 Ga0207709_10000555 Ga0207709_100005559 378
876 3300025936 Ga0207670_10000108 Ga0207670_100001082 378
877 3300025937 Ga0207669_10000110 Ga0207669_1000011039 378
878 3300025938 Ga0207704_10000311 Ga0207704_1000031113 378
879 3300025940 Ga0207691_10002227 Ga0207691_100022276 378
880 3300025941 Ga0207711_10039174 Ga0207711_100391741 378
881 3300025941 Ga0207711_10076263 Ga0207711_100762632 378
882 3300025942 Ga0207689_10000008 Ga0207689_1000000855 378
883 3300025944 Ga0207661_10000053 Ga0207661_1000005352 378
884 3300025945 Ga0207679_10000053 Ga0207679_1000005344 378
885 3300025945 Ga0207679_10039419 Ga0207679_100394192 378
886 3300025949 Ga0207667_10015140 Ga0207667_100151403 378
887 3300025960 Ga0207651_10000068 Ga0207651_1000006839 378
888 3300025961 Ga0207712_10000156 Ga0207712_1000015651 378
889 3300025961 Ga0207712_10049589 Ga0207712_100495892 378
890 3300025972 Ga0207668_10000160 Ga0207668_100001602 378
891 3300025972 Ga0207668_10028914 Ga0207668_100289143 378
892 3300025981 Ga0207640_10000325 Ga0207640_1000032521 378
893 3300025986 Ga0207658_10002013 Ga0207658_100020138 378
894 3300026023 Ga0207677_10000725 Ga0207677_100007259 378
895 3300026035 Ga0207703_10010327 Ga0207703_100103272 378
896 3300026041 Ga0207639_10001357 Ga0207639_1000135710 378
897 3300026067 Ga0207678_10000185 Ga0207678_1000018537 378
898 3300026067 Ga0207678_10081605 Ga0207678_100816051 378
899 3300026075 Ga0207708_10000263 Ga0207708_1000026334 378
900 3300026078 Ga0207702_10003403 Ga0207702_100034039 378
901 3300026088 Ga0207641_10002301 Ga0207641_1000230111 378
902 3300026089 Ga0207648_10000469 Ga0207648_1000046934 378
903 3300026095 Ga0207676_10000627 Ga0207676_1000062720 378
904 3300026118 Ga0207675_100000342 Ga0207675_1000003426 378
905 3300026118 Ga0207675_100029898 Ga0207675_1000298982 378
906 3300026121 Ga0207683_10000006 Ga0207683_1000000654 378
907 3300026121 Ga0207683_10011184 Ga0207683_100111845 378
908 3300026142 Ga0207698_10005210 Ga0207698_100052108 378
909 3300027695 Ga0209966_1001571 Ga0209966_10015714 378
910 3300027717 Ga0209998_10000664 Ga0209998_100006642 378
911 3300027876 Ga0209974_10003275 Ga0209974_100032754 378
912 3300027907 Ga0207428_10000112 Ga0207428_1000011245 378
913 3300027907 Ga0207428_10000480 Ga0207428_1000048043 378
914 3300028379 Ga0268266_10221057 Ga0268266_102210571 378
915 3300028380 Ga0268265_10000257 Ga0268265_1000025751 378
916 3300028381 Ga0268264_10011002 Ga0268264_100110024 378
917 3300028381 Ga0268264_10130404 Ga0268264_101304042 378
918 3300031241 Ga0265325_10000034 Ga0265325_1000003412 378
919 3300031711 Ga0265314_10036528 Ga0265314_100365283 378
920 3300034816 Ga0373930_0000060 Ga0373930_0000060_4500_5666 378
921 3300034817 Ga0373948_0000125 Ga0373948_0000125_156_1322 378
922 3300034818 Ga0373950_0000139 Ga0373950_0000139_2197_3363 378
923 3300034819 Ga0373958_0000692 Ga0373958_0000692_1417_2583 378
924 3300034820 Ga0373959_0010573 Ga0373959_0010573_402_1568 378
925 3300034957 Ga0373938_0000349 Ga0373938_0000349_5417_6583 378
926 3300035084 Ga0373928_0001321 Ga0373928_0001321_385_1551 378
927 3300035085 Ga0373929_0000087 Ga0373929_0000087_11735_12901 378
928 3300035088 Ga0373940_0004502 Ga0373940_0004502_852_2021 378
929 3300035088 Ga0373940_0019540 Ga0373940_0019540_292_1620 378
930 3300035090 Ga0373949_0001366 Ga0373949_0001366_424_1590 378
931 3300035090 Ga0373949_0012705 Ga0373949_0012705_29_1198 378
932 3300035091 Ga0373951_0004558 Ga0373951_0004558_238_1407 378
933 3300035092 Ga0373952_0000321 Ga0373952_0000321_6482_7648 378
934 3300035092 Ga0373952_0000488 Ga0373952_0000488_1656_2825 378
935 3300035111 Ga0373923_0017242 Ga0373923_0017242_1044_2216 378
936 3300035112 Ga0373932_0000929 Ga0373932_0000929_770_1939 378
937 3300035112 Ga0373932_0008954 Ga0373932_0008954_1077_2243 378
938 3300035114 Ga0373939_0001497 Ga0373939_0001497_2904_4073 378
939 3300035114 Ga0373939_0026430 Ga0373939_0026430_198_1364 378
940 3300035115 Ga0373941_0000030 Ga0373941_0000030_19634_20800 378
941 3300035115 Ga0373941_0003622 Ga0373941_0003622_1707_2876 378
942 3300035117 Ga0373953_0009712 Ga0373953_0009712_1825_2997 378
943 3300035119 Ga0373956_0027433 Ga0373956_0027433_660_1832 378
944 3300035121 Ga0373960_0000466 Ga0373960_0000466_6160_7326 378
945 3300035207 Ga0373942_0000232 Ga0373942_0000232_13151_14317 378
946 3300035241 Ga0373961_0000887 Ga0373961_0000887_500_1666 378
947 3300035242 Ga0373962_0001028 Ga0373962_0001028_1966_3135 378
948 3300035242 Ga0373962_0003491 Ga0373962_0003491_2217_3383 378
949 3300035691 Ga0373931_0000084 Ga0373931_0000084_31626_32795 378
950 3300035691 Ga0373931_0041086 Ga0373931_0041086_523_1689 378
951 3300036401 Ga0373937_0009714 Ga0373937_0009714_205_1377 378
952 3300036401 Ga0373937_0140640 Ga0373937_0140640_1064_2236 378
953 3300036401 Ga0373937_0245070 Ga0373937_0245070_58_1230 378
954 3300037068 Ga0373925_0142403 Ga0373925_0142403_392_1564 378
955 3300045051 Ga0451576_0279840 Ga0451576_0279840_103_1269 378
956 3300045836 Ga0466958_0022175 Ga0466958_0022175_922_2094 378
957 3300046454 Ga0495592_0061350 Ga0495592_0061350_1380_2552 378
958 3300046462 Ga0495651_0002023 Ga0495651_0002023_4761_5933 378
959 3300046511 Ga0495608_0001643 Ga0495608_0001643_13217_14389 378
960 3300046533 Ga0495640_0090454 Ga0495640_0090454_88_1260 378
961 3300046536 Ga0495587_0001373 Ga0495587_0001373_1939_3111 378
962 3300046543 Ga0495645_0064572 Ga0495645_0064572_81_1253 378
963 3300046559 Ga0495667_0047496 Ga0495667_0047496_154_1326 378
964 3300046663 Ga0495635_0033323 Ga0495635_0033323_1725_2897 378
965 3300046678 Ga0495599_0002224 Ga0495599_0002224_9730_10902 378
966 3300046679 Ga0495623_0003831 Ga0495623_0003831_3461_4633 378
967 3300046809 Ga0495600_0002906 Ga0495600_0002906_7401_8573 378
968 3300047317 Ga0495604_0004474 Ga0495604_0004474_661_1833 378
969 3300047322 Ga0495680_0001681 Ga0495680_0001681_5928_7100 378
970 3300048088 Ga0495602_0026191 Ga0495602_0026191_3077_4249 378
971 3300048903 Ga0496100_0002401 Ga0496100_0002401_4237_5406 378
972 3300048903 Ga0496100_0011288 Ga0496100_0011288_2916_4088 378
973 3300048903 Ga0496100_0023500 Ga0496100_0023500_1839_3011 378
974 3300048904 Ga0496101_0000360 Ga0496101_0000360_2930_4099 378
975 3300048905 Ga0496102_0013402 Ga0496102_0013402_3507_4676 378
976 3300048906 Ga0496103_0001517 Ga0496103_0001517_1580_2749 378
977 3300048906 Ga0496103_0090279 Ga0496103_0090279_306_1472 378
978 3300048907 Ga0496104_0125578 Ga0496104_0125578_1091_2263 378
979 3300048908 Ga0496105_0012959 Ga0496105_0012959_1364_2536 378
980 3300048909 Ga0496106_0000679 Ga0496106_0000679_9840_11009 378
981 3300048909 Ga0496106_0128690 Ga0496106_0128690_703_1869 378
982 3300048909 Ga0496106_0197995 Ga0496106_0197995_247_1572 378
983 3300048910 Ga0496107_0000386 Ga0496107_0000386_8048_9217 378
984 3300048911 Ga0496108_0011200 Ga0496108_0011200_2854_4026 378
985 3300048911 Ga0496108_0091346 Ga0496108_0091346_471_1640 378
986 3300048912 Ga0496109_0041883 Ga0496109_0041883_1961_3133 378
987 3300048912 Ga0496109_0087652 Ga0496109_0087652_613_1782 378
988 3300048913 Ga0496110_0031751 Ga0496110_0031751_1298_2470 378
989 3300048914 Ga0496111_0067605 Ga0496111_0067605_623_1792 378
990 3300048915 Ga0496112_0000017 Ga0496112_0000017_15423_16595 378
991 3300048915 Ga0496112_0111560 Ga0496112_0111560_1095_2264 378
992 3300048916 Ga0496113_0113326 Ga0496113_0113326_657_1826 378
993 3300048917 Ga0496114_0006840 Ga0496114_0006840_465_1634 378
994 3300048918 Ga0496115_0018716 Ga0496115_0018716_3286_4455 378
995 3300050511 nmdc:mga08y16_2892_c1 nmdc:mga08y16_2892_c1_5620_6786 378
996 3300050511 nmdc:mga08y16_68965_c1 nmdc:mga08y16_68965_c1_1818_2987 378
997 3300050512 nmdc:mga0n895_4346_c1 nmdc:mga0n895_4346_c1_10068_11237 378
998 3300050515 nmdc:mga0a205_19478_c1 nmdc:mga0a205_19478_c1_1804_2973 378
999 3300053077 Ga0495601_0045485 Ga0495601_0045485_81_1253 378
1000 3300053084 Ga0495595_0006128 Ga0495595_0006128_3081_4253 378

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

81

429

0.91

PF01094

ANF_receptor

Receptor family ligand binding region

101

409

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n0q-assembly1.cif.gz_A crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) 0.8963 28 361
4q6w-assembly1.cif.gz_A crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid 0.8863 26 361
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8842 26 360
3ipc-assembly1.cif.gz_A structure of atu2422-gaba f77a mutant receptor in complex with leucine 0.8805 27 361
3ip9-assembly1.cif.gz_A structure of atu2422-gaba receptor in complex with gaba 0.8791 27 361
ID Description Score Start End Superfamily
4mptA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9408 148 272 3.40.50.2300
1usiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9391 148 272 3.40.50.2300
3sg0A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9385 151 275 3.40.50.2300
4n0qA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.937 148 272 3.40.50.2300
3td9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9343 148 272 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537NHC1-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9788 48 378
AF-A0A537NHC1-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9477 48 378
AF-A0A7C6Q167-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9401 19 366 GO:0006865
AF-A0A512BTF2-F1-model_v4 Branched chain amino acid ABC transporter substrate-binding protein 0.9337 37 361 GO:0006865
AF-A0A2M7KMV2-F1-model_v4 Leucine-binding protein domain-containing protein 0.9307 26 361 GO:0006865

Feature Viewer

pLDDT pTM Quality
86.78 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map