F487876
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1000 | 460 | 993 | 385 |
Family's Representative Sequence
| Representative Sequence | 3300035088|Ga0373940_0019540|Ga0373940_0019540_292_1620 |
| Length | 442 |
| Sequence | MKKGGIAAALFIADVRINQVQATPRRLLRRKYGLAVTLPSRNYPRRMLEGECMSKAFRRMTVGIAALAFAAATVAAEAKDKVKVGFIGPLTGGVSVNGLGGRNSADLAVRLRNADPNAKYEYELVVLDDECKPNVAVQVATKMAADKDVIAGATHYCSATAIATVDTYHKFGFPVIVWGAVLPDITYRNKYEEVHRVNGTMINQNDANAELISKLGYKTVAVIHDTTDYGKGHNEYFSKSLAKIGKANIVGTFGVTAEQQDFTGELTKIKALNPEVIYFGGLTPIGVRIRSQMDKLGINAVFDGTSGIVSDAYIQGLGPLAEGTLAFREGAPTEKLPGGKFFMEKYNAQKYDNPPEAYGAFAFAAMDMILDTIEKVGPDRKKVIAALADVKDRDSIVGKITFDDHGQNTVPVITKYVVQDGKFVEWDDSEYAAGKRKLPGQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 4 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 5 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 6 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 7 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 8 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 9 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 10 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 11 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 12 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 13 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 14 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 15 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 26 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 30 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 109 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 131 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 145 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 164 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 239 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 248 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 252 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 255 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 256 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 258 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 260 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 261 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 262 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 263 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 265 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 275 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 276 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 287 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 288 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 298 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 299 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 300 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 301 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 302 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 303 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 396 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 397 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 398 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 399 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 400 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 401 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 404 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 405 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 406 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 407 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 408 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 409 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 410 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 411 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 412 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 413 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 414 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 415 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 443 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 444 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 458 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.3 |
| Metatranscriptomes | 0 |
| Isolates | 0.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.5 |
| Nodule | 0.3 |
| Rhizoplane | 6 |
| Rhizosphere | 91.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214739665 | 2209111006 | Bacteria | 3872 |
| 2 | ARcpr5oldR_c000054 | 3300000041 | Bacteria | 21079 |
| 3 | ARSoilYngRDRAFT_c00400 | 3300000042 | Bacteria | 5645 |
| 4 | ARcpr5yngRDRAFT_c000351 | 3300000043 | Bacteria | 6138 |
| 5 | ARSoilOldRDRAFT_c000055 | 3300000044 | Bacteria | 23615 |
| 6 | ARCol0oldRDRAFT_c00497 | 3300000045 | Bacteria | 3637 |
| 7 | ARCol0yngRDRAFT_1000044 | 3300000652 | Bacteria | 21392 |
| 8 | JGI24746J21847_1000489 | 3300001977 | Bacteria | 5929 |
| 9 | JGI24737J22298_10000632 | 3300001990 | Bacteria | 12387 |
| 10 | JGI24737J22298_10019755 | 3300001990 | Bacteria | 2154 |
| 11 | JGI24748J21848_1000669 | 3300002074 | Bacteria | 3686 |
| 12 | JGI24738J21930_10000039 | 3300002075 | Bacteria | 25206 |
| 13 | JGI24749J21850_1000363 | 3300002076 | Bacteria | 6752 |
| 14 | JGI24744J21845_10003566 | 3300002077 | Bacteria | 3205 |
| 15 | JGI24035J26624_1000189 | 3300002126 | Bacteria | 5706 |
| 16 | JGI24034J26672_10009055 | 3300002239 | Bacteria | 1464 |
| 17 | JGI24742J22300_10000085 | 3300002244 | Bacteria | 13624 |
| 18 | JGI24742J22300_10004309 | 3300002244 | Bacteria | 2326 |
| 19 | JGI24751J29686_10013822 | 3300002459 | Bacteria | 1666 |
| 20 | JGI25151J46595_10007003 | 3300003187 | Bacteria | 5582 |
| 21 | JGI25406J46586_10000035 | 3300003203 | Bacteria | 61904 |
| 22 | JGI25153J46596_10010546 | 3300003215 | Bacteria | 4170 |
| 23 | Ga0055526_1000300 | 3300003771 | Bacteria | 41235 |
| 24 | Ga0065717_1002729 | 3300005276 | Bacteria | 1667 |
| 25 | Ga0065716_1002257 | 3300005277 | Bacteria | 2011 |
| 26 | Ga0065704_10082675 | 3300005289 | Bacteria | 3563 |
| 27 | Ga0065715_10000340 | 3300005293 | Bacteria | 13818 |
| 28 | Ga0070658_10020743 | 3300005327 | Bacteria | 5265 |
| 29 | Ga0070676_10000016 | 3300005328 | Bacteria | 52098 |
| 30 | Ga0070683_100000075 | 3300005329 | Bacteria | 67998 |
| 31 | Ga0070683_100061281 | 3300005329 | Bacteria | 3498 |
| 32 | Ga0070683_100094509 | 3300005329 | Bacteria | 2809 |
| 33 | Ga0070690_100000713 | 3300005330 | Bacteria | 17071 |
| 34 | Ga0070690_100132786 | 3300005330 | Bacteria | 1683 |
| 35 | Ga0070670_100102194 | 3300005331 | Bacteria | 2468 |
| 36 | Ga0070677_10000005 | 3300005333 | Bacteria | 79035 |
| 37 | Ga0068869_100000124 | 3300005334 | Bacteria | 36988 |
| 38 | Ga0070666_10025518 | 3300005335 | Bacteria | 3854 |
| 39 | Ga0070666_10184167 | 3300005335 | Bacteria | 1466 |
| 40 | Ga0070680_100007119 | 3300005336 | Bacteria | 8526 |
| 41 | Ga0070680_100008506 | 3300005336 | Bacteria | 7861 |
| 42 | Ga0070680_100087580 | 3300005336 | Bacteria | 2575 |
| 43 | Ga0070680_100092537 | 3300005336 | Bacteria | 2504 |
| 44 | Ga0070680_100129119 | 3300005336 | Bacteria | 2113 |
| 45 | Ga0070682_100001022 | 3300005337 | Bacteria | 16156 |
| 46 | Ga0070682_100003502 | 3300005337 | Bacteria | 8682 |
| 47 | Ga0068868_100002137 | 3300005338 | Bacteria | 13641 |
| 48 | Ga0070660_100000153 | 3300005339 | Bacteria | 44533 |
| 49 | Ga0070660_100037042 | 3300005339 | Bacteria | 3697 |
| 50 | Ga0070660_100164961 | 3300005339 | Bacteria | 1787 |
| 51 | Ga0070660_100264316 | 3300005339 | Bacteria | 1405 |
| 52 | Ga0070689_100001013 | 3300005340 | Bacteria | 17615 |
| 53 | Ga0070689_100003632 | 3300005340 | Bacteria | 10290 |
| 54 | Ga0070689_100055590 | 3300005340 | Bacteria | 3068 |
| 55 | Ga0070691_10019041 | 3300005341 | Bacteria | 3165 |
| 56 | Ga0070687_100000346 | 3300005343 | Bacteria | 15773 |
| 57 | Ga0070661_100000315 | 3300005344 | Bacteria | 39060 |
| 58 | Ga0070661_100153535 | 3300005344 | Bacteria | 1741 |
| 59 | Ga0070692_10001032 | 3300005345 | Bacteria | 9598 |
| 60 | Ga0070692_10001066 | 3300005345 | Bacteria | 9511 |
| 61 | Ga0070692_10036722 | 3300005345 | Bacteria | 2488 |
| 62 | Ga0070668_100000824 | 3300005347 | Bacteria | 21386 |
| 63 | Ga0070669_100000145 | 3300005353 | Bacteria | 63377 |
| 64 | Ga0070669_100025592 | 3300005353 | Bacteria | 4239 |
| 65 | Ga0070669_100069934 | 3300005353 | Bacteria | 2594 |
| 66 | Ga0070675_100001417 | 3300005354 | Bacteria | 17615 |
| 67 | Ga0070675_100089134 | 3300005354 | Bacteria | 2582 |
| 68 | Ga0070671_100000267 | 3300005355 | Bacteria | 35238 |
| 69 | Ga0070671_100004618 | 3300005355 | Bacteria | 10922 |
| 70 | Ga0070671_100101185 | 3300005355 | Bacteria | 2418 |
| 71 | Ga0070674_100001317 | 3300005356 | Bacteria | 13052 |
| 72 | Ga0070674_100001510 | 3300005356 | Bacteria | 12405 |
| 73 | Ga0070673_100000125 | 3300005364 | Bacteria | 35606 |
| 74 | Ga0070673_100032842 | 3300005364 | Bacteria | 3913 |
| 75 | Ga0070673_100129842 | 3300005364 | Bacteria | 2113 |
| 76 | Ga0070688_100000075 | 3300005365 | Bacteria | 49279 |
| 77 | Ga0070688_100019720 | 3300005365 | Bacteria | 3909 |
| 78 | Ga0070688_100034653 | 3300005365 | Bacteria | 3060 |
| 79 | Ga0070659_100001342 | 3300005366 | Bacteria | 17717 |
| 80 | Ga0070659_100037181 | 3300005366 | Bacteria | 3795 |
| 81 | Ga0070659_100064864 | 3300005366 | Bacteria | 2891 |
| 82 | Ga0070659_100067952 | 3300005366 | Bacteria | 2826 |
| 83 | Ga0070659_100282162 | 3300005366 | Bacteria | 1382 |
| 84 | Ga0070667_100002562 | 3300005367 | Bacteria | 15789 |
| 85 | Ga0070667_100023818 | 3300005367 | Bacteria | 5083 |
| 86 | Ga0070667_100162130 | 3300005367 | Bacteria | 1970 |
| 87 | Ga0070703_10016942 | 3300005406 | Bacteria | 2097 |
| 88 | Ga0070709_10014282 | 3300005434 | Bacteria | 4490 |
| 89 | Ga0070714_100019685 | 3300005435 | Bacteria | 5502 |
| 90 | Ga0070714_100058800 | 3300005435 | Bacteria | 3295 |
| 91 | Ga0070713_100070174 | 3300005436 | Bacteria | 2957 |
| 92 | Ga0070713_100263595 | 3300005436 | Bacteria | 1575 |
| 93 | Ga0070710_10010584 | 3300005437 | Bacteria | 4533 |
| 94 | Ga0070710_10035887 | 3300005437 | Bacteria | 2706 |
| 95 | Ga0070710_10112910 | 3300005437 | Bacteria | 1635 |
| 96 | Ga0070710_10115561 | 3300005437 | Bacteria | 1617 |
| 97 | Ga0070701_10000658 | 3300005438 | Bacteria | 12115 |
| 98 | Ga0070701_10023479 | 3300005438 | Bacteria | 2971 |
| 99 | Ga0070711_100005516 | 3300005439 | Bacteria | 7573 |
| 100 | Ga0070711_100039067 | 3300005439 | Bacteria | 3194 |
| 101 | Ga0070711_100174145 | 3300005439 | Bacteria | 1642 |
| 102 | Ga0070711_100262835 | 3300005439 | Bacteria | 1358 |
| 103 | Ga0070705_100000926 | 3300005440 | Bacteria | 16411 |
| 104 | Ga0070705_100002812 | 3300005440 | Bacteria | 8678 |
| 105 | Ga0070705_100037811 | 3300005440 | Bacteria | 2726 |
| 106 | Ga0070700_100000613 | 3300005441 | Bacteria | 17749 |
| 107 | Ga0070700_100006104 | 3300005441 | Bacteria | 6418 |
| 108 | Ga0070700_100029592 | 3300005441 | Bacteria | 3267 |
| 109 | Ga0070700_100096888 | 3300005441 | Bacteria | 1936 |
| 110 | Ga0070694_100000041 | 3300005444 | Bacteria | 59039 |
| 111 | Ga0070694_100006032 | 3300005444 | Bacteria | 7352 |
| 112 | Ga0070694_100053384 | 3300005444 | Bacteria | 2735 |
| 113 | Ga0070694_100056792 | 3300005444 | Bacteria | 2659 |
| 114 | Ga0070708_100001512 | 3300005445 | Bacteria | 17752 |
| 115 | Ga0070708_100009486 | 3300005445 | Bacteria | 7845 |
| 116 | Ga0070708_100066756 | 3300005445 | Bacteria | 3229 |
| 117 | Ga0070708_100085056 | 3300005445 | Bacteria | 2870 |
| 118 | Ga0070708_100121559 | 3300005445 | Bacteria | 2409 |
| 119 | Ga0070663_100000260 | 3300005455 | Bacteria | 26472 |
| 120 | Ga0070663_100003392 | 3300005455 | Bacteria | 9201 |
| 121 | Ga0070663_100030281 | 3300005455 | Bacteria | 3707 |
| 122 | Ga0070663_100053153 | 3300005455 | Bacteria | 2891 |
| 123 | Ga0070663_100250881 | 3300005455 | Bacteria | 1400 |
| 124 | Ga0070662_100023831 | 3300005457 | Bacteria | 4209 |
| 125 | Ga0070681_10000525 | 3300005458 | Bacteria | 31394 |
| 126 | Ga0070681_10003118 | 3300005458 | Bacteria | 15399 |
| 127 | Ga0070681_10003404 | 3300005458 | Bacteria | 14891 |
| 128 | Ga0070681_10019233 | 3300005458 | Bacteria | 6834 |
| 129 | Ga0070681_10059346 | 3300005458 | Bacteria | 3805 |
| 130 | Ga0070681_10093921 | 3300005458 | Bacteria | 2948 |
| 131 | Ga0070681_10120122 | 3300005458 | Bacteria | 2563 |
| 132 | Ga0070681_10269010 | 3300005458 | Bacteria | 1616 |
| 133 | Ga0068867_100003207 | 3300005459 | Bacteria | 11527 |
| 134 | Ga0068867_100005713 | 3300005459 | Bacteria | 8822 |
| 135 | Ga0070685_10005160 | 3300005466 | Bacteria | 6622 |
| 136 | Ga0070685_10031138 | 3300005466 | Bacteria | 2978 |
| 137 | Ga0070685_10163742 | 3300005466 | Bacteria | 1420 |
| 138 | Ga0070706_100000058 | 3300005467 | Bacteria | 133347 |
| 139 | Ga0070706_100035941 | 3300005467 | Bacteria | 4575 |
| 140 | Ga0070706_100181558 | 3300005467 | Bacteria | 1965 |
| 141 | Ga0070707_100007827 | 3300005468 | Bacteria | 9924 |
| 142 | Ga0070707_100340643 | 3300005468 | Bacteria | 1456 |
| 143 | Ga0070698_100184843 | 3300005471 | Bacteria | 2022 |
| 144 | Ga0070699_100003539 | 3300005518 | Bacteria | 13809 |
| 145 | Ga0070699_100212718 | 3300005518 | Bacteria | 1721 |
| 146 | Ga0070699_100252818 | 3300005518 | Bacteria | 1575 |
| 147 | Ga0070679_100000464 | 3300005530 | Bacteria | 34507 |
| 148 | Ga0070679_100002575 | 3300005530 | Bacteria | 16471 |
| 149 | Ga0070679_100086972 | 3300005530 | Bacteria | 3112 |
| 150 | Ga0070679_100111652 | 3300005530 | Bacteria | 2720 |
| 151 | Ga0070679_100187460 | 3300005530 | Bacteria | 2038 |
| 152 | Ga0070684_100001338 | 3300005535 | Bacteria | 17638 |
| 153 | Ga0070684_100152977 | 3300005535 | Bacteria | 2091 |
| 154 | Ga0070697_100005197 | 3300005536 | Bacteria | 9998 |
| 155 | Ga0070697_100016032 | 3300005536 | Bacteria | 5892 |
| 156 | Ga0070697_100023289 | 3300005536 | Bacteria | 4925 |
| 157 | Ga0070697_100048096 | 3300005536 | Bacteria | 3458 |
| 158 | Ga0068853_100002117 | 3300005539 | Bacteria | 14743 |
| 159 | Ga0068853_100026561 | 3300005539 | Bacteria | 4862 |
| 160 | Ga0068853_100046770 | 3300005539 | Bacteria | 3712 |
| 161 | Ga0070672_100002280 | 3300005543 | Bacteria | 12115 |
| 162 | Ga0070686_100001401 | 3300005544 | Bacteria | 13603 |
| 163 | Ga0070686_100015930 | 3300005544 | Bacteria | 4366 |
| 164 | Ga0070686_100173839 | 3300005544 | Bacteria | 1525 |
| 165 | Ga0070695_100000720 | 3300005545 | Bacteria | 17638 |
| 166 | Ga0070695_100011357 | 3300005545 | Bacteria | 5328 |
| 167 | Ga0070695_100050067 | 3300005545 | Bacteria | 2676 |
| 168 | Ga0070696_100005203 | 3300005546 | Bacteria | 8698 |
| 169 | Ga0070696_100009677 | 3300005546 | Bacteria | 6448 |
| 170 | Ga0070696_100025374 | 3300005546 | Bacteria | 4029 |
| 171 | Ga0070696_100071433 | 3300005546 | Bacteria | 2442 |
| 172 | Ga0070693_100010486 | 3300005547 | Bacteria | 4645 |
| 173 | Ga0070693_100011021 | 3300005547 | Bacteria | 4545 |
| 174 | Ga0070693_100087117 | 3300005547 | Bacteria | 1875 |
| 175 | Ga0070665_100013399 | 3300005548 | Bacteria | 8250 |
| 176 | Ga0070665_100151089 | 3300005548 | Bacteria | 2325 |
| 177 | Ga0070704_100007447 | 3300005549 | Bacteria | 6521 |
| 178 | Ga0070704_100035355 | 3300005549 | Bacteria | 3395 |
| 179 | Ga0070704_100037540 | 3300005549 | Bacteria | 3310 |
| 180 | Ga0068855_100013780 | 3300005563 | Bacteria | 9746 |
| 181 | Ga0068855_100281530 | 3300005563 | Bacteria | 1846 |
| 182 | Ga0070664_100056205 | 3300005564 | Bacteria | 3344 |
| 183 | Ga0068857_100000122 | 3300005577 | Bacteria | 46603 |
| 184 | Ga0068857_100013592 | 3300005577 | Bacteria | 7092 |
| 185 | Ga0068857_100018049 | 3300005577 | Bacteria | 6189 |
| 186 | Ga0068857_100114345 | 3300005577 | Bacteria | 2427 |
| 187 | Ga0068854_100001039 | 3300005578 | Bacteria | 16664 |
| 188 | Ga0068856_100001112 | 3300005614 | Bacteria | 28418 |
| 189 | Ga0068856_100098612 | 3300005614 | Bacteria | 2912 |
| 190 | Ga0068856_100342804 | 3300005614 | Bacteria | 1512 |
| 191 | Ga0070702_100000908 | 3300005615 | Bacteria | 11553 |
| 192 | Ga0070702_100041521 | 3300005615 | Bacteria | 2581 |
| 193 | Ga0070702_100051843 | 3300005615 | Bacteria | 2351 |
| 194 | Ga0070702_100083125 | 3300005615 | Bacteria | 1923 |
| 195 | Ga0068852_100001884 | 3300005616 | Bacteria | 14287 |
| 196 | Ga0068852_100008946 | 3300005616 | Bacteria | 7411 |
| 197 | Ga0068852_100142758 | 3300005616 | Bacteria | 2218 |
| 198 | Ga0068859_100000365 | 3300005617 | Bacteria | 45011 |
| 199 | Ga0068859_100008214 | 3300005617 | Bacteria | 10590 |
| 200 | Ga0068859_100087315 | 3300005617 | Bacteria | 3167 |
| 201 | Ga0068859_100107876 | 3300005617 | Bacteria | 2845 |
| 202 | Ga0068864_100000271 | 3300005618 | Bacteria | 46062 |
| 203 | Ga0068864_100269749 | 3300005618 | Bacteria | 1585 |
| 204 | Ga0068866_10000525 | 3300005718 | Bacteria | 17642 |
| 205 | Ga0068861_100001852 | 3300005719 | Bacteria | 13612 |
| 206 | Ga0068861_100034799 | 3300005719 | Bacteria | 3726 |
| 207 | Ga0068851_10003770 | 3300005834 | Bacteria | 6779 |
| 208 | Ga0068870_10000263 | 3300005840 | Bacteria | 19418 |
| 209 | Ga0068863_100000372 | 3300005841 | Bacteria | 45645 |
| 210 | Ga0068863_100026295 | 3300005841 | Bacteria | 5553 |
| 211 | Ga0068858_100005253 | 3300005842 | Bacteria | 12688 |
| 212 | Ga0068858_100028586 | 3300005842 | Bacteria | 5178 |
| 213 | Ga0068858_100184288 | 3300005842 | Bacteria | 1972 |
| 214 | Ga0068860_100020260 | 3300005843 | Bacteria | 6443 |
| 215 | Ga0068860_100108710 | 3300005843 | Bacteria | 2650 |
| 216 | Ga0068860_100142840 | 3300005843 | Bacteria | 2301 |
| 217 | Ga0068862_100010491 | 3300005844 | Bacteria | 7651 |
| 218 | Ga0068862_100037922 | 3300005844 | Bacteria | 4086 |
| 219 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 220 | Ga0081455_10012925 | 3300005937 | Bacteria | 8282 |
| 221 | Ga0081538_10082541 | 3300005981 | Bacteria | 1703 |
| 222 | Ga0081540_1000257 | 3300005983 | Bacteria | 55989 |
| 223 | Ga0081539_10000113 | 3300005985 | Bacteria | 189418 |
| 224 | Ga0070717_10012854 | 3300006028 | Bacteria | 6393 |
| 225 | Ga0070717_10073713 | 3300006028 | Bacteria | 2854 |
| 226 | Ga0075432_10011926 | 3300006058 | Bacteria | 2954 |
| 227 | Ga0070715_10010738 | 3300006163 | Bacteria | 3273 |
| 228 | Ga0070716_100026747 | 3300006173 | Bacteria | 3092 |
| 229 | Ga0070712_100025560 | 3300006175 | Bacteria | 3926 |
| 230 | Ga0070712_100245332 | 3300006175 | Bacteria | 1428 |
| 231 | Ga0075427_10000069 | 3300006194 | Bacteria | 7998 |
| 232 | Ga0075366_10084604 | 3300006195 | Bacteria | 1896 |
| 233 | Ga0097621_100000047 | 3300006237 | Bacteria | 63910 |
| 234 | Ga0097621_100035900 | 3300006237 | Bacteria | 3962 |
| 235 | Ga0097621_100222381 | 3300006237 | Bacteria | 1646 |
| 236 | Ga0068871_100000721 | 3300006358 | Bacteria | 22411 |
| 237 | Ga0068871_100021627 | 3300006358 | Bacteria | 4947 |
| 238 | Ga0075428_100101896 | 3300006844 | Bacteria | 3130 |
| 239 | Ga0075428_100106622 | 3300006844 | Bacteria | 3055 |
| 240 | Ga0075428_100196518 | 3300006844 | Bacteria | 2181 |
| 241 | Ga0075428_100314720 | 3300006844 | Bacteria | 1682 |
| 242 | Ga0075430_100000070 | 3300006846 | Bacteria | 55805 |
| 243 | Ga0075430_100030966 | 3300006846 | Bacteria | 4543 |
| 244 | Ga0075431_100012360 | 3300006847 | Bacteria | 8616 |
| 245 | Ga0075431_100019547 | 3300006847 | Bacteria | 6909 |
| 246 | Ga0075431_100100834 | 3300006847 | Bacteria | 2979 |
| 247 | Ga0075431_100143838 | 3300006847 | Bacteria | 2457 |
| 248 | Ga0075433_10004877 | 3300006852 | Bacteria | 10495 |
| 249 | Ga0075433_10016738 | 3300006852 | Bacteria | 6053 |
| 250 | Ga0075433_10021597 | 3300006852 | Bacteria | 5399 |
| 251 | Ga0075433_10078464 | 3300006852 | Bacteria | 2909 |
| 252 | Ga0075434_100001558 | 3300006871 | Bacteria | 19441 |
| 253 | Ga0075434_100001839 | 3300006871 | Bacteria | 18321 |
| 254 | Ga0075434_100317828 | 3300006871 | Bacteria | 1577 |
| 255 | Ga0075429_100001678 | 3300006880 | Bacteria | 18316 |
| 256 | Ga0075429_100130495 | 3300006880 | Bacteria | 2198 |
| 257 | Ga0075429_100149931 | 3300006880 | Bacteria | 2042 |
| 258 | Ga0075429_100348390 | 3300006880 | Bacteria | 1297 |
| 259 | Ga0075436_100000428 | 3300006914 | Bacteria | 26958 |
| 260 | Ga0075436_100023731 | 3300006914 | Bacteria | 4214 |
| 261 | Ga0097620_100000365 | 3300006931 | Bacteria | 45011 |
| 262 | Ga0097620_100008214 | 3300006931 | Bacteria | 10590 |
| 263 | Ga0097620_100087318 | 3300006931 | Bacteria | 3167 |
| 264 | Ga0097620_100107884 | 3300006931 | Bacteria | 2845 |
| 265 | Ga0099826_10000023 | 3300006948 | Bacteria | 154989 |
| 266 | Ga0075435_100020291 | 3300007076 | Bacteria | 5088 |
| 267 | Ga0075435_100040034 | 3300007076 | Bacteria | 3742 |
| 268 | Ga0075435_100047070 | 3300007076 | Bacteria | 3462 |
| 269 | Ga0075435_100231281 | 3300007076 | Bacteria | 1571 |
| 270 | Ga0099794_10000089 | 3300007265 | Bacteria | 33900 |
| 271 | Ga0099794_10000711 | 3300007265 | Bacteria | 11201 |
| 272 | Ga0099794_10002341 | 3300007265 | Bacteria | 6964 |
| 273 | Ga0105251_10014854 | 3300009011 | Bacteria | 4280 |
| 274 | Ga0105251_10026344 | 3300009011 | Bacteria | 2960 |
| 275 | Ga0105240_10061672 | 3300009093 | Bacteria | 4672 |
| 276 | Ga0105240_10106121 | 3300009093 | Bacteria | 3408 |
| 277 | Ga0111539_10000185 | 3300009094 | Bacteria | 72688 |
| 278 | Ga0111539_10001287 | 3300009094 | Bacteria | 33486 |
| 279 | Ga0111539_10003613 | 3300009094 | Bacteria | 20380 |
| 280 | Ga0105245_10000213 | 3300009098 | Bacteria | 55096 |
| 281 | Ga0105245_10019072 | 3300009098 | Bacteria | 6004 |
| 282 | Ga0105247_10002058 | 3300009101 | Bacteria | 13924 |
| 283 | Ga0105247_10014638 | 3300009101 | Bacteria | 4702 |
| 284 | Ga0105247_10072297 | 3300009101 | Bacteria | 2159 |
| 285 | Ga0114129_10005426 | 3300009147 | Bacteria | 18011 |
| 286 | Ga0114129_10019580 | 3300009147 | Bacteria | 9634 |
| 287 | Ga0114129_10140383 | 3300009147 | Bacteria | 3312 |
| 288 | Ga0114129_10188675 | 3300009147 | Bacteria | 2801 |
| 289 | Ga0105243_10000175 | 3300009148 | Bacteria | 73728 |
| 290 | Ga0105243_10111941 | 3300009148 | Bacteria | 2286 |
| 291 | Ga0105241_10000734 | 3300009174 | Bacteria | 24869 |
| 292 | Ga0105241_10089568 | 3300009174 | Bacteria | 2424 |
| 293 | Ga0105242_10000170 | 3300009176 | Bacteria | 49285 |
| 294 | Ga0105242_10006360 | 3300009176 | Bacteria | 9093 |
| 295 | Ga0105248_10003499 | 3300009177 | Bacteria | 17428 |
| 296 | Ga0105248_10041608 | 3300009177 | Bacteria | 5152 |
| 297 | Ga0105237_10003191 | 3300009545 | Bacteria | 19674 |
| 298 | Ga0105237_10277457 | 3300009545 | Bacteria | 1678 |
| 299 | Ga0105238_10024404 | 3300009551 | Bacteria | 6164 |
| 300 | Ga0105238_10044753 | 3300009551 | Bacteria | 4474 |
| 301 | Ga0105238_10114492 | 3300009551 | Bacteria | 2676 |
| 302 | Ga0105249_10000200 | 3300009553 | Bacteria | 68748 |
| 303 | Ga0105249_10001979 | 3300009553 | Bacteria | 17784 |
| 304 | Ga0105249_10031218 | 3300009553 | Bacteria | 4817 |
| 305 | Ga0105249_10097718 | 3300009553 | Bacteria | 2757 |
| 306 | Ga0105028_101008 | 3300009993 | Bacteria | 2963 |
| 307 | Ga0099796_10018771 | 3300010159 | Bacteria | 2084 |
| 308 | Ga0105239_10000834 | 3300010375 | Bacteria | 43762 |
| 309 | Ga0105239_10072309 | 3300010375 | Bacteria | 3791 |
| 310 | Ga0105239_10139482 | 3300010375 | Bacteria | 2701 |
| 311 | Ga0105246_10000050 | 3300011119 | Bacteria | 46833 |
| 312 | Ga0105246_10011442 | 3300011119 | Bacteria | 5506 |
| 313 | Ga0105246_10034114 | 3300011119 | Bacteria | 3387 |
| 314 | Ga0105246_10057597 | 3300011119 | Bacteria | 2689 |
| 315 | Ga0105246_10125434 | 3300011119 | Bacteria | 1909 |
| 316 | Ga0157373_10017166 | 3300013100 | Bacteria | 5270 |
| 317 | Ga0157373_10018018 | 3300013100 | Bacteria | 5142 |
| 318 | Ga0157371_10007981 | 3300013102 | Bacteria | 8489 |
| 319 | Ga0157370_10109350 | 3300013104 | Bacteria | 2584 |
| 320 | Ga0157369_10021427 | 3300013105 | Bacteria | 7230 |
| 321 | Ga0157369_10169139 | 3300013105 | Bacteria | 2304 |
| 322 | Ga0157374_10001431 | 3300013296 | Bacteria | 20169 |
| 323 | Ga0157374_10088930 | 3300013296 | Bacteria | 2942 |
| 324 | Ga0157378_10006074 | 3300013297 | Bacteria | 10583 |
| 325 | Ga0157378_10129703 | 3300013297 | Bacteria | 2333 |
| 326 | Ga0163162_10000222 | 3300013306 | Bacteria | 52141 |
| 327 | Ga0163162_10035770 | 3300013306 | Bacteria | 4947 |
| 328 | Ga0163162_10121040 | 3300013306 | Bacteria | 2722 |
| 329 | Ga0163162_10347773 | 3300013306 | Bacteria | 1615 |
| 330 | Ga0157372_10001777 | 3300013307 | Bacteria | 23400 |
| 331 | Ga0157372_10021316 | 3300013307 | Bacteria | 7000 |
| 332 | Ga0157372_10243511 | 3300013307 | Bacteria | 2087 |
| 333 | Ga0157375_10001098 | 3300013308 | Bacteria | 23463 |
| 334 | Ga0157375_10018638 | 3300013308 | Bacteria | 6298 |
| 335 | Ga0163163_10027403 | 3300014325 | Bacteria | 5458 |
| 336 | Ga0163163_10053639 | 3300014325 | Bacteria | 3980 |
| 337 | Ga0163163_10088724 | 3300014325 | Bacteria | 3104 |
| 338 | Ga0157380_10000361 | 3300014326 | Bacteria | 27316 |
| 339 | Ga0157377_10004957 | 3300014745 | Bacteria | 6205 |
| 340 | Ga0157377_10023608 | 3300014745 | Bacteria | 3262 |
| 341 | Ga0157379_10000036 | 3300014968 | Bacteria | 81888 |
| 342 | Ga0157379_10057748 | 3300014968 | Bacteria | 3468 |
| 343 | Ga0157379_10067881 | 3300014968 | Bacteria | 3188 |
| 344 | Ga0157376_10000062 | 3300014969 | Bacteria | 89308 |
| 345 | Ga0157376_10030914 | 3300014969 | Bacteria | 4282 |
| 346 | Ga0157376_10212831 | 3300014969 | Bacteria | 1785 |
| 347 | Ga0163161_10001820 | 3300017792 | Bacteria | 15566 |
| 348 | Ga0228598_1000942 | 3300024227 | Bacteria | 6333 |
| 349 | Ga0209565_1003492 | 3300025263 | Bacteria | 5055 |
| 350 | Ga0207666_1000015 | 3300025271 | Bacteria | 41241 |
| 351 | Ga0207673_1000090 | 3300025290 | Bacteria | 8154 |
| 352 | Ga0209675_1005245 | 3300025291 | Bacteria | 5481 |
| 353 | Ga0209025_1000342 | 3300025294 | Bacteria | 102758 |
| 354 | Ga0209564_1000192 | 3300025295 | Bacteria | 142456 |
| 355 | Ga0209758_1000686 | 3300025297 | Bacteria | 50478 |
| 356 | Ga0209256_1000544 | 3300025299 | Bacteria | 54207 |
| 357 | Ga0209051_1016947 | 3300025303 | Bacteria | 3272 |
| 358 | Ga0209051_1029224 | 3300025303 | Bacteria | 2161 |
| 359 | Ga0207697_10000088 | 3300025315 | Bacteria | 41270 |
| 360 | Ga0207697_10005807 | 3300025315 | Bacteria | 5682 |
| 361 | Ga0207713_1022956 | 3300025735 | Bacteria | 2948 |
| 362 | Ga0207653_10002386 | 3300025885 | Bacteria | 5988 |
| 363 | Ga0207653_10012179 | 3300025885 | Bacteria | 2686 |
| 364 | Ga0207682_10000004 | 3300025893 | Bacteria | 104760 |
| 365 | Ga0207692_10026808 | 3300025898 | Bacteria | 2707 |
| 366 | Ga0207642_10000417 | 3300025899 | Bacteria | 12856 |
| 367 | Ga0207688_10000042 | 3300025901 | Bacteria | 44479 |
| 368 | Ga0207647_10000417 | 3300025904 | Bacteria | 35010 |
| 369 | Ga0207685_10003166 | 3300025905 | Bacteria | 3947 |
| 370 | Ga0207685_10037396 | 3300025905 | Bacteria | 1787 |
| 371 | Ga0207699_10020174 | 3300025906 | Bacteria | 3567 |
| 372 | Ga0207645_10000061 | 3300025907 | Bacteria | 77457 |
| 373 | Ga0207645_10077287 | 3300025907 | Bacteria | 2133 |
| 374 | Ga0207645_10090234 | 3300025907 | Bacteria | 1971 |
| 375 | Ga0207643_10000012 | 3300025908 | Bacteria | 133318 |
| 376 | Ga0207684_10000066 | 3300025910 | Bacteria | 193406 |
| 377 | Ga0207684_10219800 | 3300025910 | Bacteria | 1640 |
| 378 | Ga0207654_10000581 | 3300025911 | Bacteria | 20669 |
| 379 | Ga0207654_10053761 | 3300025911 | Bacteria | 2326 |
| 380 | Ga0207707_10001928 | 3300025912 | Bacteria | 18863 |
| 381 | Ga0207707_10009733 | 3300025912 | Bacteria | 8338 |
| 382 | Ga0207707_10029378 | 3300025912 | Bacteria | 4805 |
| 383 | Ga0207707_10040883 | 3300025912 | Bacteria | 4049 |
| 384 | Ga0207707_10057798 | 3300025912 | Bacteria | 3375 |
| 385 | Ga0207695_10247441 | 3300025913 | Bacteria | 1683 |
| 386 | Ga0207671_10003107 | 3300025914 | Bacteria | 16888 |
| 387 | Ga0207671_10216255 | 3300025914 | Bacteria | 1500 |
| 388 | Ga0207693_10012950 | 3300025915 | Bacteria | 6731 |
| 389 | Ga0207693_10047664 | 3300025915 | Bacteria | 3366 |
| 390 | Ga0207693_10059037 | 3300025915 | Bacteria | 3005 |
| 391 | Ga0207693_10075663 | 3300025915 | Bacteria | 2636 |
| 392 | Ga0207663_10004390 | 3300025916 | Bacteria | 7002 |
| 393 | Ga0207663_10077058 | 3300025916 | Bacteria | 2169 |
| 394 | Ga0207660_10000008 | 3300025917 | Bacteria | 98521 |
| 395 | Ga0207660_10035859 | 3300025917 | Bacteria | 3445 |
| 396 | Ga0207660_10053316 | 3300025917 | Bacteria | 2882 |
| 397 | Ga0207660_10062872 | 3300025917 | Bacteria | 2675 |
| 398 | Ga0207662_10000097 | 3300025918 | Bacteria | 41243 |
| 399 | Ga0207662_10008531 | 3300025918 | Bacteria | 5615 |
| 400 | Ga0207657_10000503 | 3300025919 | Bacteria | 41249 |
| 401 | Ga0207657_10002034 | 3300025919 | Bacteria | 21867 |
| 402 | Ga0207657_10005565 | 3300025919 | Bacteria | 13156 |
| 403 | Ga0207657_10006399 | 3300025919 | Bacteria | 12225 |
| 404 | Ga0207657_10050796 | 3300025919 | Bacteria | 3606 |
| 405 | Ga0207649_10000099 | 3300025920 | Bacteria | 71350 |
| 406 | Ga0207649_10062359 | 3300025920 | Bacteria | 2350 |
| 407 | Ga0207649_10124387 | 3300025920 | Bacteria | 1743 |
| 408 | Ga0207652_10001041 | 3300025921 | Bacteria | 25403 |
| 409 | Ga0207652_10036225 | 3300025921 | Bacteria | 4171 |
| 410 | Ga0207652_10075246 | 3300025921 | Bacteria | 2942 |
| 411 | Ga0207652_10088968 | 3300025921 | Bacteria | 2710 |
| 412 | Ga0207652_10093513 | 3300025921 | Bacteria | 2646 |
| 413 | Ga0207681_10000141 | 3300025923 | Bacteria | 59951 |
| 414 | Ga0207681_10027920 | 3300025923 | Bacteria | 3654 |
| 415 | Ga0207694_10067329 | 3300025924 | Bacteria | 2795 |
| 416 | Ga0207694_10106056 | 3300025924 | Bacteria | 2231 |
| 417 | Ga0207694_10148905 | 3300025924 | Bacteria | 1885 |
| 418 | Ga0207650_10037187 | 3300025925 | Bacteria | 3546 |
| 419 | Ga0207659_10000023 | 3300025926 | Bacteria | 142947 |
| 420 | Ga0207659_10069445 | 3300025926 | Bacteria | 2566 |
| 421 | Ga0207687_10000319 | 3300025927 | Bacteria | 32748 |
| 422 | Ga0207687_10234373 | 3300025927 | Bacteria | 1451 |
| 423 | Ga0207700_10001421 | 3300025928 | Bacteria | 13591 |
| 424 | Ga0207700_10187398 | 3300025928 | Bacteria | 1736 |
| 425 | Ga0207664_10077373 | 3300025929 | Bacteria | 2695 |
| 426 | Ga0207664_10259902 | 3300025929 | Bacteria | 1518 |
| 427 | Ga0207644_10002839 | 3300025931 | Bacteria | 11173 |
| 428 | Ga0207644_10020120 | 3300025931 | Bacteria | 4534 |
| 429 | Ga0207644_10040702 | 3300025931 | Bacteria | 3285 |
| 430 | Ga0207644_10140094 | 3300025931 | Bacteria | 1862 |
| 431 | Ga0207690_10000105 | 3300025932 | Bacteria | 68515 |
| 432 | Ga0207690_10011305 | 3300025932 | Bacteria | 5334 |
| 433 | Ga0207690_10066808 | 3300025932 | Bacteria | 2464 |
| 434 | Ga0207690_10092272 | 3300025932 | Bacteria | 2142 |
| 435 | Ga0207690_10206635 | 3300025932 | Bacteria | 1495 |
| 436 | Ga0207706_10000438 | 3300025933 | Bacteria | 44481 |
| 437 | Ga0207706_10005771 | 3300025933 | Bacteria | 11519 |
| 438 | Ga0207706_10018772 | 3300025933 | Bacteria | 6220 |
| 439 | Ga0207686_10000140 | 3300025934 | Bacteria | 56605 |
| 440 | Ga0207686_10081326 | 3300025934 | Bacteria | 2114 |
| 441 | Ga0207686_10183869 | 3300025934 | Bacteria | 1484 |
| 442 | Ga0207709_10000555 | 3300025935 | Bacteria | 31887 |
| 443 | Ga0207670_10000108 | 3300025936 | Bacteria | 56906 |
| 444 | Ga0207670_10020222 | 3300025936 | Bacteria | 4086 |
| 445 | Ga0207670_10137775 | 3300025936 | Bacteria | 1796 |
| 446 | Ga0207669_10000110 | 3300025937 | Bacteria | 40953 |
| 447 | Ga0207704_10000311 | 3300025938 | Bacteria | 22858 |
| 448 | Ga0207704_10031084 | 3300025938 | Bacteria | 3002 |
| 449 | Ga0207704_10132763 | 3300025938 | Bacteria | 1728 |
| 450 | Ga0207665_10039314 | 3300025939 | Bacteria | 3154 |
| 451 | Ga0207665_10062505 | 3300025939 | Bacteria | 2526 |
| 452 | Ga0207665_10064480 | 3300025939 | Bacteria | 2489 |
| 453 | Ga0207665_10065992 | 3300025939 | Bacteria | 2462 |
| 454 | Ga0207691_10002227 | 3300025940 | Bacteria | 18970 |
| 455 | Ga0207691_10012621 | 3300025940 | Bacteria | 8097 |
| 456 | Ga0207691_10253084 | 3300025940 | Bacteria | 1520 |
| 457 | Ga0207711_10029896 | 3300025941 | Bacteria | 4595 |
| 458 | Ga0207711_10039174 | 3300025941 | Bacteria | 4031 |
| 459 | Ga0207711_10076263 | 3300025941 | Bacteria | 2919 |
| 460 | Ga0207711_10106289 | 3300025941 | Bacteria | 2490 |
| 461 | Ga0207689_10000008 | 3300025942 | Bacteria | 127942 |
| 462 | Ga0207689_10015683 | 3300025942 | Bacteria | 6415 |
| 463 | Ga0207689_10087951 | 3300025942 | Bacteria | 2552 |
| 464 | Ga0207661_10000053 | 3300025944 | Bacteria | 90600 |
| 465 | Ga0207661_10025579 | 3300025944 | Bacteria | 4489 |
| 466 | Ga0207661_10139930 | 3300025944 | Bacteria | 2082 |
| 467 | Ga0207679_10000053 | 3300025945 | Bacteria | 109038 |
| 468 | Ga0207679_10039419 | 3300025945 | Bacteria | 3373 |
| 469 | Ga0207667_10015140 | 3300025949 | Bacteria | 8771 |
| 470 | Ga0207667_10083412 | 3300025949 | Bacteria | 3309 |
| 471 | Ga0207667_10192987 | 3300025949 | Bacteria | 2090 |
| 472 | Ga0207667_10454537 | 3300025949 | Bacteria | 1301 |
| 473 | Ga0207651_10000068 | 3300025960 | Bacteria | 46552 |
| 474 | Ga0207651_10014018 | 3300025960 | Bacteria | 4613 |
| 475 | Ga0207712_10000156 | 3300025961 | Bacteria | 70300 |
| 476 | Ga0207712_10001652 | 3300025961 | Bacteria | 15007 |
| 477 | Ga0207712_10049589 | 3300025961 | Bacteria | 2926 |
| 478 | Ga0207668_10000160 | 3300025972 | Bacteria | 47008 |
| 479 | Ga0207668_10028914 | 3300025972 | Bacteria | 3629 |
| 480 | Ga0207640_10000325 | 3300025981 | Bacteria | 31933 |
| 481 | Ga0207640_10043437 | 3300025981 | Bacteria | 2873 |
| 482 | Ga0207658_10002013 | 3300025986 | Bacteria | 15161 |
| 483 | Ga0207677_10000725 | 3300026023 | Bacteria | 19286 |
| 484 | Ga0207703_10010327 | 3300026035 | Bacteria | 7311 |
| 485 | Ga0207703_10040038 | 3300026035 | Bacteria | 3749 |
| 486 | Ga0207703_10098851 | 3300026035 | Bacteria | 2469 |
| 487 | Ga0207639_10001357 | 3300026041 | Bacteria | 16508 |
| 488 | Ga0207678_10000185 | 3300026067 | Bacteria | 53359 |
| 489 | Ga0207678_10016922 | 3300026067 | Bacteria | 6401 |
| 490 | Ga0207678_10036524 | 3300026067 | Bacteria | 4276 |
| 491 | Ga0207678_10037864 | 3300026067 | Bacteria | 4194 |
| 492 | Ga0207678_10081605 | 3300026067 | Bacteria | 2768 |
| 493 | Ga0207708_10000263 | 3300026075 | Bacteria | 41243 |
| 494 | Ga0207708_10005100 | 3300026075 | Bacteria | 9690 |
| 495 | Ga0207708_10012235 | 3300026075 | Bacteria | 6398 |
| 496 | Ga0207702_10003403 | 3300026078 | Bacteria | 14564 |
| 497 | Ga0207702_10047122 | 3300026078 | Bacteria | 3631 |
| 498 | Ga0207702_10116208 | 3300026078 | Bacteria | 2387 |
| 499 | Ga0207641_10002301 | 3300026088 | Bacteria | 17758 |
| 500 | Ga0207641_10050621 | 3300026088 | Bacteria | 3515 |
| 501 | Ga0207641_10174707 | 3300026088 | Bacteria | 1963 |
| 502 | Ga0207648_10000469 | 3300026089 | Bacteria | 45034 |
| 503 | Ga0207648_10015456 | 3300026089 | Bacteria | 7019 |
| 504 | Ga0207676_10000627 | 3300026095 | Bacteria | 28676 |
| 505 | Ga0207676_10011543 | 3300026095 | Bacteria | 6318 |
| 506 | Ga0207674_10148116 | 3300026116 | Bacteria | 2305 |
| 507 | Ga0207675_100000342 | 3300026118 | Bacteria | 44471 |
| 508 | Ga0207675_100029898 | 3300026118 | Bacteria | 5072 |
| 509 | Ga0207683_10000006 | 3300026121 | Bacteria | 181260 |
| 510 | Ga0207683_10011184 | 3300026121 | Bacteria | 7652 |
| 511 | Ga0207683_10087706 | 3300026121 | Bacteria | 2767 |
| 512 | Ga0207683_10208565 | 3300026121 | Bacteria | 1778 |
| 513 | Ga0207698_10005210 | 3300026142 | Bacteria | 7997 |
| 514 | Ga0209179_1001657 | 3300027512 | Bacteria | 2811 |
| 515 | Ga0209282_1000047 | 3300027666 | Bacteria | 114735 |
| 516 | Ga0209588_1000010 | 3300027671 | Bacteria | 159025 |
| 517 | Ga0209588_1001995 | 3300027671 | Bacteria | 5488 |
| 518 | Ga0209588_1011821 | 3300027671 | Bacteria | 2643 |
| 519 | Ga0209588_1039425 | 3300027671 | Bacteria | 1523 |
| 520 | Ga0209966_1001571 | 3300027695 | Bacteria | 3939 |
| 521 | Ga0209998_10000664 | 3300027717 | Bacteria | 9175 |
| 522 | Ga0209974_10003275 | 3300027876 | Bacteria | 5852 |
| 523 | Ga0207428_10000075 | 3300027907 | Bacteria | 137887 |
| 524 | Ga0207428_10000112 | 3300027907 | Bacteria | 110733 |
| 525 | Ga0207428_10000480 | 3300027907 | Bacteria | 48240 |
| 526 | Ga0268266_10105519 | 3300028379 | Bacteria | 2489 |
| 527 | Ga0268266_10221057 | 3300028379 | Bacteria | 1741 |
| 528 | Ga0268265_10000257 | 3300028380 | Bacteria | 60485 |
| 529 | Ga0268265_10009421 | 3300028380 | Bacteria | 6595 |
| 530 | Ga0268265_10048114 | 3300028380 | Bacteria | 3199 |
| 531 | Ga0268265_10064443 | 3300028380 | Bacteria | 2823 |
| 532 | Ga0268264_10002039 | 3300028381 | Bacteria | 18053 |
| 533 | Ga0268264_10011002 | 3300028381 | Bacteria | 7469 |
| 534 | Ga0268264_10070956 | 3300028381 | Bacteria | 2950 |
| 535 | Ga0268264_10130404 | 3300028381 | Bacteria | 2227 |
| 536 | Ga0265325_10000034 | 3300031241 | Bacteria | 99371 |
| 537 | Ga0265313_10016591 | 3300031595 | Bacteria | 4227 |
| 538 | Ga0265314_10036528 | 3300031711 | Bacteria | 3569 |
| 539 | Ga0265314_10144430 | 3300031711 | Bacteria | 1467 |
| 540 | Ga0265342_10000548 | 3300031712 | Bacteria | 39664 |
| 541 | Ga0316576_10083808 | 3300031727 | Bacteria | 2369 |
| 542 | Ga0316578_10047930 | 3300031728 | Bacteria | 2494 |
| 543 | Ga0307409_100238099 | 3300031995 | Bacteria | 1655 |
| 544 | Ga0307411_10204415 | 3300032005 | Bacteria | 1520 |
| 545 | Ga0316583_10027828 | 3300032133 | Bacteria | 2018 |
| 546 | Ga0373930_0000060 | 3300034816 | Bacteria | 10351 |
| 547 | Ga0373948_0000125 | 3300034817 | Bacteria | 8042 |
| 548 | Ga0373948_0019439 | 3300034817 | Bacteria | 1285 |
| 549 | Ga0373950_0000139 | 3300034818 | Bacteria | 12047 |
| 550 | Ga0373958_0000692 | 3300034819 | Bacteria | 4276 |
| 551 | Ga0373959_0010573 | 3300034820 | Bacteria | 1614 |
| 552 | Ga0373938_0000349 | 3300034957 | Bacteria | 7321 |
| 553 | Ga0373926_0006426 | 3300035083 | Bacteria | 3904 |
| 554 | Ga0373926_0047993 | 3300035083 | Bacteria | 1535 |
| 555 | Ga0373928_0001321 | 3300035084 | Bacteria | 4863 |
| 556 | Ga0373929_0000087 | 3300035085 | Bacteria | 15309 |
| 557 | Ga0373929_0002044 | 3300035085 | Bacteria | 3754 |
| 558 | Ga0373934_0009030 | 3300035086 | Bacteria | 3728 |
| 559 | Ga0373940_0004502 | 3300035088 | Bacteria | 2948 |
| 560 | Ga0373940_0019540 | 3300035088 | Bacteria | 1713 |
| 561 | Ga0373944_0032387 | 3300035089 | Bacteria | 1578 |
| 562 | Ga0373949_0001366 | 3300035090 | Bacteria | 7017 |
| 563 | Ga0373949_0012705 | 3300035090 | Bacteria | 1864 |
| 564 | Ga0373949_0017573 | 3300035090 | Bacteria | 1614 |
| 565 | Ga0373951_0004558 | 3300035091 | Bacteria | 3282 |
| 566 | Ga0373951_0011265 | 3300035091 | Bacteria | 2007 |
| 567 | Ga0373951_0013149 | 3300035091 | Bacteria | 1861 |
| 568 | Ga0373952_0000321 | 3300035092 | Bacteria | 8064 |
| 569 | Ga0373952_0000488 | 3300035092 | Bacteria | 6914 |
| 570 | Ga0373923_0017242 | 3300035111 | Bacteria | 2759 |
| 571 | Ga0373923_0088357 | 3300035111 | Bacteria | 1353 |
| 572 | Ga0373932_0000929 | 3300035112 | Bacteria | 8564 |
| 573 | Ga0373932_0007849 | 3300035112 | Bacteria | 2546 |
| 574 | Ga0373932_0008954 | 3300035112 | Bacteria | 2399 |
| 575 | Ga0373936_0009253 | 3300035113 | Bacteria | 3713 |
| 576 | Ga0373939_0001497 | 3300035114 | Bacteria | 5664 |
| 577 | Ga0373939_0002435 | 3300035114 | Bacteria | 4388 |
| 578 | Ga0373939_0026430 | 3300035114 | Bacteria | 1636 |
| 579 | Ga0373941_0000030 | 3300035115 | Bacteria | 21511 |
| 580 | Ga0373941_0003622 | 3300035115 | Bacteria | 3519 |
| 581 | Ga0373945_0010659 | 3300035116 | Bacteria | 3031 |
| 582 | Ga0373945_0052714 | 3300035116 | Bacteria | 1499 |
| 583 | Ga0373953_0009712 | 3300035117 | Bacteria | 3322 |
| 584 | Ga0373954_0029211 | 3300035118 | Bacteria | 2538 |
| 585 | Ga0373956_0019944 | 3300035119 | Bacteria | 2848 |
| 586 | Ga0373956_0027433 | 3300035119 | Bacteria | 2472 |
| 587 | Ga0373960_0000466 | 3300035121 | Bacteria | 7999 |
| 588 | Ga0373960_0027645 | 3300035121 | Bacteria | 1559 |
| 589 | Ga0373943_0000781 | 3300035170 | Bacteria | 13925 |
| 590 | Ga0373943_0044727 | 3300035170 | Bacteria | 2155 |
| 591 | Ga0373946_0015707 | 3300035171 | Bacteria | 2875 |
| 592 | Ga0373955_0051287 | 3300035172 | Bacteria | 2247 |
| 593 | Ga0373942_0000232 | 3300035207 | Bacteria | 14790 |
| 594 | Ga0373961_0000887 | 3300035241 | Bacteria | 10058 |
| 595 | Ga0373962_0001028 | 3300035242 | Bacteria | 6456 |
| 596 | Ga0373962_0003491 | 3300035242 | Bacteria | 3777 |
| 597 | Ga0373962_0014269 | 3300035242 | Bacteria | 2023 |
| 598 | Ga0316574_0005325 | 3300035398 | Bacteria | 6855 |
| 599 | Ga0373931_0000084 | 3300035691 | Bacteria | 44377 |
| 600 | Ga0373931_0003622 | 3300035691 | Bacteria | 6976 |
| 601 | Ga0373931_0004555 | 3300035691 | Bacteria | 6342 |
| 602 | Ga0373931_0004664 | 3300035691 | Bacteria | 6272 |
| 603 | Ga0373931_0006426 | 3300035691 | Bacteria | 5491 |
| 604 | Ga0373931_0041086 | 3300035691 | Bacteria | 2428 |
| 605 | Ga0373935_0081768 | 3300035692 | Bacteria | 2101 |
| 606 | Ga0373935_0082180 | 3300035692 | Bacteria | 2095 |
| 607 | Ga0373927_0000968 | 3300035695 | Bacteria | 21802 |
| 608 | Ga0373927_0017152 | 3300035695 | Bacteria | 4771 |
| 609 | Ga0373927_0053980 | 3300035695 | Bacteria | 2599 |
| 610 | Ga0373927_0068067 | 3300035695 | Bacteria | 2304 |
| 611 | Ga0373933_0009993 | 3300035724 | Bacteria | 5196 |
| 612 | Ga0373933_0013538 | 3300035724 | Bacteria | 4523 |
| 613 | Ga0373947_0008044 | 3300035725 | Bacteria | 6083 |
| 614 | Ga0373947_0032192 | 3300035725 | Bacteria | 3089 |
| 615 | Ga0373947_0037935 | 3300035725 | Bacteria | 2860 |
| 616 | Ga0373937_0009714 | 3300036401 | Bacteria | 8387 |
| 617 | Ga0373937_0022169 | 3300036401 | Bacteria | 5706 |
| 618 | Ga0373937_0034178 | 3300036401 | Bacteria | 4624 |
| 619 | Ga0373937_0140640 | 3300036401 | Bacteria | 2258 |
| 620 | Ga0373937_0245070 | 3300036401 | Bacteria | 1689 |
| 621 | Ga0316584_0003417 | 3300036712 | Bacteria | 10301 |
| 622 | Ga0373925_0006677 | 3300037068 | Bacteria | 8462 |
| 623 | Ga0373925_0021394 | 3300037068 | Bacteria | 4712 |
| 624 | Ga0373925_0142403 | 3300037068 | Bacteria | 1877 |
| 625 | Ga0395900_0023743 | 3300037418 | Bacteria | 6273 |
| 626 | Ga0395901_0102198 | 3300038443 | Bacteria | 3008 |
| 627 | Ga0439441_009034 | 3300042001 | Bacteria | 1642 |
| 628 | Ga0439448_0046737 | 3300042005 | Bacteria | 1411 |
| 629 | Ga0439435_0029198 | 3300042436 | Bacteria | 1487 |
| 630 | Ga0466963_0032976 | 3300044694 | Bacteria | 3358 |
| 631 | Ga0451576_0279840 | 3300045051 | Bacteria | 1744 |
| 632 | Ga0466958_0022175 | 3300045836 | Bacteria | 3718 |
| 633 | Ga0466967_0059363 | 3300045976 | Bacteria | 3385 |
| 634 | Ga0466967_0249303 | 3300045976 | Bacteria | 1696 |
| 635 | Ga0495627_043794 | 3300046453 | Bacteria | 1367 |
| 636 | Ga0495592_0048841 | 3300046454 | Bacteria | 3146 |
| 637 | Ga0495592_0061350 | 3300046454 | Bacteria | 2763 |
| 638 | Ga0495603_0002293 | 3300046455 | Bacteria | 11243 |
| 639 | Ga0495603_0005366 | 3300046455 | Bacteria | 7643 |
| 640 | Ga0495603_0010934 | 3300046455 | Bacteria | 5505 |
| 641 | Ga0495603_0020881 | 3300046455 | Bacteria | 3964 |
| 642 | Ga0495591_000044 | 3300046458 | Bacteria | 145782 |
| 643 | Ga0495591_038988 | 3300046458 | Bacteria | 1364 |
| 644 | Ga0495629_0001364 | 3300046459 | Bacteria | 19250 |
| 645 | Ga0495629_0002564 | 3300046459 | Bacteria | 13928 |
| 646 | Ga0495629_0002876 | 3300046459 | Bacteria | 13160 |
| 647 | Ga0495629_0026084 | 3300046459 | Bacteria | 4153 |
| 648 | Ga0495629_0108131 | 3300046459 | Bacteria | 1939 |
| 649 | Ga0495641_0006473 | 3300046461 | Bacteria | 7578 |
| 650 | Ga0495641_0010975 | 3300046461 | Bacteria | 5201 |
| 651 | Ga0495641_0038439 | 3300046461 | Bacteria | 2236 |
| 652 | Ga0495651_0002023 | 3300046462 | Bacteria | 15661 |
| 653 | Ga0495651_0031770 | 3300046462 | Bacteria | 4115 |
| 654 | Ga0495651_0045157 | 3300046462 | Bacteria | 3414 |
| 655 | Ga0495653_0004459 | 3300046463 | Bacteria | 11307 |
| 656 | Ga0495653_0021421 | 3300046463 | Bacteria | 5237 |
| 657 | Ga0495653_0096499 | 3300046463 | Bacteria | 2149 |
| 658 | Ga0495650_0002409 | 3300046471 | Bacteria | 15230 |
| 659 | Ga0495580_0005184 | 3300046472 | Bacteria | 10831 |
| 660 | Ga0495580_0005516 | 3300046472 | Bacteria | 10443 |
| 661 | Ga0495580_0111760 | 3300046472 | Bacteria | 1897 |
| 662 | Ga0495582_0001095 | 3300046473 | Bacteria | 15194 |
| 663 | Ga0495582_0003419 | 3300046473 | Bacteria | 8939 |
| 664 | Ga0495582_0008108 | 3300046473 | Bacteria | 5800 |
| 665 | Ga0495605_0000036 | 3300046474 | Bacteria | 203902 |
| 666 | Ga0495605_0000319 | 3300046474 | Bacteria | 50232 |
| 667 | Ga0495605_0003147 | 3300046474 | Bacteria | 9933 |
| 668 | Ga0495639_0000941 | 3300046475 | Bacteria | 13166 |
| 669 | Ga0495662_0002531 | 3300046476 | Bacteria | 9221 |
| 670 | Ga0495662_0025584 | 3300046476 | Bacteria | 2850 |
| 671 | Ga0495664_0000979 | 3300046477 | Bacteria | 14686 |
| 672 | Ga0495664_0008006 | 3300046477 | Bacteria | 5884 |
| 673 | Ga0495664_0050000 | 3300046477 | Bacteria | 2481 |
| 674 | Ga0495664_0141863 | 3300046477 | Bacteria | 1457 |
| 675 | Ga0495584_0011697 | 3300046491 | Bacteria | 4489 |
| 676 | Ga0495584_0012196 | 3300046491 | Bacteria | 4391 |
| 677 | Ga0495584_0025149 | 3300046491 | Bacteria | 3018 |
| 678 | Ga0495585_0000899 | 3300046492 | Bacteria | 25182 |
| 679 | Ga0495585_0002650 | 3300046492 | Bacteria | 12574 |
| 680 | Ga0495585_0013050 | 3300046492 | Bacteria | 4874 |
| 681 | Ga0495594_0005004 | 3300046499 | Bacteria | 6820 |
| 682 | Ga0495594_0028196 | 3300046499 | Bacteria | 3028 |
| 683 | Ga0495594_0031578 | 3300046499 | Bacteria | 2872 |
| 684 | Ga0495594_0060733 | 3300046499 | Bacteria | 2091 |
| 685 | Ga0495594_0077807 | 3300046499 | Bacteria | 1850 |
| 686 | Ga0495596_0000011 | 3300046500 | Bacteria | 129089 |
| 687 | Ga0495596_0011112 | 3300046500 | Bacteria | 3894 |
| 688 | Ga0495607_0000033 | 3300046501 | Bacteria | 149382 |
| 689 | Ga0495607_0000082 | 3300046501 | Bacteria | 96822 |
| 690 | Ga0495607_0012207 | 3300046501 | Bacteria | 5679 |
| 691 | Ga0495583_0000028 | 3300046506 | Bacteria | 255787 |
| 692 | Ga0495583_0011248 | 3300046506 | Bacteria | 5151 |
| 693 | Ga0495583_0055560 | 3300046506 | Bacteria | 1789 |
| 694 | Ga0495608_0001643 | 3300046511 | Bacteria | 16062 |
| 695 | Ga0495608_0026473 | 3300046511 | Bacteria | 3953 |
| 696 | Ga0495608_0032300 | 3300046511 | Bacteria | 3538 |
| 697 | Ga0495610_0000335 | 3300046512 | Bacteria | 49783 |
| 698 | Ga0495610_0002063 | 3300046512 | Bacteria | 17146 |
| 699 | Ga0495616_0003531 | 3300046513 | Bacteria | 9994 |
| 700 | Ga0495618_0043626 | 3300046514 | Bacteria | 2829 |
| 701 | Ga0495620_0000073 | 3300046515 | Bacteria | 83446 |
| 702 | Ga0495628_0006647 | 3300046516 | Bacteria | 10080 |
| 703 | Ga0495628_0043855 | 3300046516 | Bacteria | 3560 |
| 704 | Ga0495628_0079987 | 3300046516 | Bacteria | 2541 |
| 705 | Ga0495628_0118039 | 3300046516 | Bacteria | 2037 |
| 706 | Ga0495630_0002437 | 3300046517 | Bacteria | 12871 |
| 707 | Ga0495630_0054346 | 3300046517 | Bacteria | 3000 |
| 708 | Ga0495630_0169213 | 3300046517 | Bacteria | 1664 |
| 709 | Ga0495631_0007352 | 3300046518 | Bacteria | 5608 |
| 710 | Ga0495631_0028388 | 3300046518 | Bacteria | 2552 |
| 711 | Ga0495637_0003222 | 3300046520 | Bacteria | 8711 |
| 712 | Ga0495637_0097548 | 3300046520 | Bacteria | 1152 |
| 713 | Ga0495643_0002991 | 3300046522 | Bacteria | 12766 |
| 714 | Ga0495644_0000445 | 3300046523 | Bacteria | 18207 |
| 715 | Ga0495648_0000560 | 3300046524 | Bacteria | 39735 |
| 716 | Ga0495648_0006076 | 3300046524 | Bacteria | 9906 |
| 717 | Ga0495648_0007025 | 3300046524 | Bacteria | 9075 |
| 718 | Ga0495648_0010336 | 3300046524 | Bacteria | 7118 |
| 719 | Ga0495663_0020250 | 3300046525 | Bacteria | 1908 |
| 720 | Ga0495666_0007830 | 3300046526 | Bacteria | 5351 |
| 721 | Ga0495666_0022256 | 3300046526 | Bacteria | 3138 |
| 722 | Ga0495652_0022462 | 3300046529 | Bacteria | 5598 |
| 723 | Ga0495652_0082426 | 3300046529 | Bacteria | 2650 |
| 724 | Ga0495654_0000246 | 3300046530 | Bacteria | 50620 |
| 725 | Ga0495665_0001379 | 3300046531 | Bacteria | 13002 |
| 726 | Ga0495665_0004404 | 3300046531 | Bacteria | 7604 |
| 727 | Ga0495640_0004511 | 3300046533 | Bacteria | 11101 |
| 728 | Ga0495640_0090454 | 3300046533 | Bacteria | 2020 |
| 729 | Ga0495586_0046796 | 3300046535 | Bacteria | 2333 |
| 730 | Ga0495587_0001373 | 3300046536 | Bacteria | 16173 |
| 731 | Ga0495587_0009992 | 3300046536 | Bacteria | 6060 |
| 732 | Ga0495587_0018377 | 3300046536 | Bacteria | 4337 |
| 733 | Ga0495609_0000115 | 3300046538 | Bacteria | 93419 |
| 734 | Ga0495609_0000559 | 3300046538 | Bacteria | 29353 |
| 735 | Ga0495609_0001063 | 3300046538 | Bacteria | 19233 |
| 736 | Ga0495609_0009594 | 3300046538 | Bacteria | 4679 |
| 737 | Ga0495621_0017424 | 3300046539 | Bacteria | 2322 |
| 738 | Ga0495597_0000008 | 3300046542 | Bacteria | 232976 |
| 739 | Ga0495597_0000635 | 3300046542 | Bacteria | 28659 |
| 740 | Ga0495645_0002459 | 3300046543 | Bacteria | 12577 |
| 741 | Ga0495645_0064572 | 3300046543 | Bacteria | 2648 |
| 742 | Ga0495622_0036011 | 3300046557 | Bacteria | 2308 |
| 743 | Ga0495622_0038051 | 3300046557 | Bacteria | 2240 |
| 744 | Ga0495633_0000028 | 3300046558 | Bacteria | 203214 |
| 745 | Ga0495633_0013577 | 3300046558 | Bacteria | 4286 |
| 746 | Ga0495633_0030713 | 3300046558 | Bacteria | 2608 |
| 747 | Ga0495667_0005892 | 3300046559 | Bacteria | 8299 |
| 748 | Ga0495667_0047496 | 3300046559 | Bacteria | 2836 |
| 749 | Ga0495656_0006622 | 3300046615 | Bacteria | 4067 |
| 750 | Ga0495634_0002678 | 3300046642 | Bacteria | 14633 |
| 751 | Ga0495634_0008593 | 3300046642 | Bacteria | 7584 |
| 752 | Ga0495634_0080629 | 3300046642 | Bacteria | 2129 |
| 753 | Ga0495611_0003757 | 3300046648 | Bacteria | 6629 |
| 754 | Ga0495611_0005320 | 3300046648 | Bacteria | 5510 |
| 755 | Ga0495611_0032581 | 3300046648 | Bacteria | 2297 |
| 756 | Ga0495611_0087073 | 3300046648 | Bacteria | 1441 |
| 757 | Ga0495625_0017966 | 3300046660 | Bacteria | 5528 |
| 758 | Ga0495625_0128154 | 3300046660 | Bacteria | 1721 |
| 759 | Ga0495635_0006445 | 3300046663 | Bacteria | 8183 |
| 760 | Ga0495635_0007625 | 3300046663 | Bacteria | 7553 |
| 761 | Ga0495635_0019101 | 3300046663 | Bacteria | 4784 |
| 762 | Ga0495635_0033323 | 3300046663 | Bacteria | 3573 |
| 763 | Ga0495659_0005289 | 3300046664 | Bacteria | 4061 |
| 764 | Ga0495661_0000211 | 3300046665 | Bacteria | 67481 |
| 765 | Ga0495661_0004192 | 3300046665 | Bacteria | 10483 |
| 766 | Ga0495661_0009431 | 3300046665 | Bacteria | 6699 |
| 767 | Ga0495661_0107314 | 3300046665 | Bacteria | 1561 |
| 768 | Ga0495588_0012960 | 3300046674 | Bacteria | 3958 |
| 769 | Ga0495588_0017586 | 3300046674 | Bacteria | 3476 |
| 770 | Ga0495599_0002224 | 3300046678 | Bacteria | 11291 |
| 771 | Ga0495599_0024296 | 3300046678 | Bacteria | 3790 |
| 772 | Ga0495599_0044135 | 3300046678 | Bacteria | 2796 |
| 773 | Ga0495599_0076830 | 3300046678 | Bacteria | 2085 |
| 774 | Ga0495623_0003831 | 3300046679 | Bacteria | 9913 |
| 775 | Ga0495623_0005546 | 3300046679 | Bacteria | 8244 |
| 776 | Ga0495646_0001750 | 3300046680 | Bacteria | 13032 |
| 777 | Ga0495646_0028182 | 3300046680 | Bacteria | 3518 |
| 778 | Ga0495647_0004940 | 3300046681 | Bacteria | 4366 |
| 779 | Ga0495647_0006480 | 3300046681 | Bacteria | 3880 |
| 780 | Ga0495658_0001147 | 3300046683 | Bacteria | 13988 |
| 781 | Ga0495613_0003816 | 3300046689 | Bacteria | 11289 |
| 782 | Ga0495613_0018669 | 3300046689 | Bacteria | 5171 |
| 783 | Ga0495613_0060939 | 3300046689 | Bacteria | 2763 |
| 784 | Ga0495613_0241970 | 3300046689 | Unclassified | 1261 |
| 785 | Ga0495624_0007846 | 3300046690 | Bacteria | 7490 |
| 786 | Ga0495624_0013237 | 3300046690 | Bacteria | 5623 |
| 787 | Ga0495624_0091329 | 3300046690 | Bacteria | 1878 |
| 788 | Ga0495670_0001286 | 3300046691 | Bacteria | 12255 |
| 789 | Ga0495670_0019359 | 3300046691 | Bacteria | 3353 |
| 790 | Ga0495670_0059085 | 3300046691 | Bacteria | 1925 |
| 791 | Ga0495671_0000179 | 3300046692 | Bacteria | 56305 |
| 792 | Ga0495671_0071420 | 3300046692 | Bacteria | 1705 |
| 793 | Ga0495649_0001931 | 3300046694 | Bacteria | 15113 |
| 794 | Ga0495649_0065973 | 3300046694 | Bacteria | 1943 |
| 795 | Ga0495589_0009823 | 3300046794 | Bacteria | 4969 |
| 796 | Ga0495600_0002906 | 3300046809 | Bacteria | 9980 |
| 797 | Ga0495600_0020354 | 3300046809 | Bacteria | 4244 |
| 798 | Ga0495600_0020460 | 3300046809 | Bacteria | 4232 |
| 799 | Ga0495600_0054673 | 3300046809 | Bacteria | 2608 |
| 800 | Ga0495660_0001015 | 3300046810 | Bacteria | 20407 |
| 801 | Ga0495660_0002289 | 3300046810 | Bacteria | 12310 |
| 802 | Ga0495581_0005187 | 3300047315 | Bacteria | 7538 |
| 803 | Ga0495581_0071021 | 3300047315 | Bacteria | 2014 |
| 804 | Ga0495581_0075967 | 3300047315 | Bacteria | 1943 |
| 805 | Ga0495581_0141111 | 3300047315 | Bacteria | 1405 |
| 806 | Ga0495604_0004474 | 3300047317 | Bacteria | 11072 |
| 807 | Ga0495604_0007920 | 3300047317 | Bacteria | 8416 |
| 808 | Ga0495604_0030565 | 3300047317 | Bacteria | 4277 |
| 809 | Ga0495636_0031170 | 3300047318 | Bacteria | 2184 |
| 810 | Ga0495636_0055328 | 3300047318 | Bacteria | 1669 |
| 811 | Ga0495674_0006076 | 3300047319 | Bacteria | 11590 |
| 812 | Ga0495672_0017357 | 3300047320 | Bacteria | 4815 |
| 813 | Ga0495672_0035475 | 3300047320 | Bacteria | 3072 |
| 814 | Ga0495676_0008485 | 3300047321 | Bacteria | 9414 |
| 815 | Ga0495676_0048913 | 3300047321 | Bacteria | 3404 |
| 816 | Ga0495676_0058169 | 3300047321 | Bacteria | 3043 |
| 817 | Ga0495676_0149108 | 3300047321 | Bacteria | 1667 |
| 818 | Ga0495680_0001681 | 3300047322 | Bacteria | 23530 |
| 819 | Ga0495680_0006455 | 3300047322 | Bacteria | 10892 |
| 820 | Ga0495680_0012029 | 3300047322 | Bacteria | 7635 |
| 821 | Ga0495680_0032432 | 3300047322 | Bacteria | 4240 |
| 822 | Ga0495680_0080454 | 3300047322 | Bacteria | 2462 |
| 823 | Ga0495683_0000091 | 3300047323 | Bacteria | 91313 |
| 824 | Ga0495683_0113847 | 3300047323 | Bacteria | 1289 |
| 825 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 826 | Ga0495675_0009789 | 3300047444 | Bacteria | 5977 |
| 827 | Ga0495679_000083 | 3300047446 | Bacteria | 87051 |
| 828 | Ga0495679_002640 | 3300047446 | Bacteria | 9002 |
| 829 | Ga0495685_061532 | 3300047447 | Bacteria | 1264 |
| 830 | Ga0495673_0012965 | 3300047469 | Bacteria | 4393 |
| 831 | Ga0495673_0027281 | 3300047469 | Bacteria | 2720 |
| 832 | Ga0495681_0009092 | 3300047470 | Bacteria | 6157 |
| 833 | Ga0495684_0016404 | 3300047471 | Bacteria | 5704 |
| 834 | Ga0495593_0000213 | 3300047673 | Bacteria | 30598 |
| 835 | Ga0495593_0002662 | 3300047673 | Bacteria | 10743 |
| 836 | Ga0495602_0026191 | 3300048088 | Bacteria | 5628 |
| 837 | Ga0495602_0067255 | 3300048088 | Bacteria | 3083 |
| 838 | Ga0495602_0184897 | 3300048088 | Bacteria | 1603 |
| 839 | Ga0495614_0002734 | 3300048089 | Bacteria | 7845 |
| 840 | Ga0495614_0074068 | 3300048089 | Bacteria | 1470 |
| 841 | Ga0495626_0023131 | 3300048091 | Bacteria | 3063 |
| 842 | Ga0496100_0002401 | 3300048903 | Bacteria | 9490 |
| 843 | Ga0496100_0011288 | 3300048903 | Bacteria | 5082 |
| 844 | Ga0496100_0015342 | 3300048903 | Bacteria | 4473 |
| 845 | Ga0496100_0023500 | 3300048903 | Bacteria | 3746 |
| 846 | Ga0496100_0049331 | 3300048903 | Bacteria | 2721 |
| 847 | Ga0496101_0000360 | 3300048904 | Bacteria | 30528 |
| 848 | Ga0496101_0034661 | 3300048904 | Bacteria | 3566 |
| 849 | Ga0496102_0013402 | 3300048905 | Bacteria | 7101 |
| 850 | Ga0496102_0021629 | 3300048905 | Bacteria | 5690 |
| 851 | Ga0496102_0029699 | 3300048905 | Bacteria | 4892 |
| 852 | Ga0496102_0070994 | 3300048905 | Bacteria | 3198 |
| 853 | Ga0496102_0173607 | 3300048905 | Bacteria | 2029 |
| 854 | Ga0496102_0472319 | 3300048905 | Bacteria | 1175 |
| 855 | Ga0496103_0001517 | 3300048906 | Bacteria | 15519 |
| 856 | Ga0496103_0026444 | 3300048906 | Bacteria | 3513 |
| 857 | Ga0496103_0090279 | 3300048906 | Bacteria | 1933 |
| 858 | Ga0496104_0022869 | 3300048907 | Bacteria | 5743 |
| 859 | Ga0496104_0081924 | 3300048907 | Bacteria | 3077 |
| 860 | Ga0496104_0105690 | 3300048907 | Bacteria | 2697 |
| 861 | Ga0496104_0125578 | 3300048907 | Bacteria | 2464 |
| 862 | Ga0496105_0003179 | 3300048908 | Bacteria | 12107 |
| 863 | Ga0496105_0012959 | 3300048908 | Bacteria | 6606 |
| 864 | Ga0496105_0042530 | 3300048908 | Bacteria | 3745 |
| 865 | Ga0496106_0000679 | 3300048909 | Bacteria | 24408 |
| 866 | Ga0496106_0004879 | 3300048909 | Bacteria | 9930 |
| 867 | Ga0496106_0065356 | 3300048909 | Bacteria | 2769 |
| 868 | Ga0496106_0128690 | 3300048909 | Bacteria | 1984 |
| 869 | Ga0496106_0197995 | 3300048909 | Bacteria | 1598 |
| 870 | Ga0496107_0000386 | 3300048910 | Bacteria | 23962 |
| 871 | Ga0496107_0007583 | 3300048910 | Bacteria | 7488 |
| 872 | Ga0496107_0019793 | 3300048910 | Bacteria | 4751 |
| 873 | Ga0496107_0070523 | 3300048910 | Bacteria | 2537 |
| 874 | Ga0496108_0011200 | 3300048911 | Bacteria | 7288 |
| 875 | Ga0496108_0091346 | 3300048911 | Bacteria | 2588 |
| 876 | Ga0496108_0107114 | 3300048911 | Bacteria | 2387 |
| 877 | Ga0496108_0261005 | 3300048911 | Bacteria | 1507 |
| 878 | Ga0496109_0007323 | 3300048912 | Bacteria | 9331 |
| 879 | Ga0496109_0018945 | 3300048912 | Bacteria | 6060 |
| 880 | Ga0496109_0041883 | 3300048912 | Bacteria | 4148 |
| 881 | Ga0496109_0087652 | 3300048912 | Bacteria | 2875 |
| 882 | Ga0496109_0104430 | 3300048912 | Bacteria | 2631 |
| 883 | Ga0496109_0143345 | 3300048912 | Bacteria | 2234 |
| 884 | Ga0496110_0013940 | 3300048913 | Bacteria | 6660 |
| 885 | Ga0496110_0031751 | 3300048913 | Bacteria | 4559 |
| 886 | Ga0496110_0052111 | 3300048913 | Bacteria | 3596 |
| 887 | Ga0496110_0305637 | 3300048913 | Bacteria | 1449 |
| 888 | Ga0496111_0067605 | 3300048914 | Bacteria | 2596 |
| 889 | Ga0496111_0123973 | 3300048914 | Bacteria | 1909 |
| 890 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 891 | Ga0496112_0022724 | 3300048915 | Bacteria | 5982 |
| 892 | Ga0496112_0050647 | 3300048915 | Bacteria | 4073 |
| 893 | Ga0496112_0111560 | 3300048915 | Bacteria | 2704 |
| 894 | Ga0496112_0156680 | 3300048915 | Bacteria | 2244 |
| 895 | Ga0496113_0113326 | 3300048916 | Bacteria | 2113 |
| 896 | Ga0496114_0006840 | 3300048917 | Bacteria | 8982 |
| 897 | Ga0496114_0032476 | 3300048917 | Bacteria | 4296 |
| 898 | Ga0496114_0224754 | 3300048917 | Bacteria | 1648 |
| 899 | Ga0496115_0018716 | 3300048918 | Bacteria | 5324 |
| 900 | Ga0496115_0033229 | 3300048918 | Bacteria | 4071 |
| 901 | Ga0496115_0206352 | 3300048918 | Bacteria | 1623 |
| 902 | Ga0496116_0001641 | 3300048919 | Bacteria | 24629 |
| 903 | Ga0496121_0004777 | 3300048924 | Bacteria | 17872 |
| 904 | Ga0496122_0143010 | 3300048925 | Bacteria | 1492 |
| 905 | Ga0496123_0000340 | 3300048926 | Bacteria | 88113 |
| 906 | Ga0496125_0004305 | 3300048928 | Bacteria | 16526 |
| 907 | Ga0496125_0134661 | 3300048928 | Bacteria | 1731 |
| 908 | Ga0496126_0147413 | 3300048929 | Bacteria | 2020 |
| 909 | Ga0495678_000020 | 3300049459 | Bacteria | 253654 |
| 910 | Ga0501032_0020697 | 3300049569 | Bacteria | 4580 |
| 911 | Ga0501034_0000439 | 3300049571 | Bacteria | 68932 |
| 912 | Ga0501034_0005470 | 3300049571 | Bacteria | 13871 |
| 913 | Ga0501034_0014991 | 3300049571 | Bacteria | 7973 |
| 914 | Ga0501034_0201518 | 3300049571 | Bacteria | 1948 |
| 915 | Ga0501034_0209403 | 3300049571 | Bacteria | 1905 |
| 916 | Ga0501036_0313163 | 3300049572 | Bacteria | 1312 |
| 917 | Ga0501037_0044470 | 3300049573 | Bacteria | 3261 |
| 918 | Ga0501038_0021068 | 3300049574 | Bacteria | 5855 |
| 919 | Ga0501039_0162645 | 3300049575 | Bacteria | 1755 |
| 920 | Ga0501040_0107608 | 3300049576 | Bacteria | 1949 |
| 921 | Ga0501041_0022442 | 3300049577 | Bacteria | 3779 |
| 922 | Ga0501042_0142079 | 3300049578 | Bacteria | 1731 |
| 923 | Ga0501046_0037085 | 3300049580 | Bacteria | 3919 |
| 924 | Ga0501046_0246865 | 3300049580 | Bacteria | 1315 |
| 925 | Ga0501047_0007433 | 3300049581 | Bacteria | 10312 |
| 926 | Ga0501047_0015501 | 3300049581 | Bacteria | 7262 |
| 927 | Ga0501048_0055678 | 3300049582 | Bacteria | 2807 |
| 928 | Ga0501068_0016141 | 3300049584 | Bacteria | 4302 |
| 929 | Ga0501068_0102849 | 3300049584 | Bacteria | 1771 |
| 930 | Ga0501069_0030851 | 3300049585 | Bacteria | 2945 |
| 931 | Ga0501070_0025724 | 3300049586 | Bacteria | 4937 |
| 932 | Ga0501071_0094480 | 3300049587 | Bacteria | 2199 |
| 933 | Ga0501072_0100920 | 3300049588 | Bacteria | 2294 |
| 934 | Ga0501072_0241325 | 3300049588 | Bacteria | 1439 |
| 935 | Ga0501074_0216582 | 3300049590 | Bacteria | 1364 |
| 936 | Ga0501074_0238856 | 3300049590 | Unclassified | 1293 |
| 937 | Ga0501075_0084985 | 3300049591 | Bacteria | 2397 |
| 938 | Ga0501079_0020754 | 3300049741 | Bacteria | 5024 |
| 939 | Ga0501079_0099656 | 3300049741 | Bacteria | 2252 |
| 940 | Ga0501080_0009456 | 3300049742 | Bacteria | 8891 |
| 941 | Ga0501080_0053356 | 3300049742 | Bacteria | 3763 |
| 942 | Ga0501080_0119726 | 3300049742 | Bacteria | 2441 |
| 943 | Ga0501081_0015200 | 3300049743 | Bacteria | 5078 |
| 944 | Ga0501081_0096055 | 3300049743 | Bacteria | 2090 |
| 945 | Ga0501083_0029362 | 3300049744 | Bacteria | 3783 |
| 946 | Ga0501083_0115042 | 3300049744 | Bacteria | 1766 |
| 947 | Ga0501035_0025138 | 3300049822 | Bacteria | 5460 |
| 948 | Ga0501044_0035910 | 3300049823 | Bacteria | 5187 |
| 949 | Ga0501045_0040220 | 3300049824 | Bacteria | 3403 |
| 950 | nmdc:mga0k408_24978_c1 | 3300050493 | Bacteria | 3381 |
| 951 | nmdc:mga06z11_120557_c2 | 3300050494 | Bacteria | 1155 |
| 952 | nmdc:mga05p37_183054_c1 | 3300050507 | Bacteria | 2548 |
| 953 | nmdc:mga05p37_32_c1 | 3300050507 | Bacteria | 112982 |
| 954 | nmdc:mga05p37_82732_c1 | 3300050507 | Bacteria | 3956 |
| 955 | nmdc:mga09592_104072_c1 | 3300050508 | Bacteria | 2432 |
| 956 | nmdc:mga09592_3106_c1 | 3300050508 | Bacteria | 13485 |
| 957 | nmdc:mga09592_62290_c1 | 3300050508 | Bacteria | 3156 |
| 958 | nmdc:mga0qj67_1076_c1 | 3300050509 | Bacteria | 18902 |
| 959 | nmdc:mga0qj67_25768_c1 | 3300050509 | Bacteria | 4548 |
| 960 | nmdc:mga06r32_1541_c1 | 3300050510 | Bacteria | 20758 |
| 961 | nmdc:mga06r32_1900_c1 | 3300050510 | Bacteria | 18601 |
| 962 | nmdc:mga08y16_2892_c1 | 3300050511 | Bacteria | 17659 |
| 963 | nmdc:mga08y16_377484_c1 | 3300050511 | Bacteria | 1453 |
| 964 | nmdc:mga08y16_68965_c1 | 3300050511 | Bacteria | 3687 |
| 965 | nmdc:mga0n895_1533_c1 | 3300050512 | Bacteria | 17365 |
| 966 | nmdc:mga0n895_196240_c1 | 3300050512 | Bacteria | 2050 |
| 967 | nmdc:mga0n895_4346_c1 | 3300050512 | Bacteria | 11615 |
| 968 | nmdc:mga0rr50_1688_c1 | 3300050513 | Bacteria | 4280 |
| 969 | nmdc:mga0rr50_75230_c1 | 3300050513 | Bacteria | 2588 |
| 970 | nmdc:mga08x19_22_c1 | 3300050514 | Bacteria | 297462 |
| 971 | nmdc:mga08x19_261_c1 | 3300050514 | Bacteria | 40081 |
| 972 | nmdc:mga08x19_27532_c1 | 3300050514 | Bacteria | 3555 |
| 973 | nmdc:mga08x19_59084_c1 | 3300050514 | Bacteria | 2482 |
| 974 | nmdc:mga0a205_17203_c1 | 3300050515 | Bacteria | 6772 |
| 975 | nmdc:mga0a205_19478_c1 | 3300050515 | Bacteria | 6398 |
| 976 | nmdc:mga0a205_3714_c1 | 3300050515 | Bacteria | 13666 |
| 977 | Ga0495601_0002962 | 3300053077 | Bacteria | 9658 |
| 978 | Ga0495601_0031125 | 3300053077 | Bacteria | 3315 |
| 979 | Ga0495601_0045485 | 3300053077 | Bacteria | 2760 |
| 980 | Ga0495601_0060299 | 3300053077 | Bacteria | 2407 |
| 981 | Ga0495601_0122809 | 3300053077 | Bacteria | 1688 |
| 982 | Ga0495612_0002607 | 3300053078 | Bacteria | 7439 |
| 983 | Ga0495612_0044417 | 3300053078 | Bacteria | 1818 |
| 984 | Ga0495595_0003556 | 3300053084 | Bacteria | 6184 |
| 985 | Ga0495595_0006128 | 3300053084 | Bacteria | 4887 |
| 986 | Ga0495619_0003525 | 3300053085 | Bacteria | 10092 |
| 987 | Ga0500593_004153 | 3300053117 | Bacteria | 5572 |
| 988 | Ga0501084_0067166 | 3300054114 | Bacteria | 3001 |
| 989 | Ga0501084_0101208 | 3300054114 | Bacteria | 2420 |
| 990 | Ga0501082_0084114 | 3300060353 | Bacteria | 2744 |
| 991 | Ga0530510_0025809 | 3300061734 | Bacteria | 4203 |
| 992 | Ga0530510_0042593 | 3300061734 | Bacteria | 3280 |
| 993 | Ga0530510_0425297 | 3300061734 | Bacteria | 1003 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046558 | Ga0495633_0030713 | Ga0495633_0030713_1642_2592 | 306 |
| 2 | 3300047323 | Ga0495683_0113847 | Ga0495683_0113847_17_967 | 306 |
| 3 | 3300046477 | Ga0495664_0050000 | Ga0495664_0050000_11_970 | 309 |
| 4 | 3300048905 | Ga0496102_0472319 | Ga0496102_0472319_200_1159 | 309 |
| 5 | 3300050494 | nmdc:mga06z11_120557_c2 | nmdc:mga06z11_120557_c2_37_996 | 309 |
| 6 | 3300061734 | Ga0530510_0425297 | Ga0530510_0425297_20_979 | 309 |
| 7 | 3300049741 | Ga0501079_0020754 | Ga0501079_0020754_65_1051 | 313 |
| 8 | 3300025942 | Ga0207689_10087951 | Ga0207689_100879513 | 323 |
| 9 | 3300049580 | Ga0501046_0037085 | Ga0501046_0037085_2348_3358 | 326 |
| 10 | 3300046520 | Ga0495637_0097548 | Ga0495637_0097548_14_1072 | 342 |
| 11 | 3300049587 | Ga0501071_0094480 | Ga0501071_0094480_816_1973 | 342 |
| 12 | 3300049588 | Ga0501072_0241325 | Ga0501072_0241325_142_1299 | 342 |
| 13 | 3300049742 | Ga0501080_0009456 | Ga0501080_0009456_337_1494 | 342 |
| 14 | 3300048911 | Ga0496108_0107114 | Ga0496108_0107114_403_1512 | 345 |
| 15 | 3300005336 | Ga0070680_100129119 | Ga0070680_1001291192 | 351 |
| 16 | 3300005366 | Ga0070659_100067952 | Ga0070659_1000679521 | 351 |
| 17 | 3300005614 | Ga0068856_100342804 | Ga0068856_1003428042 | 351 |
| 18 | 3300005616 | Ga0068852_100008946 | Ga0068852_1000089464 | 351 |
| 19 | 3300013105 | Ga0157369_10169139 | Ga0157369_101691392 | 351 |
| 20 | 3300025913 | Ga0207695_10247441 | Ga0207695_102474411 | 351 |
| 21 | 3300025919 | Ga0207657_10005565 | Ga0207657_100055654 | 351 |
| 22 | 3300025921 | Ga0207652_10075246 | Ga0207652_100752461 | 351 |
| 23 | 3300025932 | Ga0207690_10206635 | Ga0207690_102066352 | 351 |
| 24 | 3300025981 | Ga0207640_10043437 | Ga0207640_100434372 | 351 |
| 25 | 3300031595 | Ga0265313_10016591 | Ga0265313_100165913 | 351 |
| 26 | 3300031711 | Ga0265314_10144430 | Ga0265314_101444302 | 351 |
| 27 | 3300031712 | Ga0265342_10000548 | Ga0265342_1000054829 | 351 |
| 28 | 3300042005 | Ga0439448_0046737 | Ga0439448_0046737_16_1182 | 351 |
| 29 | 3300049581 | Ga0501047_0007433 | Ga0501047_0007433_1496_2662 | 351 |
| 30 | 3300050510 | nmdc:mga06r32_1541_c1 | nmdc:mga06r32_1541_c1_10018_11187 | 352 |
| 31 | 3300025939 | Ga0207665_10064480 | Ga0207665_100644802 | 353 |
| 32 | 3300061734 | Ga0530510_0042593 | Ga0530510_0042593_710_1879 | 354 |
| 33 | 3300035172 | Ga0373955_0051287 | Ga0373955_0051287_359_1609 | 355 |
| 34 | 3300005336 | Ga0070680_100092537 | Ga0070680_1000925372 | 356 |
| 35 | 3300005339 | Ga0070660_100164961 | Ga0070660_1001649611 | 356 |
| 36 | 3300005444 | Ga0070694_100053384 | Ga0070694_1000533842 | 356 |
| 37 | 3300005457 | Ga0070662_100023831 | Ga0070662_1000238312 | 356 |
| 38 | 3300005458 | Ga0070681_10019233 | Ga0070681_100192336 | 356 |
| 39 | 3300005546 | Ga0070696_100025374 | Ga0070696_1000253744 | 356 |
| 40 | 3300005547 | Ga0070693_100010486 | Ga0070693_1000104862 | 356 |
| 41 | 3300005615 | Ga0070702_100041521 | Ga0070702_1000415211 | 356 |
| 42 | 3300025911 | Ga0207654_10053761 | Ga0207654_100537611 | 356 |
| 43 | 3300025919 | Ga0207657_10050796 | Ga0207657_100507962 | 356 |
| 44 | 3300025933 | Ga0207706_10018772 | Ga0207706_100187726 | 356 |
| 45 | 3300026067 | Ga0207678_10037864 | Ga0207678_100378642 | 356 |
| 46 | 3300035090 | Ga0373949_0017573 | Ga0373949_0017573_317_1486 | 356 |
| 47 | 3300046690 | Ga0495624_0091329 | Ga0495624_0091329_462_1631 | 356 |
| 48 | 3300048910 | Ga0496107_0070523 | Ga0496107_0070523_1310_2479 | 356 |
| 49 | 3300054114 | Ga0501084_0101208 | Ga0501084_0101208_1269_2402 | 356 |
| 50 | 3300005329 | Ga0070683_100061281 | Ga0070683_1000612813 | 357 |
| 51 | 3300005437 | Ga0070710_10010584 | Ga0070710_100105843 | 357 |
| 52 | 3300005439 | Ga0070711_100174145 | Ga0070711_1001741452 | 357 |
| 53 | 3300005458 | Ga0070681_10120122 | Ga0070681_101201222 | 357 |
| 54 | 3300007076 | Ga0075435_100020291 | Ga0075435_1000202915 | 357 |
| 55 | 3300025912 | Ga0207707_10057798 | Ga0207707_100577982 | 357 |
| 56 | 3300025929 | Ga0207664_10259902 | Ga0207664_102599021 | 357 |
| 57 | 3300025939 | Ga0207665_10065992 | Ga0207665_100659922 | 357 |
| 58 | 3300025944 | Ga0207661_10139930 | Ga0207661_101399301 | 357 |
| 59 | 3300025949 | Ga0207667_10454537 | Ga0207667_104545371 | 357 |
| 60 | 3300026078 | Ga0207702_10116208 | Ga0207702_101162082 | 357 |
| 61 | 3300046463 | Ga0495653_0004459 | Ga0495653_0004459_4806_5978 | 357 |
| 62 | 3300050514 | nmdc:mga08x19_22_c1 | nmdc:mga08x19_22_c1_252510_253682 | 357 |
| 63 | 3300005458 | Ga0070681_10000525 | Ga0070681_100005253 | 358 |
| 64 | 3300006844 | Ga0075428_100106622 | Ga0075428_1001066222 | 358 |
| 65 | 3300006847 | Ga0075431_100012360 | Ga0075431_1000123608 | 358 |
| 66 | 3300013307 | Ga0157372_10243511 | Ga0157372_102435112 | 358 |
| 67 | 3300035691 | Ga0373931_0004555 | Ga0373931_0004555_2929_4083 | 358 |
| 68 | 3300042001 | Ga0439441_009034 | Ga0439441_009034_22_1128 | 358 |
| 69 | 3300046462 | Ga0495651_0031770 | Ga0495651_0031770_2750_4000 | 358 |
| 70 | 3300046477 | Ga0495664_0141863 | Ga0495664_0141863_180_1352 | 358 |
| 71 | 3300046516 | Ga0495628_0043855 | Ga0495628_0043855_185_1435 | 358 |
| 72 | 3300048088 | Ga0495602_0067255 | Ga0495602_0067255_58_1308 | 358 |
| 73 | 3300053077 | Ga0495601_0031125 | Ga0495601_0031125_473_1645 | 358 |
| 74 | 3300006948 | Ga0099826_10000023 | Ga0099826_1000002389 | 359 |
| 75 | 3300027666 | Ga0209282_1000047 | Ga0209282_100004740 | 359 |
| 76 | 3300031995 | Ga0307409_100238099 | Ga0307409_1002380992 | 359 |
| 77 | 3300035119 | Ga0373956_0019944 | Ga0373956_0019944_1565_2740 | 359 |
| 78 | 3300035724 | Ga0373933_0009993 | Ga0373933_0009993_2724_3899 | 359 |
| 79 | 3300036401 | Ga0373937_0022169 | Ga0373937_0022169_4505_5680 | 359 |
| 80 | 3300046462 | Ga0495651_0045157 | Ga0495651_0045157_392_1567 | 359 |
| 81 | 3300046511 | Ga0495608_0026473 | Ga0495608_0026473_88_1263 | 359 |
| 82 | 3300046809 | Ga0495600_0020460 | Ga0495600_0020460_1157_2332 | 359 |
| 83 | 3300047322 | Ga0495680_0012029 | Ga0495680_0012029_3974_5149 | 359 |
| 84 | 3300048088 | Ga0495602_0184897 | Ga0495602_0184897_361_1536 | 359 |
| 85 | 3300050514 | nmdc:mga08x19_27532_c1 | nmdc:mga08x19_27532_c1_1345_2490 | 359 |
| 86 | 3300053077 | Ga0495601_0002962 | Ga0495601_0002962_8323_9498 | 359 |
| 87 | 3300005327 | Ga0070658_10020743 | Ga0070658_100207434 | 360 |
| 88 | 3300005530 | Ga0070679_100086972 | Ga0070679_1000869722 | 360 |
| 89 | 3300005563 | Ga0068855_100013780 | Ga0068855_1000137802 | 360 |
| 90 | 3300009551 | Ga0105238_10024404 | Ga0105238_100244043 | 360 |
| 91 | 3300025924 | Ga0207694_10067329 | Ga0207694_100673291 | 360 |
| 92 | 3300026078 | Ga0207702_10047122 | Ga0207702_100471221 | 360 |
| 93 | 3300027671 | Ga0209588_1000010 | Ga0209588_100001065 | 360 |
| 94 | 3300048929 | Ga0496126_0147413 | Ga0496126_0147413_790_1962 | 360 |
| 95 | 3300049571 | Ga0501034_0014991 | Ga0501034_0014991_5526_6698 | 360 |
| 96 | 3300049572 | Ga0501036_0313163 | Ga0501036_0313163_81_1253 | 360 |
| 97 | 3300049586 | Ga0501070_0025724 | Ga0501070_0025724_3106_4278 | 360 |
| 98 | 3300009011 | Ga0105251_10026344 | Ga0105251_100263443 | 361 |
| 99 | 3300046474 | Ga0495605_0003147 | Ga0495605_0003147_798_1973 | 361 |
| 100 | 3300046491 | Ga0495584_0011697 | Ga0495584_0011697_1571_2746 | 361 |
| 101 | 3300046500 | Ga0495596_0000011 | Ga0495596_0000011_78921_80096 | 361 |
| 102 | 3300046512 | Ga0495610_0000335 | Ga0495610_0000335_41239_42414 | 361 |
| 103 | 3300046513 | Ga0495616_0003531 | Ga0495616_0003531_4507_5682 | 361 |
| 104 | 3300046524 | Ga0495648_0010336 | Ga0495648_0010336_5655_6830 | 361 |
| 105 | 3300046538 | Ga0495609_0001063 | Ga0495609_0001063_17753_18928 | 361 |
| 106 | 3300046615 | Ga0495656_0006622 | Ga0495656_0006622_276_1451 | 361 |
| 107 | 3300046692 | Ga0495671_0000179 | Ga0495671_0000179_8978_10153 | 361 |
| 108 | 3300046694 | Ga0495649_0001931 | Ga0495649_0001931_2605_3780 | 361 |
| 109 | 3300048905 | Ga0496102_0070994 | Ga0496102_0070994_93_1250 | 361 |
| 110 | 3300048919 | Ga0496116_0001641 | Ga0496116_0001641_8251_9426 | 361 |
| 111 | 3300048924 | Ga0496121_0004777 | Ga0496121_0004777_10523_11698 | 361 |
| 112 | 3300048926 | Ga0496123_0000340 | Ga0496123_0000340_78012_79187 | 361 |
| 113 | 3300048928 | Ga0496125_0134661 | Ga0496125_0134661_83_1258 | 361 |
| 114 | 3300050508 | nmdc:mga09592_62290_c1 | nmdc:mga09592_62290_c1_1157_2272 | 361 |
| 115 | 3300024227 | Ga0228598_1000942 | Ga0228598_10009422 | 362 |
| 116 | 3300046459 | Ga0495629_0108131 | Ga0495629_0108131_133_1302 | 362 |
| 117 | 3300046678 | Ga0495599_0076830 | Ga0495599_0076830_296_1549 | 362 |
| 118 | 3300046809 | Ga0495600_0054673 | Ga0495600_0054673_370_1623 | 362 |
| 119 | 3300048928 | Ga0496125_0004305 | Ga0496125_0004305_523_1644 | 362 |
| 120 | 3300049571 | Ga0501034_0000439 | Ga0501034_0000439_41301_42470 | 362 |
| 121 | 3300049585 | Ga0501069_0030851 | Ga0501069_0030851_1577_2746 | 363 |
| 122 | 3300060353 | Ga0501082_0084114 | Ga0501082_0084114_500_1669 | 363 |
| 123 | 3300006194 | Ga0075427_10000069 | Ga0075427_100000696 | 364 |
| 124 | 3300006844 | Ga0075428_100101896 | Ga0075428_1001018962 | 364 |
| 125 | 3300006846 | Ga0075430_100000070 | Ga0075430_1000000703 | 364 |
| 126 | 3300006847 | Ga0075431_100019547 | Ga0075431_1000195473 | 364 |
| 127 | 3300006852 | Ga0075433_10004877 | Ga0075433_100048772 | 364 |
| 128 | 3300006871 | Ga0075434_100001839 | Ga0075434_1000018391 | 364 |
| 129 | 3300006880 | Ga0075429_100001678 | Ga0075429_10000167813 | 364 |
| 130 | 3300009094 | Ga0111539_10003613 | Ga0111539_100036136 | 364 |
| 131 | 3300009147 | Ga0114129_10005426 | Ga0114129_100054266 | 364 |
| 132 | 3300009993 | Ga0105028_101008 | Ga0105028_1010082 | 364 |
| 133 | 3300027907 | Ga0207428_10000075 | Ga0207428_1000007534 | 364 |
| 134 | 3300050507 | nmdc:mga05p37_32_c1 | nmdc:mga05p37_32_c1_87429_88646 | 364 |
| 135 | 3300050508 | nmdc:mga09592_3106_c1 | nmdc:mga09592_3106_c1_8522_9739 | 364 |
| 136 | 3300050509 | nmdc:mga0qj67_1076_c1 | nmdc:mga0qj67_1076_c1_6509_7726 | 364 |
| 137 | 3300050510 | nmdc:mga06r32_1900_c1 | nmdc:mga06r32_1900_c1_2250_3467 | 364 |
| 138 | 3300050512 | nmdc:mga0n895_1533_c1 | nmdc:mga0n895_1533_c1_10378_11595 | 364 |
| 139 | 3300050513 | nmdc:mga0rr50_1688_c1 | nmdc:mga0rr50_1688_c1_44_1261 | 364 |
| 140 | 3300050515 | nmdc:mga0a205_3714_c1 | nmdc:mga0a205_3714_c1_6637_7854 | 364 |
| 141 | 3300005335 | Ga0070666_10025518 | Ga0070666_100255182 | 365 |
| 142 | 3300009093 | Ga0105240_10061672 | Ga0105240_100616722 | 365 |
| 143 | 3300009551 | Ga0105238_10044753 | Ga0105238_100447532 | 365 |
| 144 | 3300010375 | Ga0105239_10072309 | Ga0105239_100723092 | 365 |
| 145 | 3300013105 | Ga0157369_10021427 | Ga0157369_100214274 | 365 |
| 146 | 3300046501 | Ga0495607_0000082 | Ga0495607_0000082_9825_10958 | 365 |
| 147 | 3300046524 | Ga0495648_0006076 | Ga0495648_0006076_8101_9285 | 365 |
| 148 | 3300049569 | Ga0501032_0020697 | Ga0501032_0020697_1157_2341 | 365 |
| 149 | 3300049573 | Ga0501037_0044470 | Ga0501037_0044470_935_2119 | 365 |
| 150 | 3300049574 | Ga0501038_0021068 | Ga0501038_0021068_1105_2289 | 365 |
| 151 | 3300049575 | Ga0501039_0162645 | Ga0501039_0162645_94_1278 | 365 |
| 152 | 3300049581 | Ga0501047_0015501 | Ga0501047_0015501_4951_6135 | 365 |
| 153 | 3300049584 | Ga0501068_0016141 | Ga0501068_0016141_1311_2495 | 365 |
| 154 | 3300049823 | Ga0501044_0035910 | Ga0501044_0035910_1956_3140 | 365 |
| 155 | 3300005455 | Ga0070663_100053153 | Ga0070663_1000531532 | 366 |
| 156 | 3300009147 | Ga0114129_10188675 | Ga0114129_101886752 | 366 |
| 157 | 3300026067 | Ga0207678_10016922 | Ga0207678_100169222 | 366 |
| 158 | 3300046492 | Ga0495585_0000899 | Ga0495585_0000899_8807_10024 | 366 |
| 159 | 3300049571 | Ga0501034_0201518 | Ga0501034_0201518_338_1510 | 366 |
| 160 | 3300049571 | Ga0501034_0209403 | Ga0501034_0209403_524_1693 | 366 |
| 161 | 3300049744 | Ga0501083_0115042 | Ga0501083_0115042_546_1715 | 366 |
| 162 | 3300050511 | nmdc:mga08y16_377484_c1 | nmdc:mga08y16_377484_c1_303_1433 | 366 |
| 163 | 3300006852 | Ga0075433_10078464 | Ga0075433_100784642 | 367 |
| 164 | 3300006880 | Ga0075429_100348390 | Ga0075429_1003483901 | 367 |
| 165 | 3300006914 | Ga0075436_100023731 | Ga0075436_1000237312 | 367 |
| 166 | 3300007076 | Ga0075435_100231281 | Ga0075435_1002312811 | 367 |
| 167 | 3300013297 | Ga0157378_10129703 | Ga0157378_101297032 | 367 |
| 168 | 3300025263 | Ga0209565_1003492 | Ga0209565_10034925 | 367 |
| 169 | 3300025291 | Ga0209675_1005245 | Ga0209675_10052453 | 367 |
| 170 | 3300025299 | Ga0209256_1000544 | Ga0209256_100054445 | 367 |
| 171 | 3300025303 | Ga0209051_1016947 | Ga0209051_10169473 | 367 |
| 172 | 3300050512 | nmdc:mga0n895_196240_c1 | nmdc:mga0n895_196240_c1_486_1661 | 367 |
| 173 | 3300050513 | nmdc:mga0rr50_75230_c1 | nmdc:mga0rr50_75230_c1_1126_2301 | 367 |
| 174 | 3300005329 | Ga0070683_100094509 | Ga0070683_1000945093 | 368 |
| 175 | 3300005336 | Ga0070680_100087580 | Ga0070680_1000875802 | 368 |
| 176 | 3300005339 | Ga0070660_100037042 | Ga0070660_1000370422 | 368 |
| 177 | 3300005344 | Ga0070661_100153535 | Ga0070661_1001535352 | 368 |
| 178 | 3300005439 | Ga0070711_100039067 | Ga0070711_1000390672 | 368 |
| 179 | 3300005445 | Ga0070708_100001512 | Ga0070708_10000151212 | 368 |
| 180 | 3300005445 | Ga0070708_100085056 | Ga0070708_1000850563 | 368 |
| 181 | 3300005467 | Ga0070706_100035941 | Ga0070706_1000359412 | 368 |
| 182 | 3300005518 | Ga0070699_100252818 | Ga0070699_1002528181 | 368 |
| 183 | 3300005535 | Ga0070684_100152977 | Ga0070684_1001529771 | 368 |
| 184 | 3300005536 | Ga0070697_100005197 | Ga0070697_1000051979 | 368 |
| 185 | 3300005536 | Ga0070697_100048096 | Ga0070697_1000480962 | 368 |
| 186 | 3300005539 | Ga0068853_100026561 | Ga0068853_1000265612 | 368 |
| 187 | 3300005577 | Ga0068857_100114345 | Ga0068857_1001143452 | 368 |
| 188 | 3300005834 | Ga0068851_10003770 | Ga0068851_100037705 | 368 |
| 189 | 3300006846 | Ga0075430_100030966 | Ga0075430_1000309664 | 368 |
| 190 | 3300006847 | Ga0075431_100100834 | Ga0075431_1001008343 | 368 |
| 191 | 3300006880 | Ga0075429_100149931 | Ga0075429_1001499313 | 368 |
| 192 | 3300007265 | Ga0099794_10000089 | Ga0099794_1000008910 | 368 |
| 193 | 3300009147 | Ga0114129_10019580 | Ga0114129_100195803 | 368 |
| 194 | 3300009551 | Ga0105238_10114492 | Ga0105238_101144922 | 368 |
| 195 | 3300025912 | Ga0207707_10029378 | Ga0207707_100293783 | 368 |
| 196 | 3300025916 | Ga0207663_10077058 | Ga0207663_100770582 | 368 |
| 197 | 3300025917 | Ga0207660_10035859 | Ga0207660_100358593 | 368 |
| 198 | 3300025919 | Ga0207657_10002034 | Ga0207657_100020346 | 368 |
| 199 | 3300025920 | Ga0207649_10124387 | Ga0207649_101243872 | 368 |
| 200 | 3300025921 | Ga0207652_10036225 | Ga0207652_100362254 | 368 |
| 201 | 3300025944 | Ga0207661_10025579 | Ga0207661_100255793 | 368 |
| 202 | 3300025949 | Ga0207667_10083412 | Ga0207667_100834123 | 368 |
| 203 | 3300026116 | Ga0207674_10148116 | Ga0207674_101481162 | 368 |
| 204 | 3300027671 | Ga0209588_1039425 | Ga0209588_10394252 | 368 |
| 205 | 3300045976 | Ga0466967_0249303 | Ga0466967_0249303_432_1607 | 368 |
| 206 | 3300047446 | Ga0495679_002640 | Ga0495679_002640_7840_8982 | 368 |
| 207 | 3300048905 | Ga0496102_0173607 | Ga0496102_0173607_593_1732 | 368 |
| 208 | 3300048915 | Ga0496112_0156680 | Ga0496112_0156680_207_1346 | 368 |
| 209 | 3300049576 | Ga0501040_0107608 | Ga0501040_0107608_514_1683 | 368 |
| 210 | 3300049591 | Ga0501075_0084985 | Ga0501075_0084985_1166_2335 | 368 |
| 211 | 3300050507 | nmdc:mga05p37_82732_c1 | nmdc:mga05p37_82732_c1_1076_2215 | 368 |
| 212 | 3300050515 | nmdc:mga0a205_17203_c1 | nmdc:mga0a205_17203_c1_2046_3185 | 368 |
| 213 | iso_pu_bacteria | 2881927736 | 2881928966 | 368 |
| 214 | 3300005981 | Ga0081538_10082541 | Ga0081538_100825412 | 369 |
| 215 | 3300006847 | Ga0075431_100143838 | Ga0075431_1001438381 | 369 |
| 216 | 3300035114 | Ga0373939_0002435 | Ga0373939_0002435_835_2007 | 369 |
| 217 | 3300050508 | nmdc:mga09592_104072_c1 | nmdc:mga09592_104072_c1_1111_2280 | 369 |
| 218 | iso_pu_bacteria | 2887375801 | 2887376690 | 369 |
| 219 | 3300005339 | Ga0070660_100264316 | Ga0070660_1002643162 | 370 |
| 220 | 3300006852 | Ga0075433_10021597 | Ga0075433_100215973 | 370 |
| 221 | 3300007076 | Ga0075435_100040034 | Ga0075435_1000400341 | 370 |
| 222 | 3300007076 | Ga0075435_100047070 | Ga0075435_1000470702 | 370 |
| 223 | 3300007265 | Ga0099794_10000711 | Ga0099794_100007118 | 370 |
| 224 | 3300009174 | Ga0105241_10089568 | Ga0105241_100895682 | 370 |
| 225 | 3300027671 | Ga0209588_1011821 | Ga0209588_10118213 | 370 |
| 226 | 3300048903 | Ga0496100_0049331 | Ga0496100_0049331_1322_2467 | 370 |
| 227 | 3300048904 | Ga0496101_0034661 | Ga0496101_0034661_1292_2437 | 370 |
| 228 | 3300048907 | Ga0496104_0081924 | Ga0496104_0081924_120_1265 | 370 |
| 229 | 3300048908 | Ga0496105_0003179 | Ga0496105_0003179_2054_3199 | 370 |
| 230 | 3300048909 | Ga0496106_0065356 | Ga0496106_0065356_495_1640 | 370 |
| 231 | 3300048910 | Ga0496107_0007583 | Ga0496107_0007583_39_1184 | 370 |
| 232 | 3300048911 | Ga0496108_0261005 | Ga0496108_0261005_120_1265 | 370 |
| 233 | 3300048912 | Ga0496109_0007323 | Ga0496109_0007323_5267_6412 | 370 |
| 234 | 3300048912 | Ga0496109_0143345 | Ga0496109_0143345_24_1169 | 370 |
| 235 | 3300048913 | Ga0496110_0052111 | Ga0496110_0052111_1322_2467 | 370 |
| 236 | 3300048915 | Ga0496112_0022724 | Ga0496112_0022724_4799_5944 | 370 |
| 237 | 3300048917 | Ga0496114_0032476 | Ga0496114_0032476_243_1388 | 370 |
| 238 | 3300050514 | nmdc:mga08x19_59084_c1 | nmdc:mga08x19_59084_c1_203_1348 | 370 |
| 239 | 3300003771 | Ga0055526_1000300 | Ga0055526_10003001 | 371 |
| 240 | 3300005983 | Ga0081540_1000257 | Ga0081540_100025733 | 371 |
| 241 | 3300025295 | Ga0209564_1000192 | Ga0209564_100019235 | 371 |
| 242 | 3300034817 | Ga0373948_0019439 | Ga0373948_0019439_16_1161 | 371 |
| 243 | 3300035085 | Ga0373929_0002044 | Ga0373929_0002044_1373_2518 | 371 |
| 244 | 3300035111 | Ga0373923_0088357 | Ga0373923_0088357_182_1333 | 371 |
| 245 | 3300006914 | Ga0075436_100000428 | Ga0075436_1000004287 | 372 |
| 246 | 3300025303 | Ga0209051_1029224 | Ga0209051_10292242 | 372 |
| 247 | 3300035083 | Ga0373926_0006426 | Ga0373926_0006426_2486_3637 | 372 |
| 248 | 3300035086 | Ga0373934_0009030 | Ga0373934_0009030_130_1281 | 372 |
| 249 | 3300035089 | Ga0373944_0032387 | Ga0373944_0032387_147_1298 | 372 |
| 250 | 3300035091 | Ga0373951_0011265 | Ga0373951_0011265_485_1636 | 372 |
| 251 | 3300035112 | Ga0373932_0007849 | Ga0373932_0007849_511_1662 | 372 |
| 252 | 3300035116 | Ga0373945_0052714 | Ga0373945_0052714_51_1202 | 372 |
| 253 | 3300035118 | Ga0373954_0029211 | Ga0373954_0029211_266_1417 | 372 |
| 254 | 3300035121 | Ga0373960_0027645 | Ga0373960_0027645_215_1366 | 372 |
| 255 | 3300035170 | Ga0373943_0000781 | Ga0373943_0000781_11636_12787 | 372 |
| 256 | 3300035170 | Ga0373943_0044727 | Ga0373943_0044727_298_1449 | 372 |
| 257 | 3300035171 | Ga0373946_0015707 | Ga0373946_0015707_1491_2642 | 372 |
| 258 | 3300035242 | Ga0373962_0014269 | Ga0373962_0014269_134_1285 | 372 |
| 259 | 3300035691 | Ga0373931_0003622 | Ga0373931_0003622_3705_4856 | 372 |
| 260 | 3300035692 | Ga0373935_0082180 | Ga0373935_0082180_108_1259 | 372 |
| 261 | 3300035695 | Ga0373927_0053980 | Ga0373927_0053980_1083_2234 | 372 |
| 262 | 3300035695 | Ga0373927_0068067 | Ga0373927_0068067_235_1392 | 372 |
| 263 | 3300035724 | Ga0373933_0013538 | Ga0373933_0013538_25_1176 | 372 |
| 264 | 3300035725 | Ga0373947_0008044 | Ga0373947_0008044_189_1340 | 372 |
| 265 | 3300037068 | Ga0373925_0021394 | Ga0373925_0021394_2357_3508 | 372 |
| 266 | 3300046455 | Ga0495603_0002293 | Ga0495603_0002293_3917_5068 | 372 |
| 267 | 3300046455 | Ga0495603_0020881 | Ga0495603_0020881_1460_2611 | 372 |
| 268 | 3300046458 | Ga0495591_038988 | Ga0495591_038988_169_1320 | 372 |
| 269 | 3300046459 | Ga0495629_0001364 | Ga0495629_0001364_1650_2801 | 372 |
| 270 | 3300046459 | Ga0495629_0026084 | Ga0495629_0026084_319_1470 | 372 |
| 271 | 3300046461 | Ga0495641_0006473 | Ga0495641_0006473_1628_2779 | 372 |
| 272 | 3300046461 | Ga0495641_0038439 | Ga0495641_0038439_884_2035 | 372 |
| 273 | 3300046463 | Ga0495653_0096499 | Ga0495653_0096499_693_1844 | 372 |
| 274 | 3300046472 | Ga0495580_0111760 | Ga0495580_0111760_433_1584 | 372 |
| 275 | 3300046473 | Ga0495582_0003419 | Ga0495582_0003419_4353_5504 | 372 |
| 276 | 3300046476 | Ga0495662_0025584 | Ga0495662_0025584_1448_2599 | 372 |
| 277 | 3300046477 | Ga0495664_0008006 | Ga0495664_0008006_1966_3117 | 372 |
| 278 | 3300046491 | Ga0495584_0012196 | Ga0495584_0012196_2083_3258 | 372 |
| 279 | 3300046491 | Ga0495584_0025149 | Ga0495584_0025149_156_1307 | 372 |
| 280 | 3300046492 | Ga0495585_0002650 | Ga0495585_0002650_3534_4685 | 372 |
| 281 | 3300046499 | Ga0495594_0031578 | Ga0495594_0031578_1334_2485 | 372 |
| 282 | 3300046499 | Ga0495594_0077807 | Ga0495594_0077807_240_1391 | 372 |
| 283 | 3300046500 | Ga0495596_0011112 | Ga0495596_0011112_1829_3004 | 372 |
| 284 | 3300046501 | Ga0495607_0012207 | Ga0495607_0012207_2774_3925 | 372 |
| 285 | 3300046511 | Ga0495608_0032300 | Ga0495608_0032300_957_2108 | 372 |
| 286 | 3300046516 | Ga0495628_0079987 | Ga0495628_0079987_308_1459 | 372 |
| 287 | 3300046517 | Ga0495630_0169213 | Ga0495630_0169213_473_1624 | 372 |
| 288 | 3300046518 | Ga0495631_0007352 | Ga0495631_0007352_2084_3259 | 372 |
| 289 | 3300046522 | Ga0495643_0002991 | Ga0495643_0002991_9069_10244 | 372 |
| 290 | 3300046523 | Ga0495644_0000445 | Ga0495644_0000445_2334_3485 | 372 |
| 291 | 3300046526 | Ga0495666_0022256 | Ga0495666_0022256_1279_2430 | 372 |
| 292 | 3300046529 | Ga0495652_0082426 | Ga0495652_0082426_791_1942 | 372 |
| 293 | 3300046531 | Ga0495665_0004404 | Ga0495665_0004404_473_1624 | 372 |
| 294 | 3300046535 | Ga0495586_0046796 | Ga0495586_0046796_836_1987 | 372 |
| 295 | 3300046536 | Ga0495587_0018377 | Ga0495587_0018377_817_1968 | 372 |
| 296 | 3300046538 | Ga0495609_0009594 | Ga0495609_0009594_805_1980 | 372 |
| 297 | 3300046557 | Ga0495622_0036011 | Ga0495622_0036011_623_1774 | 372 |
| 298 | 3300046558 | Ga0495633_0013577 | Ga0495633_0013577_1231_2382 | 372 |
| 299 | 3300046559 | Ga0495667_0005892 | Ga0495667_0005892_3342_4493 | 372 |
| 300 | 3300046642 | Ga0495634_0080629 | Ga0495634_0080629_672_1823 | 372 |
| 301 | 3300046648 | Ga0495611_0005320 | Ga0495611_0005320_161_1312 | 372 |
| 302 | 3300046663 | Ga0495635_0019101 | Ga0495635_0019101_775_1926 | 372 |
| 303 | 3300046664 | Ga0495659_0005289 | Ga0495659_0005289_2645_3796 | 372 |
| 304 | 3300046665 | Ga0495661_0009431 | Ga0495661_0009431_476_1651 | 372 |
| 305 | 3300046674 | Ga0495588_0012960 | Ga0495588_0012960_64_1215 | 372 |
| 306 | 3300046678 | Ga0495599_0024296 | Ga0495599_0024296_2486_3637 | 372 |
| 307 | 3300046680 | Ga0495646_0028182 | Ga0495646_0028182_1096_2247 | 372 |
| 308 | 3300046681 | Ga0495647_0004940 | Ga0495647_0004940_2932_4083 | 372 |
| 309 | 3300046681 | Ga0495647_0006480 | Ga0495647_0006480_1027_2178 | 372 |
| 310 | 3300046683 | Ga0495658_0001147 | Ga0495658_0001147_6794_7945 | 372 |
| 311 | 3300046689 | Ga0495613_0060939 | Ga0495613_0060939_1125_2276 | 372 |
| 312 | 3300046690 | Ga0495624_0007846 | Ga0495624_0007846_5546_6697 | 372 |
| 313 | 3300046691 | Ga0495670_0001286 | Ga0495670_0001286_3914_5065 | 372 |
| 314 | 3300046809 | Ga0495600_0020354 | Ga0495600_0020354_724_1875 | 372 |
| 315 | 3300047315 | Ga0495581_0071021 | Ga0495581_0071021_558_1709 | 372 |
| 316 | 3300047315 | Ga0495581_0141111 | Ga0495581_0141111_226_1377 | 372 |
| 317 | 3300047317 | Ga0495604_0030565 | Ga0495604_0030565_2768_3919 | 372 |
| 318 | 3300047320 | Ga0495672_0017357 | Ga0495672_0017357_3503_4678 | 372 |
| 319 | 3300047321 | Ga0495676_0008485 | Ga0495676_0008485_3706_4857 | 372 |
| 320 | 3300047321 | Ga0495676_0048913 | Ga0495676_0048913_866_2017 | 372 |
| 321 | 3300047322 | Ga0495680_0032432 | Ga0495680_0032432_1129_2280 | 372 |
| 322 | 3300047322 | Ga0495680_0080454 | Ga0495680_0080454_98_1249 | 372 |
| 323 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_346249_347424 | 372 |
| 324 | 3300047469 | Ga0495673_0027281 | Ga0495673_0027281_1280_2455 | 372 |
| 325 | 3300048089 | Ga0495614_0074068 | Ga0495614_0074068_157_1308 | 372 |
| 326 | 3300048091 | Ga0495626_0023131 | Ga0495626_0023131_1266_2441 | 372 |
| 327 | 3300048907 | Ga0496104_0105690 | Ga0496104_0105690_269_1420 | 372 |
| 328 | 3300048915 | Ga0496112_0050647 | Ga0496112_0050647_373_1524 | 372 |
| 329 | 3300049824 | Ga0501045_0040220 | Ga0501045_0040220_1020_2177 | 372 |
| 330 | 3300050514 | nmdc:mga08x19_261_c1 | nmdc:mga08x19_261_c1_7416_8576 | 372 |
| 331 | 3300053078 | Ga0495612_0002607 | Ga0495612_0002607_3229_4380 | 372 |
| 332 | 3300053084 | Ga0495595_0003556 | Ga0495595_0003556_4269_5420 | 372 |
| 333 | 3300053085 | Ga0495619_0003525 | Ga0495619_0003525_6384_7535 | 372 |
| 334 | 3300005364 | Ga0070673_100032842 | Ga0070673_1000328423 | 373 |
| 335 | 3300009011 | Ga0105251_10014854 | Ga0105251_100148543 | 373 |
| 336 | 3300025735 | Ga0207713_1022956 | Ga0207713_10229562 | 373 |
| 337 | 3300046453 | Ga0495627_043794 | Ga0495627_043794_118_1287 | 373 |
| 338 | 3300046458 | Ga0495591_000044 | Ga0495591_000044_96318_97487 | 373 |
| 339 | 3300046471 | Ga0495650_0002409 | Ga0495650_0002409_1459_2628 | 373 |
| 340 | 3300046474 | Ga0495605_0000036 | Ga0495605_0000036_85447_86616 | 373 |
| 341 | 3300046474 | Ga0495605_0000319 | Ga0495605_0000319_17879_19048 | 373 |
| 342 | 3300046499 | Ga0495594_0028196 | Ga0495594_0028196_1663_2832 | 373 |
| 343 | 3300046501 | Ga0495607_0000033 | Ga0495607_0000033_112691_113860 | 373 |
| 344 | 3300046506 | Ga0495583_0000028 | Ga0495583_0000028_98696_99865 | 373 |
| 345 | 3300046512 | Ga0495610_0002063 | Ga0495610_0002063_5398_6567 | 373 |
| 346 | 3300046515 | Ga0495620_0000073 | Ga0495620_0000073_27060_28229 | 373 |
| 347 | 3300046518 | Ga0495631_0028388 | Ga0495631_0028388_1344_2513 | 373 |
| 348 | 3300046520 | Ga0495637_0003222 | Ga0495637_0003222_4357_5526 | 373 |
| 349 | 3300046524 | Ga0495648_0000560 | Ga0495648_0000560_11146_12315 | 373 |
| 350 | 3300046530 | Ga0495654_0000246 | Ga0495654_0000246_8537_9706 | 373 |
| 351 | 3300046538 | Ga0495609_0000115 | Ga0495609_0000115_85448_86617 | 373 |
| 352 | 3300046542 | Ga0495597_0000008 | Ga0495597_0000008_183497_184666 | 373 |
| 353 | 3300046542 | Ga0495597_0000635 | Ga0495597_0000635_12752_13921 | 373 |
| 354 | 3300046558 | Ga0495633_0000028 | Ga0495633_0000028_147149_148318 | 373 |
| 355 | 3300046648 | Ga0495611_0003757 | Ga0495611_0003757_4187_5356 | 373 |
| 356 | 3300046665 | Ga0495661_0000211 | Ga0495661_0000211_10925_12094 | 373 |
| 357 | 3300046691 | Ga0495670_0019359 | Ga0495670_0019359_1689_2858 | 373 |
| 358 | 3300046794 | Ga0495589_0009823 | Ga0495589_0009823_402_1571 | 373 |
| 359 | 3300046810 | Ga0495660_0001015 | Ga0495660_0001015_5757_6926 | 373 |
| 360 | 3300046810 | Ga0495660_0002289 | Ga0495660_0002289_4852_6021 | 373 |
| 361 | 3300047320 | Ga0495672_0035475 | Ga0495672_0035475_1604_2773 | 373 |
| 362 | 3300047323 | Ga0495683_0000091 | Ga0495683_0000091_34943_36112 | 373 |
| 363 | 3300047446 | Ga0495679_000083 | Ga0495679_000083_30975_32144 | 373 |
| 364 | 3300047469 | Ga0495673_0012965 | Ga0495673_0012965_1457_2626 | 373 |
| 365 | 3300047470 | Ga0495681_0009092 | Ga0495681_0009092_4469_5638 | 373 |
| 366 | 3300048925 | Ga0496122_0143010 | Ga0496122_0143010_68_1237 | 373 |
| 367 | 3300049459 | Ga0495678_000020 | Ga0495678_000020_96799_97968 | 373 |
| 368 | 3300049744 | Ga0501083_0029362 | Ga0501083_0029362_86_1246 | 373 |
| 369 | iso_pu_bacteria | 2513237101 | 2513693941 | 373 |
| 370 | iso_pu_bacteria | 2643221651 | 2644289144 | 373 |
| 371 | iso_pu_bacteria | 2885409591 | 2885413836 | 373 |
| 372 | iso_pu_bacteria | 2906643746 | 2906651131 | 373 |
| 373 | 3300005340 | Ga0070689_100003632 | Ga0070689_1000036323 | 374 |
| 374 | 3300005458 | Ga0070681_10269010 | Ga0070681_102690102 | 374 |
| 375 | 3300005617 | Ga0068859_100087315 | Ga0068859_1000873154 | 374 |
| 376 | 3300006237 | Ga0097621_100222381 | Ga0097621_1002223812 | 374 |
| 377 | 3300006931 | Ga0097620_100087318 | Ga0097620_1000873182 | 374 |
| 378 | 3300009101 | Ga0105247_10072297 | Ga0105247_100722972 | 374 |
| 379 | 3300014325 | Ga0163163_10053639 | Ga0163163_100536395 | 374 |
| 380 | 3300014969 | Ga0157376_10212831 | Ga0157376_102128312 | 374 |
| 381 | 3300025905 | Ga0207685_10037396 | Ga0207685_100373962 | 374 |
| 382 | 3300025926 | Ga0207659_10069445 | Ga0207659_100694452 | 374 |
| 383 | 3300025936 | Ga0207670_10020222 | Ga0207670_100202221 | 374 |
| 384 | 3300025938 | Ga0207704_10132763 | Ga0207704_101327632 | 374 |
| 385 | 3300025940 | Ga0207691_10253084 | Ga0207691_102530841 | 374 |
| 386 | 3300025941 | Ga0207711_10029896 | Ga0207711_100298965 | 374 |
| 387 | 3300026035 | Ga0207703_10098851 | Ga0207703_100988512 | 374 |
| 388 | 3300026121 | Ga0207683_10087706 | Ga0207683_100877062 | 374 |
| 389 | 3300028380 | Ga0268265_10064443 | Ga0268265_100644431 | 374 |
| 390 | 3300035091 | Ga0373951_0013149 | Ga0373951_0013149_572_1735 | 374 |
| 391 | 3300035691 | Ga0373931_0004664 | Ga0373931_0004664_1054_2217 | 374 |
| 392 | 3300035691 | Ga0373931_0006426 | Ga0373931_0006426_2437_3600 | 374 |
| 393 | 3300035692 | Ga0373935_0081768 | Ga0373935_0081768_527_1690 | 374 |
| 394 | 3300042436 | Ga0439435_0029198 | Ga0439435_0029198_225_1388 | 374 |
| 395 | 3300048903 | Ga0496100_0015342 | Ga0496100_0015342_1952_3115 | 374 |
| 396 | 3300048907 | Ga0496104_0022869 | Ga0496104_0022869_3701_4864 | 374 |
| 397 | 3300048908 | Ga0496105_0042530 | Ga0496105_0042530_1421_2584 | 374 |
| 398 | 3300048912 | Ga0496109_0018945 | Ga0496109_0018945_1499_2662 | 374 |
| 399 | 3300048913 | Ga0496110_0013940 | Ga0496110_0013940_4569_5732 | 374 |
| 400 | 3300048914 | Ga0496111_0123973 | Ga0496111_0123973_456_1619 | 374 |
| 401 | 3300048918 | Ga0496115_0033229 | Ga0496115_0033229_858_2021 | 374 |
| 402 | 3300049571 | Ga0501034_0005470 | Ga0501034_0005470_10912_12144 | 374 |
| 403 | 3300049577 | Ga0501041_0022442 | Ga0501041_0022442_143_1312 | 374 |
| 404 | 3300049578 | Ga0501042_0142079 | Ga0501042_0142079_42_1211 | 374 |
| 405 | 3300049590 | Ga0501074_0216582 | Ga0501074_0216582_70_1239 | 374 |
| 406 | 3300049742 | Ga0501080_0119726 | Ga0501080_0119726_294_1463 | 374 |
| 407 | 3300049822 | Ga0501035_0025138 | Ga0501035_0025138_4152_5321 | 374 |
| 408 | 3300053077 | Ga0495601_0060299 | Ga0495601_0060299_859_2022 | 374 |
| 409 | 3300053078 | Ga0495612_0044417 | Ga0495612_0044417_532_1695 | 374 |
| 410 | 3300003187 | JGI25151J46595_10007003 | JGI25151J46595_100070035 | 375 |
| 411 | 3300005466 | Ga0070685_10163742 | Ga0070685_101637421 | 375 |
| 412 | 3300025294 | Ga0209025_1000342 | Ga0209025_100034267 | 375 |
| 413 | 3300031727 | Ga0316576_10083808 | Ga0316576_100838081 | 375 |
| 414 | 3300031728 | Ga0316578_10047930 | Ga0316578_100479301 | 375 |
| 415 | 3300032005 | Ga0307411_10204415 | Ga0307411_102044152 | 375 |
| 416 | 3300032133 | Ga0316583_10027828 | Ga0316583_100278281 | 375 |
| 417 | 3300035398 | Ga0316574_0005325 | Ga0316574_0005325_5293_6465 | 375 |
| 418 | 3300036712 | Ga0316584_0003417 | Ga0316584_0003417_470_1642 | 375 |
| 419 | 3300045976 | Ga0466967_0059363 | Ga0466967_0059363_1615_2778 | 375 |
| 420 | 3300046454 | Ga0495592_0048841 | Ga0495592_0048841_1572_2747 | 375 |
| 421 | 3300046455 | Ga0495603_0005366 | Ga0495603_0005366_5960_7135 | 375 |
| 422 | 3300046459 | Ga0495629_0002564 | Ga0495629_0002564_1491_2666 | 375 |
| 423 | 3300046461 | Ga0495641_0010975 | Ga0495641_0010975_2669_3844 | 375 |
| 424 | 3300046463 | Ga0495653_0021421 | Ga0495653_0021421_2420_3595 | 375 |
| 425 | 3300046472 | Ga0495580_0005516 | Ga0495580_0005516_7840_9015 | 375 |
| 426 | 3300046473 | Ga0495582_0008108 | Ga0495582_0008108_1401_2576 | 375 |
| 427 | 3300046477 | Ga0495664_0000979 | Ga0495664_0000979_1766_2941 | 375 |
| 428 | 3300046492 | Ga0495585_0013050 | Ga0495585_0013050_2471_3685 | 375 |
| 429 | 3300046499 | Ga0495594_0060733 | Ga0495594_0060733_818_1993 | 375 |
| 430 | 3300046506 | Ga0495583_0011248 | Ga0495583_0011248_1739_2953 | 375 |
| 431 | 3300046514 | Ga0495618_0043626 | Ga0495618_0043626_1374_2549 | 375 |
| 432 | 3300046516 | Ga0495628_0006647 | Ga0495628_0006647_1381_2556 | 375 |
| 433 | 3300046517 | Ga0495630_0002437 | Ga0495630_0002437_8091_9266 | 375 |
| 434 | 3300046524 | Ga0495648_0007025 | Ga0495648_0007025_5832_7007 | 375 |
| 435 | 3300046526 | Ga0495666_0007830 | Ga0495666_0007830_1770_2945 | 375 |
| 436 | 3300046536 | Ga0495587_0009992 | Ga0495587_0009992_3377_4552 | 375 |
| 437 | 3300046538 | Ga0495609_0000559 | Ga0495609_0000559_1262_2476 | 375 |
| 438 | 3300046543 | Ga0495645_0002459 | Ga0495645_0002459_1973_3148 | 375 |
| 439 | 3300046642 | Ga0495634_0002678 | Ga0495634_0002678_12052_13227 | 375 |
| 440 | 3300046648 | Ga0495611_0032581 | Ga0495611_0032581_571_1746 | 375 |
| 441 | 3300046660 | Ga0495625_0017966 | Ga0495625_0017966_958_2172 | 375 |
| 442 | 3300046663 | Ga0495635_0007625 | Ga0495635_0007625_3956_5131 | 375 |
| 443 | 3300046665 | Ga0495661_0004192 | Ga0495661_0004192_7715_8890 | 375 |
| 444 | 3300046665 | Ga0495661_0107314 | Ga0495661_0107314_214_1428 | 375 |
| 445 | 3300046674 | Ga0495588_0017586 | Ga0495588_0017586_1639_2814 | 375 |
| 446 | 3300046678 | Ga0495599_0044135 | Ga0495599_0044135_150_1325 | 375 |
| 447 | 3300046679 | Ga0495623_0005546 | Ga0495623_0005546_3635_4810 | 375 |
| 448 | 3300046680 | Ga0495646_0001750 | Ga0495646_0001750_10431_11606 | 375 |
| 449 | 3300046689 | Ga0495613_0003816 | Ga0495613_0003816_2051_3226 | 375 |
| 450 | 3300046690 | Ga0495624_0013237 | Ga0495624_0013237_1381_2556 | 375 |
| 451 | 3300047315 | Ga0495581_0075967 | Ga0495581_0075967_82_1257 | 375 |
| 452 | 3300047317 | Ga0495604_0007920 | Ga0495604_0007920_5825_7000 | 375 |
| 453 | 3300047318 | Ga0495636_0055328 | Ga0495636_0055328_153_1367 | 375 |
| 454 | 3300047321 | Ga0495676_0058169 | Ga0495676_0058169_226_1401 | 375 |
| 455 | 3300047322 | Ga0495680_0006455 | Ga0495680_0006455_1663_2838 | 375 |
| 456 | 3300047444 | Ga0495675_0009789 | Ga0495675_0009789_3684_4859 | 375 |
| 457 | 3300047471 | Ga0495684_0016404 | Ga0495684_0016404_2890_4065 | 375 |
| 458 | 3300047673 | Ga0495593_0002662 | Ga0495593_0002662_8065_9240 | 375 |
| 459 | 3300048089 | Ga0495614_0002734 | Ga0495614_0002734_4905_6080 | 375 |
| 460 | 3300049584 | Ga0501068_0102849 | Ga0501068_0102849_338_1507 | 375 |
| 461 | 3300049588 | Ga0501072_0100920 | Ga0501072_0100920_629_1792 | 375 |
| 462 | 3300049743 | Ga0501081_0096055 | Ga0501081_0096055_603_1766 | 375 |
| 463 | 3300005355 | Ga0070671_100004618 | Ga0070671_10000461810 | 376 |
| 464 | 3300005364 | Ga0070673_100129842 | Ga0070673_1001298422 | 376 |
| 465 | 3300005365 | Ga0070688_100019720 | Ga0070688_1000197203 | 376 |
| 466 | 3300005434 | Ga0070709_10014282 | Ga0070709_100142822 | 376 |
| 467 | 3300005435 | Ga0070714_100019685 | Ga0070714_1000196855 | 376 |
| 468 | 3300005435 | Ga0070714_100058800 | Ga0070714_1000588002 | 376 |
| 469 | 3300005436 | Ga0070713_100070174 | Ga0070713_1000701743 | 376 |
| 470 | 3300005437 | Ga0070710_10115561 | Ga0070710_101155612 | 376 |
| 471 | 3300005439 | Ga0070711_100262835 | Ga0070711_1002628351 | 376 |
| 472 | 3300005467 | Ga0070706_100000058 | Ga0070706_1000000587 | 376 |
| 473 | 3300005468 | Ga0070707_100007827 | Ga0070707_1000078277 | 376 |
| 474 | 3300005471 | Ga0070698_100184843 | Ga0070698_1001848432 | 376 |
| 475 | 3300005536 | Ga0070697_100023289 | Ga0070697_1000232895 | 376 |
| 476 | 3300005547 | Ga0070693_100087117 | Ga0070693_1000871172 | 376 |
| 477 | 3300005548 | Ga0070665_100151089 | Ga0070665_1001510892 | 376 |
| 478 | 3300005615 | Ga0070702_100083125 | Ga0070702_1000831252 | 376 |
| 479 | 3300005618 | Ga0068864_100269749 | Ga0068864_1002697492 | 376 |
| 480 | 3300006028 | Ga0070717_10012854 | Ga0070717_100128543 | 376 |
| 481 | 3300006175 | Ga0070712_100025560 | Ga0070712_1000255602 | 376 |
| 482 | 3300011119 | Ga0105246_10057597 | Ga0105246_100575972 | 376 |
| 483 | 3300014325 | Ga0163163_10088724 | Ga0163163_100887241 | 376 |
| 484 | 3300025898 | Ga0207692_10026808 | Ga0207692_100268082 | 376 |
| 485 | 3300025906 | Ga0207699_10020174 | Ga0207699_100201743 | 376 |
| 486 | 3300025907 | Ga0207645_10077287 | Ga0207645_100772872 | 376 |
| 487 | 3300025910 | Ga0207684_10000066 | Ga0207684_10000066111 | 376 |
| 488 | 3300025915 | Ga0207693_10047664 | Ga0207693_100476642 | 376 |
| 489 | 3300025915 | Ga0207693_10059037 | Ga0207693_100590373 | 376 |
| 490 | 3300025915 | Ga0207693_10075663 | Ga0207693_100756632 | 376 |
| 491 | 3300025920 | Ga0207649_10062359 | Ga0207649_100623592 | 376 |
| 492 | 3300025924 | Ga0207694_10106056 | Ga0207694_101060562 | 376 |
| 493 | 3300025925 | Ga0207650_10037187 | Ga0207650_100371872 | 376 |
| 494 | 3300025927 | Ga0207687_10234373 | Ga0207687_102343731 | 376 |
| 495 | 3300025928 | Ga0207700_10001421 | Ga0207700_100014218 | 376 |
| 496 | 3300025928 | Ga0207700_10187398 | Ga0207700_101873982 | 376 |
| 497 | 3300025931 | Ga0207644_10002839 | Ga0207644_100028398 | 376 |
| 498 | 3300025931 | Ga0207644_10020120 | Ga0207644_100201202 | 376 |
| 499 | 3300025934 | Ga0207686_10183869 | Ga0207686_101838692 | 376 |
| 500 | 3300025939 | Ga0207665_10062505 | Ga0207665_100625052 | 376 |
| 501 | 3300025941 | Ga0207711_10106289 | Ga0207711_101062892 | 376 |
| 502 | 3300026035 | Ga0207703_10040038 | Ga0207703_100400382 | 376 |
| 503 | 3300026088 | Ga0207641_10174707 | Ga0207641_101747072 | 376 |
| 504 | 3300026121 | Ga0207683_10208565 | Ga0207683_102085652 | 376 |
| 505 | 3300028379 | Ga0268266_10105519 | Ga0268266_101055192 | 376 |
| 506 | 3300037418 | Ga0395900_0023743 | Ga0395900_0023743_1282_2517 | 376 |
| 507 | 3300048913 | Ga0496110_0305637 | Ga0496110_0305637_249_1415 | 376 |
| 508 | iso_pu_bacteria | 2721755763 | 2723876003 | 376 |
| 509 | 3300002239 | JGI24034J26672_10009055 | JGI24034J26672_100090551 | 377 |
| 510 | 3300002244 | JGI24742J22300_10004309 | JGI24742J22300_100043093 | 377 |
| 511 | 3300005336 | Ga0070680_100008506 | Ga0070680_1000085063 | 377 |
| 512 | 3300005337 | Ga0070682_100003502 | Ga0070682_1000035026 | 377 |
| 513 | 3300005340 | Ga0070689_100055590 | Ga0070689_1000555902 | 377 |
| 514 | 3300005341 | Ga0070691_10019041 | Ga0070691_100190411 | 377 |
| 515 | 3300005345 | Ga0070692_10036722 | Ga0070692_100367222 | 377 |
| 516 | 3300005353 | Ga0070669_100025592 | Ga0070669_1000255923 | 377 |
| 517 | 3300005355 | Ga0070671_100101185 | Ga0070671_1001011852 | 377 |
| 518 | 3300005356 | Ga0070674_100001317 | Ga0070674_1000013177 | 377 |
| 519 | 3300005365 | Ga0070688_100034653 | Ga0070688_1000346533 | 377 |
| 520 | 3300005366 | Ga0070659_100037181 | Ga0070659_1000371811 | 377 |
| 521 | 3300005366 | Ga0070659_100282162 | Ga0070659_1002821621 | 377 |
| 522 | 3300005367 | Ga0070667_100162130 | Ga0070667_1001621302 | 377 |
| 523 | 3300005406 | Ga0070703_10016942 | Ga0070703_100169422 | 377 |
| 524 | 3300005436 | Ga0070713_100263595 | Ga0070713_1002635952 | 377 |
| 525 | 3300005438 | Ga0070701_10023479 | Ga0070701_100234792 | 377 |
| 526 | 3300005440 | Ga0070705_100002812 | Ga0070705_1000028124 | 377 |
| 527 | 3300005441 | Ga0070700_100006104 | Ga0070700_1000061045 | 377 |
| 528 | 3300005441 | Ga0070700_100029592 | Ga0070700_1000295923 | 377 |
| 529 | 3300005444 | Ga0070694_100006032 | Ga0070694_1000060327 | 377 |
| 530 | 3300005445 | Ga0070708_100121559 | Ga0070708_1001215591 | 377 |
| 531 | 3300005455 | Ga0070663_100003392 | Ga0070663_1000033928 | 377 |
| 532 | 3300005458 | Ga0070681_10003118 | Ga0070681_1000311811 | 377 |
| 533 | 3300005458 | Ga0070681_10059346 | Ga0070681_100593462 | 377 |
| 534 | 3300005459 | Ga0068867_100005713 | Ga0068867_1000057134 | 377 |
| 535 | 3300005466 | Ga0070685_10031138 | Ga0070685_100311382 | 377 |
| 536 | 3300005467 | Ga0070706_100181558 | Ga0070706_1001815581 | 377 |
| 537 | 3300005518 | Ga0070699_100003539 | Ga0070699_10000353910 | 377 |
| 538 | 3300005530 | Ga0070679_100002575 | Ga0070679_10000257513 | 377 |
| 539 | 3300005530 | Ga0070679_100111652 | Ga0070679_1001116522 | 377 |
| 540 | 3300005536 | Ga0070697_100016032 | Ga0070697_1000160321 | 377 |
| 541 | 3300005539 | Ga0068853_100002117 | Ga0068853_10000211713 | 377 |
| 542 | 3300005544 | Ga0070686_100015930 | Ga0070686_1000159302 | 377 |
| 543 | 3300005545 | Ga0070695_100011357 | Ga0070695_1000113574 | 377 |
| 544 | 3300005546 | Ga0070696_100009677 | Ga0070696_1000096775 | 377 |
| 545 | 3300005548 | Ga0070665_100013399 | Ga0070665_1000133993 | 377 |
| 546 | 3300005549 | Ga0070704_100007447 | Ga0070704_1000074478 | 377 |
| 547 | 3300005549 | Ga0070704_100037540 | Ga0070704_1000375402 | 377 |
| 548 | 3300005563 | Ga0068855_100281530 | Ga0068855_1002815301 | 377 |
| 549 | 3300005577 | Ga0068857_100013592 | Ga0068857_1000135925 | 377 |
| 550 | 3300005577 | Ga0068857_100018049 | Ga0068857_1000180493 | 377 |
| 551 | 3300005615 | Ga0070702_100051843 | Ga0070702_1000518433 | 377 |
| 552 | 3300005616 | Ga0068852_100142758 | Ga0068852_1001427582 | 377 |
| 553 | 3300005617 | Ga0068859_100008214 | Ga0068859_1000082148 | 377 |
| 554 | 3300005841 | Ga0068863_100026295 | Ga0068863_1000262952 | 377 |
| 555 | 3300005842 | Ga0068858_100028586 | Ga0068858_1000285863 | 377 |
| 556 | 3300005842 | Ga0068858_100184288 | Ga0068858_1001842882 | 377 |
| 557 | 3300005843 | Ga0068860_100020260 | Ga0068860_1000202604 | 377 |
| 558 | 3300005843 | Ga0068860_100108710 | Ga0068860_1001087102 | 377 |
| 559 | 3300005844 | Ga0068862_100010491 | Ga0068862_1000104916 | 377 |
| 560 | 3300005844 | Ga0068862_100037922 | Ga0068862_1000379222 | 377 |
| 561 | 3300006028 | Ga0070717_10073713 | Ga0070717_100737133 | 377 |
| 562 | 3300006058 | Ga0075432_10011926 | Ga0075432_100119262 | 377 |
| 563 | 3300006173 | Ga0070716_100026747 | Ga0070716_1000267472 | 377 |
| 564 | 3300006175 | Ga0070712_100245332 | Ga0070712_1002453321 | 377 |
| 565 | 3300006195 | Ga0075366_10084604 | Ga0075366_100846042 | 377 |
| 566 | 3300006237 | Ga0097621_100035900 | Ga0097621_1000359002 | 377 |
| 567 | 3300006844 | Ga0075428_100196518 | Ga0075428_1001965183 | 377 |
| 568 | 3300006844 | Ga0075428_100314720 | Ga0075428_1003147202 | 377 |
| 569 | 3300006880 | Ga0075429_100130495 | Ga0075429_1001304951 | 377 |
| 570 | 3300006931 | Ga0097620_100008214 | Ga0097620_1000082148 | 377 |
| 571 | 3300007265 | Ga0099794_10002341 | Ga0099794_100023416 | 377 |
| 572 | 3300009147 | Ga0114129_10140383 | Ga0114129_101403833 | 377 |
| 573 | 3300009176 | Ga0105242_10006360 | Ga0105242_100063607 | 377 |
| 574 | 3300009545 | Ga0105237_10277457 | Ga0105237_102774571 | 377 |
| 575 | 3300009553 | Ga0105249_10001979 | Ga0105249_1000197910 | 377 |
| 576 | 3300009553 | Ga0105249_10031218 | Ga0105249_100312184 | 377 |
| 577 | 3300010159 | Ga0099796_10018771 | Ga0099796_100187712 | 377 |
| 578 | 3300010375 | Ga0105239_10139482 | Ga0105239_101394822 | 377 |
| 579 | 3300011119 | Ga0105246_10011442 | Ga0105246_100114422 | 377 |
| 580 | 3300011119 | Ga0105246_10034114 | Ga0105246_100341142 | 377 |
| 581 | 3300013100 | Ga0157373_10017166 | Ga0157373_100171663 | 377 |
| 582 | 3300013297 | Ga0157378_10006074 | Ga0157378_100060742 | 377 |
| 583 | 3300013306 | Ga0163162_10035770 | Ga0163162_100357702 | 377 |
| 584 | 3300013306 | Ga0163162_10347773 | Ga0163162_103477732 | 377 |
| 585 | 3300013307 | Ga0157372_10021316 | Ga0157372_100213166 | 377 |
| 586 | 3300013308 | Ga0157375_10018638 | Ga0157375_100186385 | 377 |
| 587 | 3300014745 | Ga0157377_10023608 | Ga0157377_100236081 | 377 |
| 588 | 3300014968 | Ga0157379_10057748 | Ga0157379_100577483 | 377 |
| 589 | 3300014969 | Ga0157376_10030914 | Ga0157376_100309143 | 377 |
| 590 | 3300017792 | Ga0163161_10001820 | Ga0163161_100018208 | 377 |
| 591 | 3300025885 | Ga0207653_10012179 | Ga0207653_100121792 | 377 |
| 592 | 3300025907 | Ga0207645_10090234 | Ga0207645_100902341 | 377 |
| 593 | 3300025910 | Ga0207684_10219800 | Ga0207684_102198002 | 377 |
| 594 | 3300025912 | Ga0207707_10009733 | Ga0207707_100097337 | 377 |
| 595 | 3300025912 | Ga0207707_10040883 | Ga0207707_100408833 | 377 |
| 596 | 3300025914 | Ga0207671_10216255 | Ga0207671_102162552 | 377 |
| 597 | 3300025915 | Ga0207693_10012950 | Ga0207693_100129503 | 377 |
| 598 | 3300025917 | Ga0207660_10062872 | Ga0207660_100628722 | 377 |
| 599 | 3300025921 | Ga0207652_10093513 | Ga0207652_100935132 | 377 |
| 600 | 3300025929 | Ga0207664_10077373 | Ga0207664_100773731 | 377 |
| 601 | 3300025931 | Ga0207644_10140094 | Ga0207644_101400941 | 377 |
| 602 | 3300025932 | Ga0207690_10011305 | Ga0207690_100113054 | 377 |
| 603 | 3300025932 | Ga0207690_10092272 | Ga0207690_100922722 | 377 |
| 604 | 3300025933 | Ga0207706_10005771 | Ga0207706_100057715 | 377 |
| 605 | 3300025934 | Ga0207686_10081326 | Ga0207686_100813262 | 377 |
| 606 | 3300025936 | Ga0207670_10137775 | Ga0207670_101377751 | 377 |
| 607 | 3300025938 | Ga0207704_10031084 | Ga0207704_100310842 | 377 |
| 608 | 3300025939 | Ga0207665_10039314 | Ga0207665_100393142 | 377 |
| 609 | 3300025940 | Ga0207691_10012621 | Ga0207691_100126212 | 377 |
| 610 | 3300025942 | Ga0207689_10015683 | Ga0207689_100156831 | 377 |
| 611 | 3300025949 | Ga0207667_10192987 | Ga0207667_101929871 | 377 |
| 612 | 3300025960 | Ga0207651_10014018 | Ga0207651_100140181 | 377 |
| 613 | 3300025961 | Ga0207712_10001652 | Ga0207712_1000165210 | 377 |
| 614 | 3300026067 | Ga0207678_10036524 | Ga0207678_100365243 | 377 |
| 615 | 3300026075 | Ga0207708_10005100 | Ga0207708_100051008 | 377 |
| 616 | 3300026075 | Ga0207708_10012235 | Ga0207708_100122355 | 377 |
| 617 | 3300026088 | Ga0207641_10050621 | Ga0207641_100506213 | 377 |
| 618 | 3300026089 | Ga0207648_10015456 | Ga0207648_100154564 | 377 |
| 619 | 3300026095 | Ga0207676_10011543 | Ga0207676_100115435 | 377 |
| 620 | 3300027512 | Ga0209179_1001657 | Ga0209179_10016572 | 377 |
| 621 | 3300027671 | Ga0209588_1001995 | Ga0209588_10019953 | 377 |
| 622 | 3300028380 | Ga0268265_10009421 | Ga0268265_100094216 | 377 |
| 623 | 3300028380 | Ga0268265_10048114 | Ga0268265_100481143 | 377 |
| 624 | 3300028381 | Ga0268264_10002039 | Ga0268264_1000203916 | 377 |
| 625 | 3300028381 | Ga0268264_10070956 | Ga0268264_100709561 | 377 |
| 626 | 3300035083 | Ga0373926_0047993 | Ga0373926_0047993_338_1510 | 377 |
| 627 | 3300035113 | Ga0373936_0009253 | Ga0373936_0009253_1299_2471 | 377 |
| 628 | 3300035116 | Ga0373945_0010659 | Ga0373945_0010659_793_1965 | 377 |
| 629 | 3300035695 | Ga0373927_0000968 | Ga0373927_0000968_10479_11651 | 377 |
| 630 | 3300035695 | Ga0373927_0017152 | Ga0373927_0017152_928_2100 | 377 |
| 631 | 3300035725 | Ga0373947_0032192 | Ga0373947_0032192_932_2104 | 377 |
| 632 | 3300035725 | Ga0373947_0037935 | Ga0373947_0037935_226_1398 | 377 |
| 633 | 3300036401 | Ga0373937_0034178 | Ga0373937_0034178_932_2104 | 377 |
| 634 | 3300037068 | Ga0373925_0006677 | Ga0373925_0006677_2633_3805 | 377 |
| 635 | 3300038443 | Ga0395901_0102198 | Ga0395901_0102198_1367_2536 | 377 |
| 636 | 3300044694 | Ga0466963_0032976 | Ga0466963_0032976_1133_2302 | 377 |
| 637 | 3300046455 | Ga0495603_0010934 | Ga0495603_0010934_2276_3448 | 377 |
| 638 | 3300046459 | Ga0495629_0002876 | Ga0495629_0002876_7306_8478 | 377 |
| 639 | 3300046472 | Ga0495580_0005184 | Ga0495580_0005184_6249_7421 | 377 |
| 640 | 3300046473 | Ga0495582_0001095 | Ga0495582_0001095_10140_11312 | 377 |
| 641 | 3300046475 | Ga0495639_0000941 | Ga0495639_0000941_4683_5855 | 377 |
| 642 | 3300046476 | Ga0495662_0002531 | Ga0495662_0002531_4625_5797 | 377 |
| 643 | 3300046499 | Ga0495594_0005004 | Ga0495594_0005004_1007_2179 | 377 |
| 644 | 3300046506 | Ga0495583_0055560 | Ga0495583_0055560_75_1247 | 377 |
| 645 | 3300046516 | Ga0495628_0118039 | Ga0495628_0118039_541_1713 | 377 |
| 646 | 3300046517 | Ga0495630_0054346 | Ga0495630_0054346_832_2004 | 377 |
| 647 | 3300046525 | Ga0495663_0020250 | Ga0495663_0020250_74_1246 | 377 |
| 648 | 3300046529 | Ga0495652_0022462 | Ga0495652_0022462_2890_4062 | 377 |
| 649 | 3300046531 | Ga0495665_0001379 | Ga0495665_0001379_7120_8292 | 377 |
| 650 | 3300046533 | Ga0495640_0004511 | Ga0495640_0004511_4700_5872 | 377 |
| 651 | 3300046539 | Ga0495621_0017424 | Ga0495621_0017424_597_1769 | 377 |
| 652 | 3300046557 | Ga0495622_0038051 | Ga0495622_0038051_141_1313 | 377 |
| 653 | 3300046642 | Ga0495634_0008593 | Ga0495634_0008593_1814_2986 | 377 |
| 654 | 3300046648 | Ga0495611_0087073 | Ga0495611_0087073_256_1428 | 377 |
| 655 | 3300046660 | Ga0495625_0128154 | Ga0495625_0128154_273_1445 | 377 |
| 656 | 3300046663 | Ga0495635_0006445 | Ga0495635_0006445_6001_7173 | 377 |
| 657 | 3300046689 | Ga0495613_0018669 | Ga0495613_0018669_3033_4205 | 377 |
| 658 | 3300046689 | Ga0495613_0241970 | Ga0495613_0241970_28_1200 | 377 |
| 659 | 3300046691 | Ga0495670_0059085 | Ga0495670_0059085_40_1212 | 377 |
| 660 | 3300046692 | Ga0495671_0071420 | Ga0495671_0071420_504_1676 | 377 |
| 661 | 3300046694 | Ga0495649_0065973 | Ga0495649_0065973_162_1334 | 377 |
| 662 | 3300047315 | Ga0495581_0005187 | Ga0495581_0005187_4687_5859 | 377 |
| 663 | 3300047318 | Ga0495636_0031170 | Ga0495636_0031170_119_1291 | 377 |
| 664 | 3300047319 | Ga0495674_0006076 | Ga0495674_0006076_7291_8463 | 377 |
| 665 | 3300047321 | Ga0495676_0149108 | Ga0495676_0149108_231_1403 | 377 |
| 666 | 3300047447 | Ga0495685_061532 | Ga0495685_061532_20_1192 | 377 |
| 667 | 3300047673 | Ga0495593_0000213 | Ga0495593_0000213_23723_24895 | 377 |
| 668 | 3300048905 | Ga0496102_0021629 | Ga0496102_0021629_1173_2342 | 377 |
| 669 | 3300048905 | Ga0496102_0029699 | Ga0496102_0029699_1884_3056 | 377 |
| 670 | 3300048906 | Ga0496103_0026444 | Ga0496103_0026444_316_1485 | 377 |
| 671 | 3300048909 | Ga0496106_0004879 | Ga0496106_0004879_4693_5862 | 377 |
| 672 | 3300048910 | Ga0496107_0019793 | Ga0496107_0019793_3058_4227 | 377 |
| 673 | 3300048912 | Ga0496109_0104430 | Ga0496109_0104430_503_1672 | 377 |
| 674 | 3300048917 | Ga0496114_0224754 | Ga0496114_0224754_230_1402 | 377 |
| 675 | 3300048918 | Ga0496115_0206352 | Ga0496115_0206352_154_1323 | 377 |
| 676 | 3300049580 | Ga0501046_0246865 | Ga0501046_0246865_111_1280 | 377 |
| 677 | 3300049582 | Ga0501048_0055678 | Ga0501048_0055678_579_1748 | 377 |
| 678 | 3300049590 | Ga0501074_0238856 | Ga0501074_0238856_19_1188 | 377 |
| 679 | 3300049741 | Ga0501079_0099656 | Ga0501079_0099656_312_1481 | 377 |
| 680 | 3300049742 | Ga0501080_0053356 | Ga0501080_0053356_1725_2894 | 377 |
| 681 | 3300049743 | Ga0501081_0015200 | Ga0501081_0015200_218_1387 | 377 |
| 682 | 3300050493 | nmdc:mga0k408_24978_c1 | nmdc:mga0k408_24978_c1_156_1325 | 377 |
| 683 | 3300050507 | nmdc:mga05p37_183054_c1 | nmdc:mga05p37_183054_c1_920_2089 | 377 |
| 684 | 3300050509 | nmdc:mga0qj67_25768_c1 | nmdc:mga0qj67_25768_c1_2135_3304 | 377 |
| 685 | 3300053077 | Ga0495601_0122809 | Ga0495601_0122809_466_1638 | 377 |
| 686 | 3300053117 | Ga0500593_004153 | Ga0500593_004153_3932_5107 | 377 |
| 687 | 3300054114 | Ga0501084_0067166 | Ga0501084_0067166_1437_2606 | 377 |
| 688 | 3300061734 | Ga0530510_0025809 | Ga0530510_0025809_1960_3129 | 377 |
| 689 | 2209111006 | 2214739665 | 2213746912 | 378 |
| 690 | 3300000041 | ARcpr5oldR_c000054 | ARcpr5oldR_0000543 | 378 |
| 691 | 3300000042 | ARSoilYngRDRAFT_c00400 | ARSoilYngRDRAFT_004002 | 378 |
| 692 | 3300000043 | ARcpr5yngRDRAFT_c000351 | ARcpr5yngRDRAFT_0003513 | 378 |
| 693 | 3300000044 | ARSoilOldRDRAFT_c000055 | ARSoilOldRDRAFT_00005520 | 378 |
| 694 | 3300000045 | ARCol0oldRDRAFT_c00497 | ARCol0oldRDRAFT_004973 | 378 |
| 695 | 3300000652 | ARCol0yngRDRAFT_1000044 | ARCol0yngRDRAFT_10000443 | 378 |
| 696 | 3300001977 | JGI24746J21847_1000489 | JGI24746J21847_10004896 | 378 |
| 697 | 3300001990 | JGI24737J22298_10000632 | JGI24737J22298_100006327 | 378 |
| 698 | 3300001990 | JGI24737J22298_10019755 | JGI24737J22298_100197552 | 378 |
| 699 | 3300002074 | JGI24748J21848_1000669 | JGI24748J21848_10006692 | 378 |
| 700 | 3300002075 | JGI24738J21930_10000039 | JGI24738J21930_100000396 | 378 |
| 701 | 3300002076 | JGI24749J21850_1000363 | JGI24749J21850_10003632 | 378 |
| 702 | 3300002077 | JGI24744J21845_10003566 | JGI24744J21845_100035663 | 378 |
| 703 | 3300002126 | JGI24035J26624_1000189 | JGI24035J26624_10001896 | 378 |
| 704 | 3300002244 | JGI24742J22300_10000085 | JGI24742J22300_100000859 | 378 |
| 705 | 3300002459 | JGI24751J29686_10013822 | JGI24751J29686_100138221 | 378 |
| 706 | 3300003203 | JGI25406J46586_10000035 | JGI25406J46586_1000003528 | 378 |
| 707 | 3300003215 | JGI25153J46596_10010546 | JGI25153J46596_100105462 | 378 |
| 708 | 3300005276 | Ga0065717_1002729 | Ga0065717_10027292 | 378 |
| 709 | 3300005277 | Ga0065716_1002257 | Ga0065716_10022573 | 378 |
| 710 | 3300005289 | Ga0065704_10082675 | Ga0065704_100826751 | 378 |
| 711 | 3300005293 | Ga0065715_10000340 | Ga0065715_100003406 | 378 |
| 712 | 3300005328 | Ga0070676_10000016 | Ga0070676_1000001642 | 378 |
| 713 | 3300005329 | Ga0070683_100000075 | Ga0070683_10000007550 | 378 |
| 714 | 3300005330 | Ga0070690_100000713 | Ga0070690_1000007134 | 378 |
| 715 | 3300005330 | Ga0070690_100132786 | Ga0070690_1001327862 | 378 |
| 716 | 3300005331 | Ga0070670_100102194 | Ga0070670_1001021941 | 378 |
| 717 | 3300005333 | Ga0070677_10000005 | Ga0070677_1000000548 | 378 |
| 718 | 3300005334 | Ga0068869_100000124 | Ga0068869_10000012429 | 378 |
| 719 | 3300005335 | Ga0070666_10184167 | Ga0070666_101841671 | 378 |
| 720 | 3300005336 | Ga0070680_100007119 | Ga0070680_1000071191 | 378 |
| 721 | 3300005337 | Ga0070682_100001022 | Ga0070682_1000010227 | 378 |
| 722 | 3300005338 | Ga0068868_100002137 | Ga0068868_1000021374 | 378 |
| 723 | 3300005339 | Ga0070660_100000153 | Ga0070660_10000015340 | 378 |
| 724 | 3300005340 | Ga0070689_100001013 | Ga0070689_1000010137 | 378 |
| 725 | 3300005343 | Ga0070687_100000346 | Ga0070687_1000003465 | 378 |
| 726 | 3300005344 | Ga0070661_100000315 | Ga0070661_10000031510 | 378 |
| 727 | 3300005345 | Ga0070692_10001032 | Ga0070692_100010329 | 378 |
| 728 | 3300005345 | Ga0070692_10001066 | Ga0070692_100010666 | 378 |
| 729 | 3300005347 | Ga0070668_100000824 | Ga0070668_1000008246 | 378 |
| 730 | 3300005353 | Ga0070669_100000145 | Ga0070669_10000014549 | 378 |
| 731 | 3300005353 | Ga0070669_100069934 | Ga0070669_1000699343 | 378 |
| 732 | 3300005354 | Ga0070675_100001417 | Ga0070675_1000014177 | 378 |
| 733 | 3300005354 | Ga0070675_100089134 | Ga0070675_1000891341 | 378 |
| 734 | 3300005355 | Ga0070671_100000267 | Ga0070671_1000002676 | 378 |
| 735 | 3300005356 | Ga0070674_100001510 | Ga0070674_1000015107 | 378 |
| 736 | 3300005364 | Ga0070673_100000125 | Ga0070673_10000012516 | 378 |
| 737 | 3300005365 | Ga0070688_100000075 | Ga0070688_1000000755 | 378 |
| 738 | 3300005366 | Ga0070659_100001342 | Ga0070659_1000013427 | 378 |
| 739 | 3300005366 | Ga0070659_100064864 | Ga0070659_1000648643 | 378 |
| 740 | 3300005367 | Ga0070667_100002562 | Ga0070667_1000025625 | 378 |
| 741 | 3300005367 | Ga0070667_100023818 | Ga0070667_1000238183 | 378 |
| 742 | 3300005437 | Ga0070710_10035887 | Ga0070710_100358872 | 378 |
| 743 | 3300005437 | Ga0070710_10112910 | Ga0070710_101129101 | 378 |
| 744 | 3300005438 | Ga0070701_10000658 | Ga0070701_100006587 | 378 |
| 745 | 3300005439 | Ga0070711_100005516 | Ga0070711_1000055167 | 378 |
| 746 | 3300005440 | Ga0070705_100000926 | Ga0070705_10000092616 | 378 |
| 747 | 3300005440 | Ga0070705_100037811 | Ga0070705_1000378113 | 378 |
| 748 | 3300005441 | Ga0070700_100000613 | Ga0070700_10000061310 | 378 |
| 749 | 3300005441 | Ga0070700_100096888 | Ga0070700_1000968882 | 378 |
| 750 | 3300005444 | Ga0070694_100000041 | Ga0070694_1000000413 | 378 |
| 751 | 3300005444 | Ga0070694_100056792 | Ga0070694_1000567923 | 378 |
| 752 | 3300005445 | Ga0070708_100009486 | Ga0070708_1000094864 | 378 |
| 753 | 3300005445 | Ga0070708_100066756 | Ga0070708_1000667563 | 378 |
| 754 | 3300005455 | Ga0070663_100000260 | Ga0070663_10000026010 | 378 |
| 755 | 3300005455 | Ga0070663_100030281 | Ga0070663_1000302812 | 378 |
| 756 | 3300005455 | Ga0070663_100250881 | Ga0070663_1002508811 | 378 |
| 757 | 3300005458 | Ga0070681_10003404 | Ga0070681_100034048 | 378 |
| 758 | 3300005458 | Ga0070681_10093921 | Ga0070681_100939212 | 378 |
| 759 | 3300005459 | Ga0068867_100003207 | Ga0068867_1000032073 | 378 |
| 760 | 3300005466 | Ga0070685_10005160 | Ga0070685_100051606 | 378 |
| 761 | 3300005468 | Ga0070707_100340643 | Ga0070707_1003406431 | 378 |
| 762 | 3300005518 | Ga0070699_100212718 | Ga0070699_1002127182 | 378 |
| 763 | 3300005530 | Ga0070679_100000464 | Ga0070679_1000004646 | 378 |
| 764 | 3300005530 | Ga0070679_100187460 | Ga0070679_1001874602 | 378 |
| 765 | 3300005535 | Ga0070684_100001338 | Ga0070684_1000013387 | 378 |
| 766 | 3300005539 | Ga0068853_100046770 | Ga0068853_1000467701 | 378 |
| 767 | 3300005543 | Ga0070672_100002280 | Ga0070672_1000022805 | 378 |
| 768 | 3300005544 | Ga0070686_100001401 | Ga0070686_1000014017 | 378 |
| 769 | 3300005544 | Ga0070686_100173839 | Ga0070686_1001738391 | 378 |
| 770 | 3300005545 | Ga0070695_100000720 | Ga0070695_1000007207 | 378 |
| 771 | 3300005545 | Ga0070695_100050067 | Ga0070695_1000500672 | 378 |
| 772 | 3300005546 | Ga0070696_100005203 | Ga0070696_1000052036 | 378 |
| 773 | 3300005546 | Ga0070696_100071433 | Ga0070696_1000714332 | 378 |
| 774 | 3300005547 | Ga0070693_100011021 | Ga0070693_1000110212 | 378 |
| 775 | 3300005549 | Ga0070704_100035355 | Ga0070704_1000353553 | 378 |
| 776 | 3300005564 | Ga0070664_100056205 | Ga0070664_1000562052 | 378 |
| 777 | 3300005577 | Ga0068857_100000122 | Ga0068857_1000001222 | 378 |
| 778 | 3300005578 | Ga0068854_100001039 | Ga0068854_1000010396 | 378 |
| 779 | 3300005614 | Ga0068856_100001112 | Ga0068856_10000111217 | 378 |
| 780 | 3300005614 | Ga0068856_100098612 | Ga0068856_1000986123 | 378 |
| 781 | 3300005615 | Ga0070702_100000908 | Ga0070702_10000090810 | 378 |
| 782 | 3300005616 | Ga0068852_100001884 | Ga0068852_1000018848 | 378 |
| 783 | 3300005617 | Ga0068859_100000365 | Ga0068859_10000036534 | 378 |
| 784 | 3300005617 | Ga0068859_100107876 | Ga0068859_1001078763 | 378 |
| 785 | 3300005618 | Ga0068864_100000271 | Ga0068864_1000002712 | 378 |
| 786 | 3300005718 | Ga0068866_10000525 | Ga0068866_100005257 | 378 |
| 787 | 3300005719 | Ga0068861_100001852 | Ga0068861_1000018527 | 378 |
| 788 | 3300005719 | Ga0068861_100034799 | Ga0068861_1000347993 | 378 |
| 789 | 3300005840 | Ga0068870_10000263 | Ga0068870_1000026310 | 378 |
| 790 | 3300005841 | Ga0068863_100000372 | Ga0068863_10000037240 | 378 |
| 791 | 3300005842 | Ga0068858_100005253 | Ga0068858_10000525312 | 378 |
| 792 | 3300005843 | Ga0068860_100142840 | Ga0068860_1001428402 | 378 |
| 793 | 3300005937 | Ga0081455_10000007 | Ga0081455_10000007112 | 378 |
| 794 | 3300005937 | Ga0081455_10012925 | Ga0081455_100129252 | 378 |
| 795 | 3300005985 | Ga0081539_10000113 | Ga0081539_1000011390 | 378 |
| 796 | 3300006163 | Ga0070715_10010738 | Ga0070715_100107382 | 378 |
| 797 | 3300006237 | Ga0097621_100000047 | Ga0097621_10000004752 | 378 |
| 798 | 3300006358 | Ga0068871_100000721 | Ga0068871_1000007216 | 378 |
| 799 | 3300006358 | Ga0068871_100021627 | Ga0068871_1000216275 | 378 |
| 800 | 3300006852 | Ga0075433_10016738 | Ga0075433_100167383 | 378 |
| 801 | 3300006871 | Ga0075434_100001558 | Ga0075434_1000015583 | 378 |
| 802 | 3300006871 | Ga0075434_100317828 | Ga0075434_1003178282 | 378 |
| 803 | 3300006931 | Ga0097620_100000365 | Ga0097620_10000036510 | 378 |
| 804 | 3300006931 | Ga0097620_100107884 | Ga0097620_1001078843 | 378 |
| 805 | 3300009093 | Ga0105240_10106121 | Ga0105240_101061212 | 378 |
| 806 | 3300009094 | Ga0111539_10000185 | Ga0111539_1000018554 | 378 |
| 807 | 3300009094 | Ga0111539_10001287 | Ga0111539_1000128733 | 378 |
| 808 | 3300009098 | Ga0105245_10000213 | Ga0105245_100002132 | 378 |
| 809 | 3300009098 | Ga0105245_10019072 | Ga0105245_100190724 | 378 |
| 810 | 3300009101 | Ga0105247_10002058 | Ga0105247_1000205813 | 378 |
| 811 | 3300009101 | Ga0105247_10014638 | Ga0105247_100146383 | 378 |
| 812 | 3300009148 | Ga0105243_10000175 | Ga0105243_1000017556 | 378 |
| 813 | 3300009148 | Ga0105243_10111941 | Ga0105243_101119412 | 378 |
| 814 | 3300009174 | Ga0105241_10000734 | Ga0105241_1000073414 | 378 |
| 815 | 3300009176 | Ga0105242_10000170 | Ga0105242_1000017042 | 378 |
| 816 | 3300009177 | Ga0105248_10003499 | Ga0105248_1000349912 | 378 |
| 817 | 3300009177 | Ga0105248_10041608 | Ga0105248_100416081 | 378 |
| 818 | 3300009545 | Ga0105237_10003191 | Ga0105237_1000319112 | 378 |
| 819 | 3300009553 | Ga0105249_10000200 | Ga0105249_1000020051 | 378 |
| 820 | 3300009553 | Ga0105249_10097718 | Ga0105249_100977182 | 378 |
| 821 | 3300010375 | Ga0105239_10000834 | Ga0105239_1000083440 | 378 |
| 822 | 3300011119 | Ga0105246_10000050 | Ga0105246_1000005039 | 378 |
| 823 | 3300011119 | Ga0105246_10125434 | Ga0105246_101254342 | 378 |
| 824 | 3300013100 | Ga0157373_10018018 | Ga0157373_100180183 | 378 |
| 825 | 3300013102 | Ga0157371_10007981 | Ga0157371_100079812 | 378 |
| 826 | 3300013104 | Ga0157370_10109350 | Ga0157370_101093503 | 378 |
| 827 | 3300013296 | Ga0157374_10001431 | Ga0157374_1000143120 | 378 |
| 828 | 3300013296 | Ga0157374_10088930 | Ga0157374_100889302 | 378 |
| 829 | 3300013306 | Ga0163162_10000222 | Ga0163162_1000022243 | 378 |
| 830 | 3300013306 | Ga0163162_10121040 | Ga0163162_101210402 | 378 |
| 831 | 3300013307 | Ga0157372_10001777 | Ga0157372_100017779 | 378 |
| 832 | 3300013308 | Ga0157375_10001098 | Ga0157375_1000109817 | 378 |
| 833 | 3300014325 | Ga0163163_10027403 | Ga0163163_100274033 | 378 |
| 834 | 3300014326 | Ga0157380_10000361 | Ga0157380_1000036120 | 378 |
| 835 | 3300014745 | Ga0157377_10004957 | Ga0157377_100049572 | 378 |
| 836 | 3300014968 | Ga0157379_10000036 | Ga0157379_100000366 | 378 |
| 837 | 3300014968 | Ga0157379_10067881 | Ga0157379_100678812 | 378 |
| 838 | 3300014969 | Ga0157376_10000062 | Ga0157376_1000006255 | 378 |
| 839 | 3300025271 | Ga0207666_1000015 | Ga0207666_10000156 | 378 |
| 840 | 3300025290 | Ga0207673_1000090 | Ga0207673_10000902 | 378 |
| 841 | 3300025297 | Ga0209758_1000686 | Ga0209758_10006865 | 378 |
| 842 | 3300025315 | Ga0207697_10000088 | Ga0207697_100000886 | 378 |
| 843 | 3300025315 | Ga0207697_10005807 | Ga0207697_100058072 | 378 |
| 844 | 3300025885 | Ga0207653_10002386 | Ga0207653_100023862 | 378 |
| 845 | 3300025893 | Ga0207682_10000004 | Ga0207682_1000000441 | 378 |
| 846 | 3300025899 | Ga0207642_10000417 | Ga0207642_100004172 | 378 |
| 847 | 3300025901 | Ga0207688_10000042 | Ga0207688_100000426 | 378 |
| 848 | 3300025904 | Ga0207647_10000417 | Ga0207647_1000041734 | 378 |
| 849 | 3300025905 | Ga0207685_10003166 | Ga0207685_100031662 | 378 |
| 850 | 3300025907 | Ga0207645_10000061 | Ga0207645_1000006110 | 378 |
| 851 | 3300025908 | Ga0207643_10000012 | Ga0207643_1000001269 | 378 |
| 852 | 3300025911 | Ga0207654_10000581 | Ga0207654_100005815 | 378 |
| 853 | 3300025912 | Ga0207707_10001928 | Ga0207707_1000192814 | 378 |
| 854 | 3300025914 | Ga0207671_10003107 | Ga0207671_1000310711 | 378 |
| 855 | 3300025916 | Ga0207663_10004390 | Ga0207663_100043904 | 378 |
| 856 | 3300025917 | Ga0207660_10000008 | Ga0207660_1000000851 | 378 |
| 857 | 3300025917 | Ga0207660_10053316 | Ga0207660_100533162 | 378 |
| 858 | 3300025918 | Ga0207662_10000097 | Ga0207662_100000976 | 378 |
| 859 | 3300025918 | Ga0207662_10008531 | Ga0207662_100085316 | 378 |
| 860 | 3300025919 | Ga0207657_10000503 | Ga0207657_100005036 | 378 |
| 861 | 3300025919 | Ga0207657_10006399 | Ga0207657_100063996 | 378 |
| 862 | 3300025920 | Ga0207649_10000099 | Ga0207649_1000009938 | 378 |
| 863 | 3300025921 | Ga0207652_10001041 | Ga0207652_100010418 | 378 |
| 864 | 3300025921 | Ga0207652_10088968 | Ga0207652_100889682 | 378 |
| 865 | 3300025923 | Ga0207681_10000141 | Ga0207681_100001419 | 378 |
| 866 | 3300025923 | Ga0207681_10027920 | Ga0207681_100279204 | 378 |
| 867 | 3300025924 | Ga0207694_10148905 | Ga0207694_101489052 | 378 |
| 868 | 3300025926 | Ga0207659_10000023 | Ga0207659_1000002351 | 378 |
| 869 | 3300025927 | Ga0207687_10000319 | Ga0207687_1000031931 | 378 |
| 870 | 3300025931 | Ga0207644_10040702 | Ga0207644_100407024 | 378 |
| 871 | 3300025932 | Ga0207690_10000105 | Ga0207690_1000010557 | 378 |
| 872 | 3300025932 | Ga0207690_10066808 | Ga0207690_100668082 | 378 |
| 873 | 3300025933 | Ga0207706_10000438 | Ga0207706_100004386 | 378 |
| 874 | 3300025934 | Ga0207686_10000140 | Ga0207686_1000014043 | 378 |
| 875 | 3300025935 | Ga0207709_10000555 | Ga0207709_100005559 | 378 |
| 876 | 3300025936 | Ga0207670_10000108 | Ga0207670_100001082 | 378 |
| 877 | 3300025937 | Ga0207669_10000110 | Ga0207669_1000011039 | 378 |
| 878 | 3300025938 | Ga0207704_10000311 | Ga0207704_1000031113 | 378 |
| 879 | 3300025940 | Ga0207691_10002227 | Ga0207691_100022276 | 378 |
| 880 | 3300025941 | Ga0207711_10039174 | Ga0207711_100391741 | 378 |
| 881 | 3300025941 | Ga0207711_10076263 | Ga0207711_100762632 | 378 |
| 882 | 3300025942 | Ga0207689_10000008 | Ga0207689_1000000855 | 378 |
| 883 | 3300025944 | Ga0207661_10000053 | Ga0207661_1000005352 | 378 |
| 884 | 3300025945 | Ga0207679_10000053 | Ga0207679_1000005344 | 378 |
| 885 | 3300025945 | Ga0207679_10039419 | Ga0207679_100394192 | 378 |
| 886 | 3300025949 | Ga0207667_10015140 | Ga0207667_100151403 | 378 |
| 887 | 3300025960 | Ga0207651_10000068 | Ga0207651_1000006839 | 378 |
| 888 | 3300025961 | Ga0207712_10000156 | Ga0207712_1000015651 | 378 |
| 889 | 3300025961 | Ga0207712_10049589 | Ga0207712_100495892 | 378 |
| 890 | 3300025972 | Ga0207668_10000160 | Ga0207668_100001602 | 378 |
| 891 | 3300025972 | Ga0207668_10028914 | Ga0207668_100289143 | 378 |
| 892 | 3300025981 | Ga0207640_10000325 | Ga0207640_1000032521 | 378 |
| 893 | 3300025986 | Ga0207658_10002013 | Ga0207658_100020138 | 378 |
| 894 | 3300026023 | Ga0207677_10000725 | Ga0207677_100007259 | 378 |
| 895 | 3300026035 | Ga0207703_10010327 | Ga0207703_100103272 | 378 |
| 896 | 3300026041 | Ga0207639_10001357 | Ga0207639_1000135710 | 378 |
| 897 | 3300026067 | Ga0207678_10000185 | Ga0207678_1000018537 | 378 |
| 898 | 3300026067 | Ga0207678_10081605 | Ga0207678_100816051 | 378 |
| 899 | 3300026075 | Ga0207708_10000263 | Ga0207708_1000026334 | 378 |
| 900 | 3300026078 | Ga0207702_10003403 | Ga0207702_100034039 | 378 |
| 901 | 3300026088 | Ga0207641_10002301 | Ga0207641_1000230111 | 378 |
| 902 | 3300026089 | Ga0207648_10000469 | Ga0207648_1000046934 | 378 |
| 903 | 3300026095 | Ga0207676_10000627 | Ga0207676_1000062720 | 378 |
| 904 | 3300026118 | Ga0207675_100000342 | Ga0207675_1000003426 | 378 |
| 905 | 3300026118 | Ga0207675_100029898 | Ga0207675_1000298982 | 378 |
| 906 | 3300026121 | Ga0207683_10000006 | Ga0207683_1000000654 | 378 |
| 907 | 3300026121 | Ga0207683_10011184 | Ga0207683_100111845 | 378 |
| 908 | 3300026142 | Ga0207698_10005210 | Ga0207698_100052108 | 378 |
| 909 | 3300027695 | Ga0209966_1001571 | Ga0209966_10015714 | 378 |
| 910 | 3300027717 | Ga0209998_10000664 | Ga0209998_100006642 | 378 |
| 911 | 3300027876 | Ga0209974_10003275 | Ga0209974_100032754 | 378 |
| 912 | 3300027907 | Ga0207428_10000112 | Ga0207428_1000011245 | 378 |
| 913 | 3300027907 | Ga0207428_10000480 | Ga0207428_1000048043 | 378 |
| 914 | 3300028379 | Ga0268266_10221057 | Ga0268266_102210571 | 378 |
| 915 | 3300028380 | Ga0268265_10000257 | Ga0268265_1000025751 | 378 |
| 916 | 3300028381 | Ga0268264_10011002 | Ga0268264_100110024 | 378 |
| 917 | 3300028381 | Ga0268264_10130404 | Ga0268264_101304042 | 378 |
| 918 | 3300031241 | Ga0265325_10000034 | Ga0265325_1000003412 | 378 |
| 919 | 3300031711 | Ga0265314_10036528 | Ga0265314_100365283 | 378 |
| 920 | 3300034816 | Ga0373930_0000060 | Ga0373930_0000060_4500_5666 | 378 |
| 921 | 3300034817 | Ga0373948_0000125 | Ga0373948_0000125_156_1322 | 378 |
| 922 | 3300034818 | Ga0373950_0000139 | Ga0373950_0000139_2197_3363 | 378 |
| 923 | 3300034819 | Ga0373958_0000692 | Ga0373958_0000692_1417_2583 | 378 |
| 924 | 3300034820 | Ga0373959_0010573 | Ga0373959_0010573_402_1568 | 378 |
| 925 | 3300034957 | Ga0373938_0000349 | Ga0373938_0000349_5417_6583 | 378 |
| 926 | 3300035084 | Ga0373928_0001321 | Ga0373928_0001321_385_1551 | 378 |
| 927 | 3300035085 | Ga0373929_0000087 | Ga0373929_0000087_11735_12901 | 378 |
| 928 | 3300035088 | Ga0373940_0004502 | Ga0373940_0004502_852_2021 | 378 |
| 929 | 3300035088 | Ga0373940_0019540 | Ga0373940_0019540_292_1620 | 378 |
| 930 | 3300035090 | Ga0373949_0001366 | Ga0373949_0001366_424_1590 | 378 |
| 931 | 3300035090 | Ga0373949_0012705 | Ga0373949_0012705_29_1198 | 378 |
| 932 | 3300035091 | Ga0373951_0004558 | Ga0373951_0004558_238_1407 | 378 |
| 933 | 3300035092 | Ga0373952_0000321 | Ga0373952_0000321_6482_7648 | 378 |
| 934 | 3300035092 | Ga0373952_0000488 | Ga0373952_0000488_1656_2825 | 378 |
| 935 | 3300035111 | Ga0373923_0017242 | Ga0373923_0017242_1044_2216 | 378 |
| 936 | 3300035112 | Ga0373932_0000929 | Ga0373932_0000929_770_1939 | 378 |
| 937 | 3300035112 | Ga0373932_0008954 | Ga0373932_0008954_1077_2243 | 378 |
| 938 | 3300035114 | Ga0373939_0001497 | Ga0373939_0001497_2904_4073 | 378 |
| 939 | 3300035114 | Ga0373939_0026430 | Ga0373939_0026430_198_1364 | 378 |
| 940 | 3300035115 | Ga0373941_0000030 | Ga0373941_0000030_19634_20800 | 378 |
| 941 | 3300035115 | Ga0373941_0003622 | Ga0373941_0003622_1707_2876 | 378 |
| 942 | 3300035117 | Ga0373953_0009712 | Ga0373953_0009712_1825_2997 | 378 |
| 943 | 3300035119 | Ga0373956_0027433 | Ga0373956_0027433_660_1832 | 378 |
| 944 | 3300035121 | Ga0373960_0000466 | Ga0373960_0000466_6160_7326 | 378 |
| 945 | 3300035207 | Ga0373942_0000232 | Ga0373942_0000232_13151_14317 | 378 |
| 946 | 3300035241 | Ga0373961_0000887 | Ga0373961_0000887_500_1666 | 378 |
| 947 | 3300035242 | Ga0373962_0001028 | Ga0373962_0001028_1966_3135 | 378 |
| 948 | 3300035242 | Ga0373962_0003491 | Ga0373962_0003491_2217_3383 | 378 |
| 949 | 3300035691 | Ga0373931_0000084 | Ga0373931_0000084_31626_32795 | 378 |
| 950 | 3300035691 | Ga0373931_0041086 | Ga0373931_0041086_523_1689 | 378 |
| 951 | 3300036401 | Ga0373937_0009714 | Ga0373937_0009714_205_1377 | 378 |
| 952 | 3300036401 | Ga0373937_0140640 | Ga0373937_0140640_1064_2236 | 378 |
| 953 | 3300036401 | Ga0373937_0245070 | Ga0373937_0245070_58_1230 | 378 |
| 954 | 3300037068 | Ga0373925_0142403 | Ga0373925_0142403_392_1564 | 378 |
| 955 | 3300045051 | Ga0451576_0279840 | Ga0451576_0279840_103_1269 | 378 |
| 956 | 3300045836 | Ga0466958_0022175 | Ga0466958_0022175_922_2094 | 378 |
| 957 | 3300046454 | Ga0495592_0061350 | Ga0495592_0061350_1380_2552 | 378 |
| 958 | 3300046462 | Ga0495651_0002023 | Ga0495651_0002023_4761_5933 | 378 |
| 959 | 3300046511 | Ga0495608_0001643 | Ga0495608_0001643_13217_14389 | 378 |
| 960 | 3300046533 | Ga0495640_0090454 | Ga0495640_0090454_88_1260 | 378 |
| 961 | 3300046536 | Ga0495587_0001373 | Ga0495587_0001373_1939_3111 | 378 |
| 962 | 3300046543 | Ga0495645_0064572 | Ga0495645_0064572_81_1253 | 378 |
| 963 | 3300046559 | Ga0495667_0047496 | Ga0495667_0047496_154_1326 | 378 |
| 964 | 3300046663 | Ga0495635_0033323 | Ga0495635_0033323_1725_2897 | 378 |
| 965 | 3300046678 | Ga0495599_0002224 | Ga0495599_0002224_9730_10902 | 378 |
| 966 | 3300046679 | Ga0495623_0003831 | Ga0495623_0003831_3461_4633 | 378 |
| 967 | 3300046809 | Ga0495600_0002906 | Ga0495600_0002906_7401_8573 | 378 |
| 968 | 3300047317 | Ga0495604_0004474 | Ga0495604_0004474_661_1833 | 378 |
| 969 | 3300047322 | Ga0495680_0001681 | Ga0495680_0001681_5928_7100 | 378 |
| 970 | 3300048088 | Ga0495602_0026191 | Ga0495602_0026191_3077_4249 | 378 |
| 971 | 3300048903 | Ga0496100_0002401 | Ga0496100_0002401_4237_5406 | 378 |
| 972 | 3300048903 | Ga0496100_0011288 | Ga0496100_0011288_2916_4088 | 378 |
| 973 | 3300048903 | Ga0496100_0023500 | Ga0496100_0023500_1839_3011 | 378 |
| 974 | 3300048904 | Ga0496101_0000360 | Ga0496101_0000360_2930_4099 | 378 |
| 975 | 3300048905 | Ga0496102_0013402 | Ga0496102_0013402_3507_4676 | 378 |
| 976 | 3300048906 | Ga0496103_0001517 | Ga0496103_0001517_1580_2749 | 378 |
| 977 | 3300048906 | Ga0496103_0090279 | Ga0496103_0090279_306_1472 | 378 |
| 978 | 3300048907 | Ga0496104_0125578 | Ga0496104_0125578_1091_2263 | 378 |
| 979 | 3300048908 | Ga0496105_0012959 | Ga0496105_0012959_1364_2536 | 378 |
| 980 | 3300048909 | Ga0496106_0000679 | Ga0496106_0000679_9840_11009 | 378 |
| 981 | 3300048909 | Ga0496106_0128690 | Ga0496106_0128690_703_1869 | 378 |
| 982 | 3300048909 | Ga0496106_0197995 | Ga0496106_0197995_247_1572 | 378 |
| 983 | 3300048910 | Ga0496107_0000386 | Ga0496107_0000386_8048_9217 | 378 |
| 984 | 3300048911 | Ga0496108_0011200 | Ga0496108_0011200_2854_4026 | 378 |
| 985 | 3300048911 | Ga0496108_0091346 | Ga0496108_0091346_471_1640 | 378 |
| 986 | 3300048912 | Ga0496109_0041883 | Ga0496109_0041883_1961_3133 | 378 |
| 987 | 3300048912 | Ga0496109_0087652 | Ga0496109_0087652_613_1782 | 378 |
| 988 | 3300048913 | Ga0496110_0031751 | Ga0496110_0031751_1298_2470 | 378 |
| 989 | 3300048914 | Ga0496111_0067605 | Ga0496111_0067605_623_1792 | 378 |
| 990 | 3300048915 | Ga0496112_0000017 | Ga0496112_0000017_15423_16595 | 378 |
| 991 | 3300048915 | Ga0496112_0111560 | Ga0496112_0111560_1095_2264 | 378 |
| 992 | 3300048916 | Ga0496113_0113326 | Ga0496113_0113326_657_1826 | 378 |
| 993 | 3300048917 | Ga0496114_0006840 | Ga0496114_0006840_465_1634 | 378 |
| 994 | 3300048918 | Ga0496115_0018716 | Ga0496115_0018716_3286_4455 | 378 |
| 995 | 3300050511 | nmdc:mga08y16_2892_c1 | nmdc:mga08y16_2892_c1_5620_6786 | 378 |
| 996 | 3300050511 | nmdc:mga08y16_68965_c1 | nmdc:mga08y16_68965_c1_1818_2987 | 378 |
| 997 | 3300050512 | nmdc:mga0n895_4346_c1 | nmdc:mga0n895_4346_c1_10068_11237 | 378 |
| 998 | 3300050515 | nmdc:mga0a205_19478_c1 | nmdc:mga0a205_19478_c1_1804_2973 | 378 |
| 999 | 3300053077 | Ga0495601_0045485 | Ga0495601_0045485_81_1253 | 378 |
| 1000 | 3300053084 | Ga0495595_0006128 | Ga0495595_0006128_3081_4253 | 378 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4n0q-assembly1.cif.gz_A | crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) | 0.8963 | 28 | 361 |
| 4q6w-assembly1.cif.gz_A | crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid | 0.8863 | 26 | 361 |
| 1z18-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8842 | 26 | 360 |
| 3ipc-assembly1.cif.gz_A | structure of atu2422-gaba f77a mutant receptor in complex with leucine | 0.8805 | 27 | 361 |
| 3ip9-assembly1.cif.gz_A | structure of atu2422-gaba receptor in complex with gaba | 0.8791 | 27 | 361 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4mptA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9408 | 148 | 272 | 3.40.50.2300 |
| 1usiA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9391 | 148 | 272 | 3.40.50.2300 |
| 3sg0A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9385 | 151 | 275 | 3.40.50.2300 |
| 4n0qA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.937 | 148 | 272 | 3.40.50.2300 |
| 3td9A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9343 | 148 | 272 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537NHC1-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9788 | 48 | 378 |
|
| AF-A0A537NHC1-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9477 | 48 | 378 |
|
| AF-A0A7C6Q167-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9401 | 19 | 366 |
GO:0006865
|
| AF-A0A512BTF2-F1-model_v4 | Branched chain amino acid ABC transporter substrate-binding protein | 0.9337 | 37 | 361 |
GO:0006865
|
| AF-A0A2M7KMV2-F1-model_v4 | Leucine-binding protein domain-containing protein | 0.9307 | 26 | 361 |
GO:0006865
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar