F487907
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1002 | 450 | 2004 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300015262|Ga0182007_10002759|Ga0182007_100027594 |
| Length | 341 |
| Sequence | MQESQVAFRRAGSVKTHYGGTVKALQGVEGQVVWADEPSPACDVGQVRIRVAAAGLNRADLLQKAGLYPPPPGASQVLGLECSGVISEVGPGSSWQVGDRVCALLAGGGMAEEVVVDGRHVLPVPEGLSLAEAAALPEVYGTAWLNLFQLAALKPGEKVLLHAGASGVGSAAIQLCKAFGNPCWVSVGSTDRLSYCEALGAQGGVVRTDGLESLNDLGPFDVILDPVGANYAQLNVKLLSVDGRWVLIGLMGGRSTELDLAQVLGKRIQLLGSTLRSRDEQFKANLISELGQQVWPLFADKRLSPQLAKTFAIKDAEAAFAELATNKVSGKVVLVIDELLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 32 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 33 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 34 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 35 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 43 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 45 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 91 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 95 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 96 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 97 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 98 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 101 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 102 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 103 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 104 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 105 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 106 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 107 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 108 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 109 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 110 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 111 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 112 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 113 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 114 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 115 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 116 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 117 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 118 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 119 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 120 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 121 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 122 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 123 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 124 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 125 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 126 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 127 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 128 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 129 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 130 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 131 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 132 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 133 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 134 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 135 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 136 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 137 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 206 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 207 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 208 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 209 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 210 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 211 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 212 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 213 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 214 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 215 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 216 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 221 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 222 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 223 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 225 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 227 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 228 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 229 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 230 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 231 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 232 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 233 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 234 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 235 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 236 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 237 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 238 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 239 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 240 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 241 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 242 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 243 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 244 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 245 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 246 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 247 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 248 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 249 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 250 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 251 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 252 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 253 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 254 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 255 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 256 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 257 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 258 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 259 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 260 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 261 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 262 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 263 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 264 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 265 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 266 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 267 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 268 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 269 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 270 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 271 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 272 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 273 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 274 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 275 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 276 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 277 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 278 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 279 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 280 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 281 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 282 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 283 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 284 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 285 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 286 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 287 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 288 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 289 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 290 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 291 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 292 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 293 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 294 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 295 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 296 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 297 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 298 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 299 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 300 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 301 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 302 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 303 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 304 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 305 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 306 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 307 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 308 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 309 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 310 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 311 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 312 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 313 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 314 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 315 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 316 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 317 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 318 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 319 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 320 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 321 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 322 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 323 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 324 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 325 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 326 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 327 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 328 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 329 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 330 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 331 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 332 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 333 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 334 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 335 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 336 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 337 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 338 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 339 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 340 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 341 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 342 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 343 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 344 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 345 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 346 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 347 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 348 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 349 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 350 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 351 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 352 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 353 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 354 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 355 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 356 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 357 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 358 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 359 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 360 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 361 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 362 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 363 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 364 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 365 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 366 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 367 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 368 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 369 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 370 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 371 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 372 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 373 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 374 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 375 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 376 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 377 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 378 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 379 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 380 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 381 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 382 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 383 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 384 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 385 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 386 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 387 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 388 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 389 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 390 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 391 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 392 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 393 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 394 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 395 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 396 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 397 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 398 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 399 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 400 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 401 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 402 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 403 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 404 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 405 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 406 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 407 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 408 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 409 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 410 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 411 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 412 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 413 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 414 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 415 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 416 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 417 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 418 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 419 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 420 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 421 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 422 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 423 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 424 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 425 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 426 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 427 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 428 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 429 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 430 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 431 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 432 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 433 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 434 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 435 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 436 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 437 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 438 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 439 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 440 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 441 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 442 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 443 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 444 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 445 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 446 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 447 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 448 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 449 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 450 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.94 |
| Metatranscriptomes | 0 |
| Isolates | 22.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 7.39 |
| Nodule | 2.2 |
| Rhizoplane | 7.19 |
| Rhizosphere | 70.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182007_10002759 | 3300015262 | Bacteria | 8577 |
| 2 | MRS2a_Contig_9054 | 2124908027 | Bacteria | 2380 |
| 3 | SwRhRL2b_contig_249379 | 2162886007 | Bacteria | 2007 |
| 4 | SwRhRL2b_contig_3818765 | 2162886007 | Bacteria | 2929 |
| 5 | JGI24735J21928_10001792 | 3300002067 | Bacteria | 7537 |
| 6 | JGI25162J39368_1000018 | 3300002737 | Bacteria | 277875 |
| 7 | JGI25157J39369_1000011 | 3300002741 | Bacteria | 206831 |
| 8 | JGI25163J39215_1000612 | 3300002771 | Bacteria | 9846 |
| 9 | JGI25163J39215_1001671 | 3300002771 | Bacteria | 3224 |
| 10 | JGI25163J39215_1001757 | 3300002771 | Bacteria | 3006 |
| 11 | JGI25164J39214_1000007 | 3300002772 | Bacteria | 312507 |
| 12 | JGI25164J39214_1000194 | 3300002772 | Bacteria | 52332 |
| 13 | JGI25164J39214_1000513 | 3300002772 | Bacteria | 18583 |
| 14 | JGI25165J46597_1000029 | 3300003214 | Bacteria | 312507 |
| 15 | JGI25165J46597_1000348 | 3300003214 | Bacteria | 52332 |
| 16 | JGI25165J46597_1000430 | 3300003214 | Bacteria | 42934 |
| 17 | Ga0055535_1000025 | 3300003761 | Bacteria | 213549 |
| 18 | Ga0055535_1000103 | 3300003761 | Bacteria | 91199 |
| 19 | Ga0055542_1000010 | 3300003762 | Bacteria | 414813 |
| 20 | Ga0055542_1000024 | 3300003762 | Bacteria | 277875 |
| 21 | Ga0055529_1000029 | 3300003763 | Bacteria | 277978 |
| 22 | Ga0055536_1000111 | 3300003781 | Bacteria | 71634 |
| 23 | Ga0055530_10000146 | 3300003791 | Bacteria | 63397 |
| 24 | Ga0055530_10001124 | 3300003791 | Bacteria | 20902 |
| 25 | Ga0055540_1000822 | 3300003792 | Bacteria | 20902 |
| 26 | Ga0055540_1001173 | 3300003792 | Bacteria | 16221 |
| 27 | Ga0055540_1001379 | 3300003792 | Bacteria | 14505 |
| 28 | Ga0055531_10005378 | 3300003794 | Bacteria | 7503 |
| 29 | Ga0065714_10003020 | 3300005288 | Bacteria | 10111 |
| 30 | Ga0065714_10008503 | 3300005288 | Bacteria | 3283 |
| 31 | Ga0065714_10010964 | 3300005288 | Bacteria | 2862 |
| 32 | Ga0065704_10000811 | 3300005289 | Bacteria | 15100 |
| 33 | Ga0065704_10128936 | 3300005289 | Bacteria | 1626 |
| 34 | Ga0065712_10001766 | 3300005290 | Bacteria | 11896 |
| 35 | Ga0065712_10067928 | 3300005290 | Bacteria | 20363 |
| 36 | Ga0065712_10095511 | 3300005290 | Bacteria | 2216 |
| 37 | Ga0070670_100001032 | 3300005331 | Bacteria | 22056 |
| 38 | Ga0070670_100039965 | 3300005331 | Bacteria | 4034 |
| 39 | Ga0070661_100000410 | 3300005344 | Bacteria | 33146 |
| 40 | Ga0070709_10380710 | 3300005434 | Bacteria | 1049 |
| 41 | Ga0070662_100000575 | 3300005457 | Bacteria | 22374 |
| 42 | Ga0070662_100231300 | 3300005457 | Bacteria | 1479 |
| 43 | Ga0070699_100484596 | 3300005518 | Bacteria | 1123 |
| 44 | Ga0068853_100017790 | 3300005539 | Bacteria | 5869 |
| 45 | Ga0070664_100000377 | 3300005564 | Bacteria | 33163 |
| 46 | Ga0070664_100508048 | 3300005564 | Bacteria | 1111 |
| 47 | Ga0068854_100020669 | 3300005578 | Bacteria | 4459 |
| 48 | Ga0068851_10000251 | 3300005834 | Bacteria | 25318 |
| 49 | Ga0081455_10008620 | 3300005937 | Bacteria | 10577 |
| 50 | Ga0075364_10111970 | 3300006051 | Bacteria | 1822 |
| 51 | Ga0075432_10001356 | 3300006058 | Bacteria | 7950 |
| 52 | Ga0075432_10004567 | 3300006058 | Bacteria | 4712 |
| 53 | Ga0075432_10033448 | 3300006058 | Bacteria | 1783 |
| 54 | Ga0075432_10071867 | 3300006058 | Bacteria | 1244 |
| 55 | Ga0075362_10031647 | 3300006177 | Bacteria | 2291 |
| 56 | Ga0075362_10052897 | 3300006177 | Bacteria | 1821 |
| 57 | Ga0075362_10092813 | 3300006177 | Bacteria | 1403 |
| 58 | Ga0075369_10005588 | 3300006186 | Bacteria | 4707 |
| 59 | Ga0079104_1000364 | 3300006946 | Bacteria | 54402 |
| 60 | Ga0105251_10000275 | 3300009011 | Bacteria | 51691 |
| 61 | Ga0105251_10000284 | 3300009011 | Bacteria | 50987 |
| 62 | Ga0105251_10003067 | 3300009011 | Bacteria | 12418 |
| 63 | Ga0105251_10003252 | 3300009011 | Bacteria | 11939 |
| 64 | Ga0105251_10004649 | 3300009011 | Bacteria | 9252 |
| 65 | Ga0105251_10005474 | 3300009011 | Bacteria | 8282 |
| 66 | Ga0105251_10007774 | 3300009011 | Bacteria | 6534 |
| 67 | Ga0105251_10017472 | 3300009011 | Bacteria | 3843 |
| 68 | Ga0105251_10019528 | 3300009011 | Bacteria | 3577 |
| 69 | Ga0105251_10021821 | 3300009011 | Bacteria | 3336 |
| 70 | Ga0105251_10028781 | 3300009011 | Bacteria | 2804 |
| 71 | Ga0105251_10050514 | 3300009011 | Bacteria | 1986 |
| 72 | Ga0105251_10068203 | 3300009011 | Bacteria | 1660 |
| 73 | Ga0105251_10122040 | 3300009011 | Bacteria | 1183 |
| 74 | Ga0105244_10000248 | 3300009036 | Bacteria | 55384 |
| 75 | Ga0105244_10001261 | 3300009036 | Bacteria | 20750 |
| 76 | Ga0105244_10009784 | 3300009036 | Bacteria | 5857 |
| 77 | Ga0105244_10012090 | 3300009036 | Bacteria | 5127 |
| 78 | Ga0105244_10020378 | 3300009036 | Bacteria | 3686 |
| 79 | Ga0105244_10026295 | 3300009036 | Bacteria | 3151 |
| 80 | Ga0105244_10043759 | 3300009036 | Bacteria | 2308 |
| 81 | Ga0105244_10079305 | 3300009036 | Bacteria | 1627 |
| 82 | Ga0105250_10000232 | 3300009092 | Bacteria | 46504 |
| 83 | Ga0105250_10001490 | 3300009092 | Bacteria | 12642 |
| 84 | Ga0105250_10001860 | 3300009092 | Bacteria | 10989 |
| 85 | Ga0105250_10016458 | 3300009092 | Bacteria | 3012 |
| 86 | Ga0105250_10023495 | 3300009092 | Bacteria | 2484 |
| 87 | Ga0105250_10050018 | 3300009092 | Bacteria | 1677 |
| 88 | Ga0105243_10001441 | 3300009148 | Bacteria | 20939 |
| 89 | Ga0105243_10002007 | 3300009148 | Bacteria | 17310 |
| 90 | Ga0105243_10053799 | 3300009148 | Bacteria | 3194 |
| 91 | Ga0105243_10200929 | 3300009148 | Bacteria | 1748 |
| 92 | Ga0105242_10002563 | 3300009176 | Bacteria | 14245 |
| 93 | Ga0105237_10002926 | 3300009545 | Bacteria | 20681 |
| 94 | Ga0105249_10098399 | 3300009553 | Bacteria | 2747 |
| 95 | Ga0099796_10102136 | 3300010159 | Bacteria | 1080 |
| 96 | Ga0105246_10001555 | 3300011119 | Bacteria | 13637 |
| 97 | Ga0105246_10015749 | 3300011119 | Bacteria | 4780 |
| 98 | Ga0105246_10023510 | 3300011119 | Bacteria | 3989 |
| 99 | Ga0105246_10055583 | 3300011119 | Bacteria | 2732 |
| 100 | Ga0157345_1000292 | 3300012498 | Bacteria | 6601 |
| 101 | Ga0157373_10002707 | 3300013100 | Bacteria | 13428 |
| 102 | Ga0157373_10013017 | 3300013100 | Bacteria | 6105 |
| 103 | Ga0157373_10014185 | 3300013100 | Bacteria | 5844 |
| 104 | Ga0157373_10111685 | 3300013100 | Bacteria | 1921 |
| 105 | Ga0157373_10140465 | 3300013100 | Bacteria | 1698 |
| 106 | Ga0157371_10003281 | 3300013102 | Bacteria | 14813 |
| 107 | Ga0157371_10004368 | 3300013102 | Bacteria | 12370 |
| 108 | Ga0157371_10014445 | 3300013102 | Bacteria | 5958 |
| 109 | Ga0157371_10137678 | 3300013102 | Bacteria | 1739 |
| 110 | Ga0157370_10000162 | 3300013104 | Bacteria | 81640 |
| 111 | Ga0157370_10031069 | 3300013104 | Bacteria | 5228 |
| 112 | Ga0157370_10043496 | 3300013104 | Bacteria | 4322 |
| 113 | Ga0157370_10085672 | 3300013104 | Bacteria | 2960 |
| 114 | Ga0157370_10109001 | 3300013104 | Bacteria | 2589 |
| 115 | Ga0157370_10183943 | 3300013104 | Bacteria | 1941 |
| 116 | Ga0157370_10192611 | 3300013104 | Bacteria | 1892 |
| 117 | Ga0157369_10024884 | 3300013105 | Bacteria | 6652 |
| 118 | Ga0157369_10030369 | 3300013105 | Bacteria | 5960 |
| 119 | Ga0157369_10032322 | 3300013105 | Bacteria | 5756 |
| 120 | Ga0157369_10086755 | 3300013105 | Bacteria | 3342 |
| 121 | Ga0163162_10009884 | 3300013306 | Bacteria | 9280 |
| 122 | Ga0163162_10286440 | 3300013306 | Bacteria | 1779 |
| 123 | Ga0157372_10086657 | 3300013307 | Bacteria | 3553 |
| 124 | Ga0157375_10097473 | 3300013308 | Bacteria | 3015 |
| 125 | Ga0157375_10766014 | 3300013308 | Bacteria | 1116 |
| 126 | Ga0182008_10005686 | 3300014497 | Bacteria | 7062 |
| 127 | Ga0182008_10011957 | 3300014497 | Bacteria | 4600 |
| 128 | Ga0182008_10021333 | 3300014497 | Bacteria | 3326 |
| 129 | Ga0182008_10021424 | 3300014497 | Bacteria | 3318 |
| 130 | Ga0182008_10041281 | 3300014497 | Bacteria | 2301 |
| 131 | Ga0182006_1001230 | 3300015261 | Bacteria | 15900 |
| 132 | Ga0182006_1002590 | 3300015261 | Bacteria | 9781 |
| 133 | Ga0182006_1008846 | 3300015261 | Bacteria | 4547 |
| 134 | Ga0182006_1021402 | 3300015261 | Bacteria | 2697 |
| 135 | Ga0182006_1023158 | 3300015261 | Bacteria | 2573 |
| 136 | Ga0182006_1026917 | 3300015261 | Bacteria | 2351 |
| 137 | Ga0182006_1056635 | 3300015261 | Bacteria | 1493 |
| 138 | Ga0182006_1070478 | 3300015261 | Bacteria | 1297 |
| 139 | Ga0182007_10001571 | 3300015262 | Bacteria | 12179 |
| 140 | Ga0182007_10021435 | 3300015262 | Bacteria | 2295 |
| 141 | Ga0182005_1004406 | 3300015265 | Bacteria | 4558 |
| 142 | Ga0182005_1005003 | 3300015265 | Bacteria | 4191 |
| 143 | Ga0182005_1017950 | 3300015265 | Bacteria | 1957 |
| 144 | Ga0182005_1022377 | 3300015265 | Bacteria | 1732 |
| 145 | Ga0182005_1022935 | 3300015265 | Bacteria | 1708 |
| 146 | Ga0182005_1023813 | 3300015265 | Bacteria | 1672 |
| 147 | Ga0163161_10012776 | 3300017792 | Bacteria | 5832 |
| 148 | Ga0209760_100011 | 3300025207 | Bacteria | 197221 |
| 149 | Ga0209760_100064 | 3300025207 | Bacteria | 91180 |
| 150 | Ga0209784_100026 | 3300025224 | Bacteria | 371540 |
| 151 | Ga0209566_102356 | 3300025225 | Bacteria | 3594 |
| 152 | Ga0209672_102246 | 3300025228 | Bacteria | 4977 |
| 153 | Ga0209563_100694 | 3300025230 | Bacteria | 10611 |
| 154 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 155 | Ga0207427_100023 | 3300025231 | Bacteria | 439725 |
| 156 | Ga0207427_100082 | 3300025231 | Bacteria | 142809 |
| 157 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 158 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 159 | Ga0209437_100069 | 3300025233 | Bacteria | 307733 |
| 160 | Ga0209437_100245 | 3300025233 | Bacteria | 88331 |
| 161 | Ga0209258_100059 | 3300025242 | Bacteria | 324934 |
| 162 | Ga0209258_101045 | 3300025242 | Bacteria | 12271 |
| 163 | Ga0209258_101292 | 3300025242 | Bacteria | 9314 |
| 164 | Ga0209646_1001047 | 3300025246 | Bacteria | 8338 |
| 165 | Ga0209026_1000036 | 3300025250 | Bacteria | 296607 |
| 166 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 167 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 168 | Ga0209759_1000023 | 3300025256 | Bacteria | 321695 |
| 169 | Ga0209759_1002192 | 3300025256 | Bacteria | 8942 |
| 170 | Ga0209759_1021902 | 3300025256 | Bacteria | 1442 |
| 171 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 172 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 173 | Ga0209233_1000105 | 3300025261 | Bacteria | 272035 |
| 174 | Ga0209455_1000020 | 3300025272 | Bacteria | 702259 |
| 175 | Ga0209130_1022753 | 3300025284 | Bacteria | 1392 |
| 176 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 177 | Ga0209676_1000369 | 3300025292 | Bacteria | 83704 |
| 178 | Ga0209676_1001140 | 3300025292 | Bacteria | 29053 |
| 179 | Ga0209676_1003514 | 3300025292 | Bacteria | 9576 |
| 180 | Ga0209676_1004051 | 3300025292 | Bacteria | 8429 |
| 181 | Ga0209050_1000070 | 3300025298 | Bacteria | 296366 |
| 182 | Ga0209050_1000235 | 3300025298 | Bacteria | 121420 |
| 183 | Ga0209050_1000380 | 3300025298 | Bacteria | 83704 |
| 184 | Ga0209050_1001241 | 3300025298 | Bacteria | 29500 |
| 185 | Ga0209051_1000086 | 3300025303 | Bacteria | 183550 |
| 186 | Ga0209051_1000123 | 3300025303 | Bacteria | 144298 |
| 187 | Ga0209051_1001064 | 3300025303 | Bacteria | 25530 |
| 188 | Ga0209051_1036421 | 3300025303 | Bacteria | 1817 |
| 189 | Ga0209051_1051857 | 3300025303 | Bacteria | 1361 |
| 190 | Ga0209257_1000421 | 3300025304 | Bacteria | 81748 |
| 191 | Ga0209257_1010774 | 3300025304 | Bacteria | 4545 |
| 192 | Ga0207656_10000094 | 3300025321 | Bacteria | 33269 |
| 193 | Ga0207696_1000025 | 3300025711 | Bacteria | 418650 |
| 194 | Ga0207696_1000161 | 3300025711 | Bacteria | 109070 |
| 195 | Ga0207696_1000399 | 3300025711 | Bacteria | 40570 |
| 196 | Ga0207696_1002704 | 3300025711 | Bacteria | 8488 |
| 197 | Ga0207696_1004662 | 3300025711 | Bacteria | 5860 |
| 198 | Ga0207696_1010679 | 3300025711 | Bacteria | 3352 |
| 199 | Ga0207655_1000113 | 3300025728 | Bacteria | 167376 |
| 200 | Ga0207655_1000269 | 3300025728 | Bacteria | 81483 |
| 201 | Ga0207655_1000976 | 3300025728 | Bacteria | 29345 |
| 202 | Ga0207655_1002157 | 3300025728 | Bacteria | 16397 |
| 203 | Ga0207655_1003563 | 3300025728 | Bacteria | 11530 |
| 204 | Ga0207655_1004512 | 3300025728 | Bacteria | 9847 |
| 205 | Ga0207655_1011189 | 3300025728 | Bacteria | 5363 |
| 206 | Ga0207655_1016647 | 3300025728 | Bacteria | 4010 |
| 207 | Ga0207655_1065760 | 3300025728 | Bacteria | 1374 |
| 208 | Ga0207713_1000102 | 3300025735 | Bacteria | 139512 |
| 209 | Ga0207713_1000344 | 3300025735 | Bacteria | 50995 |
| 210 | Ga0207713_1001819 | 3300025735 | Bacteria | 16288 |
| 211 | Ga0207713_1002656 | 3300025735 | Bacteria | 12830 |
| 212 | Ga0207713_1003166 | 3300025735 | Bacteria | 11392 |
| 213 | Ga0207713_1005358 | 3300025735 | Bacteria | 8054 |
| 214 | Ga0207713_1006303 | 3300025735 | Bacteria | 7248 |
| 215 | Ga0207713_1006787 | 3300025735 | Bacteria | 6908 |
| 216 | Ga0207713_1021584 | 3300025735 | Bacteria | 3082 |
| 217 | Ga0207713_1035118 | 3300025735 | Bacteria | 2167 |
| 218 | Ga0207684_10407806 | 3300025910 | Bacteria | 1168 |
| 219 | Ga0207671_10001551 | 3300025914 | Bacteria | 26296 |
| 220 | Ga0207649_10000061 | 3300025920 | Bacteria | 98067 |
| 221 | Ga0207681_10013490 | 3300025923 | Bacteria | 5058 |
| 222 | Ga0207650_10000419 | 3300025925 | Bacteria | 37719 |
| 223 | Ga0207650_10001683 | 3300025925 | Bacteria | 15718 |
| 224 | Ga0207706_10000668 | 3300025933 | Bacteria | 36073 |
| 225 | Ga0207686_10002078 | 3300025934 | Bacteria | 11029 |
| 226 | Ga0207709_10000223 | 3300025935 | Bacteria | 71537 |
| 227 | Ga0207709_10000835 | 3300025935 | Bacteria | 23621 |
| 228 | Ga0207709_10030251 | 3300025935 | Bacteria | 3148 |
| 229 | Ga0207709_10049445 | 3300025935 | Bacteria | 2567 |
| 230 | Ga0207679_10000018 | 3300025945 | Bacteria | 238375 |
| 231 | Ga0207640_10018613 | 3300025981 | Bacteria | 4085 |
| 232 | Ga0207639_10016158 | 3300026041 | Bacteria | 5273 |
| 233 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 234 | Ga0209281_1000331 | 3300027111 | Bacteria | 81645 |
| 235 | Ga0209281_1002825 | 3300027111 | Bacteria | 6375 |
| 236 | Ga0209371_1000365 | 3300027312 | Bacteria | 48737 |
| 237 | Ga0207428_10021464 | 3300027907 | Bacteria | 5468 |
| 238 | Ga0207428_10026590 | 3300027907 | Bacteria | 4829 |
| 239 | Ga0207428_10105296 | 3300027907 | Bacteria | 2176 |
| 240 | Ga0207428_10133142 | 3300027907 | Bacteria | 1902 |
| 241 | Ga0207428_10242544 | 3300027907 | Bacteria | 1346 |
| 242 | Ga0268256_1000236 | 3300030500 | Bacteria | 57974 |
| 243 | Ga0314311_1137078 | 3300030733 | Bacteria | 2096 |
| 244 | Ga0316178_1174406 | 3300030735 | Bacteria | 18287 |
| 245 | Ga0307408_100000025 | 3300031548 | Bacteria | 267563 |
| 246 | Ga0307408_100036272 | 3300031548 | Bacteria | 3465 |
| 247 | Ga0307408_100144895 | 3300031548 | Bacteria | 1868 |
| 248 | Ga0307516_10194648 | 3300031730 | Bacteria | 1751 |
| 249 | Ga0307405_10040867 | 3300031731 | Bacteria | 2811 |
| 250 | Ga0307412_10115724 | 3300031911 | Bacteria | 1922 |
| 251 | Ga0307412_10325564 | 3300031911 | Bacteria | 1224 |
| 252 | Ga0307409_100026395 | 3300031995 | Bacteria | 4095 |
| 253 | Ga0307414_10062721 | 3300032004 | Bacteria | 2639 |
| 254 | Ga0307414_10096469 | 3300032004 | Bacteria | 2212 |
| 255 | Ga0373927_0179601 | 3300035695 | Bacteria | 1388 |
| 256 | Ga0395899_0022460 | 3300037312 | Bacteria | 4784 |
| 257 | Ga0395900_0054481 | 3300037418 | Bacteria | 4118 |
| 258 | Ga0395898_0026985 | 3300037466 | Bacteria | 5770 |
| 259 | Ga0237819_00881 | 3300038705 | Bacteria | 9379 |
| 260 | Ga0400483_011826 | 3300039062 | Bacteria | 13740 |
| 261 | Ga0400483_279756 | 3300039062 | Bacteria | 11311 |
| 262 | Ga0436363_0138769 | 3300039450 | Bacteria | 1887 |
| 263 | Ga0439436_0016475 | 3300041404 | Bacteria | 2216 |
| 264 | Ga0439438_002391 | 3300041405 | Bacteria | 7994 |
| 265 | Ga0439438_005853 | 3300041405 | Bacteria | 4454 |
| 266 | Ga0439438_010670 | 3300041405 | Bacteria | 2893 |
| 267 | Ga0439438_025483 | 3300041405 | Bacteria | 1611 |
| 268 | Ga0439447_001809 | 3300041407 | Bacteria | 7835 |
| 269 | Ga0439447_006010 | 3300041407 | Bacteria | 3982 |
| 270 | Ga0439447_010708 | 3300041407 | Bacteria | 2709 |
| 271 | Ga0439447_029585 | 3300041407 | Bacteria | 1385 |
| 272 | Ga0439447_033238 | 3300041407 | Bacteria | 1286 |
| 273 | Ga0439466_0004608 | 3300041411 | Bacteria | 5298 |
| 274 | Ga0439466_0009682 | 3300041411 | Bacteria | 3597 |
| 275 | Ga0439466_0014226 | 3300041411 | Bacteria | 2900 |
| 276 | Ga0439466_0017268 | 3300041411 | Bacteria | 2601 |
| 277 | Ga0439466_0024300 | 3300041411 | Bacteria | 2125 |
| 278 | Ga0439431_0004367 | 3300041997 | Bacteria | 3106 |
| 279 | Ga0439437_000520 | 3300042000 | Bacteria | 3822 |
| 280 | Ga0439443_002718 | 3300042003 | Bacteria | 2149 |
| 281 | Ga0439432_002368 | 3300042006 | Bacteria | 7116 |
| 282 | Ga0439432_007415 | 3300042006 | Bacteria | 3888 |
| 283 | Ga0439432_018956 | 3300042006 | Bacteria | 2295 |
| 284 | Ga0439432_021257 | 3300042006 | Bacteria | 2153 |
| 285 | Ga0439432_031308 | 3300042006 | Bacteria | 1721 |
| 286 | Ga0439452_000667 | 3300042010 | Bacteria | 16915 |
| 287 | Ga0439452_011937 | 3300042010 | Bacteria | 2484 |
| 288 | Ga0439452_016034 | 3300042010 | Bacteria | 2041 |
| 289 | Ga0439452_018731 | 3300042010 | Bacteria | 1840 |
| 290 | Ga0439452_034005 | 3300042010 | Bacteria | 1234 |
| 291 | Ga0439456_000315 | 3300042013 | Bacteria | 11172 |
| 292 | Ga0439456_012132 | 3300042013 | Bacteria | 1786 |
| 293 | Ga0439456_014249 | 3300042013 | Bacteria | 1657 |
| 294 | Ga0439463_001299 | 3300042016 | Bacteria | 6640 |
| 295 | Ga0439463_003312 | 3300042016 | Bacteria | 4083 |
| 296 | Ga0450911_000017 | 3300042115 | Bacteria | 104823 |
| 297 | Ga0450911_002369 | 3300042115 | Bacteria | 3754 |
| 298 | Ga0450911_008410 | 3300042115 | Bacteria | 1471 |
| 299 | Ga0450913_001977 | 3300042117 | Bacteria | 1209 |
| 300 | Ga0450902_008097 | 3300042137 | Bacteria | 1636 |
| 301 | Ga0450903_005766 | 3300042138 | Bacteria | 2067 |
| 302 | Ga0450904_000166 | 3300042139 | Bacteria | 14541 |
| 303 | Ga0450904_002326 | 3300042139 | Bacteria | 2297 |
| 304 | Ga0450904_005246 | 3300042139 | Bacteria | 1319 |
| 305 | Ga0450906_004046 | 3300042145 | Bacteria | 3101 |
| 306 | Ga0450907_000439 | 3300042146 | Bacteria | 12184 |
| 307 | Ga0450910_000985 | 3300042147 | Bacteria | 3450 |
| 308 | Ga0439446_0000026 | 3300042156 | Bacteria | 25155 |
| 309 | Ga0439446_0059653 | 3300042156 | Bacteria | 1151 |
| 310 | Ga0439434_0009636 | 3300042435 | Bacteria | 2842 |
| 311 | Ga0439434_0044252 | 3300042435 | Bacteria | 1371 |
| 312 | Ga0439459_0000879 | 3300042438 | Bacteria | 4200 |
| 313 | Ga0439464_0006527 | 3300042439 | Bacteria | 3041 |
| 314 | Ga0439464_0018885 | 3300042439 | Bacteria | 1878 |
| 315 | Ga0439460_0001955 | 3300042461 | Bacteria | 4930 |
| 316 | Ga0450916_000791 | 3300042530 | Bacteria | 2949 |
| 317 | Ga0450893_0001272 | 3300042532 | Bacteria | 3813 |
| 318 | Ga0451577_0033401 | 3300042876 | Bacteria | 4638 |
| 319 | Ga0439440_0002330 | 3300042993 | Bacteria | 3572 |
| 320 | Ga0439440_0043154 | 3300042993 | Bacteria | 1105 |
| 321 | Ga0495617_009670 | 3300046452 | Bacteria | 3307 |
| 322 | Ga0495617_009807 | 3300046452 | Bacteria | 3284 |
| 323 | Ga0495627_000040 | 3300046453 | Bacteria | 195248 |
| 324 | Ga0495627_001207 | 3300046453 | Bacteria | 16248 |
| 325 | Ga0495627_002117 | 3300046453 | Bacteria | 10035 |
| 326 | Ga0495627_009066 | 3300046453 | Bacteria | 3676 |
| 327 | Ga0495627_014002 | 3300046453 | Bacteria | 2811 |
| 328 | Ga0495627_028094 | 3300046453 | Bacteria | 1799 |
| 329 | Ga0495603_0017243 | 3300046455 | Bacteria | 4371 |
| 330 | Ga0495590_0005676 | 3300046457 | Bacteria | 4909 |
| 331 | Ga0495590_0009911 | 3300046457 | Bacteria | 3602 |
| 332 | Ga0495590_0025595 | 3300046457 | Bacteria | 2074 |
| 333 | Ga0495590_0037316 | 3300046457 | Bacteria | 1694 |
| 334 | Ga0495591_000023 | 3300046458 | Bacteria | 191598 |
| 335 | Ga0495591_001720 | 3300046458 | Bacteria | 13044 |
| 336 | Ga0495591_002767 | 3300046458 | Bacteria | 9469 |
| 337 | Ga0495591_007086 | 3300046458 | Bacteria | 4828 |
| 338 | Ga0495591_008921 | 3300046458 | Bacteria | 4043 |
| 339 | Ga0495591_016013 | 3300046458 | Bacteria | 2627 |
| 340 | Ga0495638_0023429 | 3300046460 | Bacteria | 4038 |
| 341 | Ga0495638_0026283 | 3300046460 | Bacteria | 3773 |
| 342 | Ga0495638_0044887 | 3300046460 | Bacteria | 2782 |
| 343 | Ga0495638_0095137 | 3300046460 | Bacteria | 1789 |
| 344 | Ga0495638_0101843 | 3300046460 | Bacteria | 1716 |
| 345 | Ga0495638_0117272 | 3300046460 | Bacteria | 1576 |
| 346 | Ga0495638_0222737 | 3300046460 | Bacteria | 1053 |
| 347 | Ga0495653_0001688 | 3300046463 | Bacteria | 17382 |
| 348 | Ga0495653_0075011 | 3300046463 | Bacteria | 2518 |
| 349 | Ga0495653_0109414 | 3300046463 | Bacteria | 1988 |
| 350 | Ga0495653_0153470 | 3300046463 | Bacteria | 1606 |
| 351 | Ga0495650_0001179 | 3300046471 | Bacteria | 27791 |
| 352 | Ga0495650_0021310 | 3300046471 | Bacteria | 3136 |
| 353 | Ga0495650_0023543 | 3300046471 | Bacteria | 2929 |
| 354 | Ga0495650_0024731 | 3300046471 | Bacteria | 2831 |
| 355 | Ga0495650_0036242 | 3300046471 | Bacteria | 2160 |
| 356 | Ga0495650_0040558 | 3300046471 | Bacteria | 1997 |
| 357 | Ga0495650_0096008 | 3300046471 | Bacteria | 1119 |
| 358 | Ga0495605_0000048 | 3300046474 | Bacteria | 170182 |
| 359 | Ga0495605_0000094 | 3300046474 | Bacteria | 112717 |
| 360 | Ga0495605_0001067 | 3300046474 | Bacteria | 18295 |
| 361 | Ga0495605_0002988 | 3300046474 | Bacteria | 10219 |
| 362 | Ga0495605_0005577 | 3300046474 | Bacteria | 7318 |
| 363 | Ga0495605_0019091 | 3300046474 | Bacteria | 3668 |
| 364 | Ga0495605_0027745 | 3300046474 | Bacteria | 2930 |
| 365 | Ga0495605_0030595 | 3300046474 | Bacteria | 2758 |
| 366 | Ga0495605_0047399 | 3300046474 | Bacteria | 2108 |
| 367 | Ga0495605_0082438 | 3300046474 | Bacteria | 1502 |
| 368 | Ga0495639_0014215 | 3300046475 | Bacteria | 3444 |
| 369 | Ga0495584_0019852 | 3300046491 | Bacteria | 3414 |
| 370 | Ga0495584_0038569 | 3300046491 | Bacteria | 2414 |
| 371 | Ga0495584_0058589 | 3300046491 | Bacteria | 1937 |
| 372 | Ga0495584_0150297 | 3300046491 | Bacteria | 1183 |
| 373 | Ga0495585_0028644 | 3300046492 | Bacteria | 3175 |
| 374 | Ga0495585_0033388 | 3300046492 | Bacteria | 2912 |
| 375 | Ga0495585_0038594 | 3300046492 | Bacteria | 2687 |
| 376 | Ga0495585_0053125 | 3300046492 | Bacteria | 2242 |
| 377 | Ga0495585_0105470 | 3300046492 | Bacteria | 1503 |
| 378 | Ga0495596_0001228 | 3300046500 | Bacteria | 14950 |
| 379 | Ga0495596_0002112 | 3300046500 | Bacteria | 10892 |
| 380 | Ga0495596_0063070 | 3300046500 | Bacteria | 1441 |
| 381 | Ga0495607_0000893 | 3300046501 | Bacteria | 27775 |
| 382 | Ga0495607_0000972 | 3300046501 | Bacteria | 26545 |
| 383 | Ga0495607_0001113 | 3300046501 | Bacteria | 24369 |
| 384 | Ga0495607_0001564 | 3300046501 | Bacteria | 20007 |
| 385 | Ga0495607_0007321 | 3300046501 | Bacteria | 7651 |
| 386 | Ga0495607_0009646 | 3300046501 | Bacteria | 6523 |
| 387 | Ga0495607_0011176 | 3300046501 | Bacteria | 5993 |
| 388 | Ga0495607_0016917 | 3300046501 | Bacteria | 4694 |
| 389 | Ga0495607_0019252 | 3300046501 | Bacteria | 4338 |
| 390 | Ga0495607_0021308 | 3300046501 | Bacteria | 4080 |
| 391 | Ga0495607_0039860 | 3300046501 | Bacteria | 2802 |
| 392 | Ga0495607_0042425 | 3300046501 | Bacteria | 2696 |
| 393 | Ga0495607_0064024 | 3300046501 | Bacteria | 2078 |
| 394 | Ga0495607_0084220 | 3300046501 | Bacteria | 1740 |
| 395 | Ga0495607_0087591 | 3300046501 | Bacteria | 1694 |
| 396 | Ga0495607_0096301 | 3300046501 | Bacteria | 1593 |
| 397 | Ga0495607_0172485 | 3300046501 | Bacteria | 1091 |
| 398 | Ga0495607_0191470 | 3300046501 | Bacteria | 1018 |
| 399 | Ga0495583_0000096 | 3300046506 | Bacteria | 151090 |
| 400 | Ga0495583_0002375 | 3300046506 | Bacteria | 16249 |
| 401 | Ga0495583_0004233 | 3300046506 | Bacteria | 10418 |
| 402 | Ga0495583_0004686 | 3300046506 | Bacteria | 9632 |
| 403 | Ga0495583_0004830 | 3300046506 | Bacteria | 9432 |
| 404 | Ga0495583_0008065 | 3300046506 | Bacteria | 6494 |
| 405 | Ga0495583_0023222 | 3300046506 | Bacteria | 3142 |
| 406 | Ga0495583_0031157 | 3300046506 | Bacteria | 2588 |
| 407 | Ga0495606_0000076 | 3300046507 | Bacteria | 166969 |
| 408 | Ga0495606_0000167 | 3300046507 | Bacteria | 115739 |
| 409 | Ga0495606_0000608 | 3300046507 | Bacteria | 56665 |
| 410 | Ga0495606_0003110 | 3300046507 | Bacteria | 18033 |
| 411 | Ga0495606_0003580 | 3300046507 | Bacteria | 16376 |
| 412 | Ga0495606_0003873 | 3300046507 | Bacteria | 15447 |
| 413 | Ga0495606_0020781 | 3300046507 | Bacteria | 4826 |
| 414 | Ga0495606_0029098 | 3300046507 | Bacteria | 3885 |
| 415 | Ga0495606_0031245 | 3300046507 | Bacteria | 3705 |
| 416 | Ga0495606_0035413 | 3300046507 | Bacteria | 3411 |
| 417 | Ga0495606_0044791 | 3300046507 | Bacteria | 2939 |
| 418 | Ga0495606_0060369 | 3300046507 | Bacteria | 2428 |
| 419 | Ga0495606_0071520 | 3300046507 | Bacteria | 2183 |
| 420 | Ga0495606_0105579 | 3300046507 | Bacteria | 1707 |
| 421 | Ga0495610_0003673 | 3300046512 | Bacteria | 11795 |
| 422 | Ga0495610_0029882 | 3300046512 | Bacteria | 2862 |
| 423 | Ga0495610_0034875 | 3300046512 | Bacteria | 2587 |
| 424 | Ga0495610_0042094 | 3300046512 | Bacteria | 2287 |
| 425 | Ga0495610_0042670 | 3300046512 | Bacteria | 2266 |
| 426 | Ga0495610_0045081 | 3300046512 | Bacteria | 2183 |
| 427 | Ga0495616_0001347 | 3300046513 | Bacteria | 17142 |
| 428 | Ga0495616_0010197 | 3300046513 | Bacteria | 5451 |
| 429 | Ga0495616_0014233 | 3300046513 | Bacteria | 4461 |
| 430 | Ga0495616_0026394 | 3300046513 | Bacteria | 3092 |
| 431 | Ga0495616_0043632 | 3300046513 | Bacteria | 2277 |
| 432 | Ga0495616_0044749 | 3300046513 | Bacteria | 2244 |
| 433 | Ga0495616_0055653 | 3300046513 | Bacteria | 1957 |
| 434 | Ga0495616_0056399 | 3300046513 | Bacteria | 1940 |
| 435 | Ga0495616_0106807 | 3300046513 | Bacteria | 1305 |
| 436 | Ga0495620_0000001 | 3300046515 | Bacteria | 386508 |
| 437 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 438 | Ga0495620_0000736 | 3300046515 | Bacteria | 20171 |
| 439 | Ga0495620_0001383 | 3300046515 | Bacteria | 14599 |
| 440 | Ga0495620_0010185 | 3300046515 | Bacteria | 4966 |
| 441 | Ga0495620_0020358 | 3300046515 | Bacteria | 3241 |
| 442 | Ga0495620_0022320 | 3300046515 | Bacteria | 3050 |
| 443 | Ga0495620_0068247 | 3300046515 | Bacteria | 1460 |
| 444 | Ga0495620_0071961 | 3300046515 | Bacteria | 1412 |
| 445 | Ga0495620_0077028 | 3300046515 | Bacteria | 1354 |
| 446 | Ga0495631_0000361 | 3300046518 | Bacteria | 31358 |
| 447 | Ga0495631_0011216 | 3300046518 | Bacteria | 4413 |
| 448 | Ga0495631_0013811 | 3300046518 | Bacteria | 3911 |
| 449 | Ga0495631_0037631 | 3300046518 | Bacteria | 2154 |
| 450 | Ga0495631_0041744 | 3300046518 | Bacteria | 2029 |
| 451 | Ga0495632_0001293 | 3300046519 | Bacteria | 21160 |
| 452 | Ga0495632_0009098 | 3300046519 | Bacteria | 6011 |
| 453 | Ga0495632_0018573 | 3300046519 | Bacteria | 3812 |
| 454 | Ga0495632_0026907 | 3300046519 | Bacteria | 3019 |
| 455 | Ga0495632_0027921 | 3300046519 | Bacteria | 2949 |
| 456 | Ga0495632_0032968 | 3300046519 | Bacteria | 2663 |
| 457 | Ga0495632_0048392 | 3300046519 | Bacteria | 2105 |
| 458 | Ga0495632_0055072 | 3300046519 | Bacteria | 1948 |
| 459 | Ga0495632_0060055 | 3300046519 | Bacteria | 1848 |
| 460 | Ga0495632_0068125 | 3300046519 | Bacteria | 1715 |
| 461 | Ga0495632_0071228 | 3300046519 | Bacteria | 1670 |
| 462 | Ga0495632_0106812 | 3300046519 | Bacteria | 1316 |
| 463 | Ga0495632_0117266 | 3300046519 | Bacteria | 1246 |
| 464 | Ga0495637_0000583 | 3300046520 | Bacteria | 25971 |
| 465 | Ga0495637_0006191 | 3300046520 | Bacteria | 6021 |
| 466 | Ga0495637_0008837 | 3300046520 | Bacteria | 4932 |
| 467 | Ga0495637_0009658 | 3300046520 | Bacteria | 4700 |
| 468 | Ga0495637_0010701 | 3300046520 | Bacteria | 4427 |
| 469 | Ga0495637_0019602 | 3300046520 | Bacteria | 3125 |
| 470 | Ga0495637_0023730 | 3300046520 | Bacteria | 2781 |
| 471 | Ga0495637_0027828 | 3300046520 | Bacteria | 2525 |
| 472 | Ga0495637_0034806 | 3300046520 | Bacteria | 2203 |
| 473 | Ga0495637_0042478 | 3300046520 | Bacteria | 1944 |
| 474 | Ga0495637_0051564 | 3300046520 | Bacteria | 1721 |
| 475 | Ga0495637_0064442 | 3300046520 | Bacteria | 1494 |
| 476 | Ga0495637_0117289 | 3300046520 | Bacteria | 1027 |
| 477 | Ga0495643_0000673 | 3300046522 | Bacteria | 40197 |
| 478 | Ga0495643_0000785 | 3300046522 | Bacteria | 35224 |
| 479 | Ga0495643_0011714 | 3300046522 | Bacteria | 5324 |
| 480 | Ga0495643_0034692 | 3300046522 | Bacteria | 2783 |
| 481 | Ga0495643_0070369 | 3300046522 | Bacteria | 1837 |
| 482 | Ga0495643_0140461 | 3300046522 | Bacteria | 1205 |
| 483 | Ga0495643_0169472 | 3300046522 | Bacteria | 1068 |
| 484 | Ga0495644_0005422 | 3300046523 | Bacteria | 4981 |
| 485 | Ga0495644_0016173 | 3300046523 | Bacteria | 2857 |
| 486 | Ga0495644_0020076 | 3300046523 | Bacteria | 2549 |
| 487 | Ga0495644_0027817 | 3300046523 | Bacteria | 2141 |
| 488 | Ga0495648_0008068 | 3300046524 | Bacteria | 8328 |
| 489 | Ga0495648_0008743 | 3300046524 | Bacteria | 7930 |
| 490 | Ga0495648_0019177 | 3300046524 | Bacteria | 4819 |
| 491 | Ga0495648_0029004 | 3300046524 | Bacteria | 3678 |
| 492 | Ga0495648_0030511 | 3300046524 | Bacteria | 3563 |
| 493 | Ga0495648_0041982 | 3300046524 | Bacteria | 2882 |
| 494 | Ga0495648_0067821 | 3300046524 | Bacteria | 2084 |
| 495 | Ga0495648_0078373 | 3300046524 | Bacteria | 1889 |
| 496 | Ga0495648_0078685 | 3300046524 | Bacteria | 1884 |
| 497 | Ga0495648_0083334 | 3300046524 | Bacteria | 1812 |
| 498 | Ga0495648_0126020 | 3300046524 | Bacteria | 1368 |
| 499 | Ga0495648_0198136 | 3300046524 | Bacteria | 1007 |
| 500 | Ga0495666_0019899 | 3300046526 | Bacteria | 3329 |
| 501 | Ga0495666_0119399 | 3300046526 | Bacteria | 1235 |
| 502 | Ga0495642_0001507 | 3300046528 | Bacteria | 10362 |
| 503 | Ga0495642_0009207 | 3300046528 | Bacteria | 3780 |
| 504 | Ga0495654_0001014 | 3300046530 | Bacteria | 20561 |
| 505 | Ga0495654_0001425 | 3300046530 | Bacteria | 16486 |
| 506 | Ga0495654_0003292 | 3300046530 | Bacteria | 9954 |
| 507 | Ga0495654_0004160 | 3300046530 | Bacteria | 8670 |
| 508 | Ga0495654_0015896 | 3300046530 | Bacteria | 3988 |
| 509 | Ga0495654_0018333 | 3300046530 | Bacteria | 3669 |
| 510 | Ga0495654_0032304 | 3300046530 | Bacteria | 2653 |
| 511 | Ga0495654_0037006 | 3300046530 | Bacteria | 2450 |
| 512 | Ga0495654_0041036 | 3300046530 | Bacteria | 2303 |
| 513 | Ga0495654_0050130 | 3300046530 | Bacteria | 2041 |
| 514 | Ga0495654_0073257 | 3300046530 | Bacteria | 1620 |
| 515 | Ga0495654_0074100 | 3300046530 | Bacteria | 1608 |
| 516 | Ga0495654_0083276 | 3300046530 | Bacteria | 1495 |
| 517 | Ga0495654_0085444 | 3300046530 | Bacteria | 1472 |
| 518 | Ga0495587_0097056 | 3300046536 | Bacteria | 1699 |
| 519 | Ga0495587_0250428 | 3300046536 | Bacteria | 996 |
| 520 | Ga0495609_0000012 | 3300046538 | Bacteria | 333994 |
| 521 | Ga0495609_0000079 | 3300046538 | Bacteria | 118997 |
| 522 | Ga0495609_0000799 | 3300046538 | Bacteria | 23561 |
| 523 | Ga0495609_0020773 | 3300046538 | Bacteria | 3030 |
| 524 | Ga0495609_0024870 | 3300046538 | Bacteria | 2745 |
| 525 | Ga0495609_0109095 | 3300046538 | Bacteria | 1195 |
| 526 | Ga0495597_0000016 | 3300046542 | Bacteria | 167456 |
| 527 | Ga0495597_0009148 | 3300046542 | Bacteria | 4915 |
| 528 | Ga0495597_0015221 | 3300046542 | Bacteria | 3644 |
| 529 | Ga0495597_0018427 | 3300046542 | Bacteria | 3276 |
| 530 | Ga0495597_0072903 | 3300046542 | Bacteria | 1476 |
| 531 | Ga0495597_0085496 | 3300046542 | Bacteria | 1344 |
| 532 | Ga0495622_0015164 | 3300046557 | Bacteria | 3582 |
| 533 | Ga0495622_0016356 | 3300046557 | Bacteria | 3453 |
| 534 | Ga0495633_0000034 | 3300046558 | Bacteria | 185552 |
| 535 | Ga0495633_0017328 | 3300046558 | Bacteria | 3686 |
| 536 | Ga0495633_0024822 | 3300046558 | Bacteria | 2957 |
| 537 | Ga0495633_0096518 | 3300046558 | Bacteria | 1373 |
| 538 | Ga0495668_0002256 | 3300046616 | Bacteria | 16217 |
| 539 | Ga0495668_0023584 | 3300046616 | Bacteria | 3506 |
| 540 | Ga0495668_0026859 | 3300046616 | Bacteria | 3264 |
| 541 | Ga0495668_0027121 | 3300046616 | Bacteria | 3245 |
| 542 | Ga0495668_0027373 | 3300046616 | Bacteria | 3230 |
| 543 | Ga0495668_0225564 | 3300046616 | Bacteria | 1026 |
| 544 | Ga0495634_0043592 | 3300046642 | Bacteria | 3040 |
| 545 | Ga0495611_0002095 | 3300046648 | Bacteria | 9371 |
| 546 | Ga0495611_0003561 | 3300046648 | Bacteria | 6845 |
| 547 | Ga0495611_0004112 | 3300046648 | Bacteria | 6337 |
| 548 | Ga0495611_0040427 | 3300046648 | Bacteria | 2079 |
| 549 | Ga0495625_0000185 | 3300046660 | Bacteria | 97863 |
| 550 | Ga0495625_0074759 | 3300046660 | Bacteria | 2372 |
| 551 | Ga0495625_0096238 | 3300046660 | Bacteria | 2039 |
| 552 | Ga0495625_0099653 | 3300046660 | Bacteria | 1997 |
| 553 | Ga0495625_0104960 | 3300046660 | Bacteria | 1936 |
| 554 | Ga0495625_0112061 | 3300046660 | Bacteria | 1864 |
| 555 | Ga0495625_0115766 | 3300046660 | Bacteria | 1829 |
| 556 | Ga0495635_0038697 | 3300046663 | Bacteria | 3301 |
| 557 | Ga0495659_0006501 | 3300046664 | Bacteria | 3691 |
| 558 | Ga0495659_0010963 | 3300046664 | Bacteria | 2919 |
| 559 | Ga0495661_0000004 | 3300046665 | Bacteria | 555340 |
| 560 | Ga0495661_0000028 | 3300046665 | Bacteria | 182191 |
| 561 | Ga0495661_0000088 | 3300046665 | Bacteria | 111782 |
| 562 | Ga0495661_0000146 | 3300046665 | Bacteria | 82292 |
| 563 | Ga0495661_0006678 | 3300046665 | Bacteria | 8098 |
| 564 | Ga0495661_0007167 | 3300046665 | Bacteria | 7780 |
| 565 | Ga0495661_0007616 | 3300046665 | Bacteria | 7545 |
| 566 | Ga0495661_0033661 | 3300046665 | Bacteria | 3230 |
| 567 | Ga0495661_0051739 | 3300046665 | Bacteria | 2478 |
| 568 | Ga0495661_0064528 | 3300046665 | Bacteria | 2160 |
| 569 | Ga0495661_0113925 | 3300046665 | Bacteria | 1503 |
| 570 | Ga0495623_0042430 | 3300046679 | Bacteria | 2897 |
| 571 | Ga0495669_0016942 | 3300046684 | Bacteria | 3125 |
| 572 | Ga0495613_0145210 | 3300046689 | Bacteria | 1693 |
| 573 | Ga0495624_0087188 | 3300046690 | Bacteria | 1927 |
| 574 | Ga0495670_0009810 | 3300046691 | Bacteria | 4707 |
| 575 | Ga0495670_0011441 | 3300046691 | Bacteria | 4364 |
| 576 | Ga0495670_0093401 | 3300046691 | Bacteria | 1542 |
| 577 | Ga0495670_0183475 | 3300046691 | Bacteria | 1105 |
| 578 | Ga0495671_0007977 | 3300046692 | Bacteria | 5984 |
| 579 | Ga0495671_0022459 | 3300046692 | Bacteria | 3306 |
| 580 | Ga0495671_0026438 | 3300046692 | Bacteria | 3008 |
| 581 | Ga0495671_0026874 | 3300046692 | Bacteria | 2978 |
| 582 | Ga0495671_0033954 | 3300046692 | Bacteria | 2596 |
| 583 | Ga0495671_0058828 | 3300046692 | Bacteria | 1900 |
| 584 | Ga0495671_0059785 | 3300046692 | Bacteria | 1882 |
| 585 | Ga0495671_0070706 | 3300046692 | Bacteria | 1714 |
| 586 | Ga0495671_0072743 | 3300046692 | Bacteria | 1688 |
| 587 | Ga0495649_0000445 | 3300046694 | Bacteria | 35787 |
| 588 | Ga0495649_0000699 | 3300046694 | Bacteria | 27370 |
| 589 | Ga0495649_0001861 | 3300046694 | Bacteria | 15440 |
| 590 | Ga0495649_0018962 | 3300046694 | Bacteria | 3864 |
| 591 | Ga0495649_0034226 | 3300046694 | Bacteria | 2795 |
| 592 | Ga0495649_0041788 | 3300046694 | Bacteria | 2505 |
| 593 | Ga0495649_0047307 | 3300046694 | Bacteria | 2339 |
| 594 | Ga0495649_0049862 | 3300046694 | Bacteria | 2273 |
| 595 | Ga0495649_0055490 | 3300046694 | Bacteria | 2140 |
| 596 | Ga0495649_0083759 | 3300046694 | Bacteria | 1703 |
| 597 | Ga0495649_0085329 | 3300046694 | Bacteria | 1685 |
| 598 | Ga0495649_0089962 | 3300046694 | Bacteria | 1637 |
| 599 | Ga0495649_0103200 | 3300046694 | Bacteria | 1514 |
| 600 | Ga0495589_0002693 | 3300046794 | Bacteria | 9819 |
| 601 | Ga0495589_0022642 | 3300046794 | Bacteria | 3205 |
| 602 | Ga0495589_0032567 | 3300046794 | Bacteria | 2620 |
| 603 | Ga0495589_0050517 | 3300046794 | Bacteria | 2056 |
| 604 | Ga0495600_0074118 | 3300046809 | Bacteria | 2222 |
| 605 | Ga0495600_0104308 | 3300046809 | Bacteria | 1847 |
| 606 | Ga0495660_0003327 | 3300046810 | Bacteria | 9969 |
| 607 | Ga0495660_0006173 | 3300046810 | Bacteria | 7113 |
| 608 | Ga0495660_0020264 | 3300046810 | Bacteria | 3811 |
| 609 | Ga0495660_0032533 | 3300046810 | Bacteria | 2928 |
| 610 | Ga0495660_0039041 | 3300046810 | Bacteria | 2637 |
| 611 | Ga0495660_0071840 | 3300046810 | Bacteria | 1834 |
| 612 | Ga0495660_0079596 | 3300046810 | Bacteria | 1720 |
| 613 | Ga0495660_0091256 | 3300046810 | Bacteria | 1582 |
| 614 | Ga0495660_0098328 | 3300046810 | Bacteria | 1509 |
| 615 | Ga0495660_0159451 | 3300046810 | Bacteria | 1107 |
| 616 | Ga0495604_0074539 | 3300047317 | Bacteria | 2557 |
| 617 | Ga0495604_0163243 | 3300047317 | Bacteria | 1572 |
| 618 | Ga0495672_0001231 | 3300047320 | Bacteria | 25711 |
| 619 | Ga0495672_0023814 | 3300047320 | Bacteria | 3955 |
| 620 | Ga0495672_0026378 | 3300047320 | Bacteria | 3708 |
| 621 | Ga0495672_0028199 | 3300047320 | Bacteria | 3555 |
| 622 | Ga0495672_0033814 | 3300047320 | Bacteria | 3165 |
| 623 | Ga0495672_0035798 | 3300047320 | Bacteria | 3054 |
| 624 | Ga0495672_0045498 | 3300047320 | Bacteria | 2625 |
| 625 | Ga0495672_0054056 | 3300047320 | Bacteria | 2349 |
| 626 | Ga0495672_0060894 | 3300047320 | Bacteria | 2177 |
| 627 | Ga0495672_0065070 | 3300047320 | Bacteria | 2085 |
| 628 | Ga0495672_0084549 | 3300047320 | Bacteria | 1759 |
| 629 | Ga0495676_0000160 | 3300047321 | Bacteria | 51908 |
| 630 | Ga0495676_0064969 | 3300047321 | Bacteria | 2834 |
| 631 | Ga0495676_0295111 | 3300047321 | Bacteria | 1094 |
| 632 | Ga0495680_0059649 | 3300047322 | Bacteria | 2944 |
| 633 | Ga0495680_0139795 | 3300047322 | Bacteria | 1772 |
| 634 | Ga0495680_0302553 | 3300047322 | Bacteria | 1122 |
| 635 | Ga0495683_0000034 | 3300047323 | Bacteria | 148959 |
| 636 | Ga0495683_0000216 | 3300047323 | Bacteria | 54311 |
| 637 | Ga0495683_0010981 | 3300047323 | Bacteria | 4776 |
| 638 | Ga0495683_0022020 | 3300047323 | Bacteria | 3279 |
| 639 | Ga0495683_0051853 | 3300047323 | Bacteria | 2049 |
| 640 | Ga0495683_0089758 | 3300047323 | Bacteria | 1490 |
| 641 | Ga0495683_0129158 | 3300047323 | Bacteria | 1193 |
| 642 | Ga0495687_019903 | 3300047443 | Bacteria | 3281 |
| 643 | Ga0495677_0030674 | 3300047445 | Bacteria | 1956 |
| 644 | Ga0495679_000377 | 3300047446 | Bacteria | 34132 |
| 645 | Ga0495679_014863 | 3300047446 | Bacteria | 2866 |
| 646 | Ga0495679_015263 | 3300047446 | Bacteria | 2815 |
| 647 | Ga0495679_015573 | 3300047446 | Bacteria | 2777 |
| 648 | Ga0495679_021050 | 3300047446 | Bacteria | 2261 |
| 649 | Ga0495679_024414 | 3300047446 | Bacteria | 2037 |
| 650 | Ga0495679_031583 | 3300047446 | Bacteria | 1707 |
| 651 | Ga0495685_031430 | 3300047447 | Bacteria | 1825 |
| 652 | Ga0495673_0002712 | 3300047469 | Bacteria | 12168 |
| 653 | Ga0495673_0006452 | 3300047469 | Bacteria | 6889 |
| 654 | Ga0495673_0010072 | 3300047469 | Bacteria | 5170 |
| 655 | Ga0495673_0015923 | 3300047469 | Bacteria | 3858 |
| 656 | Ga0495673_0016934 | 3300047469 | Bacteria | 3713 |
| 657 | Ga0495673_0033689 | 3300047469 | Bacteria | 2374 |
| 658 | Ga0495673_0036706 | 3300047469 | Bacteria | 2244 |
| 659 | Ga0495673_0037163 | 3300047469 | Bacteria | 2226 |
| 660 | Ga0495673_0040815 | 3300047469 | Bacteria | 2092 |
| 661 | Ga0495673_0042642 | 3300047469 | Bacteria | 2035 |
| 662 | Ga0495673_0048050 | 3300047469 | Bacteria | 1883 |
| 663 | Ga0495673_0055315 | 3300047469 | Bacteria | 1721 |
| 664 | Ga0495673_0069862 | 3300047469 | Bacteria | 1480 |
| 665 | Ga0495673_0087283 | 3300047469 | Bacteria | 1280 |
| 666 | Ga0495681_0009159 | 3300047470 | Bacteria | 6125 |
| 667 | Ga0495681_0013039 | 3300047470 | Bacteria | 4850 |
| 668 | Ga0495681_0021377 | 3300047470 | Bacteria | 3489 |
| 669 | Ga0495681_0025854 | 3300047470 | Bacteria | 3066 |
| 670 | Ga0495681_0030486 | 3300047470 | Bacteria | 2745 |
| 671 | Ga0495681_0042194 | 3300047470 | Bacteria | 2209 |
| 672 | Ga0495681_0044007 | 3300047470 | Bacteria | 2149 |
| 673 | Ga0495681_0075821 | 3300047470 | Bacteria | 1513 |
| 674 | Ga0495681_0079196 | 3300047470 | Bacteria | 1470 |
| 675 | Ga0495684_0146740 | 3300047471 | Bacteria | 1766 |
| 676 | Ga0495686_0011832 | 3300047472 | Bacteria | 6137 |
| 677 | Ga0495686_0029647 | 3300047472 | Bacteria | 3558 |
| 678 | Ga0495686_0099960 | 3300047472 | Bacteria | 1750 |
| 679 | Ga0495686_0167550 | 3300047472 | Bacteria | 1279 |
| 680 | Ga0495593_0035166 | 3300047673 | Bacteria | 2721 |
| 681 | Ga0495593_0060514 | 3300047673 | Bacteria | 1982 |
| 682 | Ga0495602_0163305 | 3300048088 | Bacteria | 1736 |
| 683 | Ga0495626_0000125 | 3300048091 | Bacteria | 99451 |
| 684 | Ga0495626_0001796 | 3300048091 | Bacteria | 16211 |
| 685 | Ga0495626_0004821 | 3300048091 | Bacteria | 8133 |
| 686 | Ga0495626_0019437 | 3300048091 | Bacteria | 3398 |
| 687 | Ga0495626_0019580 | 3300048091 | Bacteria | 3384 |
| 688 | Ga0495626_0026534 | 3300048091 | Bacteria | 2822 |
| 689 | Ga0495626_0037187 | 3300048091 | Bacteria | 2314 |
| 690 | Ga0495626_0047813 | 3300048091 | Bacteria | 1987 |
| 691 | Ga0495626_0063581 | 3300048091 | Bacteria | 1673 |
| 692 | Ga0495626_0077874 | 3300048091 | Bacteria | 1477 |
| 693 | Ga0496102_0065015 | 3300048905 | Bacteria | 3342 |
| 694 | Ga0496102_0208392 | 3300048905 | Bacteria | 1843 |
| 695 | Ga0496110_0049992 | 3300048913 | Bacteria | 3670 |
| 696 | Ga0496110_0175404 | 3300048913 | Bacteria | 1945 |
| 697 | Ga0496115_0000372 | 3300048918 | Bacteria | 37081 |
| 698 | Ga0496116_0001043 | 3300048919 | Bacteria | 33784 |
| 699 | Ga0496116_0004638 | 3300048919 | Bacteria | 13019 |
| 700 | Ga0496116_0018663 | 3300048919 | Bacteria | 5335 |
| 701 | Ga0496116_0069705 | 3300048919 | Bacteria | 2234 |
| 702 | Ga0496116_0100650 | 3300048919 | Bacteria | 1727 |
| 703 | Ga0496116_0142693 | 3300048919 | Bacteria | 1344 |
| 704 | Ga0496117_0047000 | 3300048920 | Bacteria | 3100 |
| 705 | Ga0496117_0050821 | 3300048920 | Bacteria | 2937 |
| 706 | Ga0496117_0053566 | 3300048920 | Bacteria | 2833 |
| 707 | Ga0496117_0067336 | 3300048920 | Bacteria | 2423 |
| 708 | Ga0496117_0086027 | 3300048920 | Bacteria | 2044 |
| 709 | Ga0496117_0091099 | 3300048920 | Bacteria | 1962 |
| 710 | Ga0496117_0094012 | 3300048920 | Bacteria | 1920 |
| 711 | Ga0496118_0044010 | 3300048921 | Bacteria | 3500 |
| 712 | Ga0496118_0071816 | 3300048921 | Bacteria | 2489 |
| 713 | Ga0496118_0086981 | 3300048921 | Bacteria | 2169 |
| 714 | Ga0496118_0144446 | 3300048921 | Bacteria | 1501 |
| 715 | Ga0496118_0181456 | 3300048921 | Bacteria | 1271 |
| 716 | Ga0496120_0122213 | 3300048923 | Bacteria | 1344 |
| 717 | Ga0496120_0142244 | 3300048923 | Bacteria | 1216 |
| 718 | Ga0496121_0002337 | 3300048924 | Bacteria | 29283 |
| 719 | Ga0496121_0004179 | 3300048924 | Bacteria | 19722 |
| 720 | Ga0496121_0038182 | 3300048924 | Bacteria | 4257 |
| 721 | Ga0496121_0097272 | 3300048924 | Bacteria | 2281 |
| 722 | Ga0496122_0021670 | 3300048925 | Bacteria | 5743 |
| 723 | Ga0496122_0026521 | 3300048925 | Bacteria | 4991 |
| 724 | Ga0496122_0046468 | 3300048925 | Bacteria | 3361 |
| 725 | Ga0496122_0072157 | 3300048925 | Bacteria | 2456 |
| 726 | Ga0496122_0077118 | 3300048925 | Bacteria | 2342 |
| 727 | Ga0496122_0164504 | 3300048925 | Bacteria | 1347 |
| 728 | Ga0496123_0001511 | 3300048926 | Bacteria | 32223 |
| 729 | Ga0496123_0041688 | 3300048926 | Bacteria | 3177 |
| 730 | Ga0496123_0059724 | 3300048926 | Bacteria | 2462 |
| 731 | Ga0496123_0104605 | 3300048926 | Bacteria | 1636 |
| 732 | Ga0496123_0105572 | 3300048926 | Bacteria | 1625 |
| 733 | Ga0496123_0109509 | 3300048926 | Bacteria | 1582 |
| 734 | Ga0496123_0118448 | 3300048926 | Bacteria | 1495 |
| 735 | Ga0496124_0001524 | 3300048927 | Bacteria | 33727 |
| 736 | Ga0496124_0001773 | 3300048927 | Bacteria | 30021 |
| 737 | Ga0496124_0033048 | 3300048927 | Bacteria | 4556 |
| 738 | Ga0496124_0054267 | 3300048927 | Bacteria | 3393 |
| 739 | Ga0496124_0062509 | 3300048927 | Bacteria | 3115 |
| 740 | Ga0496124_0063450 | 3300048927 | Bacteria | 3086 |
| 741 | Ga0496124_0075351 | 3300048927 | Bacteria | 2787 |
| 742 | Ga0496124_0239997 | 3300048927 | Bacteria | 1348 |
| 743 | Ga0496125_0091942 | 3300048928 | Bacteria | 2270 |
| 744 | Ga0496125_0115071 | 3300048928 | Bacteria | 1935 |
| 745 | Ga0496125_0165927 | 3300048928 | Bacteria | 1492 |
| 746 | Ga0496125_0231127 | 3300048928 | Bacteria | 1182 |
| 747 | Ga0496126_0032090 | 3300048929 | Bacteria | 4953 |
| 748 | Ga0496126_0092027 | 3300048929 | Bacteria | 2665 |
| 749 | Ga0496126_0125710 | 3300048929 | Bacteria | 2219 |
| 750 | Ga0495678_000049 | 3300049459 | Bacteria | 163929 |
| 751 | Ga0495678_000918 | 3300049459 | Bacteria | 25900 |
| 752 | Ga0495678_001783 | 3300049459 | Bacteria | 15918 |
| 753 | Ga0495678_016655 | 3300049459 | Bacteria | 3353 |
| 754 | Ga0495678_016849 | 3300049459 | Bacteria | 3327 |
| 755 | Ga0495678_017909 | 3300049459 | Bacteria | 3197 |
| 756 | Ga0495678_019253 | 3300049459 | Bacteria | 3049 |
| 757 | Ga0495678_032576 | 3300049459 | Bacteria | 2158 |
| 758 | Ga0495678_042946 | 3300049459 | Bacteria | 1798 |
| 759 | Ga0495678_062025 | 3300049459 | Bacteria | 1400 |
| 760 | Ga0495678_074266 | 3300049459 | Bacteria | 1237 |
| 761 | Ga0495678_080216 | 3300049459 | Bacteria | 1173 |
| 762 | Ga0495682_0000153 | 3300049460 | Bacteria | 59021 |
| 763 | Ga0495682_0004151 | 3300049460 | Bacteria | 6281 |
| 764 | Ga0495682_0020304 | 3300049460 | Bacteria | 2494 |
| 765 | Ga0495682_0021639 | 3300049460 | Bacteria | 2408 |
| 766 | Ga0495682_0042657 | 3300049460 | Bacteria | 1662 |
| 767 | Ga0495682_0065185 | 3300049460 | Bacteria | 1313 |
| 768 | Ga0495682_0086038 | 3300049460 | Bacteria | 1129 |
| 769 | Ga0501031_0111953 | 3300049568 | Bacteria | 1783 |
| 770 | Ga0501037_0302412 | 3300049573 | Bacteria | 1111 |
| 771 | Ga0501222_004172 | 3300049662 | Bacteria | 1963 |
| 772 | Ga0501241_004405 | 3300049758 | Bacteria | 2641 |
| 773 | Ga0501226_000017 | 3300049853 | Bacteria | 150879 |
| 774 | nmdc:mga03683_112256_c1 | 3300050489 | Bacteria | 1206 |
| 775 | nmdc:mga03683_2291_c1 | 3300050489 | Bacteria | 4706 |
| 776 | nmdc:mga00v17_117429_c1 | 3300050491 | Bacteria | 1692 |
| 777 | nmdc:mga0sz30_19496_c1 | 3300050516 | Bacteria | 2728 |
| 778 | Ga0500572_004688 | 3300053111 | Bacteria | 3100 |
| 779 | Ga0500618_025028 | 3300053125 | Bacteria | 1433 |
| 780 | Ga0500573_0040451 | 3300053140 | Bacteria | 2692 |
| 781 | Ga0500552_001318 | 3300053733 | Bacteria | 2362 |
| 782 | 2510285141 | 2510065053 | Bacteria | 5005518 |
| 783 | 2510294022 | 2510065055 | Bacteria | 5037935 |
| 784 | 2510313056 | 2510065058 | Bacteria | 5005894 |
| 785 | 2511254580 | 2511231004 | Bacteria | 6669789 |
| 786 | 2511266622 | 2511231006 | Bacteria | 6794709 |
| 787 | 2511270760 | 2511231007 | Bacteria | 6306603 |
| 788 | 2511276672 | 2511231008 | Bacteria | 6624100 |
| 789 | 2511293035 | 2511231010 | Bacteria | 6373152 |
| 790 | 2511296267 | 2511231011 | Bacteria | 6149768 |
| 791 | 2511301895 | 2511231012 | Bacteria | 6738011 |
| 792 | 2511321007 | 2511231015 | Bacteria | 6598026 |
| 793 | 2511323983 | 2511231016 | Bacteria | 6704427 |
| 794 | 2511331572 | 2511231017 | Bacteria | 6503007 |
| 795 | 2511339038 | 2511231018 | Bacteria | 6436256 |
| 796 | 2511345000 | 2511231019 | Bacteria | 6520662 |
| 797 | 2511349346 | 2511231020 | Bacteria | 6115223 |
| 798 | 2511356449 | 2511231021 | Bacteria | 7302637 |
| 799 | 2511364427 | 2511231022 | Bacteria | 6719296 |
| 800 | 2511370195 | 2511231023 | Bacteria | 6808468 |
| 801 | 2511414636 | 2511231031 | Bacteria | 6558529 |
| 802 | 2511826349 | 2511231156 | Bacteria | 6845832 |
| 803 | 2512324148 | 2512047018 | Bacteria | 6663241 |
| 804 | 2555671408 | 2554235341 | Bacteria | 6867980 |
| 805 | 2583793818 | 2582580891 | Bacteria | 6800976 |
| 806 | 2597859492 | 2597489887 | Bacteria | 6666321 |
| 807 | 2599328589 | 2599185155 | Bacteria | 5827168 |
| 808 | 2599354435 | 2599185160 | Bacteria | 6844013 |
| 809 | 2599359851 | 2599185161 | Bacteria | 6960462 |
| 810 | 2599366173 | 2599185162 | Bacteria | 6957254 |
| 811 | 2599372963 | 2599185163 | Bacteria | 6995158 |
| 812 | 2599379543 | 2599185164 | Bacteria | 6841688 |
| 813 | 2599385479 | 2599185165 | Bacteria | 6843250 |
| 814 | 2599391822 | 2599185166 | Bacteria | 6959206 |
| 815 | 2599401751 | 2599185167 | Bacteria | 6353609 |
| 816 | 2599403588 | 2599185168 | Bacteria | 6997636 |
| 817 | 2599451604 | 2599185179 | Bacteria | 6611171 |
| 818 | 2599461269 | 2599185181 | Bacteria | 6844519 |
| 819 | 2599469813 | 2599185182 | Bacteria | 6883168 |
| 820 | 2599482322 | 2599185185 | Bacteria | 6652270 |
| 821 | 2599490289 | 2599185186 | Bacteria | 6831633 |
| 822 | 2599504152 | 2599185188 | Bacteria | 6164180 |
| 823 | 2599514995 | 2599185190 | Bacteria | 6285678 |
| 824 | 2599521096 | 2599185191 | Bacteria | 6297582 |
| 825 | 2599613438 | 2599185212 | Bacteria | 6765997 |
| 826 | 2599772342 | 2599185248 | Bacteria | 6696816 |
| 827 | 2599803959 | 2599185257 | Bacteria | 6492581 |
| 828 | 2599882322 | 2599185288 | Bacteria | 6666191 |
| 829 | 2599888936 | 2599185289 | Bacteria | 6778765 |
| 830 | 2599894204 | 2599185290 | Bacteria | 6289611 |
| 831 | 2599900565 | 2599185291 | Bacteria | 6775623 |
| 832 | 2599935183 | 2599185300 | Bacteria | 6062622 |
| 833 | 2599943961 | 2599185302 | Bacteria | 5954930 |
| 834 | 2599952269 | 2599185303 | Bacteria | 6512725 |
| 835 | 2599955827 | 2599185304 | Bacteria | 5951361 |
| 836 | 2599961461 | 2599185305 | Bacteria | 6748700 |
| 837 | 2599969861 | 2599185306 | Bacteria | 6637356 |
| 838 | 2599974282 | 2599185307 | Bacteria | 6194719 |
| 839 | 2599981469 | 2599185308 | Bacteria | 6621546 |
| 840 | 2599985628 | 2599185309 | Bacteria | 5969593 |
| 841 | 2599989551 | 2599185310 | Bacteria | 6014457 |
| 842 | 2599994422 | 2599185311 | Bacteria | 6354990 |
| 843 | 2600000103 | 2599185312 | Bacteria | 5912071 |
| 844 | 2600009082 | 2599185313 | Bacteria | 6658188 |
| 845 | 2600015290 | 2599185314 | Bacteria | 6621749 |
| 846 | 2600019597 | 2599185315 | Bacteria | 6771107 |
| 847 | 2600023716 | 2599185316 | Bacteria | 6320029 |
| 848 | 2600032362 | 2599185317 | Bacteria | 6435722 |
| 849 | 2600038805 | 2599185318 | Bacteria | 6961590 |
| 850 | 2600044152 | 2599185319 | Bacteria | 6637840 |
| 851 | 2600048358 | 2599185320 | Bacteria | 5963263 |
| 852 | 2600054107 | 2599185321 | Bacteria | 6764560 |
| 853 | 2600060327 | 2599185322 | Bacteria | 6763055 |
| 854 | 2600066583 | 2599185323 | Bacteria | 6688755 |
| 855 | 2600074366 | 2599185324 | Bacteria | 6590677 |
| 856 | 2600078109 | 2599185325 | Bacteria | 6324919 |
| 857 | 2600213885 | 2599185356 | Bacteria | 6843884 |
| 858 | 2600361924 | 2600254930 | Bacteria | 6431253 |
| 859 | 2600364396 | 2600254931 | Bacteria | 6734225 |
| 860 | 2600443128 | 2600254954 | Bacteria | 5100516 |
| 861 | 2601626575 | 2600255283 | Bacteria | 6061572 |
| 862 | 2601774051 | 2600255313 | Bacteria | 6842543 |
| 863 | 2601795595 | 2600255318 | Bacteria | 6383414 |
| 864 | 2602009383 | 2600255389 | Bacteria | 5275336 |
| 865 | 2606075664 | 2603880185 | Bacteria | 6379190 |
| 866 | 2606128423 | 2603880199 | Bacteria | 6377649 |
| 867 | 2608384633 | 2606217733 | Bacteria | 6360972 |
| 868 | 2621300746 | 2619619299 | Bacteria | 6649820 |
| 869 | 2624479533 | 2623620443 | Bacteria | 6427864 |
| 870 | 2624493456 | 2623620446 | Bacteria | 6500345 |
| 871 | 2643842742 | 2643221565 | Bacteria | 6216018 |
| 872 | 2643952665 | 2643221589 | Bacteria | 6250934 |
| 873 | 2644022427 | 2643221602 | Bacteria | 6249926 |
| 874 | 2644187451 | 2643221633 | Bacteria | 6733554 |
| 875 | 2644281828 | 2643221650 | Bacteria | 7029547 |
| 876 | 2652544525 | 2651869719 | Bacteria | 6047974 |
| 877 | 2671093226 | 2667528170 | Bacteria | 6786960 |
| 878 | 2671097016 | 2667528171 | Bacteria | 6900659 |
| 879 | 2671128910 | 2667528176 | Bacteria | 6724917 |
| 880 | 2671770473 | 2671180172 | Bacteria | 6495783 |
| 881 | 2678264698 | 2675903515 | Bacteria | 6580491 |
| 882 | 2715753934 | 2713897148 | Bacteria | 5883533 |
| 883 | 2715757799 | 2713897149 | Bacteria | 6506249 |
| 884 | 2718633362 | 2718217725 | Bacteria | 5758958 |
| 885 | 2738670636 | 2738541265 | Bacteria | 6594665 |
| 886 | 2738691390 | 2738541271 | Bacteria | 5657310 |
| 887 | 2738749029 | 2738541282 | Bacteria | 6593925 |
| 888 | 2738812224 | 2738541294 | Bacteria | 6925949 |
| 889 | 2738858071 | 2738541303 | Bacteria | 6591772 |
| 890 | 2738899584 | 2738541309 | Bacteria | 6926455 |
| 891 | 2739201234 | 2738543004 | Bacteria | 6381073 |
| 892 | 2739262423 | 2738543015 | Bacteria | 6750701 |
| 893 | 2739267165 | 2738543016 | Bacteria | 5657564 |
| 894 | 2739286272 | 2738543020 | Bacteria | 5718238 |
| 895 | 2739291585 | 2738543021 | Bacteria | 5718241 |
| 896 | 2739316194 | 2738543025 | Bacteria | 6600348 |
| 897 | 2743739022 | 2740892503 | Bacteria | 6855563 |
| 898 | 2745005152 | 2744054620 | Bacteria | 6551379 |
| 899 | 2774123429 | 2773857670 | Bacteria | 6407454 |
| 900 | 2774128233 | 2773857672 | Bacteria | 4993178 |
| 901 | 2774138423 | 2773857673 | Bacteria | 6513460 |
| 902 | 2784316029 | 2784132072 | Bacteria | 6596533 |
| 903 | 2794595040 | 2791355520 | Bacteria | 5948615 |
| 904 | 2808857098 | 2808606361 | Bacteria | 6136259 |
| 905 | 2808907254 | 2808606373 | Bacteria | 4423627 |
| 906 | 2808926676 | 2808606376 | Bacteria | 6248667 |
| 907 | 2808927462 | 2808606377 | Bacteria | 6646337 |
| 908 | 2808937170 | 2808606378 | Bacteria | 6177535 |
| 909 | 2808940647 | 2808606379 | Bacteria | 5022697 |
| 910 | 2808948837 | 2808606380 | Bacteria | 6248705 |
| 911 | 2808949999 | 2808606381 | Bacteria | 6646461 |
| 912 | 2808957284 | 2808606382 | Bacteria | 6841132 |
| 913 | 2808965486 | 2808606383 | Bacteria | 6138645 |
| 914 | 2808980914 | 2808606385 | Bacteria | 6711065 |
| 915 | 2808996638 | 2808606388 | Bacteria | 6706662 |
| 916 | 2809000273 | 2808606389 | Bacteria | 6138126 |
| 917 | 2809216476 | 2808606445 | Bacteria | 6057339 |
| 918 | 2812368079 | 2811994881 | Bacteria | 6298475 |
| 919 | 2817490014 | 2816332298 | Bacteria | 6852809 |
| 920 | 2819654697 | 2818991456 | Bacteria | 6123676 |
| 921 | 2819702110 | 2818991464 | Bacteria | 6907494 |
| 922 | 2823424758 | 2823421272 | Bacteria | 5372474 |
| 923 | 2825656415 | 2825651385 | Bacteria | 6715909 |
| 924 | 2826584501 | 2826581358 | Bacteria | 5963467 |
| 925 | 2834029819 | 2834028612 | Bacteria | 6354979 |
| 926 | 2842805561 | 2842805378 | Bacteria | 5385175 |
| 927 | 2842818055 | 2842815866 | Bacteria | 5947510 |
| 928 | 2842832596 | 2842832357 | Bacteria | 5959113 |
| 929 | 2842849309 | 2842849001 | Bacteria | 5924277 |
| 930 | 2842856800 | 2842854478 | Bacteria | 6143501 |
| 931 | 2844671928 | 2844665904 | Bacteria | 6817974 |
| 932 | 2852617639 | 2852612431 | Bacteria | 6885235 |
| 933 | 2852659019 | 2852657418 | Bacteria | 6472974 |
| 934 | 2852672997 | 2852667396 | Bacteria | 6885555 |
| 935 | 2860339918 | 2860339153 | Bacteria | 6846989 |
| 936 | 2880232409 | 2880230671 | Bacteria | 6140320 |
| 937 | 2904523900 | 2904518522 | Bacteria | 6068986 |
| 938 | 2908448768 | 2908446538 | Bacteria | 6829095 |
| 939 | 2912967695 | 2912963787 | Bacteria | 5646108 |
| 940 | 2913041172 | 2913036834 | Bacteria | 6704877 |
| 941 | 2917075274 | 2917070673 | Bacteria | 6868303 |
| 942 | 2917835417 | 2917832318 | Bacteria | 5346010 |
| 943 | 2919129251 | 2919125081 | Bacteria | 5385106 |
| 944 | 2919386500 | 2919385768 | Bacteria | 5897293 |
| 945 | 2919457013 | 2919456309 | Bacteria | 6586567 |
| 946 | 2919486066 | 2919481497 | Bacteria | 6907839 |
| 947 | 2919491217 | 2919487758 | Bacteria | 5929766 |
| 948 | 2919504484 | 2919501602 | Bacteria | 5286340 |
| 949 | 2919699279 | 2919697872 | Bacteria | 6553725 |
| 950 | 2923158101 | 2923153595 | Bacteria | 6870622 |
| 951 | 2923522132 | 2923519811 | Bacteria | 6298479 |
| 952 | 2923590156 | 2923586266 | Bacteria | 6565975 |
| 953 | 2926064943 | 2926063275 | Bacteria | 5285848 |
| 954 | 2928963945 | 2928963466 | Bacteria | 5165703 |
| 955 | 2929148625 | 2929144301 | Bacteria | 6622272 |
| 956 | 2931373936 | 2931369376 | Bacteria | 6847892 |
| 957 | 2931392890 | 2931390751 | Bacteria | 6273349 |
| 958 | 2931400188 | 2931396565 | Bacteria | 7251677 |
| 959 | 2935356262 | 2935353572 | Unclassified | 6955622 |
| 960 | 2939639645 | 2939636861 | Bacteria | 6297853 |
| 961 | 2939655843 | 2939651529 | Bacteria | 5895393 |
| 962 | 2945965022 | 2945961074 | Bacteria | 7342064 |
| 963 | 2946010962 | 2946006987 | Bacteria | 6705746 |
| 964 | 2969306321 | 2969304461 | Bacteria | 6601805 |
| 965 | 2974292025 | 2974289157 | Bacteria | 6080362 |
| 966 | 2974299610 | 2974298342 | Bacteria | 4840922 |
| 967 | 2984288077 | 2984286254 | Bacteria | 6702062 |
| 968 | 2984501967 | 2984499530 | Bacteria | 5020881 |
| 969 | 2984504534 | 2984504281 | Bacteria | 5262371 |
| 970 | 2988730214 | 2988728565 | Bacteria | 6124362 |
| 971 | 2990200195 | 2990196909 | Bacteria | 4054280 |
| 972 | 2998141716 | 2998139840 | Bacteria | 6073514 |
| 973 | 3007253446 | 3007252601 | Bacteria | 4559114 |
| 974 | 3007317747 | 3007315729 | Bacteria | 5076637 |
| 975 | 3007397404 | 3007395558 | Bacteria | 6755444 |
| 976 | 3007424563 | 3007419365 | Bacteria | 7026924 |
| 977 | 3007515670 | 3007511990 | Bacteria | 6481491 |
| 978 | 3007618761 | 3007614139 | Bacteria | 6053559 |
| 979 | 3007625501 | 3007619802 | Bacteria | 6411688 |
| 980 | 3007719387 | 3007718800 | Bacteria | 5971527 |
| 981 | 3007856307 | 3007855910 | Bacteria | 5637581 |
| 982 | 3007863046 | 3007861166 | Bacteria | 6045338 |
| 983 | 3007870557 | 3007866637 | Bacteria | 5899198 |
| 984 | 637321730 | 637000220 | Bacteria | 7074893 |
| 985 | 8011353882 | 8011350971 | Bacteria | 6158957 |
| 986 | 8015692197 | 8015687852 | Bacteria | 6613826 |
| 987 | 8016733658 | 8016728285 | Bacteria | 5263933 |
| 988 | 8019776451 | 8019775933 | Bacteria | 6858656 |
| 989 | 8034962735 | 8034962539 | Bacteria | 4884839 |
| 990 | 8054285616 | 8054285046 | Bacteria | 6919322 |
| 991 | 8054505387 | 8054503363 | Bacteria | 6101651 |
| 992 | 8055775406 | 8055770955 | Bacteria | 6827675 |
| 993 | 8055819956 | 8055817908 | Bacteria | 6609162 |
| 994 | 8056130090 | 8056125926 | Bacteria | 6228218 |
| 995 | 8056133726 | 8056131705 | Bacteria | 6107031 |
| 996 | 8056144757 | 8056143049 | Bacteria | 6307666 |
| 997 | 8056156134 | 8056155041 | Bacteria | 6486948 |
| 998 | 8056169277 | 8056166840 | Bacteria | 5820959 |
| 999 | 8056175464 | 8056172158 | Bacteria | 6133900 |
| 1000 | 8056181240 | 8056177738 | Bacteria | 6748268 |
| 1001 | 8056571449 | 8056569372 | Bacteria | 5997322 |
| 1002 | 8057804222 | 8057798959 | Bacteria | 6713499 |
| 1003 | Ga0182007_10002759 | |||
| 1004 | MRS2a_Contig_9054 | |||
| 1005 | SwRhRL2b_contig_249379 | |||
| 1006 | SwRhRL2b_contig_3818765 | |||
| 1007 | JGI24735J21928_10001792 | |||
| 1008 | JGI25162J39368_1000018 | |||
| 1009 | JGI25157J39369_1000011 | |||
| 1010 | JGI25163J39215_1000612 | |||
| 1011 | JGI25163J39215_1001671 | |||
| 1012 | JGI25163J39215_1001757 | |||
| 1013 | JGI25164J39214_1000007 | |||
| 1014 | JGI25164J39214_1000194 | |||
| 1015 | JGI25164J39214_1000513 | |||
| 1016 | JGI25165J46597_1000029 | |||
| 1017 | JGI25165J46597_1000348 | |||
| 1018 | JGI25165J46597_1000430 | |||
| 1019 | Ga0055535_1000025 | |||
| 1020 | Ga0055535_1000103 | |||
| 1021 | Ga0055542_1000010 | |||
| 1022 | Ga0055542_1000024 | |||
| 1023 | Ga0055529_1000029 | |||
| 1024 | Ga0055536_1000111 | |||
| 1025 | Ga0055530_10000146 | |||
| 1026 | Ga0055530_10001124 | |||
| 1027 | Ga0055540_1000822 | |||
| 1028 | Ga0055540_1001173 | |||
| 1029 | Ga0055540_1001379 | |||
| 1030 | Ga0055531_10005378 | |||
| 1031 | Ga0065714_10003020 | |||
| 1032 | Ga0065714_10008503 | |||
| 1033 | Ga0065714_10010964 | |||
| 1034 | Ga0065704_10000811 | |||
| 1035 | Ga0065704_10128936 | |||
| 1036 | Ga0065712_10001766 | |||
| 1037 | Ga0065712_10067928 | |||
| 1038 | Ga0065712_10095511 | |||
| 1039 | Ga0070670_100001032 | |||
| 1040 | Ga0070670_100039965 | |||
| 1041 | Ga0070661_100000410 | |||
| 1042 | Ga0070709_10380710 | |||
| 1043 | Ga0070662_100000575 | |||
| 1044 | Ga0070662_100231300 | |||
| 1045 | Ga0070699_100484596 | |||
| 1046 | Ga0068853_100017790 | |||
| 1047 | Ga0070664_100000377 | |||
| 1048 | Ga0070664_100508048 | |||
| 1049 | Ga0068854_100020669 | |||
| 1050 | Ga0068851_10000251 | |||
| 1051 | Ga0081455_10008620 | |||
| 1052 | Ga0075364_10111970 | |||
| 1053 | Ga0075432_10001356 | |||
| 1054 | Ga0075432_10004567 | |||
| 1055 | Ga0075432_10033448 | |||
| 1056 | Ga0075432_10071867 | |||
| 1057 | Ga0075362_10031647 | |||
| 1058 | Ga0075362_10052897 | |||
| 1059 | Ga0075362_10092813 | |||
| 1060 | Ga0075369_10005588 | |||
| 1061 | Ga0079104_1000364 | |||
| 1062 | Ga0105251_10000275 | |||
| 1063 | Ga0105251_10000284 | |||
| 1064 | Ga0105251_10003067 | |||
| 1065 | Ga0105251_10003252 | |||
| 1066 | Ga0105251_10004649 | |||
| 1067 | Ga0105251_10005474 | |||
| 1068 | Ga0105251_10007774 | |||
| 1069 | Ga0105251_10017472 | |||
| 1070 | Ga0105251_10019528 | |||
| 1071 | Ga0105251_10021821 | |||
| 1072 | Ga0105251_10028781 | |||
| 1073 | Ga0105251_10050514 | |||
| 1074 | Ga0105251_10068203 | |||
| 1075 | Ga0105251_10122040 | |||
| 1076 | Ga0105244_10000248 | |||
| 1077 | Ga0105244_10001261 | |||
| 1078 | Ga0105244_10009784 | |||
| 1079 | Ga0105244_10012090 | |||
| 1080 | Ga0105244_10020378 | |||
| 1081 | Ga0105244_10026295 | |||
| 1082 | Ga0105244_10043759 | |||
| 1083 | Ga0105244_10079305 | |||
| 1084 | Ga0105250_10000232 | |||
| 1085 | Ga0105250_10001490 | |||
| 1086 | Ga0105250_10001860 | |||
| 1087 | Ga0105250_10016458 | |||
| 1088 | Ga0105250_10023495 | |||
| 1089 | Ga0105250_10050018 | |||
| 1090 | Ga0105243_10001441 | |||
| 1091 | Ga0105243_10002007 | |||
| 1092 | Ga0105243_10053799 | |||
| 1093 | Ga0105243_10200929 | |||
| 1094 | Ga0105242_10002563 | |||
| 1095 | Ga0105237_10002926 | |||
| 1096 | Ga0105249_10098399 | |||
| 1097 | Ga0099796_10102136 | |||
| 1098 | Ga0105246_10001555 | |||
| 1099 | Ga0105246_10015749 | |||
| 1100 | Ga0105246_10023510 | |||
| 1101 | Ga0105246_10055583 | |||
| 1102 | Ga0157345_1000292 | |||
| 1103 | Ga0157373_10002707 | |||
| 1104 | Ga0157373_10013017 | |||
| 1105 | Ga0157373_10014185 | |||
| 1106 | Ga0157373_10111685 | |||
| 1107 | Ga0157373_10140465 | |||
| 1108 | Ga0157371_10003281 | |||
| 1109 | Ga0157371_10004368 | |||
| 1110 | Ga0157371_10014445 | |||
| 1111 | Ga0157371_10137678 | |||
| 1112 | Ga0157370_10000162 | |||
| 1113 | Ga0157370_10031069 | |||
| 1114 | Ga0157370_10043496 | |||
| 1115 | Ga0157370_10085672 | |||
| 1116 | Ga0157370_10109001 | |||
| 1117 | Ga0157370_10183943 | |||
| 1118 | Ga0157370_10192611 | |||
| 1119 | Ga0157369_10024884 | |||
| 1120 | Ga0157369_10030369 | |||
| 1121 | Ga0157369_10032322 | |||
| 1122 | Ga0157369_10086755 | |||
| 1123 | Ga0163162_10009884 | |||
| 1124 | Ga0163162_10286440 | |||
| 1125 | Ga0157372_10086657 | |||
| 1126 | Ga0157375_10097473 | |||
| 1127 | Ga0157375_10766014 | |||
| 1128 | Ga0182008_10005686 | |||
| 1129 | Ga0182008_10011957 | |||
| 1130 | Ga0182008_10021333 | |||
| 1131 | Ga0182008_10021424 | |||
| 1132 | Ga0182008_10041281 | |||
| 1133 | Ga0182006_1001230 | |||
| 1134 | Ga0182006_1002590 | |||
| 1135 | Ga0182006_1008846 | |||
| 1136 | Ga0182006_1021402 | |||
| 1137 | Ga0182006_1023158 | |||
| 1138 | Ga0182006_1026917 | |||
| 1139 | Ga0182006_1056635 | |||
| 1140 | Ga0182006_1070478 | |||
| 1141 | Ga0182007_10001571 | |||
| 1142 | Ga0182007_10021435 | |||
| 1143 | Ga0182005_1004406 | |||
| 1144 | Ga0182005_1005003 | |||
| 1145 | Ga0182005_1017950 | |||
| 1146 | Ga0182005_1022377 | |||
| 1147 | Ga0182005_1022935 | |||
| 1148 | Ga0182005_1023813 | |||
| 1149 | Ga0163161_10012776 | |||
| 1150 | Ga0209760_100011 | |||
| 1151 | Ga0209760_100064 | |||
| 1152 | Ga0209784_100026 | |||
| 1153 | Ga0209566_102356 | |||
| 1154 | Ga0209672_102246 | |||
| 1155 | Ga0209563_100694 | |||
| 1156 | Ga0207427_100008 | |||
| 1157 | Ga0207427_100023 | |||
| 1158 | Ga0207427_100082 | |||
| 1159 | Ga0209437_100006 | |||
| 1160 | Ga0209437_100014 | |||
| 1161 | Ga0209437_100069 | |||
| 1162 | Ga0209437_100245 | |||
| 1163 | Ga0209258_100059 | |||
| 1164 | Ga0209258_101045 | |||
| 1165 | Ga0209258_101292 | |||
| 1166 | Ga0209646_1001047 | |||
| 1167 | Ga0209026_1000036 | |||
| 1168 | Ga0209148_1000005 | |||
| 1169 | Ga0209148_1000010 | |||
| 1170 | Ga0209759_1000023 | |||
| 1171 | Ga0209759_1002192 | |||
| 1172 | Ga0209759_1021902 | |||
| 1173 | Ga0209233_1000008 | |||
| 1174 | Ga0209233_1000009 | |||
| 1175 | Ga0209233_1000105 | |||
| 1176 | Ga0209455_1000020 | |||
| 1177 | Ga0209130_1022753 | |||
| 1178 | Ga0209676_1000006 | |||
| 1179 | Ga0209676_1000369 | |||
| 1180 | Ga0209676_1001140 | |||
| 1181 | Ga0209676_1003514 | |||
| 1182 | Ga0209676_1004051 | |||
| 1183 | Ga0209050_1000070 | |||
| 1184 | Ga0209050_1000235 | |||
| 1185 | Ga0209050_1000380 | |||
| 1186 | Ga0209050_1001241 | |||
| 1187 | Ga0209051_1000086 | |||
| 1188 | Ga0209051_1000123 | |||
| 1189 | Ga0209051_1001064 | |||
| 1190 | Ga0209051_1036421 | |||
| 1191 | Ga0209051_1051857 | |||
| 1192 | Ga0209257_1000421 | |||
| 1193 | Ga0209257_1010774 | |||
| 1194 | Ga0207656_10000094 | |||
| 1195 | Ga0207696_1000025 | |||
| 1196 | Ga0207696_1000161 | |||
| 1197 | Ga0207696_1000399 | |||
| 1198 | Ga0207696_1002704 | |||
| 1199 | Ga0207696_1004662 | |||
| 1200 | Ga0207696_1010679 | |||
| 1201 | Ga0207655_1000113 | |||
| 1202 | Ga0207655_1000269 | |||
| 1203 | Ga0207655_1000976 | |||
| 1204 | Ga0207655_1002157 | |||
| 1205 | Ga0207655_1003563 | |||
| 1206 | Ga0207655_1004512 | |||
| 1207 | Ga0207655_1011189 | |||
| 1208 | Ga0207655_1016647 | |||
| 1209 | Ga0207655_1065760 | |||
| 1210 | Ga0207713_1000102 | |||
| 1211 | Ga0207713_1000344 | |||
| 1212 | Ga0207713_1001819 | |||
| 1213 | Ga0207713_1002656 | |||
| 1214 | Ga0207713_1003166 | |||
| 1215 | Ga0207713_1005358 | |||
| 1216 | Ga0207713_1006303 | |||
| 1217 | Ga0207713_1006787 | |||
| 1218 | Ga0207713_1021584 | |||
| 1219 | Ga0207713_1035118 | |||
| 1220 | Ga0207684_10407806 | |||
| 1221 | Ga0207671_10001551 | |||
| 1222 | Ga0207649_10000061 | |||
| 1223 | Ga0207681_10013490 | |||
| 1224 | Ga0207650_10000419 | |||
| 1225 | Ga0207650_10001683 | |||
| 1226 | Ga0207706_10000668 | |||
| 1227 | Ga0207686_10002078 | |||
| 1228 | Ga0207709_10000223 | |||
| 1229 | Ga0207709_10000835 | |||
| 1230 | Ga0207709_10030251 | |||
| 1231 | Ga0207709_10049445 | |||
| 1232 | Ga0207679_10000018 | |||
| 1233 | Ga0207640_10018613 | |||
| 1234 | Ga0207639_10016158 | |||
| 1235 | Ga0209281_1000010 | |||
| 1236 | Ga0209281_1000331 | |||
| 1237 | Ga0209281_1002825 | |||
| 1238 | Ga0209371_1000365 | |||
| 1239 | Ga0207428_10021464 | |||
| 1240 | Ga0207428_10026590 | |||
| 1241 | Ga0207428_10105296 | |||
| 1242 | Ga0207428_10133142 | |||
| 1243 | Ga0207428_10242544 | |||
| 1244 | Ga0268256_1000236 | |||
| 1245 | Ga0314311_1137078 | |||
| 1246 | Ga0316178_1174406 | |||
| 1247 | Ga0307408_100000025 | |||
| 1248 | Ga0307408_100036272 | |||
| 1249 | Ga0307408_100144895 | |||
| 1250 | Ga0307516_10194648 | |||
| 1251 | Ga0307405_10040867 | |||
| 1252 | Ga0307412_10115724 | |||
| 1253 | Ga0307412_10325564 | |||
| 1254 | Ga0307409_100026395 | |||
| 1255 | Ga0307414_10062721 | |||
| 1256 | Ga0307414_10096469 | |||
| 1257 | Ga0373927_0179601 | |||
| 1258 | Ga0395899_0022460 | |||
| 1259 | Ga0395900_0054481 | |||
| 1260 | Ga0395898_0026985 | |||
| 1261 | Ga0237819_00881 | |||
| 1262 | Ga0400483_011826 | |||
| 1263 | Ga0400483_279756 | |||
| 1264 | Ga0436363_0138769 | |||
| 1265 | Ga0439436_0016475 | |||
| 1266 | Ga0439438_002391 | |||
| 1267 | Ga0439438_005853 | |||
| 1268 | Ga0439438_010670 | |||
| 1269 | Ga0439438_025483 | |||
| 1270 | Ga0439447_001809 | |||
| 1271 | Ga0439447_006010 | |||
| 1272 | Ga0439447_010708 | |||
| 1273 | Ga0439447_029585 | |||
| 1274 | Ga0439447_033238 | |||
| 1275 | Ga0439466_0004608 | |||
| 1276 | Ga0439466_0009682 | |||
| 1277 | Ga0439466_0014226 | |||
| 1278 | Ga0439466_0017268 | |||
| 1279 | Ga0439466_0024300 | |||
| 1280 | Ga0439431_0004367 | |||
| 1281 | Ga0439437_000520 | |||
| 1282 | Ga0439443_002718 | |||
| 1283 | Ga0439432_002368 | |||
| 1284 | Ga0439432_007415 | |||
| 1285 | Ga0439432_018956 | |||
| 1286 | Ga0439432_021257 | |||
| 1287 | Ga0439432_031308 | |||
| 1288 | Ga0439452_000667 | |||
| 1289 | Ga0439452_011937 | |||
| 1290 | Ga0439452_016034 | |||
| 1291 | Ga0439452_018731 | |||
| 1292 | Ga0439452_034005 | |||
| 1293 | Ga0439456_000315 | |||
| 1294 | Ga0439456_012132 | |||
| 1295 | Ga0439456_014249 | |||
| 1296 | Ga0439463_001299 | |||
| 1297 | Ga0439463_003312 | |||
| 1298 | Ga0450911_000017 | |||
| 1299 | Ga0450911_002369 | |||
| 1300 | Ga0450911_008410 | |||
| 1301 | Ga0450913_001977 | |||
| 1302 | Ga0450902_008097 | |||
| 1303 | Ga0450903_005766 | |||
| 1304 | Ga0450904_000166 | |||
| 1305 | Ga0450904_002326 | |||
| 1306 | Ga0450904_005246 | |||
| 1307 | Ga0450906_004046 | |||
| 1308 | Ga0450907_000439 | |||
| 1309 | Ga0450910_000985 | |||
| 1310 | Ga0439446_0000026 | |||
| 1311 | Ga0439446_0059653 | |||
| 1312 | Ga0439434_0009636 | |||
| 1313 | Ga0439434_0044252 | |||
| 1314 | Ga0439459_0000879 | |||
| 1315 | Ga0439464_0006527 | |||
| 1316 | Ga0439464_0018885 | |||
| 1317 | Ga0439460_0001955 | |||
| 1318 | Ga0450916_000791 | |||
| 1319 | Ga0450893_0001272 | |||
| 1320 | Ga0451577_0033401 | |||
| 1321 | Ga0439440_0002330 | |||
| 1322 | Ga0439440_0043154 | |||
| 1323 | Ga0495617_009670 | |||
| 1324 | Ga0495617_009807 | |||
| 1325 | Ga0495627_000040 | |||
| 1326 | Ga0495627_001207 | |||
| 1327 | Ga0495627_002117 | |||
| 1328 | Ga0495627_009066 | |||
| 1329 | Ga0495627_014002 | |||
| 1330 | Ga0495627_028094 | |||
| 1331 | Ga0495603_0017243 | |||
| 1332 | Ga0495590_0005676 | |||
| 1333 | Ga0495590_0009911 | |||
| 1334 | Ga0495590_0025595 | |||
| 1335 | Ga0495590_0037316 | |||
| 1336 | Ga0495591_000023 | |||
| 1337 | Ga0495591_001720 | |||
| 1338 | Ga0495591_002767 | |||
| 1339 | Ga0495591_007086 | |||
| 1340 | Ga0495591_008921 | |||
| 1341 | Ga0495591_016013 | |||
| 1342 | Ga0495638_0023429 | |||
| 1343 | Ga0495638_0026283 | |||
| 1344 | Ga0495638_0044887 | |||
| 1345 | Ga0495638_0095137 | |||
| 1346 | Ga0495638_0101843 | |||
| 1347 | Ga0495638_0117272 | |||
| 1348 | Ga0495638_0222737 | |||
| 1349 | Ga0495653_0001688 | |||
| 1350 | Ga0495653_0075011 | |||
| 1351 | Ga0495653_0109414 | |||
| 1352 | Ga0495653_0153470 | |||
| 1353 | Ga0495650_0001179 | |||
| 1354 | Ga0495650_0021310 | |||
| 1355 | Ga0495650_0023543 | |||
| 1356 | Ga0495650_0024731 | |||
| 1357 | Ga0495650_0036242 | |||
| 1358 | Ga0495650_0040558 | |||
| 1359 | Ga0495650_0096008 | |||
| 1360 | Ga0495605_0000048 | |||
| 1361 | Ga0495605_0000094 | |||
| 1362 | Ga0495605_0001067 | |||
| 1363 | Ga0495605_0002988 | |||
| 1364 | Ga0495605_0005577 | |||
| 1365 | Ga0495605_0019091 | |||
| 1366 | Ga0495605_0027745 | |||
| 1367 | Ga0495605_0030595 | |||
| 1368 | Ga0495605_0047399 | |||
| 1369 | Ga0495605_0082438 | |||
| 1370 | Ga0495639_0014215 | |||
| 1371 | Ga0495584_0019852 | |||
| 1372 | Ga0495584_0038569 | |||
| 1373 | Ga0495584_0058589 | |||
| 1374 | Ga0495584_0150297 | |||
| 1375 | Ga0495585_0028644 | |||
| 1376 | Ga0495585_0033388 | |||
| 1377 | Ga0495585_0038594 | |||
| 1378 | Ga0495585_0053125 | |||
| 1379 | Ga0495585_0105470 | |||
| 1380 | Ga0495596_0001228 | |||
| 1381 | Ga0495596_0002112 | |||
| 1382 | Ga0495596_0063070 | |||
| 1383 | Ga0495607_0000893 | |||
| 1384 | Ga0495607_0000972 | |||
| 1385 | Ga0495607_0001113 | |||
| 1386 | Ga0495607_0001564 | |||
| 1387 | Ga0495607_0007321 | |||
| 1388 | Ga0495607_0009646 | |||
| 1389 | Ga0495607_0011176 | |||
| 1390 | Ga0495607_0016917 | |||
| 1391 | Ga0495607_0019252 | |||
| 1392 | Ga0495607_0021308 | |||
| 1393 | Ga0495607_0039860 | |||
| 1394 | Ga0495607_0042425 | |||
| 1395 | Ga0495607_0064024 | |||
| 1396 | Ga0495607_0084220 | |||
| 1397 | Ga0495607_0087591 | |||
| 1398 | Ga0495607_0096301 | |||
| 1399 | Ga0495607_0172485 | |||
| 1400 | Ga0495607_0191470 | |||
| 1401 | Ga0495583_0000096 | |||
| 1402 | Ga0495583_0002375 | |||
| 1403 | Ga0495583_0004233 | |||
| 1404 | Ga0495583_0004686 | |||
| 1405 | Ga0495583_0004830 | |||
| 1406 | Ga0495583_0008065 | |||
| 1407 | Ga0495583_0023222 | |||
| 1408 | Ga0495583_0031157 | |||
| 1409 | Ga0495606_0000076 | |||
| 1410 | Ga0495606_0000167 | |||
| 1411 | Ga0495606_0000608 | |||
| 1412 | Ga0495606_0003110 | |||
| 1413 | Ga0495606_0003580 | |||
| 1414 | Ga0495606_0003873 | |||
| 1415 | Ga0495606_0020781 | |||
| 1416 | Ga0495606_0029098 | |||
| 1417 | Ga0495606_0031245 | |||
| 1418 | Ga0495606_0035413 | |||
| 1419 | Ga0495606_0044791 | |||
| 1420 | Ga0495606_0060369 | |||
| 1421 | Ga0495606_0071520 | |||
| 1422 | Ga0495606_0105579 | |||
| 1423 | Ga0495610_0003673 | |||
| 1424 | Ga0495610_0029882 | |||
| 1425 | Ga0495610_0034875 | |||
| 1426 | Ga0495610_0042094 | |||
| 1427 | Ga0495610_0042670 | |||
| 1428 | Ga0495610_0045081 | |||
| 1429 | Ga0495616_0001347 | |||
| 1430 | Ga0495616_0010197 | |||
| 1431 | Ga0495616_0014233 | |||
| 1432 | Ga0495616_0026394 | |||
| 1433 | Ga0495616_0043632 | |||
| 1434 | Ga0495616_0044749 | |||
| 1435 | Ga0495616_0055653 | |||
| 1436 | Ga0495616_0056399 | |||
| 1437 | Ga0495616_0106807 | |||
| 1438 | Ga0495620_0000001 | |||
| 1439 | Ga0495620_0000003 | |||
| 1440 | Ga0495620_0000736 | |||
| 1441 | Ga0495620_0001383 | |||
| 1442 | Ga0495620_0010185 | |||
| 1443 | Ga0495620_0020358 | |||
| 1444 | Ga0495620_0022320 | |||
| 1445 | Ga0495620_0068247 | |||
| 1446 | Ga0495620_0071961 | |||
| 1447 | Ga0495620_0077028 | |||
| 1448 | Ga0495631_0000361 | |||
| 1449 | Ga0495631_0011216 | |||
| 1450 | Ga0495631_0013811 | |||
| 1451 | Ga0495631_0037631 | |||
| 1452 | Ga0495631_0041744 | |||
| 1453 | Ga0495632_0001293 | |||
| 1454 | Ga0495632_0009098 | |||
| 1455 | Ga0495632_0018573 | |||
| 1456 | Ga0495632_0026907 | |||
| 1457 | Ga0495632_0027921 | |||
| 1458 | Ga0495632_0032968 | |||
| 1459 | Ga0495632_0048392 | |||
| 1460 | Ga0495632_0055072 | |||
| 1461 | Ga0495632_0060055 | |||
| 1462 | Ga0495632_0068125 | |||
| 1463 | Ga0495632_0071228 | |||
| 1464 | Ga0495632_0106812 | |||
| 1465 | Ga0495632_0117266 | |||
| 1466 | Ga0495637_0000583 | |||
| 1467 | Ga0495637_0006191 | |||
| 1468 | Ga0495637_0008837 | |||
| 1469 | Ga0495637_0009658 | |||
| 1470 | Ga0495637_0010701 | |||
| 1471 | Ga0495637_0019602 | |||
| 1472 | Ga0495637_0023730 | |||
| 1473 | Ga0495637_0027828 | |||
| 1474 | Ga0495637_0034806 | |||
| 1475 | Ga0495637_0042478 | |||
| 1476 | Ga0495637_0051564 | |||
| 1477 | Ga0495637_0064442 | |||
| 1478 | Ga0495637_0117289 | |||
| 1479 | Ga0495643_0000673 | |||
| 1480 | Ga0495643_0000785 | |||
| 1481 | Ga0495643_0011714 | |||
| 1482 | Ga0495643_0034692 | |||
| 1483 | Ga0495643_0070369 | |||
| 1484 | Ga0495643_0140461 | |||
| 1485 | Ga0495643_0169472 | |||
| 1486 | Ga0495644_0005422 | |||
| 1487 | Ga0495644_0016173 | |||
| 1488 | Ga0495644_0020076 | |||
| 1489 | Ga0495644_0027817 | |||
| 1490 | Ga0495648_0008068 | |||
| 1491 | Ga0495648_0008743 | |||
| 1492 | Ga0495648_0019177 | |||
| 1493 | Ga0495648_0029004 | |||
| 1494 | Ga0495648_0030511 | |||
| 1495 | Ga0495648_0041982 | |||
| 1496 | Ga0495648_0067821 | |||
| 1497 | Ga0495648_0078373 | |||
| 1498 | Ga0495648_0078685 | |||
| 1499 | Ga0495648_0083334 | |||
| 1500 | Ga0495648_0126020 | |||
| 1501 | Ga0495648_0198136 | |||
| 1502 | Ga0495666_0019899 | |||
| 1503 | Ga0495666_0119399 | |||
| 1504 | Ga0495642_0001507 | |||
| 1505 | Ga0495642_0009207 | |||
| 1506 | Ga0495654_0001014 | |||
| 1507 | Ga0495654_0001425 | |||
| 1508 | Ga0495654_0003292 | |||
| 1509 | Ga0495654_0004160 | |||
| 1510 | Ga0495654_0015896 | |||
| 1511 | Ga0495654_0018333 | |||
| 1512 | Ga0495654_0032304 | |||
| 1513 | Ga0495654_0037006 | |||
| 1514 | Ga0495654_0041036 | |||
| 1515 | Ga0495654_0050130 | |||
| 1516 | Ga0495654_0073257 | |||
| 1517 | Ga0495654_0074100 | |||
| 1518 | Ga0495654_0083276 | |||
| 1519 | Ga0495654_0085444 | |||
| 1520 | Ga0495587_0097056 | |||
| 1521 | Ga0495587_0250428 | |||
| 1522 | Ga0495609_0000012 | |||
| 1523 | Ga0495609_0000079 | |||
| 1524 | Ga0495609_0000799 | |||
| 1525 | Ga0495609_0020773 | |||
| 1526 | Ga0495609_0024870 | |||
| 1527 | Ga0495609_0109095 | |||
| 1528 | Ga0495597_0000016 | |||
| 1529 | Ga0495597_0009148 | |||
| 1530 | Ga0495597_0015221 | |||
| 1531 | Ga0495597_0018427 | |||
| 1532 | Ga0495597_0072903 | |||
| 1533 | Ga0495597_0085496 | |||
| 1534 | Ga0495622_0015164 | |||
| 1535 | Ga0495622_0016356 | |||
| 1536 | Ga0495633_0000034 | |||
| 1537 | Ga0495633_0017328 | |||
| 1538 | Ga0495633_0024822 | |||
| 1539 | Ga0495633_0096518 | |||
| 1540 | Ga0495668_0002256 | |||
| 1541 | Ga0495668_0023584 | |||
| 1542 | Ga0495668_0026859 | |||
| 1543 | Ga0495668_0027121 | |||
| 1544 | Ga0495668_0027373 | |||
| 1545 | Ga0495668_0225564 | |||
| 1546 | Ga0495634_0043592 | |||
| 1547 | Ga0495611_0002095 | |||
| 1548 | Ga0495611_0003561 | |||
| 1549 | Ga0495611_0004112 | |||
| 1550 | Ga0495611_0040427 | |||
| 1551 | Ga0495625_0000185 | |||
| 1552 | Ga0495625_0074759 | |||
| 1553 | Ga0495625_0096238 | |||
| 1554 | Ga0495625_0099653 | |||
| 1555 | Ga0495625_0104960 | |||
| 1556 | Ga0495625_0112061 | |||
| 1557 | Ga0495625_0115766 | |||
| 1558 | Ga0495635_0038697 | |||
| 1559 | Ga0495659_0006501 | |||
| 1560 | Ga0495659_0010963 | |||
| 1561 | Ga0495661_0000004 | |||
| 1562 | Ga0495661_0000028 | |||
| 1563 | Ga0495661_0000088 | |||
| 1564 | Ga0495661_0000146 | |||
| 1565 | Ga0495661_0006678 | |||
| 1566 | Ga0495661_0007167 | |||
| 1567 | Ga0495661_0007616 | |||
| 1568 | Ga0495661_0033661 | |||
| 1569 | Ga0495661_0051739 | |||
| 1570 | Ga0495661_0064528 | |||
| 1571 | Ga0495661_0113925 | |||
| 1572 | Ga0495623_0042430 | |||
| 1573 | Ga0495669_0016942 | |||
| 1574 | Ga0495613_0145210 | |||
| 1575 | Ga0495624_0087188 | |||
| 1576 | Ga0495670_0009810 | |||
| 1577 | Ga0495670_0011441 | |||
| 1578 | Ga0495670_0093401 | |||
| 1579 | Ga0495670_0183475 | |||
| 1580 | Ga0495671_0007977 | |||
| 1581 | Ga0495671_0022459 | |||
| 1582 | Ga0495671_0026438 | |||
| 1583 | Ga0495671_0026874 | |||
| 1584 | Ga0495671_0033954 | |||
| 1585 | Ga0495671_0058828 | |||
| 1586 | Ga0495671_0059785 | |||
| 1587 | Ga0495671_0070706 | |||
| 1588 | Ga0495671_0072743 | |||
| 1589 | Ga0495649_0000445 | |||
| 1590 | Ga0495649_0000699 | |||
| 1591 | Ga0495649_0001861 | |||
| 1592 | Ga0495649_0018962 | |||
| 1593 | Ga0495649_0034226 | |||
| 1594 | Ga0495649_0041788 | |||
| 1595 | Ga0495649_0047307 | |||
| 1596 | Ga0495649_0049862 | |||
| 1597 | Ga0495649_0055490 | |||
| 1598 | Ga0495649_0083759 | |||
| 1599 | Ga0495649_0085329 | |||
| 1600 | Ga0495649_0089962 | |||
| 1601 | Ga0495649_0103200 | |||
| 1602 | Ga0495589_0002693 | |||
| 1603 | Ga0495589_0022642 | |||
| 1604 | Ga0495589_0032567 | |||
| 1605 | Ga0495589_0050517 | |||
| 1606 | Ga0495600_0074118 | |||
| 1607 | Ga0495600_0104308 | |||
| 1608 | Ga0495660_0003327 | |||
| 1609 | Ga0495660_0006173 | |||
| 1610 | Ga0495660_0020264 | |||
| 1611 | Ga0495660_0032533 | |||
| 1612 | Ga0495660_0039041 | |||
| 1613 | Ga0495660_0071840 | |||
| 1614 | Ga0495660_0079596 | |||
| 1615 | Ga0495660_0091256 | |||
| 1616 | Ga0495660_0098328 | |||
| 1617 | Ga0495660_0159451 | |||
| 1618 | Ga0495604_0074539 | |||
| 1619 | Ga0495604_0163243 | |||
| 1620 | Ga0495672_0001231 | |||
| 1621 | Ga0495672_0023814 | |||
| 1622 | Ga0495672_0026378 | |||
| 1623 | Ga0495672_0028199 | |||
| 1624 | Ga0495672_0033814 | |||
| 1625 | Ga0495672_0035798 | |||
| 1626 | Ga0495672_0045498 | |||
| 1627 | Ga0495672_0054056 | |||
| 1628 | Ga0495672_0060894 | |||
| 1629 | Ga0495672_0065070 | |||
| 1630 | Ga0495672_0084549 | |||
| 1631 | Ga0495676_0000160 | |||
| 1632 | Ga0495676_0064969 | |||
| 1633 | Ga0495676_0295111 | |||
| 1634 | Ga0495680_0059649 | |||
| 1635 | Ga0495680_0139795 | |||
| 1636 | Ga0495680_0302553 | |||
| 1637 | Ga0495683_0000034 | |||
| 1638 | Ga0495683_0000216 | |||
| 1639 | Ga0495683_0010981 | |||
| 1640 | Ga0495683_0022020 | |||
| 1641 | Ga0495683_0051853 | |||
| 1642 | Ga0495683_0089758 | |||
| 1643 | Ga0495683_0129158 | |||
| 1644 | Ga0495687_019903 | |||
| 1645 | Ga0495677_0030674 | |||
| 1646 | Ga0495679_000377 | |||
| 1647 | Ga0495679_014863 | |||
| 1648 | Ga0495679_015263 | |||
| 1649 | Ga0495679_015573 | |||
| 1650 | Ga0495679_021050 | |||
| 1651 | Ga0495679_024414 | |||
| 1652 | Ga0495679_031583 | |||
| 1653 | Ga0495685_031430 | |||
| 1654 | Ga0495673_0002712 | |||
| 1655 | Ga0495673_0006452 | |||
| 1656 | Ga0495673_0010072 | |||
| 1657 | Ga0495673_0015923 | |||
| 1658 | Ga0495673_0016934 | |||
| 1659 | Ga0495673_0033689 | |||
| 1660 | Ga0495673_0036706 | |||
| 1661 | Ga0495673_0037163 | |||
| 1662 | Ga0495673_0040815 | |||
| 1663 | Ga0495673_0042642 | |||
| 1664 | Ga0495673_0048050 | |||
| 1665 | Ga0495673_0055315 | |||
| 1666 | Ga0495673_0069862 | |||
| 1667 | Ga0495673_0087283 | |||
| 1668 | Ga0495681_0009159 | |||
| 1669 | Ga0495681_0013039 | |||
| 1670 | Ga0495681_0021377 | |||
| 1671 | Ga0495681_0025854 | |||
| 1672 | Ga0495681_0030486 | |||
| 1673 | Ga0495681_0042194 | |||
| 1674 | Ga0495681_0044007 | |||
| 1675 | Ga0495681_0075821 | |||
| 1676 | Ga0495681_0079196 | |||
| 1677 | Ga0495684_0146740 | |||
| 1678 | Ga0495686_0011832 | |||
| 1679 | Ga0495686_0029647 | |||
| 1680 | Ga0495686_0099960 | |||
| 1681 | Ga0495686_0167550 | |||
| 1682 | Ga0495593_0035166 | |||
| 1683 | Ga0495593_0060514 | |||
| 1684 | Ga0495602_0163305 | |||
| 1685 | Ga0495626_0000125 | |||
| 1686 | Ga0495626_0001796 | |||
| 1687 | Ga0495626_0004821 | |||
| 1688 | Ga0495626_0019437 | |||
| 1689 | Ga0495626_0019580 | |||
| 1690 | Ga0495626_0026534 | |||
| 1691 | Ga0495626_0037187 | |||
| 1692 | Ga0495626_0047813 | |||
| 1693 | Ga0495626_0063581 | |||
| 1694 | Ga0495626_0077874 | |||
| 1695 | Ga0496102_0065015 | |||
| 1696 | Ga0496102_0208392 | |||
| 1697 | Ga0496110_0049992 | |||
| 1698 | Ga0496110_0175404 | |||
| 1699 | Ga0496115_0000372 | |||
| 1700 | Ga0496116_0001043 | |||
| 1701 | Ga0496116_0004638 | |||
| 1702 | Ga0496116_0018663 | |||
| 1703 | Ga0496116_0069705 | |||
| 1704 | Ga0496116_0100650 | |||
| 1705 | Ga0496116_0142693 | |||
| 1706 | Ga0496117_0047000 | |||
| 1707 | Ga0496117_0050821 | |||
| 1708 | Ga0496117_0053566 | |||
| 1709 | Ga0496117_0067336 | |||
| 1710 | Ga0496117_0086027 | |||
| 1711 | Ga0496117_0091099 | |||
| 1712 | Ga0496117_0094012 | |||
| 1713 | Ga0496118_0044010 | |||
| 1714 | Ga0496118_0071816 | |||
| 1715 | Ga0496118_0086981 | |||
| 1716 | Ga0496118_0144446 | |||
| 1717 | Ga0496118_0181456 | |||
| 1718 | Ga0496120_0122213 | |||
| 1719 | Ga0496120_0142244 | |||
| 1720 | Ga0496121_0002337 | |||
| 1721 | Ga0496121_0004179 | |||
| 1722 | Ga0496121_0038182 | |||
| 1723 | Ga0496121_0097272 | |||
| 1724 | Ga0496122_0021670 | |||
| 1725 | Ga0496122_0026521 | |||
| 1726 | Ga0496122_0046468 | |||
| 1727 | Ga0496122_0072157 | |||
| 1728 | Ga0496122_0077118 | |||
| 1729 | Ga0496122_0164504 | |||
| 1730 | Ga0496123_0001511 | |||
| 1731 | Ga0496123_0041688 | |||
| 1732 | Ga0496123_0059724 | |||
| 1733 | Ga0496123_0104605 | |||
| 1734 | Ga0496123_0105572 | |||
| 1735 | Ga0496123_0109509 | |||
| 1736 | Ga0496123_0118448 | |||
| 1737 | Ga0496124_0001524 | |||
| 1738 | Ga0496124_0001773 | |||
| 1739 | Ga0496124_0033048 | |||
| 1740 | Ga0496124_0054267 | |||
| 1741 | Ga0496124_0062509 | |||
| 1742 | Ga0496124_0063450 | |||
| 1743 | Ga0496124_0075351 | |||
| 1744 | Ga0496124_0239997 | |||
| 1745 | Ga0496125_0091942 | |||
| 1746 | Ga0496125_0115071 | |||
| 1747 | Ga0496125_0165927 | |||
| 1748 | Ga0496125_0231127 | |||
| 1749 | Ga0496126_0032090 | |||
| 1750 | Ga0496126_0092027 | |||
| 1751 | Ga0496126_0125710 | |||
| 1752 | Ga0495678_000049 | |||
| 1753 | Ga0495678_000918 | |||
| 1754 | Ga0495678_001783 | |||
| 1755 | Ga0495678_016655 | |||
| 1756 | Ga0495678_016849 | |||
| 1757 | Ga0495678_017909 | |||
| 1758 | Ga0495678_019253 | |||
| 1759 | Ga0495678_032576 | |||
| 1760 | Ga0495678_042946 | |||
| 1761 | Ga0495678_062025 | |||
| 1762 | Ga0495678_074266 | |||
| 1763 | Ga0495678_080216 | |||
| 1764 | Ga0495682_0000153 | |||
| 1765 | Ga0495682_0004151 | |||
| 1766 | Ga0495682_0020304 | |||
| 1767 | Ga0495682_0021639 | |||
| 1768 | Ga0495682_0042657 | |||
| 1769 | Ga0495682_0065185 | |||
| 1770 | Ga0495682_0086038 | |||
| 1771 | Ga0501031_0111953 | |||
| 1772 | Ga0501037_0302412 | |||
| 1773 | Ga0501222_004172 | |||
| 1774 | Ga0501241_004405 | |||
| 1775 | Ga0501226_000017 | |||
| 1776 | nmdc:mga03683_112256_c1 | |||
| 1777 | nmdc:mga03683_2291_c1 | |||
| 1778 | nmdc:mga00v17_117429_c1 | |||
| 1779 | nmdc:mga0sz30_19496_c1 | |||
| 1780 | Ga0500572_004688 | |||
| 1781 | Ga0500618_025028 | |||
| 1782 | Ga0500573_0040451 | |||
| 1783 | Ga0500552_001318 | |||
| 1784 | 2510285141 | |||
| 1785 | 2510294022 | |||
| 1786 | 2510313056 | |||
| 1787 | 2511254580 | |||
| 1788 | 2511266622 | |||
| 1789 | 2511270760 | |||
| 1790 | 2511276672 | |||
| 1791 | 2511293035 | |||
| 1792 | 2511296267 | |||
| 1793 | 2511301895 | |||
| 1794 | 2511321007 | |||
| 1795 | 2511323983 | |||
| 1796 | 2511331572 | |||
| 1797 | 2511339038 | |||
| 1798 | 2511345000 | |||
| 1799 | 2511349346 | |||
| 1800 | 2511356449 | |||
| 1801 | 2511364427 | |||
| 1802 | 2511370195 | |||
| 1803 | 2511414636 | |||
| 1804 | 2511826349 | |||
| 1805 | 2512324148 | |||
| 1806 | 2555671408 | |||
| 1807 | 2583793818 | |||
| 1808 | 2597859492 | |||
| 1809 | 2599328589 | |||
| 1810 | 2599354435 | |||
| 1811 | 2599359851 | |||
| 1812 | 2599366173 | |||
| 1813 | 2599372963 | |||
| 1814 | 2599379543 | |||
| 1815 | 2599385479 | |||
| 1816 | 2599391822 | |||
| 1817 | 2599401751 | |||
| 1818 | 2599403588 | |||
| 1819 | 2599451604 | |||
| 1820 | 2599461269 | |||
| 1821 | 2599469813 | |||
| 1822 | 2599482322 | |||
| 1823 | 2599490289 | |||
| 1824 | 2599504152 | |||
| 1825 | 2599514995 | |||
| 1826 | 2599521096 | |||
| 1827 | 2599613438 | |||
| 1828 | 2599772342 | |||
| 1829 | 2599803959 | |||
| 1830 | 2599882322 | |||
| 1831 | 2599888936 | |||
| 1832 | 2599894204 | |||
| 1833 | 2599900565 | |||
| 1834 | 2599935183 | |||
| 1835 | 2599943961 | |||
| 1836 | 2599952269 | |||
| 1837 | 2599955827 | |||
| 1838 | 2599961461 | |||
| 1839 | 2599969861 | |||
| 1840 | 2599974282 | |||
| 1841 | 2599981469 | |||
| 1842 | 2599985628 | |||
| 1843 | 2599989551 | |||
| 1844 | 2599994422 | |||
| 1845 | 2600000103 | |||
| 1846 | 2600009082 | |||
| 1847 | 2600015290 | |||
| 1848 | 2600019597 | |||
| 1849 | 2600023716 | |||
| 1850 | 2600032362 | |||
| 1851 | 2600038805 | |||
| 1852 | 2600044152 | |||
| 1853 | 2600048358 | |||
| 1854 | 2600054107 | |||
| 1855 | 2600060327 | |||
| 1856 | 2600066583 | |||
| 1857 | 2600074366 | |||
| 1858 | 2600078109 | |||
| 1859 | 2600213885 | |||
| 1860 | 2600361924 | |||
| 1861 | 2600364396 | |||
| 1862 | 2600443128 | |||
| 1863 | 2601626575 | |||
| 1864 | 2601774051 | |||
| 1865 | 2601795595 | |||
| 1866 | 2602009383 | |||
| 1867 | 2606075664 | |||
| 1868 | 2606128423 | |||
| 1869 | 2608384633 | |||
| 1870 | 2621300746 | |||
| 1871 | 2624479533 | |||
| 1872 | 2624493456 | |||
| 1873 | 2643842742 | |||
| 1874 | 2643952665 | |||
| 1875 | 2644022427 | |||
| 1876 | 2644187451 | |||
| 1877 | 2644281828 | |||
| 1878 | 2652544525 | |||
| 1879 | 2671093226 | |||
| 1880 | 2671097016 | |||
| 1881 | 2671128910 | |||
| 1882 | 2671770473 | |||
| 1883 | 2678264698 | |||
| 1884 | 2715753934 | |||
| 1885 | 2715757799 | |||
| 1886 | 2718633362 | |||
| 1887 | 2738670636 | |||
| 1888 | 2738691390 | |||
| 1889 | 2738749029 | |||
| 1890 | 2738812224 | |||
| 1891 | 2738858071 | |||
| 1892 | 2738899584 | |||
| 1893 | 2739201234 | |||
| 1894 | 2739262423 | |||
| 1895 | 2739267165 | |||
| 1896 | 2739286272 | |||
| 1897 | 2739291585 | |||
| 1898 | 2739316194 | |||
| 1899 | 2743739022 | |||
| 1900 | 2745005152 | |||
| 1901 | 2774123429 | |||
| 1902 | 2774128233 | |||
| 1903 | 2774138423 | |||
| 1904 | 2784316029 | |||
| 1905 | 2794595040 | |||
| 1906 | 2808857098 | |||
| 1907 | 2808907254 | |||
| 1908 | 2808926676 | |||
| 1909 | 2808927462 | |||
| 1910 | 2808937170 | |||
| 1911 | 2808940647 | |||
| 1912 | 2808948837 | |||
| 1913 | 2808949999 | |||
| 1914 | 2808957284 | |||
| 1915 | 2808965486 | |||
| 1916 | 2808980914 | |||
| 1917 | 2808996638 | |||
| 1918 | 2809000273 | |||
| 1919 | 2809216476 | |||
| 1920 | 2812368079 | |||
| 1921 | 2817490014 | |||
| 1922 | 2819654697 | |||
| 1923 | 2819702110 | |||
| 1924 | 2823424758 | |||
| 1925 | 2825656415 | |||
| 1926 | 2826584501 | |||
| 1927 | 2834029819 | |||
| 1928 | 2842805561 | |||
| 1929 | 2842818055 | |||
| 1930 | 2842832596 | |||
| 1931 | 2842849309 | |||
| 1932 | 2842856800 | |||
| 1933 | 2844671928 | |||
| 1934 | 2852617639 | |||
| 1935 | 2852659019 | |||
| 1936 | 2852672997 | |||
| 1937 | 2860339918 | |||
| 1938 | 2880232409 | |||
| 1939 | 2904523900 | |||
| 1940 | 2908448768 | |||
| 1941 | 2912967695 | |||
| 1942 | 2913041172 | |||
| 1943 | 2917075274 | |||
| 1944 | 2917835417 | |||
| 1945 | 2919129251 | |||
| 1946 | 2919386500 | |||
| 1947 | 2919457013 | |||
| 1948 | 2919486066 | |||
| 1949 | 2919491217 | |||
| 1950 | 2919504484 | |||
| 1951 | 2919699279 | |||
| 1952 | 2923158101 | |||
| 1953 | 2923522132 | |||
| 1954 | 2923590156 | |||
| 1955 | 2926064943 | |||
| 1956 | 2928963945 | |||
| 1957 | 2929148625 | |||
| 1958 | 2931373936 | |||
| 1959 | 2931392890 | |||
| 1960 | 2931400188 | |||
| 1961 | 2935356262 | |||
| 1962 | 2939639645 | |||
| 1963 | 2939655843 | |||
| 1964 | 2945965022 | |||
| 1965 | 2946010962 | |||
| 1966 | 2969306321 | |||
| 1967 | 2974292025 | |||
| 1968 | 2974299610 | |||
| 1969 | 2984288077 | |||
| 1970 | 2984501967 | |||
| 1971 | 2984504534 | |||
| 1972 | 2988730214 | |||
| 1973 | 2990200195 | |||
| 1974 | 2998141716 | |||
| 1975 | 3007253446 | |||
| 1976 | 3007317747 | |||
| 1977 | 3007397404 | |||
| 1978 | 3007424563 | |||
| 1979 | 3007515670 | |||
| 1980 | 3007618761 | |||
| 1981 | 3007625501 | |||
| 1982 | 3007719387 | |||
| 1983 | 3007856307 | |||
| 1984 | 3007863046 | |||
| 1985 | 3007870557 | |||
| 1986 | 637321730 | |||
| 1987 | 8011353882 | |||
| 1988 | 8015692197 | |||
| 1989 | 8016733658 | |||
| 1990 | 8019776451 | |||
| 1991 | 8034962735 | |||
| 1992 | 8054285616 | |||
| 1993 | 8054505387 | |||
| 1994 | 8055775406 | |||
| 1995 | 8055819956 | |||
| 1996 | 8056130090 | |||
| 1997 | 8056133726 | |||
| 1998 | 8056144757 | |||
| 1999 | 8056156134 | |||
| 2000 | 8056169277 | |||
| 2001 | 8056175464 | |||
| 2002 | 8056181240 | |||
| 2003 | 8056571449 | |||
| 2004 | 8057804222 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oby-assembly2.cif.gz_C | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9741 | 1 | 285 |
| 2j8z-assembly1.cif.gz_A-2 | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9713 | 1 | 285 |
| 4dup-assembly1.cif.gz_A | crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 | 0.9696 | 2 | 286 |
| 2oby-assembly2.cif.gz_C | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9511 | 1 | 285 |
| 4dup-assembly1.cif.gz_B | crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 | 0.9508 | 2 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6HNQ2_3_340_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9785 | 1 | 286 | 3.90.180.10 |
| af_C6TID4_1_124_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9759 | 4 | 89 | 3.90.180.10 |
| af_Q4DAS0_3_129_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9747 | 4 | 88 | 3.90.180.10 |
| af_A0A1D6HNQ2_126_296_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9678 | 89 | 242 | 3.40.50.720 |
| af_Q75JT6_1_334_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9634 | 1 | 285 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A803NY03-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9824 | 1 | 286 |
GO:0016651
GO:0034045 GO:0070402 |
| AF-A0A0S6UP13-F1-model_v4 | Quinone oxidoreductase | 0.9796 | 1 | 286 |
GO:0016651
GO:0070402 |
| AF-A0A445BBA4-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9789 | 1 | 287 |
GO:0008270
GO:0016651 GO:0070402 |
| AF-A0A7J6HSH9-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9786 | 1 | 289 |
GO:0016020
GO:0016651 GO:0070402 |
| AF-A0A1B1BLD5-F1-model_v4 | NADPH:quinone oxidoreductase | 0.978 | 1 | 286 |
GO:0016651
GO:0070402 |