F487928

General Info

Members Datasets Scaffolds Average Seq Length
1003 519 2006 103

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10453065|Ga0105244_104530651
Length 116
Sequence MYAIVKTGGKQYKVAVDDVVTVEKIDGAPGDEISLVPVLLVDGEDLTTAADALASATVSAKVVEHTKGPKIRIHKFKNKTGYHKRQGHRQPLTQVKVTGISASSRAEQRGNSSSGK

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
26 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
123 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
124 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
128 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
129 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
130 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
131 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
147 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
153 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
160 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
220 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
221 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
222 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
223 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
224 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
225 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
226 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
227 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
232 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
247 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
248 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
253 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
259 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
260 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
272 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
273 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
274 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
275 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
276 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
277 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
278 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
279 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
280 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
281 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
282 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
283 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
284 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
285 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
286 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
287 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
288 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
289 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
290 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
293 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
294 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
295 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
296 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
297 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
298 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
299 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
300 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
301 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
302 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
303 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
304 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
305 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
306 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
307 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
308 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
309 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
310 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
311 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
312 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
313 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
314 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
315 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
316 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
317 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
318 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
321 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
325 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
326 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
327 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
328 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
329 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
330 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
331 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
334 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
341 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
342 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
343 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
344 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
361 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
362 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
363 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
364 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
365 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
366 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
367 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
368 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
369 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
392 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
393 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
394 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
395 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
398 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
401 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
406 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
407 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
408 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
409 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
410 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
411 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
412 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
413 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
414 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
415 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
416 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
417 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
418 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
419 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
422 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
423 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
424 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
425 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
426 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
427 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
428 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
429 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
470 2501939600 Micromonospora sp. L5 Isolate Unclassified
471 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
472 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
473 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
474 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
475 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
476 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
477 2558860280 Kutzneria sp. 744 Isolate Unclassified
478 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
479 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
480 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
481 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
482 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
483 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
484 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
485 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
486 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
487 2855683550 Micromonospora sp. RP3T Isolate Unclassified
488 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
489 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
490 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
491 2858882152 Micromonospora noduli MED15 Isolate Nodule
492 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
493 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
494 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
495 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
496 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
497 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
498 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
499 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
500 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
501 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
502 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
503 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
504 2902582711 Micromonospora sp. AP08 Isolate Unclassified
505 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
506 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
507 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
508 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
509 649633069 Micromonospora sp. L5 Isolate Unclassified
510 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
511 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
512 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
513 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
514 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
515 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
516 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
517 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
518 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
519 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.98
Metatranscriptomes 23.03
Isolates 4.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0.6
Rhizoplane 4.39
Rhizosphere 83.95
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10453065 3300009036 Bacteria 590
2 2214744876 2209111006 Bacteria 501
3 LJQas_1014194 3300000549 Bacteria 935
4 JGI24739J22299_10240319 3300001989 Bacteria 530
5 JGI24745J21846_1036060 3300002073 Bacteria 605
6 JGI24034J26672_10058467 3300002239 Bacteria 673
7 Ga0006778J45830_1009023 3300003162 Bacteria 551
8 Ga0006778J45830_1016377 3300003162 Bacteria 570
9 Ga0006778J45830_1041840 3300003162 Bacteria 680
10 Ga0006759J45824_1013206 3300003163 Bacteria 618
11 Ga0006759J45824_1014821 3300003163 Bacteria 731
12 JGI25406J46586_10009537 3300003203 Bacteria 4346
13 JGI25406J46586_10011374 3300003203 Bacteria 3906
14 JGI25406J46586_10088159 3300003203 Bacteria 940
15 JGI25406J46586_10123475 3300003203 Bacteria 761
16 rootH2_10085212 3300003320 Bacteria 1467
17 Ga0007417J51691_1007731 3300003544 Bacteria 625
18 Ga0007417J51691_1036457 3300003544 Bacteria 529
19 Ga0007417J51691_1036609 3300003544 Bacteria 732
20 Ga0007417J51691_1037507 3300003544 Bacteria 505
21 Ga0007427J51700_104985 3300003559 Bacteria 508
22 Ga0006781J51513_1010662 3300003568 Bacteria 597
23 Ga0006781J51513_1029898 3300003568 Bacteria 724
24 Ga0007410J51695_1032791 3300003574 Bacteria 743
25 Ga0007410J51695_1047814 3300003574 Bacteria 697
26 Ga0007409J51694_1033305 3300003575 Bacteria 730
27 Ga0007409J51694_1042642 3300003575 Bacteria 550
28 Ga0007416J51690_1011182 3300003577 Bacteria 502
29 Ga0007416J51690_1034645 3300003577 Bacteria 725
30 Ga0007416J51690_1057945 3300003577 Bacteria 698
31 Ga0007429J51699_1014261 3300003579 Bacteria 674
32 Ga0007429J51699_1029843 3300003579 Bacteria 722
33 Ga0007429J51699_1056898 3300003579 Bacteria 796
34 Ga0007429J51699_1057006 3300003579 Bacteria 657
35 Ga0007429J51699_1059000 3300003579 Bacteria 692
36 JGI25404J52841_10068869 3300003659 Bacteria 740
37 Ga0032354_1007423 3300003693 Bacteria 622
38 Ga0032354_1034419 3300003693 Bacteria 727
39 Ga0032354_1059346 3300003693 Bacteria 659
40 Ga0032354_1070627 3300003693 Bacteria 728
41 Ga0006780_1008494 3300003735 Bacteria 705
42 Ga0006780_1016201 3300003735 Bacteria 617
43 Ga0006780_1026420 3300003735 Bacteria 670
44 Ga0006780_1027665 3300003735 Bacteria 659
45 Ga0058858_1385167 3300004785 Bacteria 512
46 Ga0058859_10043114 3300004798 Bacteria 829
47 Ga0058859_10045571 3300004798 Bacteria 661
48 Ga0058859_11823711 3300004798 Bacteria 731
49 Ga0058859_11831572 3300004798 Bacteria 554
50 Ga0058863_10016284 3300004799 Bacteria 802
51 Ga0058863_11874610 3300004799 Bacteria 691
52 Ga0058861_10006413 3300004800 Bacteria 613
53 Ga0058861_10034986 3300004800 Bacteria 578
54 Ga0058861_10046471 3300004800 Bacteria 623
55 Ga0058861_11988158 3300004800 Bacteria 871
56 Ga0058860_10003778 3300004801 Bacteria 772
57 Ga0058860_10010621 3300004801 Bacteria 710
58 Ga0058860_10085527 3300004801 Bacteria 702
59 Ga0058860_12242734 3300004801 Bacteria 598
60 Ga0058862_10078798 3300004803 Bacteria 805
61 Ga0058862_10083481 3300004803 Bacteria 660
62 Ga0058862_10152929 3300004803 Bacteria 659
63 Ga0070658_10005407 3300005327 Bacteria 10364
64 Ga0070658_10470811 3300005327 Bacteria 1084
65 Ga0070658_10625737 3300005327 Bacteria 933
66 Ga0070658_11405653 3300005327 Bacteria 605
67 Ga0070676_10714872 3300005328 Bacteria 733
68 Ga0070676_11021511 3300005328 Bacteria 621
69 Ga0070683_100826319 3300005329 Bacteria 888
70 Ga0070683_100871583 3300005329 Bacteria 863
71 Ga0070683_100933687 3300005329 Bacteria 833
72 Ga0070683_101091467 3300005329 Bacteria 767
73 Ga0070690_100458257 3300005330 Bacteria 947
74 Ga0070670_100054419 3300005331 Bacteria 3436
75 Ga0070670_100984546 3300005331 Bacteria 766
76 Ga0070670_101735610 3300005331 Bacteria 574
77 Ga0070677_10702317 3300005333 Bacteria 570
78 Ga0068869_100002500 3300005334 Bacteria 11085
79 Ga0068869_100265062 3300005334 Bacteria 1376
80 Ga0068869_100346208 3300005334 Bacteria 1210
81 Ga0068869_100376417 3300005334 Bacteria 1163
82 Ga0068869_102124055 3300005334 Bacteria 505
83 Ga0070666_10111724 3300005335 Bacteria 1890
84 Ga0070680_100464388 3300005336 Bacteria 1082
85 Ga0070680_100485254 3300005336 Bacteria 1056
86 Ga0070680_100637339 3300005336 Bacteria 915
87 Ga0070680_101082942 3300005336 Bacteria 692
88 Ga0070682_100167871 3300005337 Bacteria 1522
89 Ga0070682_100497853 3300005337 Bacteria 944
90 Ga0070682_100936204 3300005337 Bacteria 714
91 Ga0068868_100474765 3300005338 Bacteria 1091
92 Ga0070660_100308392 3300005339 Bacteria 1298
93 Ga0070660_100712854 3300005339 Bacteria 841
94 Ga0070689_101058379 3300005340 Bacteria 724
95 Ga0070687_100032777 3300005343 Bacteria 2559
96 Ga0070687_100092980 3300005343 Bacteria 1672
97 Ga0070687_100442326 3300005343 Bacteria 863
98 Ga0070661_100006334 3300005344 Bacteria 8165
99 Ga0070661_100341267 3300005344 Bacteria 1173
100 Ga0070661_100370410 3300005344 Bacteria 1127
101 Ga0070661_100737984 3300005344 Bacteria 804
102 Ga0070692_10369427 3300005345 Bacteria 897
103 Ga0070692_11012353 3300005345 Bacteria 582
104 Ga0070668_100000590 3300005347 Bacteria 24324
105 Ga0070668_100314078 3300005347 Bacteria 1318
106 Ga0070668_100352577 3300005347 Bacteria 1246
107 Ga0070668_100726423 3300005347 Bacteria 877
108 Ga0070669_100115761 3300005353 Bacteria 2040
109 Ga0070675_100002055 3300005354 Bacteria 14941
110 Ga0070675_100190511 3300005354 Bacteria 1777
111 Ga0070675_100627890 3300005354 Bacteria 976
112 Ga0070671_100002585 3300005355 Bacteria 14021
113 Ga0070674_100414612 3300005356 Bacteria 1103
114 Ga0070674_101030568 3300005356 Bacteria 723
115 Ga0070674_101299798 3300005356 Bacteria 648
116 Ga0070674_101565720 3300005356 Bacteria 594
117 Ga0070688_100733883 3300005365 Bacteria 768
118 Ga0070659_100166722 3300005366 Bacteria 1803
119 Ga0070659_100604768 3300005366 Bacteria 942
120 Ga0070667_100126394 3300005367 Bacteria 2228
121 Ga0070667_100164713 3300005367 Bacteria 1955
122 Ga0070667_100432841 3300005367 Bacteria 1200
123 Ga0070667_100972086 3300005367 Bacteria 792
124 Ga0070709_10404720 3300005434 Bacteria 1020
125 Ga0070714_100399422 3300005435 Bacteria 1299
126 Ga0070714_100536709 3300005435 Bacteria 1119
127 Ga0070713_100113101 3300005436 Bacteria 2369
128 Ga0070713_100511581 3300005436 Bacteria 1134
129 Ga0070713_101370933 3300005436 Bacteria 685
130 Ga0070710_11124928 3300005437 Bacteria 578
131 Ga0070701_10239972 3300005438 Bacteria 1090
132 Ga0070701_10406859 3300005438 Bacteria 863
133 Ga0070705_100987385 3300005440 Bacteria 683
134 Ga0070700_100109967 3300005441 Bacteria 1831
135 Ga0070700_100295851 3300005441 Bacteria 1180
136 Ga0070700_100571114 3300005441 Bacteria 882
137 Ga0070700_100586016 3300005441 Bacteria 872
138 Ga0070708_101579300 3300005445 Bacteria 611
139 Ga0070708_102098192 3300005445 Bacteria 523
140 Ga0070663_100024264 3300005455 Bacteria 4079
141 Ga0070663_100184012 3300005455 Bacteria 1622
142 Ga0070678_100143704 3300005456 Bacteria 1913
143 Ga0070678_100398905 3300005456 Bacteria 1194
144 Ga0070678_100936525 3300005456 Bacteria 793
145 Ga0070662_100003769 3300005457 Bacteria 9485
146 Ga0070681_10036758 3300005458 Bacteria 4917
147 Ga0070681_10324639 3300005458 Bacteria 1449
148 Ga0070681_10439495 3300005458 Bacteria 1216
149 Ga0068867_100792016 3300005459 Bacteria 845
150 Ga0070685_10058492 3300005466 Bacteria 2247
151 Ga0070685_10172560 3300005466 Bacteria 1387
152 Ga0070685_10260667 3300005466 Bacteria 1152
153 Ga0070685_11356243 3300005466 Bacteria 545
154 Ga0070707_100871511 3300005468 Bacteria 865
155 Ga0070698_100894043 3300005471 Bacteria 834
156 Ga0070679_100016277 3300005530 Bacteria 7166
157 Ga0070679_100222880 3300005530 Bacteria 1846
158 Ga0070679_100943019 3300005530 Bacteria 807
159 Ga0070684_100138123 3300005535 Bacteria 2202
160 Ga0070684_100266548 3300005535 Bacteria 1567
161 Ga0070684_101171883 3300005535 Bacteria 723
162 Ga0068853_100406738 3300005539 Bacteria 1275
163 Ga0068853_100628804 3300005539 Bacteria 1021
164 Ga0070672_100507706 3300005543 Bacteria 1043
165 Ga0070672_101859996 3300005543 Bacteria 542
166 Ga0070686_101685403 3300005544 Bacteria 538
167 Ga0070696_101735053 3300005546 Bacteria 539
168 Ga0070693_100099800 3300005547 Bacteria 1767
169 Ga0070693_100309508 3300005547 Bacteria 1068
170 Ga0070693_100617661 3300005547 Bacteria 784
171 Ga0070665_100005910 3300005548 Bacteria 12537
172 Ga0070665_100233199 3300005548 Bacteria 1841
173 Ga0070665_100821318 3300005548 Bacteria 943
174 Ga0070665_100963511 3300005548 Bacteria 865
175 Ga0070665_101174394 3300005548 Bacteria 778
176 Ga0070665_101257487 3300005548 Bacteria 750
177 Ga0070665_101598516 3300005548 Bacteria 660
178 Ga0070704_101972481 3300005549 Bacteria 542
179 Ga0068855_100434995 3300005563 Bacteria 1433
180 Ga0068855_100604971 3300005563 Bacteria 1182
181 Ga0070664_100009670 3300005564 Bacteria 7823
182 Ga0070664_100064658 3300005564 Bacteria 3120
183 Ga0070664_100161857 3300005564 Bacteria 1980
184 Ga0070664_100555630 3300005564 Bacteria 1062
185 Ga0070664_100587223 3300005564 Bacteria 1032
186 Ga0070664_101047315 3300005564 Bacteria 767
187 Ga0068857_100060657 3300005577 Bacteria 3360
188 Ga0068857_100201896 3300005577 Bacteria 1812
189 Ga0068857_100213364 3300005577 Bacteria 1762
190 Ga0068857_100558759 3300005577 Bacteria 1079
191 Ga0068857_101470352 3300005577 Bacteria 664
192 Ga0068857_101622646 3300005577 Bacteria 631
193 Ga0068857_101658876 3300005577 Bacteria 625
194 Ga0068854_100065864 3300005578 Bacteria 2635
195 Ga0068854_100703324 3300005578 Bacteria 872
196 Ga0068854_102178772 3300005578 Bacteria 512
197 Ga0068856_100420401 3300005614 Bacteria 1356
198 Ga0068856_100510156 3300005614 Bacteria 1224
199 Ga0068856_100556139 3300005614 Bacteria 1169
200 Ga0068856_100665689 3300005614 Bacteria 1062
201 Ga0070702_100057530 3300005615 Bacteria 2249
202 Ga0070702_100261013 3300005615 Bacteria 1179
203 Ga0070702_100289858 3300005615 Bacteria 1127
204 Ga0070702_100614966 3300005615 Bacteria 817
205 Ga0068852_100190769 3300005616 Bacteria 1934
206 Ga0068852_100308948 3300005616 Bacteria 1532
207 Ga0068859_100385328 3300005617 Bacteria 1497
208 Ga0068859_100572094 3300005617 Bacteria 1224
209 Ga0068859_100778888 3300005617 Bacteria 1045
210 Ga0068859_102656885 3300005617 Bacteria 550
211 Ga0068864_100080993 3300005618 Bacteria 2845
212 Ga0068864_100703296 3300005618 Bacteria 987
213 Ga0068864_100830671 3300005618 Bacteria 909
214 Ga0068864_101824209 3300005618 Bacteria 614
215 Ga0068866_10586168 3300005718 Bacteria 751
216 Ga0068861_100058071 3300005719 Bacteria 2958
217 Ga0068861_100552459 3300005719 Bacteria 1049
218 Ga0068861_100977619 3300005719 Bacteria 806
219 Ga0068861_101585484 3300005719 Bacteria 645
220 Ga0068851_10343743 3300005834 Bacteria 866
221 Ga0068863_100002283 3300005841 Bacteria 19063
222 Ga0068863_100023910 3300005841 Bacteria 5831
223 Ga0068863_100359361 3300005841 Bacteria 1419
224 Ga0068863_101234369 3300005841 Bacteria 754
225 Ga0068863_101798098 3300005841 Bacteria 623
226 Ga0068863_102341471 3300005841 Bacteria 544
227 Ga0068858_100579055 3300005842 Bacteria 1088
228 Ga0068858_100947657 3300005842 Bacteria 842
229 Ga0068860_100041221 3300005843 Bacteria 4410
230 Ga0068860_100218746 3300005843 Bacteria 1849
231 Ga0068862_100171644 3300005844 Bacteria 1942
232 Ga0068862_100175192 3300005844 Bacteria 1922
233 Ga0068862_100686570 3300005844 Bacteria 991
234 Ga0068862_101150884 3300005844 Bacteria 773
235 Ga0081455_10067796 3300005937 Bacteria 2972
236 Ga0081455_10814569 3300005937 Bacteria 585
237 Ga0081538_10258058 3300005981 Bacteria 660
238 Ga0081540_1003296 3300005983 Bacteria 12805
239 Ga0081540_1008757 3300005983 Bacteria 7036
240 Ga0081540_1283097 3300005983 Bacteria 572
241 Ga0081539_10000682 3300005985 Bacteria 67986
242 Ga0081539_10001171 3300005985 Bacteria 47476
243 Ga0081539_10002170 3300005985 Bacteria 28828
244 Ga0081539_10006340 3300005985 Bacteria 11401
245 Ga0081539_10020403 3300005985 Bacteria 4480
246 Ga0081539_10198185 3300005985 Bacteria 930
247 Ga0081539_10416293 3300005985 Bacteria 558
248 Ga0070717_10843886 3300006028 Bacteria 834
249 Ga0070717_11346416 3300006028 Bacteria 649
250 Ga0075364_10177057 3300006051 Bacteria 1443
251 Ga0075432_10437413 3300006058 Bacteria 572
252 Ga0070716_100252708 3300006173 Bacteria 1202
253 Ga0070712_100970098 3300006175 Bacteria 735
254 Ga0070712_101363018 3300006175 Bacteria 618
255 Ga0097621_100727152 3300006237 Bacteria 915
256 Ga0068871_100314868 3300006358 Bacteria 1376
257 Ga0075428_100278660 3300006844 Bacteria 1799
258 Ga0075428_102406418 3300006844 Bacteria 541
259 Ga0075430_100616051 3300006846 Bacteria 895
260 Ga0075430_100762342 3300006846 Bacteria 797
261 Ga0075431_100068735 3300006847 Bacteria 3655
262 Ga0075431_101295915 3300006847 Bacteria 689
263 Ga0075431_101597553 3300006847 Bacteria 610
264 Ga0075431_101913437 3300006847 Bacteria 549
265 Ga0075434_102293646 3300006871 Bacteria 543
266 Ga0075429_100089212 3300006880 Bacteria 2687
267 Ga0075429_100557017 3300006880 Bacteria 1005
268 Ga0075429_100668930 3300006880 Bacteria 910
269 Ga0068865_100413367 3300006881 Bacteria 1107
270 Ga0097620_100385341 3300006931 Bacteria 1497
271 Ga0097620_100572103 3300006931 Bacteria 1224
272 Ga0097620_100778945 3300006931 Bacteria 1045
273 Ga0097620_102656899 3300006931 Bacteria 550
274 Ga0075435_101392319 3300007076 Bacteria 615
275 Ga0105251_10330246 3300009011 Bacteria 694
276 Ga0105244_10270956 3300009036 Bacteria 789
277 Ga0105250_10173063 3300009092 Bacteria 904
278 Ga0111539_10025315 3300009094 Bacteria 7274
279 Ga0111539_11939622 3300009094 Bacteria 683
280 Ga0105245_10074465 3300009098 Bacteria 3090
281 Ga0105245_11397817 3300009098 Bacteria 750
282 Ga0114129_10000056 3300009147 Bacteria 99329
283 Ga0114129_10062051 3300009147 Bacteria 5222
284 Ga0114129_11138613 3300009147 Bacteria 975
285 Ga0114129_12295499 3300009147 Bacteria 648
286 Ga0105243_10466530 3300009148 Bacteria 1188
287 Ga0105242_12178815 3300009176 Bacteria 599
288 Ga0105248_10212790 3300009177 Bacteria 2178
289 Ga0105248_10502943 3300009177 Bacteria 1366
290 Ga0105248_12677037 3300009177 Bacteria 569
291 Ga0105237_10597377 3300009545 Bacteria 1111
292 Ga0105237_11468134 3300009545 Bacteria 688
293 Ga0105238_10479737 3300009551 Bacteria 1243
294 Ga0105238_10517128 3300009551 Bacteria 1196
295 Ga0105249_10556529 3300009553 Bacteria 1198
296 Ga0105249_11371881 3300009553 Bacteria 779
297 Ga0105249_12470939 3300009553 Bacteria 592
298 Ga0130084_1120475 3300009835 Bacteria 545
299 Ga0105032_101594 3300009979 Bacteria 2063
300 Ga0105028_106121 3300009993 Bacteria 1255
301 Ga0105239_10089155 3300010375 Bacteria 3401
302 Ga0105239_10399074 3300010375 Bacteria 1556
303 Ga0105239_10830829 3300010375 Bacteria 1059
304 Ga0105239_11508849 3300010375 Bacteria 777
305 Ga0105246_10447390 3300011119 Bacteria 1085
306 Ga0105246_10516710 3300011119 Bacteria 1017
307 Ga0105246_10544662 3300011119 Bacteria 993
308 Ga0105246_11640567 3300011119 Bacteria 609
309 Ga0157320_1016578 3300012481 Bacteria 634
310 Ga0157341_1016358 3300012494 Bacteria 690
311 Ga0157339_1041555 3300012505 Bacteria 579
312 Ga0157338_1031337 3300012515 Bacteria 679
313 Ga0154012_115786 3300013059 Bacteria 578
314 Ga0154012_176035 3300013059 Bacteria 755
315 Ga0154010_157036 3300013062 Bacteria 703
316 Ga0157371_10418815 3300013102 Bacteria 982
317 Ga0157369_10021627 3300013105 Bacteria 7193
318 Ga0157369_10236478 3300013105 Bacteria 1909
319 Ga0157369_10313236 3300013105 Bacteria 1632
320 Ga0157369_11900178 3300013105 Bacteria 604
321 Ga0157374_10606082 3300013296 Bacteria 1105
322 Ga0157374_11479369 3300013296 Bacteria 702
323 Ga0157374_12075113 3300013296 Bacteria 595
324 Ga0157378_10148347 3300013297 Bacteria 2184
325 Ga0157378_11661326 3300013297 Bacteria 685
326 Ga0163162_10193492 3300013306 Bacteria 2162
327 Ga0163162_12099418 3300013306 Bacteria 648
328 Ga0157372_10209745 3300013307 Bacteria 2257
329 Ga0157372_10461374 3300013307 Bacteria 1480
330 Ga0157372_11426663 3300013307 Bacteria 798
331 Ga0157372_12138646 3300013307 Bacteria 643
332 Ga0157372_12351401 3300013307 Bacteria 612
333 Ga0157375_11156048 3300013308 Bacteria 907
334 Ga0157375_12916398 3300013308 Bacteria 571
335 Ga0163163_10111596 3300014325 Bacteria 2763
336 Ga0163163_10436355 3300014325 Bacteria 1369
337 Ga0163163_11158352 3300014325 Bacteria 836
338 Ga0163163_12398254 3300014325 Bacteria 586
339 Ga0157380_10195782 3300014326 Bacteria 1789
340 Ga0157380_11393062 3300014326 Bacteria 751
341 Ga0157380_11816662 3300014326 Bacteria 669
342 Ga0182008_10150045 3300014497 Bacteria 1169
343 Ga0157377_10068917 3300014745 Bacteria 2040
344 Ga0157377_10112134 3300014745 Bacteria 1641
345 Ga0157377_10495787 3300014745 Bacteria 852
346 Ga0157377_11728632 3300014745 Bacteria 506
347 Ga0157379_10004447 3300014968 Bacteria 12020
348 Ga0157379_10114482 3300014968 Bacteria 2424
349 Ga0157379_10237366 3300014968 Bacteria 1653
350 Ga0157376_10716337 3300014969 Bacteria 1007
351 Ga0182006_1308336 3300015261 Bacteria 520
352 Ga0182007_10078659 3300015262 Bacteria 1081
353 Ga0163161_10980819 3300017792 Bacteria 720
354 Ga0197907_10130848 3300020069 Bacteria 581
355 Ga0197907_10290521 3300020069 Bacteria 514
356 Ga0197907_10931216 3300020069 Bacteria 750
357 Ga0197907_11094761 3300020069 Bacteria 641
358 Ga0197907_11335908 3300020069 Bacteria 984
359 Ga0206356_10176895 3300020070 Bacteria 614
360 Ga0206356_10900112 3300020070 Bacteria 618
361 Ga0206356_11071879 3300020070 Bacteria 614
362 Ga0206356_11079847 3300020070 Bacteria 772
363 Ga0206349_1221287 3300020075 Bacteria 838
364 Ga0206349_1252883 3300020075 Bacteria 632
365 Ga0206349_1512573 3300020075 Bacteria 756
366 Ga0206349_1601640 3300020075 Bacteria 593
367 Ga0206349_1646595 3300020075 Bacteria 518
368 Ga0206355_1000167 3300020076 Bacteria 664
369 Ga0206355_1093080 3300020076 Bacteria 710
370 Ga0206355_1263721 3300020076 Bacteria 845
371 Ga0206355_1631847 3300020076 Bacteria 637
372 Ga0206355_1680853 3300020076 Bacteria 801
373 Ga0206351_10073110 3300020077 Bacteria 828
374 Ga0206351_10810188 3300020077 Bacteria 656
375 Ga0206351_10815273 3300020077 Bacteria 674
376 Ga0206351_10926472 3300020077 Bacteria 609
377 Ga0206352_10175716 3300020078 Bacteria 794
378 Ga0206352_10339378 3300020078 Bacteria 732
379 Ga0206352_10527522 3300020078 Bacteria 677
380 Ga0206352_10543400 3300020078 Bacteria 788
381 Ga0206352_10978437 3300020078 Bacteria 562
382 Ga0206352_11123643 3300020078 Bacteria 903
383 Ga0206350_10081742 3300020080 Bacteria 791
384 Ga0206350_10471505 3300020080 Bacteria 786
385 Ga0206350_11228157 3300020080 Bacteria 659
386 Ga0206354_10004381 3300020081 Bacteria 683
387 Ga0206354_10370725 3300020081 Bacteria 1470
388 Ga0206354_10456219 3300020081 Bacteria 630
389 Ga0206354_10748701 3300020081 Bacteria 594
390 Ga0206354_11017929 3300020081 Bacteria 1669
391 Ga0206354_11539509 3300020081 Bacteria 1253
392 Ga0206354_11564612 3300020081 Bacteria 791
393 Ga0206354_11673340 3300020081 Bacteria 506
394 Ga0206353_10069880 3300020082 Bacteria 1274
395 Ga0206353_10271544 3300020082 Bacteria 840
396 Ga0206353_11798783 3300020082 Bacteria 996
397 Ga0154015_1238497 3300020610 Bacteria 596
398 Ga0154015_1258986 3300020610 Bacteria 777
399 Ga0154015_1455192 3300020610 Bacteria 739
400 Ga0213875_10443638 3300021388 Bacteria 621
401 Ga0224712_10171710 3300022467 Bacteria 973
402 Ga0224712_10277696 3300022467 Bacteria 779
403 Ga0224712_10293906 3300022467 Bacteria 758
404 Ga0224712_10576527 3300022467 Bacteria 548
405 Ga0256720_132808 3300023438 Bacteria 522
406 Ga0207656_10747959 3300025321 Bacteria 501
407 Ga0207653_10334711 3300025885 Bacteria 590
408 Ga0207692_10142356 3300025898 Bacteria 1365
409 Ga0207692_11029744 3300025898 Bacteria 544
410 Ga0207688_10219580 3300025901 Bacteria 1145
411 Ga0207688_10289700 3300025901 Bacteria 999
412 Ga0207688_10571697 3300025901 Bacteria 711
413 Ga0207647_10368871 3300025904 Bacteria 812
414 Ga0207699_10945381 3300025906 Bacteria 636
415 Ga0207645_10239301 3300025907 Bacteria 1199
416 Ga0207645_10741759 3300025907 Bacteria 668
417 Ga0207643_10423994 3300025908 Bacteria 844
418 Ga0207643_11128438 3300025908 Bacteria 505
419 Ga0207705_10316856 3300025909 Bacteria 1198
420 Ga0207707_10205767 3300025912 Bacteria 1715
421 Ga0207671_10992206 3300025914 Bacteria 662
422 Ga0207671_10998404 3300025914 Bacteria 660
423 Ga0207660_10065813 3300025917 Bacteria 2620
424 Ga0207662_10116313 3300025918 Bacteria 1672
425 Ga0207662_10147625 3300025918 Bacteria 1494
426 Ga0207662_10384455 3300025918 Bacteria 949
427 Ga0207657_10145026 3300025919 Bacteria 1937
428 Ga0207657_10464775 3300025919 Bacteria 992
429 Ga0207649_10002678 3300025920 Bacteria 9878
430 Ga0207649_10542764 3300025920 Bacteria 889
431 Ga0207694_10459128 3300025924 Bacteria 1064
432 Ga0207694_10916182 3300025924 Bacteria 741
433 Ga0207659_10011915 3300025926 Bacteria 5507
434 Ga0207659_10502290 3300025926 Bacteria 1027
435 Ga0207687_11191090 3300025927 Bacteria 655
436 Ga0207687_11901013 3300025927 Bacteria 509
437 Ga0207700_10129871 3300025928 Bacteria 2056
438 Ga0207664_10958261 3300025929 Bacteria 767
439 Ga0207664_11143239 3300025929 Bacteria 695
440 Ga0207664_11340623 3300025929 Bacteria 636
441 Ga0207644_10074847 3300025931 Bacteria 2486
442 Ga0207690_10287790 3300025932 Bacteria 1282
443 Ga0207690_10431242 3300025932 Bacteria 1056
444 Ga0207690_10444134 3300025932 Bacteria 1041
445 Ga0207706_10005117 3300025933 Bacteria 12240
446 Ga0207706_10264937 3300025933 Bacteria 1500
447 Ga0207706_10372934 3300025933 Bacteria 1239
448 Ga0207686_11366543 3300025934 Bacteria 582
449 Ga0207709_10374346 3300025935 Bacteria 1082
450 Ga0207670_11403836 3300025936 Bacteria 593
451 Ga0207670_11676106 3300025936 Bacteria 541
452 Ga0207669_10265770 3300025937 Bacteria 1286
453 Ga0207704_10537559 3300025938 Bacteria 948
454 Ga0207704_10726401 3300025938 Bacteria 824
455 Ga0207665_10162579 3300025939 Bacteria 1607
456 Ga0207665_10180237 3300025939 Bacteria 1530
457 Ga0207691_10423862 3300025940 Bacteria 1134
458 Ga0207691_10703054 3300025940 Bacteria 852
459 Ga0207711_10545247 3300025941 Bacteria 1082
460 Ga0207711_11425732 3300025941 Bacteria 635
461 Ga0207689_10006565 3300025942 Bacteria 10257
462 Ga0207689_10040371 3300025942 Bacteria 3862
463 Ga0207689_10217264 3300025942 Bacteria 1579
464 Ga0207689_10360629 3300025942 Bacteria 1209
465 Ga0207661_10058262 3300025944 Bacteria 3108
466 Ga0207661_10104262 3300025944 Bacteria 2387
467 Ga0207679_10134757 3300025945 Bacteria 1987
468 Ga0207679_11860078 3300025945 Bacteria 549
469 Ga0207667_11480546 3300025949 Bacteria 650
470 Ga0207651_11258734 3300025960 Bacteria 665
471 Ga0207712_10399851 3300025961 Bacteria 1154
472 Ga0207668_10006800 3300025972 Bacteria 6774
473 Ga0207668_10085199 3300025972 Bacteria 2305
474 Ga0207668_10086405 3300025972 Bacteria 2291
475 Ga0207640_10361078 3300025981 Bacteria 1170
476 Ga0207640_10529240 3300025981 Bacteria 987
477 Ga0207677_10354280 3300026023 Bacteria 1231
478 Ga0207677_12103370 3300026023 Bacteria 525
479 Ga0207703_10395320 3300026035 Bacteria 1281
480 Ga0207703_10642435 3300026035 Bacteria 1006
481 Ga0207703_10883365 3300026035 Bacteria 856
482 Ga0207703_11375450 3300026035 Bacteria 679
483 Ga0207678_10009672 3300026067 Bacteria 8480
484 Ga0207678_10117774 3300026067 Bacteria 2266
485 Ga0207708_10103253 3300026075 Bacteria 2208
486 Ga0207708_10144910 3300026075 Bacteria 1866
487 Ga0207708_10771973 3300026075 Bacteria 826
488 Ga0207708_11130501 3300026075 Bacteria 683
489 Ga0207702_10186996 3300026078 Bacteria 1911
490 Ga0207702_10296670 3300026078 Bacteria 1533
491 Ga0207702_10390241 3300026078 Bacteria 1340
492 Ga0207702_11145137 3300026078 Bacteria 772
493 Ga0207641_10000419 3300026088 Bacteria 49566
494 Ga0207641_10037929 3300026088 Bacteria 4027
495 Ga0207641_10063495 3300026088 Bacteria 3154
496 Ga0207641_11742074 3300026088 Bacteria 625
497 Ga0207648_10137534 3300026089 Bacteria 2152
498 Ga0207648_10198771 3300026089 Bacteria 1778
499 Ga0207648_10576250 3300026089 Bacteria 1036
500 Ga0207676_10296215 3300026095 Bacteria 1475
501 Ga0207676_10339051 3300026095 Bacteria 1386
502 Ga0207676_10410277 3300026095 Bacteria 1268
503 Ga0207674_10051595 3300026116 Bacteria 4197
504 Ga0207674_10101881 3300026116 Bacteria 2852
505 Ga0207674_10106532 3300026116 Bacteria 2781
506 Ga0207674_10155538 3300026116 Bacteria 2242
507 Ga0207675_100085150 3300026118 Bacteria 2966
508 Ga0207675_100471478 3300026118 Bacteria 1246
509 Ga0207675_100918867 3300026118 Bacteria 892
510 Ga0207675_101183950 3300026118 Bacteria 784
511 Ga0207675_101272078 3300026118 Bacteria 756
512 Ga0207683_10059946 3300026121 Bacteria 3344
513 Ga0207683_10209105 3300026121 Bacteria 1775
514 Ga0207683_10437002 3300026121 Bacteria 1206
515 Ga0207683_10916546 3300026121 Bacteria 814
516 Ga0207698_10451519 3300026142 Bacteria 1241
517 Ga0207428_10175714 3300027907 Bacteria 1620
518 Ga0207428_10176902 3300027907 Bacteria 1613
519 Ga0268266_10002878 3300028379 Bacteria 17879
520 Ga0268266_10487636 3300028379 Bacteria 1175
521 Ga0268266_11077608 3300028379 Bacteria 777
522 Ga0268266_11312153 3300028379 Bacteria 699
523 Ga0268266_11931642 3300028379 Bacteria 564
524 Ga0268265_10153413 3300028380 Bacteria 1946
525 Ga0268265_11046874 3300028380 Bacteria 808
526 Ga0265337_1095228 3300028556 Bacteria 811
527 Ga0307517_10162993 3300028786 Bacteria 1490
528 Ga0307515_10000148 3300028794 Bacteria 170303
529 Ga0307515_10057219 3300028794 Bacteria 5647
530 Ga0307515_10167936 3300028794 Bacteria 2202
531 Ga0311004_156697 3300029276 Bacteria 597
532 Ga0311001_1067596 3300029277 Bacteria 599
533 Ga0310981_1045895 3300029285 Bacteria 691
534 Ga0307511_10000442 3300030521 Bacteria 44415
535 Ga0307511_10167736 3300030521 Bacteria 1215
536 Ga0307512_10023306 3300030522 Bacteria 5535
537 Ga0307512_10050742 3300030522 Bacteria 3328
538 Ga0316180_1086595 3300030736 Bacteria 514
539 Ga0316183_1000667 3300030742 Bacteria 696
540 Ga0316182_1051395 3300030745 Bacteria 1149
541 Ga0265328_10068246 3300031239 Bacteria 1306
542 Ga0307513_10000002 3300031456 Bacteria 842612
543 Ga0307513_10002320 3300031456 Bacteria 26540
544 Ga0307513_10082362 3300031456 Bacteria 3313
545 Ga0307509_10009471 3300031507 Bacteria 12168
546 Ga0307408_100375079 3300031548 Bacteria 1214
547 Ga0307408_100416224 3300031548 Bacteria 1158
548 Ga0307408_100708943 3300031548 Bacteria 905
549 Ga0307408_100724508 3300031548 Bacteria 896
550 Ga0307508_10007906 3300031616 Bacteria 9869
551 Ga0307508_10022643 3300031616 Bacteria 5710
552 Ga0307508_10024389 3300031616 Bacteria 5489
553 Ga0307514_10350755 3300031649 Bacteria 787
554 Ga0307514_10359352 3300031649 Bacteria 770
555 Ga0307516_10003585 3300031730 Bacteria 19795
556 Ga0307516_10088874 3300031730 Bacteria 2921
557 Ga0307516_10147657 3300031730 Bacteria 2115
558 Ga0307405_10143152 3300031731 Bacteria 1670
559 Ga0307405_10173496 3300031731 Bacteria 1540
560 Ga0307413_10534776 3300031824 Bacteria 948
561 Ga0307410_10068505 3300031852 Bacteria 2451
562 Ga0307410_10266182 3300031852 Unclassified 1339
563 Ga0307410_10401544 3300031852 Bacteria 1107
564 Ga0307410_10655088 3300031852 Bacteria 881
565 Ga0307410_11123488 3300031852 Bacteria 682
566 Ga0307410_11468154 3300031852 Bacteria 600
567 Ga0307406_10000856 3300031901 Bacteria 17128
568 Ga0307406_10071795 3300031901 Bacteria 2270
569 Ga0307406_10516412 3300031901 Bacteria 971
570 Ga0307406_12096970 3300031901 Bacteria 506
571 Ga0307407_10049499 3300031903 Bacteria 2399
572 Ga0307412_10121539 3300031911 Bacteria 1881
573 Ga0307409_100038755 3300031995 Bacteria 3528
574 Ga0307409_100242668 3300031995 Bacteria 1641
575 Ga0307409_100824913 3300031995 Bacteria 936
576 Ga0307416_100102513 3300032002 Bacteria 2495
577 Ga0307416_100171696 3300032002 Bacteria 2019
578 Ga0307416_100578772 3300032002 Bacteria 1200
579 Ga0307416_101544704 3300032002 Bacteria 769
580 Ga0307416_102749958 3300032002 Unclassified 588
581 Ga0307416_103254378 3300032002 Bacteria 543
582 Ga0307414_10255234 3300032004 Bacteria 1460
583 Ga0307414_11750102 3300032004 Bacteria 580
584 Ga0307411_10984297 3300032005 Bacteria 754
585 Ga0307411_11747421 3300032005 Bacteria 576
586 Ga0307415_100008707 3300032126 Bacteria 5645
587 Ga0307415_100067194 3300032126 Bacteria 2504
588 Ga0307415_100113492 3300032126 Bacteria 2015
589 Ga0307415_100371260 3300032126 Bacteria 1211
590 Ga0307415_100426882 3300032126 Bacteria 1139
591 Ga0307415_100615632 3300032126 Bacteria 968
592 Ga0307415_101385280 3300032126 Bacteria 669
593 Ga0307415_101502427 3300032126 Bacteria 644
594 Ga0316593_10135718 3300032168 Bacteria 890
595 Ga0307507_10275880 3300033179 Bacteria 1056
596 Ga0307510_10529989 3300033180 Bacteria 622
597 Ga0373930_0056376 3300034816 Bacteria 868
598 Ga0373929_0151525 3300035085 Bacteria 622
599 Ga0373951_0000077 3300035091 Bacteria 38676
600 Ga0373932_0088562 3300035112 Bacteria 989
601 Ga0373939_0178085 3300035114 Bacteria 791
602 Ga0373941_0099891 3300035115 Bacteria 1008
603 Ga0373954_0527839 3300035118 Bacteria 585
604 Ga0373956_0000255 3300035119 Bacteria 21213
605 Ga0373943_0492358 3300035170 Bacteria 716
606 Ga0373955_0325886 3300035172 Bacteria 928
607 Ga0373942_0003991 3300035207 Bacteria 3442
608 Ga0373942_0045220 3300035207 Bacteria 1216
609 Ga0373962_0001763 3300035242 Bacteria 5150
610 Ga0373924_0407941 3300035410 Bacteria 608
611 Ga0373931_0496328 3300035691 Bacteria 787
612 Ga0373931_1013333 3300035691 Bacteria 562
613 Ga0373935_0178931 3300035692 Bacteria 1455
614 Ga0373927_0495995 3300035695 Bacteria 807
615 Ga0373925_0452932 3300037068 Bacteria 1051
616 Ga0373925_1137328 3300037068 Bacteria 642
617 Ga0373925_1369960 3300037068 Bacteria 580
618 Ga0395899_0691500 3300037312 Bacteria 640
619 Ga0395900_0017058 3300037418 Bacteria 7413
620 Ga0395900_0178726 3300037418 Bacteria 2158
621 Ga0395900_0416874 3300037418 Bacteria 1304
622 Ga0395898_0017301 3300037466 Bacteria 7365
623 Ga0395898_0063355 3300037466 Bacteria 3588
624 Ga0395898_1219123 3300037466 Bacteria 683
625 Ga0395905_0025967 3300037471 Bacteria 5522
626 Ga0395905_1341435 3300037471 Bacteria 619
627 Ga0436364_0843409 3300037853 Bacteria 976
628 Ga0395901_0006306 3300038443 Bacteria 12014
629 Ga0395901_0216316 3300038443 Bacteria 2004
630 Ga0395901_2094819 3300038443 Bacteria 511
631 Ga0439436_0045199 3300041404 Bacteria 1253
632 Ga0439439_0004566 3300041406 Bacteria 3130
633 Ga0439466_0038464 3300041411 Bacteria 1607
634 Ga0439465_0363526 3300041413 Bacteria 548
635 Ga0451792_08217 3300041445 Bacteria 555
636 Ga0451793_1559054 3300041452 Bacteria 819
637 Ga0451797_0420750 3300041453 Bacteria 712
638 Ga0451797_1374646 3300041453 Bacteria 837
639 Ga0451802_1014310 3300041460 Bacteria 687
640 Ga0451805_106874 3300041461 Bacteria 624
641 Ga0451804_0022812 3300041463 Bacteria 909
642 Ga0451807_0695240 3300041486 Bacteria 887
643 Ga0451807_0770464 3300041486 Bacteria 612
644 Ga0451833_0517963 3300041491 Bacteria 933
645 Ga0451837_1200754 3300041494 Bacteria 802
646 Ga0451839_1160533 3300041496 Bacteria 1028
647 Ga0451840_23904 3300041497 Bacteria 606
648 Ga0451841_0484083 3300041498 Bacteria 788
649 Ga0451846_62652 3300041502 Bacteria 619
650 Ga0451850_61463 3300041506 Bacteria 681
651 Ga0451854_00925 3300041510 Bacteria 710
652 Ga0451855_1976416 3300041511 Bacteria 585
653 Ga0451853_3684749 3300041512 Bacteria 633
654 Ga0439433_0106745 3300041999 Bacteria 698
655 Ga0439448_0113420 3300042005 Bacteria 927
656 Ga0439449_0019645 3300042007 Bacteria 2532
657 Ga0439449_0431918 3300042007 Bacteria 500
658 Ga0439455_0153397 3300042012 Bacteria 656
659 Ga0439457_002664 3300042014 Bacteria 5031
660 Ga0439462_0244260 3300042015 Bacteria 516
661 Ga0439463_205356 3300042016 Bacteria 512
662 Ga0450890_034518 3300042127 Bacteria 731
663 Ga0450891_031721 3300042129 Bacteria 549
664 Ga0450907_048730 3300042146 Bacteria 727
665 Ga0439458_0099147 3300042157 Bacteria 755
666 Ga0439460_0157239 3300042461 Bacteria 761
667 Ga0450916_054246 3300042530 Bacteria 639
668 Ga0450916_080381 3300042530 Bacteria 556
669 Ga0439440_0117683 3300042993 Bacteria 737
670 Ga0466969_0018202 3300044656 Bacteria 3662
671 Ga0466972_0008350 3300044658 Bacteria 5190
672 Ga0466965_0010254 3300044683 Bacteria 4365
673 Ga0466965_0086124 3300044683 Bacteria 1593
674 Ga0466965_0929169 3300044683 Bacteria 508
675 Ga0466966_0001061 3300044684 Bacteria 17560
676 Ga0466966_0116988 3300044684 Bacteria 1640
677 Ga0466966_0158096 3300044684 Bacteria 1380
678 Ga0466961_0045785 3300044693 Bacteria 2798
679 Ga0466961_0166202 3300044693 Bacteria 1373
680 Ga0466961_0202773 3300044693 Bacteria 1226
681 Ga0466963_0165271 3300044694 Bacteria 1541
682 Ga0466963_0226003 3300044694 Bacteria 1311
683 Ga0466963_0635468 3300044694 Bacteria 753
684 Ga0466963_1008406 3300044694 Bacteria 586
685 Ga0466963_1072156 3300044694 Bacteria 567
686 Ga0466964_0393964 3300044706 Bacteria 722
687 Ga0466971_0088779 3300044719 Bacteria 1414
688 Ga0466971_0387714 3300044719 Bacteria 680
689 Ga0466970_0004599 3300044765 Bacteria 6809
690 Ga0466970_0102599 3300044765 Bacteria 1558
691 Ga0466957_0058510 3300044842 Bacteria 2361
692 Ga0466957_0600378 3300044842 Bacteria 770
693 Ga0466960_0000951 3300044901 Bacteria 10271
694 Ga0466960_0218205 3300044901 Bacteria 1048
695 Ga0466960_0267624 3300044901 Bacteria 954
696 Ga0466959_0006875 3300045049 Bacteria 7935
697 Ga0466959_0034988 3300045049 Bacteria 3715
698 Ga0466959_0518013 3300045049 Bacteria 805
699 Ga0466958_0179691 3300045836 Bacteria 1342
700 Ga0466958_0325340 3300045836 Bacteria 988
701 Ga0466958_0630727 3300045836 Bacteria 697
702 Ga0466958_1081724 3300045836 Bacteria 523
703 Ga0466967_0186810 3300045976 Bacteria 1957
704 Ga0466967_0760305 3300045976 Bacteria 961
705 Ga0466967_1834271 3300045976 Bacteria 603
706 Ga0495603_0020570 3300046455 Bacteria 3998
707 Ga0495603_0178051 3300046455 Bacteria 1231
708 Ga0495603_0479913 3300046455 Bacteria 712
709 Ga0495629_0014670 3300046459 Bacteria 5636
710 Ga0495638_0159213 3300046460 Bacteria 1304
711 Ga0495641_0031083 3300046461 Bacteria 2554
712 Ga0495641_0417016 3300046461 Bacteria 609
713 Ga0495582_0010933 3300046473 Bacteria 4995
714 Ga0495662_0033040 3300046476 Bacteria 2500
715 Ga0495662_0630683 3300046476 Bacteria 524
716 Ga0495585_0289287 3300046492 Bacteria 808
717 Ga0495594_0027313 3300046499 Bacteria 3075
718 Ga0495594_0106681 3300046499 Bacteria 1578
719 Ga0495606_0012057 3300046507 Bacteria 6975
720 Ga0495630_1386487 3300046517 Bacteria 529
721 Ga0495640_0015877 3300046533 Bacteria 5650
722 Ga0495645_0575155 3300046543 Bacteria 696
723 Ga0495668_0000213 3300046616 Bacteria 84412
724 Ga0495634_0053960 3300046642 Bacteria 2691
725 Ga0495625_0012217 3300046660 Bacteria 6965
726 Ga0495625_0917893 3300046660 Bacteria 501
727 Ga0495658_0101826 3300046683 Bacteria 1715
728 Ga0495613_0865175 3300046689 Bacteria 587
729 Ga0495624_0074271 3300046690 Bacteria 2113
730 Ga0495649_0523856 3300046694 Bacteria 588
731 Ga0495581_0917504 3300047315 Bacteria 500
732 Ga0495636_0382446 3300047318 Bacteria 668
733 Ga0495683_0408413 3300047323 Bacteria 563
734 Ga0495675_0416186 3300047444 Bacteria 782
735 Ga0495593_0340094 3300047673 Bacteria 750
736 Ga0495626_0005869 3300048091 Bacteria 7075
737 Ga0496100_0002555 3300048903 Bacteria 9274
738 Ga0496100_1084651 3300048903 Bacteria 631
739 Ga0496101_0170148 3300048904 Bacteria 1674
740 Ga0496101_0887299 3300048904 Bacteria 702
741 Ga0496101_1150931 3300048904 Bacteria 609
742 Ga0496102_0000222 3300048905 Bacteria 75152
743 Ga0496103_0000179 3300048906 Bacteria 64934
744 Ga0496103_1062419 3300048906 Bacteria 502
745 Ga0496104_0173411 3300048907 Bacteria 2067
746 Ga0496104_0179122 3300048907 Bacteria 2030
747 Ga0496104_0311805 3300048907 Bacteria 1486
748 Ga0496104_1712313 3300048907 Bacteria 531
749 Ga0496105_0040289 3300048908 Bacteria 3851
750 Ga0496105_0507949 3300048908 Bacteria 945
751 Ga0496105_1076309 3300048908 Bacteria 598
752 Ga0496106_0331240 3300048909 Bacteria 1222
753 Ga0496107_0270229 3300048910 Bacteria 1265
754 Ga0496108_0000065 3300048911 Bacteria 117405
755 Ga0496108_0339622 3300048911 Bacteria 1310
756 Ga0496108_0509882 3300048911 Bacteria 1050
757 Ga0496108_0848060 3300048911 Bacteria 786
758 Ga0496108_1173632 3300048911 Bacteria 650
759 Ga0496109_0168214 3300048912 Bacteria 2056
760 Ga0496109_1209056 3300048912 Bacteria 692
761 Ga0496109_1543252 3300048912 Bacteria 599
762 Ga0496109_1577902 3300048912 Bacteria 591
763 Ga0496110_0640672 3300048913 Bacteria 962
764 Ga0496110_1445963 3300048913 Bacteria 597
765 Ga0496111_0147266 3300048914 Bacteria 1746
766 Ga0496112_0108341 3300048915 Bacteria 2748
767 Ga0496112_0210902 3300048915 Bacteria 1899
768 Ga0496113_1411458 3300048916 Bacteria 539
769 Ga0496114_0148461 3300048917 Bacteria 2033
770 Ga0496114_1029793 3300048917 Bacteria 707
771 Ga0496115_0457950 3300048918 Bacteria 1029
772 Ga0496116_0000481 3300048919 Bacteria 54969
773 Ga0496117_0000242 3300048920 Bacteria 103350
774 Ga0496118_0000412 3300048921 Bacteria 71447
775 Ga0496119_0013023 3300048922 Bacteria 6676
776 Ga0496120_0003152 3300048923 Bacteria 15386
777 Ga0496121_0002113 3300048924 Bacteria 31255
778 Ga0496122_0107771 3300048925 Bacteria 1840
779 Ga0496124_0028247 3300048927 Bacteria 5021
780 Ga0496125_0077747 3300048928 Bacteria 2555
781 Ga0496126_0000521 3300048929 Bacteria 74946
782 Ga0496126_0403213 3300048929 Bacteria 1109
783 Ga0501306_026908 3300049127 Bacteria 835
784 Ga0501308_039955 3300049128 Bacteria 658
785 Ga0501309_054766 3300049129 Bacteria 632
786 Ga0501309_080375 3300049129 Bacteria 546
787 Ga0501307_036786 3300049162 Bacteria 699
788 Ga0501311_042223 3300049527 Bacteria 694
789 Ga0501311_065165 3300049527 Bacteria 595
790 Ga0501311_089539 3300049527 Bacteria 533
791 Ga0501312_101412 3300049528 Bacteria 540
792 Ga0501312_106094 3300049528 Bacteria 531
793 Ga0501315_065039 3300049531 Bacteria 596
794 Ga0501315_072729 3300049531 Bacteria 573
795 Ga0501316_053986 3300049532 Bacteria 583
796 Ga0501317_097649 3300049533 Bacteria 527
797 Ga0501318_036492 3300049534 Bacteria 688
798 Ga0501318_042966 3300049534 Bacteria 652
799 Ga0501320_021563 3300049536 Bacteria 749
800 Ga0501320_022750 3300049536 Bacteria 737
801 Ga0501321_045840 3300049537 Bacteria 627
802 Ga0501322_014138 3300049538 Bacteria 649
803 Ga0501323_035375 3300049539 Bacteria 716
804 Ga0501325_025402 3300049541 Bacteria 650
805 Ga0501325_039029 3300049541 Bacteria 572
806 Ga0501325_046295 3300049541 Bacteria 543
807 Ga0501031_0621082 3300049568 Bacteria 695
808 Ga0501040_0939010 3300049576 Bacteria 627
809 Ga0501042_0337365 3300049578 Bacteria 1090
810 Ga0501042_0610898 3300049578 Bacteria 793
811 Ga0501042_1148701 3300049578 Bacteria 566
812 Ga0501043_0789770 3300049579 Bacteria 687
813 Ga0501047_0043781 3300049581 Bacteria 4324
814 Ga0501070_0325459 3300049586 Bacteria 1250
815 Ga0501071_1357103 3300049587 Bacteria 549
816 Ga0501072_1204745 3300049588 Bacteria 588
817 Ga0501073_1123314 3300049589 Bacteria 540
818 Ga0501257_193330 3300049686 Bacteria 582
819 Ga0501044_0950220 3300049823 Bacteria 733
820 nmdc:mga00v17_134291_c1 3300050491 Bacteria 1583
821 nmdc:mga05p37_43650_c1 3300050507 Bacteria 5516
822 nmdc:mga05p37_6610_c1 3300050507 Bacteria 13668
823 nmdc:mga09592_437295_c1 3300050508 Bacteria 1129
824 nmdc:mga09592_59221_c1 3300050508 Bacteria 3238
825 nmdc:mga09592_92293_c1 3300050508 Bacteria 2588
826 nmdc:mga0qj67_312095_c1 3300050509 Bacteria 1273
827 nmdc:mga06r32_8857_c1 3300050510 Bacteria 9069
828 nmdc:mga08y16_38963_c1 3300050511 Bacteria 4988
829 nmdc:mga0n895_1716881_c1 3300050512 Bacteria 590
830 nmdc:mga0rr50_144385_c1 3300050513 Bacteria 1917
831 nmdc:mga0rr50_355518_c1 3300050513 Bacteria 1232
832 nmdc:mga08x19_968998_c1 3300050514 Bacteria 604
833 nmdc:mga0a205_773109_c1 3300050515 Bacteria 808
834 Ga0500644_0103302 3300053088 Bacteria 1086
835 Ga0500646_0001171 3300053090 Bacteria 7073
836 Ga0500583_0005277 3300053092 Bacteria 4313
837 Ga0500583_0206079 3300053092 Bacteria 977
838 Ga0500651_0219695 3300053093 Bacteria 1115
839 Ga0500651_0613695 3300053093 Bacteria 589
840 Ga0500641_0251238 3300053096 Bacteria 741
841 Ga0500641_0382371 3300053096 Bacteria 558
842 Ga0500650_0120431 3300053098 Bacteria 1223
843 Ga0500556_0251196 3300053104 Bacteria 696
844 Ga0500562_094148 3300053108 Bacteria 814
845 Ga0500569_049329 3300053109 Bacteria 1264
846 Ga0500572_240015 3300053111 Bacteria 591
847 Ga0500594_0011394 3300053118 Bacteria 2075
848 Ga0500652_066448 3300053131 Bacteria 1490
849 Ga0500655_108929 3300053133 Bacteria 584
850 Ga0500559_0282774 3300053136 Bacteria 780
851 Ga0500568_0147348 3300053139 Bacteria 872
852 Ga0500579_175879 3300053143 Bacteria 857
853 Ga0500588_0001715 3300053146 Bacteria 4256
854 Ga0500600_0058151 3300053149 Bacteria 2166
855 Ga0500622_0299608 3300053156 Bacteria 686
856 Ga0500633_0203585 3300053160 Bacteria 741
857 Ga0500611_078197 3300053727 Bacteria 820
858 Ga0500587_022858 3300053739 Bacteria 824
859 Ga0587084_060986 3300059477 Bacteria 691
860 Ga0587084_090669 3300059477 Bacteria 606
861 Ga0587093_063957 3300059478 Bacteria 606
862 Ga0587066_103943 3300059490 Bacteria 649
863 Ga0587066_178793 3300059490 Bacteria 545
864 Ga0587070_095813 3300059491 Bacteria 675
865 Ga0587070_157689 3300059491 Bacteria 574
866 Ga0587073_0086985 3300059492 Bacteria 787
867 Ga0587073_0168109 3300059492 Bacteria 634
868 Ga0587073_0179273 3300059492 Bacteria 621
869 Ga0587073_0274677 3300059492 Bacteria 538
870 Ga0587073_0294866 3300059492 Bacteria 526
871 Ga0587077_095821 3300059493 Bacteria 705
872 Ga0587080_123629 3300059503 Bacteria 576
873 Ga0587080_135832 3300059503 Bacteria 558
874 Ga0587082_078791 3300059504 Bacteria 683
875 Ga0587082_084640 3300059504 Bacteria 667
876 Ga0587083_0038990 3300059505 Bacteria 985
877 Ga0587083_0215446 3300059505 Bacteria 556
878 Ga0587085_126315 3300059506 Bacteria 567
879 Ga0587085_132014 3300059506 Bacteria 559
880 Ga0587086_087395 3300059507 Bacteria 558
881 Ga0587086_087670 3300059507 Bacteria 557
882 Ga0587086_092800 3300059507 Bacteria 547
883 Ga0587088_100208 3300059508 Bacteria 646
884 Ga0587089_090275 3300059509 Bacteria 544
885 Ga0587089_100265 3300059509 Bacteria 525
886 Ga0587090_058002 3300059510 Bacteria 727
887 Ga0587090_079098 3300059510 Bacteria 655
888 Ga0587090_137982 3300059510 Bacteria 543
889 Ga0587091_085544 3300059511 Bacteria 715
890 Ga0587091_104714 3300059511 Bacteria 668
891 Ga0587091_188255 3300059511 Bacteria 547
892 Ga0587092_105043 3300059512 Bacteria 587
893 Ga0587092_109522 3300059512 Bacteria 578
894 Ga0587094_049988 3300059513 Bacteria 706
895 Ga0587094_118190 3300059513 Bacteria 528
896 Ga0587094_120394 3300059513 Bacteria 525
897 Ga0587095_042182 3300059514 Bacteria 501
898 Ga0587098_029596 3300059604 Bacteria 746
899 Ga0587106_032717 3300059605 Bacteria 843
900 Ga0587106_060370 3300059605 Bacteria 695
901 Ga0587106_106587 3300059605 Bacteria 579
902 Ga0587129_013458 3300059608 Bacteria 663
903 Ga0587099_019322 3300059622 Bacteria 758
904 Ga0587099_046241 3300059622 Bacteria 570
905 Ga0587099_054607 3300059622 Bacteria 540
906 Ga0587101_128489 3300059623 Bacteria 531
907 Ga0587109_101942 3300059624 Bacteria 661
908 Ga0587113_016745 3300059625 Bacteria 738
909 Ga0587113_034552 3300059625 Bacteria 586
910 Ga0587115_075823 3300059626 Bacteria 588
911 Ga0587122_014419 3300059628 Bacteria 797
912 Ga0587128_042347 3300059630 Bacteria 802
913 Ga0587128_063783 3300059630 Bacteria 702
914 Ga0587128_081058 3300059630 Bacteria 650
915 Ga0587128_103809 3300059630 Bacteria 599
916 Ga0587130_027322 3300059631 Bacteria 644
917 Ga0587130_043050 3300059631 Bacteria 550
918 Ga0587067_049979 3300059640 Bacteria 843
919 Ga0587067_092343 3300059640 Bacteria 688
920 Ga0587067_174189 3300059640 Bacteria 556
921 Ga0587067_185936 3300059640 Bacteria 544
922 Ga0587067_190818 3300059640 Bacteria 539
923 Ga0587067_236033 3300059640 Bacteria 502
924 Ga0587068_040150 3300059641 Bacteria 844
925 Ga0587068_138597 3300059641 Bacteria 541
926 Ga0587069_060010 3300059642 Bacteria 698
927 Ga0587069_060133 3300059642 Bacteria 698
928 Ga0587069_088558 3300059642 Bacteria 615
929 Ga0587069_104651 3300059642 Bacteria 582
930 Ga0587069_138201 3300059642 Bacteria 531
931 Ga0587075_050973 3300059644 Bacteria 722
932 Ga0587075_057723 3300059644 Bacteria 693
933 Ga0587075_060047 3300059644 Bacteria 684
934 Ga0587075_078247 3300059644 Bacteria 626
935 Ga0587076_054659 3300059645 Bacteria 788
936 Ga0587076_057258 3300059645 Bacteria 777
937 Ga0587076_075029 3300059645 Bacteria 710
938 Ga0587076_090219 3300059645 Bacteria 669
939 Ga0587079_098300 3300059647 Bacteria 695
940 Ga0587079_191683 3300059647 Bacteria 553
941 Ga0587100_043739 3300059648 Bacteria 511
942 Ga0587107_069764 3300059652 Bacteria 639
943 Ga0587107_126542 3300059652 Bacteria 532
944 Ga0587107_142883 3300059652 Bacteria 513
945 Ga0587114_055332 3300059655 Bacteria 682
946 Ga0587114_062937 3300059655 Bacteria 655
947 Ga0587114_068245 3300059655 Bacteria 639
948 Ga0587114_097970 3300059655 Bacteria 568
949 Ga0587119_026366 3300059658 Bacteria 771
950 Ga0587071_061297 3300060344 Bacteria 800
951 Ga0466962_0040787 3300061719 Bacteria 2221
952 Ga0466962_0175028 3300061719 Bacteria 1045
953 Ga0466962_0714048 3300061719 Bacteria 514
954 2501945236 2501939600 Bacteria 6907073
955 2515498359 2515154088 Bacteria 5526283
956 2515722787 2515154129 Bacteria 5584369
957 2515759628 2515154137 Bacteria 5711575
958 2516087001 2515154202 Bacteria 5471270
959 2516092057 2515154203 Bacteria 5458536
960 2552106614 2551306166 Bacteria 9731570
961 2559425982 2558860280 Bacteria 11429938
962 2623499741 2622736605 Bacteria 4992138
963 2623591234 2622736626 Bacteria 7181580
964 2753272073 2751185782 Bacteria 11227053
965 2772647165 2772190715 Bacteria 6959372
966 2816508677 2816332139 Bacteria 9138787
967 2831938478 2831935698 Bacteria 5963223
968 2832005375 2832004796 Bacteria 6538017
969 2855674015 2855670206 Bacteria 7120389
970 2855677031 2855676851 Bacteria 7063653
971 2855688794 2855683550 Bacteria 7134265
972 2856858179 2856858025 Bacteria 7255264
973 2857295431 2857288857 Bacteria 7189066
974 2858852708 2858848962 Bacteria 6963058
975 2858886543 2858882152 Bacteria 7230291
976 2858894241 2858888857 Bacteria 7060307
977 2858898249 2858895516 Bacteria 7378898
978 2866065285 2866065130 Bacteria 6518152
979 2867307710 2867302475 Bacteria 7087181
980 2867316492 2867312974 Bacteria 7058875
981 2867324872 2867319477 Bacteria 7069771
982 2869054697 2869048445 Bacteria 6875584
983 2869066840 2869061728 Bacteria 7112407
984 2869072662 2869068681 Bacteria 7205615
985 2880495887 2880489317 Bacteria 7096270
986 2880496479 2880495981 Bacteria 7340502
987 2887480673 2887478801 Bacteria 8972725
988 2902584805 2902582711 Bacteria 6187705
989 2915364145 2915358134 Bacteria 6050864
990 2929225122 2929219909 Bacteria 6984360
991 2929231912 2929226422 Bacteria 7248583
992 2996225799 2996221748 Bacteria 6799777
993 649813580 649633069 Bacteria 6962533
994 8001786119 8001781756 Bacteria 9586736
995 8003832142 8003830390 Bacteria 6541657
996 8003862625 8003856774 Bacteria 7675274
997 8003873935 8003870546 Bacteria 7396674
998 8054473259 8054472261 Bacteria 7464355
999 8054705198 8054704163 Bacteria 7247792
1000 8054730611 8054727385 Bacteria 7558670
1001 8054736932 8054734606 Bacteria 6947278
1002 8055415408 8055412473 Bacteria 6257500
1003 8056057533 8056054917 Bacteria 5736694
1004 Ga0105244_10453065
1005 2214744876
1006 LJQas_1014194
1007 JGI24739J22299_10240319
1008 JGI24745J21846_1036060
1009 JGI24034J26672_10058467
1010 Ga0006778J45830_1009023
1011 Ga0006778J45830_1016377
1012 Ga0006778J45830_1041840
1013 Ga0006759J45824_1013206
1014 Ga0006759J45824_1014821
1015 JGI25406J46586_10009537
1016 JGI25406J46586_10011374
1017 JGI25406J46586_10088159
1018 JGI25406J46586_10123475
1019 rootH2_10085212
1020 Ga0007417J51691_1007731
1021 Ga0007417J51691_1036457
1022 Ga0007417J51691_1036609
1023 Ga0007417J51691_1037507
1024 Ga0007427J51700_104985
1025 Ga0006781J51513_1010662
1026 Ga0006781J51513_1029898
1027 Ga0007410J51695_1032791
1028 Ga0007410J51695_1047814
1029 Ga0007409J51694_1033305
1030 Ga0007409J51694_1042642
1031 Ga0007416J51690_1011182
1032 Ga0007416J51690_1034645
1033 Ga0007416J51690_1057945
1034 Ga0007429J51699_1014261
1035 Ga0007429J51699_1029843
1036 Ga0007429J51699_1056898
1037 Ga0007429J51699_1057006
1038 Ga0007429J51699_1059000
1039 JGI25404J52841_10068869
1040 Ga0032354_1007423
1041 Ga0032354_1034419
1042 Ga0032354_1059346
1043 Ga0032354_1070627
1044 Ga0006780_1008494
1045 Ga0006780_1016201
1046 Ga0006780_1026420
1047 Ga0006780_1027665
1048 Ga0058858_1385167
1049 Ga0058859_10043114
1050 Ga0058859_10045571
1051 Ga0058859_11823711
1052 Ga0058859_11831572
1053 Ga0058863_10016284
1054 Ga0058863_11874610
1055 Ga0058861_10006413
1056 Ga0058861_10034986
1057 Ga0058861_10046471
1058 Ga0058861_11988158
1059 Ga0058860_10003778
1060 Ga0058860_10010621
1061 Ga0058860_10085527
1062 Ga0058860_12242734
1063 Ga0058862_10078798
1064 Ga0058862_10083481
1065 Ga0058862_10152929
1066 Ga0070658_10005407
1067 Ga0070658_10470811
1068 Ga0070658_10625737
1069 Ga0070658_11405653
1070 Ga0070676_10714872
1071 Ga0070676_11021511
1072 Ga0070683_100826319
1073 Ga0070683_100871583
1074 Ga0070683_100933687
1075 Ga0070683_101091467
1076 Ga0070690_100458257
1077 Ga0070670_100054419
1078 Ga0070670_100984546
1079 Ga0070670_101735610
1080 Ga0070677_10702317
1081 Ga0068869_100002500
1082 Ga0068869_100265062
1083 Ga0068869_100346208
1084 Ga0068869_100376417
1085 Ga0068869_102124055
1086 Ga0070666_10111724
1087 Ga0070680_100464388
1088 Ga0070680_100485254
1089 Ga0070680_100637339
1090 Ga0070680_101082942
1091 Ga0070682_100167871
1092 Ga0070682_100497853
1093 Ga0070682_100936204
1094 Ga0068868_100474765
1095 Ga0070660_100308392
1096 Ga0070660_100712854
1097 Ga0070689_101058379
1098 Ga0070687_100032777
1099 Ga0070687_100092980
1100 Ga0070687_100442326
1101 Ga0070661_100006334
1102 Ga0070661_100341267
1103 Ga0070661_100370410
1104 Ga0070661_100737984
1105 Ga0070692_10369427
1106 Ga0070692_11012353
1107 Ga0070668_100000590
1108 Ga0070668_100314078
1109 Ga0070668_100352577
1110 Ga0070668_100726423
1111 Ga0070669_100115761
1112 Ga0070675_100002055
1113 Ga0070675_100190511
1114 Ga0070675_100627890
1115 Ga0070671_100002585
1116 Ga0070674_100414612
1117 Ga0070674_101030568
1118 Ga0070674_101299798
1119 Ga0070674_101565720
1120 Ga0070688_100733883
1121 Ga0070659_100166722
1122 Ga0070659_100604768
1123 Ga0070667_100126394
1124 Ga0070667_100164713
1125 Ga0070667_100432841
1126 Ga0070667_100972086
1127 Ga0070709_10404720
1128 Ga0070714_100399422
1129 Ga0070714_100536709
1130 Ga0070713_100113101
1131 Ga0070713_100511581
1132 Ga0070713_101370933
1133 Ga0070710_11124928
1134 Ga0070701_10239972
1135 Ga0070701_10406859
1136 Ga0070705_100987385
1137 Ga0070700_100109967
1138 Ga0070700_100295851
1139 Ga0070700_100571114
1140 Ga0070700_100586016
1141 Ga0070708_101579300
1142 Ga0070708_102098192
1143 Ga0070663_100024264
1144 Ga0070663_100184012
1145 Ga0070678_100143704
1146 Ga0070678_100398905
1147 Ga0070678_100936525
1148 Ga0070662_100003769
1149 Ga0070681_10036758
1150 Ga0070681_10324639
1151 Ga0070681_10439495
1152 Ga0068867_100792016
1153 Ga0070685_10058492
1154 Ga0070685_10172560
1155 Ga0070685_10260667
1156 Ga0070685_11356243
1157 Ga0070707_100871511
1158 Ga0070698_100894043
1159 Ga0070679_100016277
1160 Ga0070679_100222880
1161 Ga0070679_100943019
1162 Ga0070684_100138123
1163 Ga0070684_100266548
1164 Ga0070684_101171883
1165 Ga0068853_100406738
1166 Ga0068853_100628804
1167 Ga0070672_100507706
1168 Ga0070672_101859996
1169 Ga0070686_101685403
1170 Ga0070696_101735053
1171 Ga0070693_100099800
1172 Ga0070693_100309508
1173 Ga0070693_100617661
1174 Ga0070665_100005910
1175 Ga0070665_100233199
1176 Ga0070665_100821318
1177 Ga0070665_100963511
1178 Ga0070665_101174394
1179 Ga0070665_101257487
1180 Ga0070665_101598516
1181 Ga0070704_101972481
1182 Ga0068855_100434995
1183 Ga0068855_100604971
1184 Ga0070664_100009670
1185 Ga0070664_100064658
1186 Ga0070664_100161857
1187 Ga0070664_100555630
1188 Ga0070664_100587223
1189 Ga0070664_101047315
1190 Ga0068857_100060657
1191 Ga0068857_100201896
1192 Ga0068857_100213364
1193 Ga0068857_100558759
1194 Ga0068857_101470352
1195 Ga0068857_101622646
1196 Ga0068857_101658876
1197 Ga0068854_100065864
1198 Ga0068854_100703324
1199 Ga0068854_102178772
1200 Ga0068856_100420401
1201 Ga0068856_100510156
1202 Ga0068856_100556139
1203 Ga0068856_100665689
1204 Ga0070702_100057530
1205 Ga0070702_100261013
1206 Ga0070702_100289858
1207 Ga0070702_100614966
1208 Ga0068852_100190769
1209 Ga0068852_100308948
1210 Ga0068859_100385328
1211 Ga0068859_100572094
1212 Ga0068859_100778888
1213 Ga0068859_102656885
1214 Ga0068864_100080993
1215 Ga0068864_100703296
1216 Ga0068864_100830671
1217 Ga0068864_101824209
1218 Ga0068866_10586168
1219 Ga0068861_100058071
1220 Ga0068861_100552459
1221 Ga0068861_100977619
1222 Ga0068861_101585484
1223 Ga0068851_10343743
1224 Ga0068863_100002283
1225 Ga0068863_100023910
1226 Ga0068863_100359361
1227 Ga0068863_101234369
1228 Ga0068863_101798098
1229 Ga0068863_102341471
1230 Ga0068858_100579055
1231 Ga0068858_100947657
1232 Ga0068860_100041221
1233 Ga0068860_100218746
1234 Ga0068862_100171644
1235 Ga0068862_100175192
1236 Ga0068862_100686570
1237 Ga0068862_101150884
1238 Ga0081455_10067796
1239 Ga0081455_10814569
1240 Ga0081538_10258058
1241 Ga0081540_1003296
1242 Ga0081540_1008757
1243 Ga0081540_1283097
1244 Ga0081539_10000682
1245 Ga0081539_10001171
1246 Ga0081539_10002170
1247 Ga0081539_10006340
1248 Ga0081539_10020403
1249 Ga0081539_10198185
1250 Ga0081539_10416293
1251 Ga0070717_10843886
1252 Ga0070717_11346416
1253 Ga0075364_10177057
1254 Ga0075432_10437413
1255 Ga0070716_100252708
1256 Ga0070712_100970098
1257 Ga0070712_101363018
1258 Ga0097621_100727152
1259 Ga0068871_100314868
1260 Ga0075428_100278660
1261 Ga0075428_102406418
1262 Ga0075430_100616051
1263 Ga0075430_100762342
1264 Ga0075431_100068735
1265 Ga0075431_101295915
1266 Ga0075431_101597553
1267 Ga0075431_101913437
1268 Ga0075434_102293646
1269 Ga0075429_100089212
1270 Ga0075429_100557017
1271 Ga0075429_100668930
1272 Ga0068865_100413367
1273 Ga0097620_100385341
1274 Ga0097620_100572103
1275 Ga0097620_100778945
1276 Ga0097620_102656899
1277 Ga0075435_101392319
1278 Ga0105251_10330246
1279 Ga0105244_10270956
1280 Ga0105250_10173063
1281 Ga0111539_10025315
1282 Ga0111539_11939622
1283 Ga0105245_10074465
1284 Ga0105245_11397817
1285 Ga0114129_10000056
1286 Ga0114129_10062051
1287 Ga0114129_11138613
1288 Ga0114129_12295499
1289 Ga0105243_10466530
1290 Ga0105242_12178815
1291 Ga0105248_10212790
1292 Ga0105248_10502943
1293 Ga0105248_12677037
1294 Ga0105237_10597377
1295 Ga0105237_11468134
1296 Ga0105238_10479737
1297 Ga0105238_10517128
1298 Ga0105249_10556529
1299 Ga0105249_11371881
1300 Ga0105249_12470939
1301 Ga0130084_1120475
1302 Ga0105032_101594
1303 Ga0105028_106121
1304 Ga0105239_10089155
1305 Ga0105239_10399074
1306 Ga0105239_10830829
1307 Ga0105239_11508849
1308 Ga0105246_10447390
1309 Ga0105246_10516710
1310 Ga0105246_10544662
1311 Ga0105246_11640567
1312 Ga0157320_1016578
1313 Ga0157341_1016358
1314 Ga0157339_1041555
1315 Ga0157338_1031337
1316 Ga0154012_115786
1317 Ga0154012_176035
1318 Ga0154010_157036
1319 Ga0157371_10418815
1320 Ga0157369_10021627
1321 Ga0157369_10236478
1322 Ga0157369_10313236
1323 Ga0157369_11900178
1324 Ga0157374_10606082
1325 Ga0157374_11479369
1326 Ga0157374_12075113
1327 Ga0157378_10148347
1328 Ga0157378_11661326
1329 Ga0163162_10193492
1330 Ga0163162_12099418
1331 Ga0157372_10209745
1332 Ga0157372_10461374
1333 Ga0157372_11426663
1334 Ga0157372_12138646
1335 Ga0157372_12351401
1336 Ga0157375_11156048
1337 Ga0157375_12916398
1338 Ga0163163_10111596
1339 Ga0163163_10436355
1340 Ga0163163_11158352
1341 Ga0163163_12398254
1342 Ga0157380_10195782
1343 Ga0157380_11393062
1344 Ga0157380_11816662
1345 Ga0182008_10150045
1346 Ga0157377_10068917
1347 Ga0157377_10112134
1348 Ga0157377_10495787
1349 Ga0157377_11728632
1350 Ga0157379_10004447
1351 Ga0157379_10114482
1352 Ga0157379_10237366
1353 Ga0157376_10716337
1354 Ga0182006_1308336
1355 Ga0182007_10078659
1356 Ga0163161_10980819
1357 Ga0197907_10130848
1358 Ga0197907_10290521
1359 Ga0197907_10931216
1360 Ga0197907_11094761
1361 Ga0197907_11335908
1362 Ga0206356_10176895
1363 Ga0206356_10900112
1364 Ga0206356_11071879
1365 Ga0206356_11079847
1366 Ga0206349_1221287
1367 Ga0206349_1252883
1368 Ga0206349_1512573
1369 Ga0206349_1601640
1370 Ga0206349_1646595
1371 Ga0206355_1000167
1372 Ga0206355_1093080
1373 Ga0206355_1263721
1374 Ga0206355_1631847
1375 Ga0206355_1680853
1376 Ga0206351_10073110
1377 Ga0206351_10810188
1378 Ga0206351_10815273
1379 Ga0206351_10926472
1380 Ga0206352_10175716
1381 Ga0206352_10339378
1382 Ga0206352_10527522
1383 Ga0206352_10543400
1384 Ga0206352_10978437
1385 Ga0206352_11123643
1386 Ga0206350_10081742
1387 Ga0206350_10471505
1388 Ga0206350_11228157
1389 Ga0206354_10004381
1390 Ga0206354_10370725
1391 Ga0206354_10456219
1392 Ga0206354_10748701
1393 Ga0206354_11017929
1394 Ga0206354_11539509
1395 Ga0206354_11564612
1396 Ga0206354_11673340
1397 Ga0206353_10069880
1398 Ga0206353_10271544
1399 Ga0206353_11798783
1400 Ga0154015_1238497
1401 Ga0154015_1258986
1402 Ga0154015_1455192
1403 Ga0213875_10443638
1404 Ga0224712_10171710
1405 Ga0224712_10277696
1406 Ga0224712_10293906
1407 Ga0224712_10576527
1408 Ga0256720_132808
1409 Ga0207656_10747959
1410 Ga0207653_10334711
1411 Ga0207692_10142356
1412 Ga0207692_11029744
1413 Ga0207688_10219580
1414 Ga0207688_10289700
1415 Ga0207688_10571697
1416 Ga0207647_10368871
1417 Ga0207699_10945381
1418 Ga0207645_10239301
1419 Ga0207645_10741759
1420 Ga0207643_10423994
1421 Ga0207643_11128438
1422 Ga0207705_10316856
1423 Ga0207707_10205767
1424 Ga0207671_10992206
1425 Ga0207671_10998404
1426 Ga0207660_10065813
1427 Ga0207662_10116313
1428 Ga0207662_10147625
1429 Ga0207662_10384455
1430 Ga0207657_10145026
1431 Ga0207657_10464775
1432 Ga0207649_10002678
1433 Ga0207649_10542764
1434 Ga0207694_10459128
1435 Ga0207694_10916182
1436 Ga0207659_10011915
1437 Ga0207659_10502290
1438 Ga0207687_11191090
1439 Ga0207687_11901013
1440 Ga0207700_10129871
1441 Ga0207664_10958261
1442 Ga0207664_11143239
1443 Ga0207664_11340623
1444 Ga0207644_10074847
1445 Ga0207690_10287790
1446 Ga0207690_10431242
1447 Ga0207690_10444134
1448 Ga0207706_10005117
1449 Ga0207706_10264937
1450 Ga0207706_10372934
1451 Ga0207686_11366543
1452 Ga0207709_10374346
1453 Ga0207670_11403836
1454 Ga0207670_11676106
1455 Ga0207669_10265770
1456 Ga0207704_10537559
1457 Ga0207704_10726401
1458 Ga0207665_10162579
1459 Ga0207665_10180237
1460 Ga0207691_10423862
1461 Ga0207691_10703054
1462 Ga0207711_10545247
1463 Ga0207711_11425732
1464 Ga0207689_10006565
1465 Ga0207689_10040371
1466 Ga0207689_10217264
1467 Ga0207689_10360629
1468 Ga0207661_10058262
1469 Ga0207661_10104262
1470 Ga0207679_10134757
1471 Ga0207679_11860078
1472 Ga0207667_11480546
1473 Ga0207651_11258734
1474 Ga0207712_10399851
1475 Ga0207668_10006800
1476 Ga0207668_10085199
1477 Ga0207668_10086405
1478 Ga0207640_10361078
1479 Ga0207640_10529240
1480 Ga0207677_10354280
1481 Ga0207677_12103370
1482 Ga0207703_10395320
1483 Ga0207703_10642435
1484 Ga0207703_10883365
1485 Ga0207703_11375450
1486 Ga0207678_10009672
1487 Ga0207678_10117774
1488 Ga0207708_10103253
1489 Ga0207708_10144910
1490 Ga0207708_10771973
1491 Ga0207708_11130501
1492 Ga0207702_10186996
1493 Ga0207702_10296670
1494 Ga0207702_10390241
1495 Ga0207702_11145137
1496 Ga0207641_10000419
1497 Ga0207641_10037929
1498 Ga0207641_10063495
1499 Ga0207641_11742074
1500 Ga0207648_10137534
1501 Ga0207648_10198771
1502 Ga0207648_10576250
1503 Ga0207676_10296215
1504 Ga0207676_10339051
1505 Ga0207676_10410277
1506 Ga0207674_10051595
1507 Ga0207674_10101881
1508 Ga0207674_10106532
1509 Ga0207674_10155538
1510 Ga0207675_100085150
1511 Ga0207675_100471478
1512 Ga0207675_100918867
1513 Ga0207675_101183950
1514 Ga0207675_101272078
1515 Ga0207683_10059946
1516 Ga0207683_10209105
1517 Ga0207683_10437002
1518 Ga0207683_10916546
1519 Ga0207698_10451519
1520 Ga0207428_10175714
1521 Ga0207428_10176902
1522 Ga0268266_10002878
1523 Ga0268266_10487636
1524 Ga0268266_11077608
1525 Ga0268266_11312153
1526 Ga0268266_11931642
1527 Ga0268265_10153413
1528 Ga0268265_11046874
1529 Ga0265337_1095228
1530 Ga0307517_10162993
1531 Ga0307515_10000148
1532 Ga0307515_10057219
1533 Ga0307515_10167936
1534 Ga0311004_156697
1535 Ga0311001_1067596
1536 Ga0310981_1045895
1537 Ga0307511_10000442
1538 Ga0307511_10167736
1539 Ga0307512_10023306
1540 Ga0307512_10050742
1541 Ga0316180_1086595
1542 Ga0316183_1000667
1543 Ga0316182_1051395
1544 Ga0265328_10068246
1545 Ga0307513_10000002
1546 Ga0307513_10002320
1547 Ga0307513_10082362
1548 Ga0307509_10009471
1549 Ga0307408_100375079
1550 Ga0307408_100416224
1551 Ga0307408_100708943
1552 Ga0307408_100724508
1553 Ga0307508_10007906
1554 Ga0307508_10022643
1555 Ga0307508_10024389
1556 Ga0307514_10350755
1557 Ga0307514_10359352
1558 Ga0307516_10003585
1559 Ga0307516_10088874
1560 Ga0307516_10147657
1561 Ga0307405_10143152
1562 Ga0307405_10173496
1563 Ga0307413_10534776
1564 Ga0307410_10068505
1565 Ga0307410_10266182
1566 Ga0307410_10401544
1567 Ga0307410_10655088
1568 Ga0307410_11123488
1569 Ga0307410_11468154
1570 Ga0307406_10000856
1571 Ga0307406_10071795
1572 Ga0307406_10516412
1573 Ga0307406_12096970
1574 Ga0307407_10049499
1575 Ga0307412_10121539
1576 Ga0307409_100038755
1577 Ga0307409_100242668
1578 Ga0307409_100824913
1579 Ga0307416_100102513
1580 Ga0307416_100171696
1581 Ga0307416_100578772
1582 Ga0307416_101544704
1583 Ga0307416_102749958
1584 Ga0307416_103254378
1585 Ga0307414_10255234
1586 Ga0307414_11750102
1587 Ga0307411_10984297
1588 Ga0307411_11747421
1589 Ga0307415_100008707
1590 Ga0307415_100067194
1591 Ga0307415_100113492
1592 Ga0307415_100371260
1593 Ga0307415_100426882
1594 Ga0307415_100615632
1595 Ga0307415_101385280
1596 Ga0307415_101502427
1597 Ga0316593_10135718
1598 Ga0307507_10275880
1599 Ga0307510_10529989
1600 Ga0373930_0056376
1601 Ga0373929_0151525
1602 Ga0373951_0000077
1603 Ga0373932_0088562
1604 Ga0373939_0178085
1605 Ga0373941_0099891
1606 Ga0373954_0527839
1607 Ga0373956_0000255
1608 Ga0373943_0492358
1609 Ga0373955_0325886
1610 Ga0373942_0003991
1611 Ga0373942_0045220
1612 Ga0373962_0001763
1613 Ga0373924_0407941
1614 Ga0373931_0496328
1615 Ga0373931_1013333
1616 Ga0373935_0178931
1617 Ga0373927_0495995
1618 Ga0373925_0452932
1619 Ga0373925_1137328
1620 Ga0373925_1369960
1621 Ga0395899_0691500
1622 Ga0395900_0017058
1623 Ga0395900_0178726
1624 Ga0395900_0416874
1625 Ga0395898_0017301
1626 Ga0395898_0063355
1627 Ga0395898_1219123
1628 Ga0395905_0025967
1629 Ga0395905_1341435
1630 Ga0436364_0843409
1631 Ga0395901_0006306
1632 Ga0395901_0216316
1633 Ga0395901_2094819
1634 Ga0439436_0045199
1635 Ga0439439_0004566
1636 Ga0439466_0038464
1637 Ga0439465_0363526
1638 Ga0451792_08217
1639 Ga0451793_1559054
1640 Ga0451797_0420750
1641 Ga0451797_1374646
1642 Ga0451802_1014310
1643 Ga0451805_106874
1644 Ga0451804_0022812
1645 Ga0451807_0695240
1646 Ga0451807_0770464
1647 Ga0451833_0517963
1648 Ga0451837_1200754
1649 Ga0451839_1160533
1650 Ga0451840_23904
1651 Ga0451841_0484083
1652 Ga0451846_62652
1653 Ga0451850_61463
1654 Ga0451854_00925
1655 Ga0451855_1976416
1656 Ga0451853_3684749
1657 Ga0439433_0106745
1658 Ga0439448_0113420
1659 Ga0439449_0019645
1660 Ga0439449_0431918
1661 Ga0439455_0153397
1662 Ga0439457_002664
1663 Ga0439462_0244260
1664 Ga0439463_205356
1665 Ga0450890_034518
1666 Ga0450891_031721
1667 Ga0450907_048730
1668 Ga0439458_0099147
1669 Ga0439460_0157239
1670 Ga0450916_054246
1671 Ga0450916_080381
1672 Ga0439440_0117683
1673 Ga0466969_0018202
1674 Ga0466972_0008350
1675 Ga0466965_0010254
1676 Ga0466965_0086124
1677 Ga0466965_0929169
1678 Ga0466966_0001061
1679 Ga0466966_0116988
1680 Ga0466966_0158096
1681 Ga0466961_0045785
1682 Ga0466961_0166202
1683 Ga0466961_0202773
1684 Ga0466963_0165271
1685 Ga0466963_0226003
1686 Ga0466963_0635468
1687 Ga0466963_1008406
1688 Ga0466963_1072156
1689 Ga0466964_0393964
1690 Ga0466971_0088779
1691 Ga0466971_0387714
1692 Ga0466970_0004599
1693 Ga0466970_0102599
1694 Ga0466957_0058510
1695 Ga0466957_0600378
1696 Ga0466960_0000951
1697 Ga0466960_0218205
1698 Ga0466960_0267624
1699 Ga0466959_0006875
1700 Ga0466959_0034988
1701 Ga0466959_0518013
1702 Ga0466958_0179691
1703 Ga0466958_0325340
1704 Ga0466958_0630727
1705 Ga0466958_1081724
1706 Ga0466967_0186810
1707 Ga0466967_0760305
1708 Ga0466967_1834271
1709 Ga0495603_0020570
1710 Ga0495603_0178051
1711 Ga0495603_0479913
1712 Ga0495629_0014670
1713 Ga0495638_0159213
1714 Ga0495641_0031083
1715 Ga0495641_0417016
1716 Ga0495582_0010933
1717 Ga0495662_0033040
1718 Ga0495662_0630683
1719 Ga0495585_0289287
1720 Ga0495594_0027313
1721 Ga0495594_0106681
1722 Ga0495606_0012057
1723 Ga0495630_1386487
1724 Ga0495640_0015877
1725 Ga0495645_0575155
1726 Ga0495668_0000213
1727 Ga0495634_0053960
1728 Ga0495625_0012217
1729 Ga0495625_0917893
1730 Ga0495658_0101826
1731 Ga0495613_0865175
1732 Ga0495624_0074271
1733 Ga0495649_0523856
1734 Ga0495581_0917504
1735 Ga0495636_0382446
1736 Ga0495683_0408413
1737 Ga0495675_0416186
1738 Ga0495593_0340094
1739 Ga0495626_0005869
1740 Ga0496100_0002555
1741 Ga0496100_1084651
1742 Ga0496101_0170148
1743 Ga0496101_0887299
1744 Ga0496101_1150931
1745 Ga0496102_0000222
1746 Ga0496103_0000179
1747 Ga0496103_1062419
1748 Ga0496104_0173411
1749 Ga0496104_0179122
1750 Ga0496104_0311805
1751 Ga0496104_1712313
1752 Ga0496105_0040289
1753 Ga0496105_0507949
1754 Ga0496105_1076309
1755 Ga0496106_0331240
1756 Ga0496107_0270229
1757 Ga0496108_0000065
1758 Ga0496108_0339622
1759 Ga0496108_0509882
1760 Ga0496108_0848060
1761 Ga0496108_1173632
1762 Ga0496109_0168214
1763 Ga0496109_1209056
1764 Ga0496109_1543252
1765 Ga0496109_1577902
1766 Ga0496110_0640672
1767 Ga0496110_1445963
1768 Ga0496111_0147266
1769 Ga0496112_0108341
1770 Ga0496112_0210902
1771 Ga0496113_1411458
1772 Ga0496114_0148461
1773 Ga0496114_1029793
1774 Ga0496115_0457950
1775 Ga0496116_0000481
1776 Ga0496117_0000242
1777 Ga0496118_0000412
1778 Ga0496119_0013023
1779 Ga0496120_0003152
1780 Ga0496121_0002113
1781 Ga0496122_0107771
1782 Ga0496124_0028247
1783 Ga0496125_0077747
1784 Ga0496126_0000521
1785 Ga0496126_0403213
1786 Ga0501306_026908
1787 Ga0501308_039955
1788 Ga0501309_054766
1789 Ga0501309_080375
1790 Ga0501307_036786
1791 Ga0501311_042223
1792 Ga0501311_065165
1793 Ga0501311_089539
1794 Ga0501312_101412
1795 Ga0501312_106094
1796 Ga0501315_065039
1797 Ga0501315_072729
1798 Ga0501316_053986
1799 Ga0501317_097649
1800 Ga0501318_036492
1801 Ga0501318_042966
1802 Ga0501320_021563
1803 Ga0501320_022750
1804 Ga0501321_045840
1805 Ga0501322_014138
1806 Ga0501323_035375
1807 Ga0501325_025402
1808 Ga0501325_039029
1809 Ga0501325_046295
1810 Ga0501031_0621082
1811 Ga0501040_0939010
1812 Ga0501042_0337365
1813 Ga0501042_0610898
1814 Ga0501042_1148701
1815 Ga0501043_0789770
1816 Ga0501047_0043781
1817 Ga0501070_0325459
1818 Ga0501071_1357103
1819 Ga0501072_1204745
1820 Ga0501073_1123314
1821 Ga0501257_193330
1822 Ga0501044_0950220
1823 nmdc:mga00v17_134291_c1
1824 nmdc:mga05p37_43650_c1
1825 nmdc:mga05p37_6610_c1
1826 nmdc:mga09592_437295_c1
1827 nmdc:mga09592_59221_c1
1828 nmdc:mga09592_92293_c1
1829 nmdc:mga0qj67_312095_c1
1830 nmdc:mga06r32_8857_c1
1831 nmdc:mga08y16_38963_c1
1832 nmdc:mga0n895_1716881_c1
1833 nmdc:mga0rr50_144385_c1
1834 nmdc:mga0rr50_355518_c1
1835 nmdc:mga08x19_968998_c1
1836 nmdc:mga0a205_773109_c1
1837 Ga0500644_0103302
1838 Ga0500646_0001171
1839 Ga0500583_0005277
1840 Ga0500583_0206079
1841 Ga0500651_0219695
1842 Ga0500651_0613695
1843 Ga0500641_0251238
1844 Ga0500641_0382371
1845 Ga0500650_0120431
1846 Ga0500556_0251196
1847 Ga0500562_094148
1848 Ga0500569_049329
1849 Ga0500572_240015
1850 Ga0500594_0011394
1851 Ga0500652_066448
1852 Ga0500655_108929
1853 Ga0500559_0282774
1854 Ga0500568_0147348
1855 Ga0500579_175879
1856 Ga0500588_0001715
1857 Ga0500600_0058151
1858 Ga0500622_0299608
1859 Ga0500633_0203585
1860 Ga0500611_078197
1861 Ga0500587_022858
1862 Ga0587084_060986
1863 Ga0587084_090669
1864 Ga0587093_063957
1865 Ga0587066_103943
1866 Ga0587066_178793
1867 Ga0587070_095813
1868 Ga0587070_157689
1869 Ga0587073_0086985
1870 Ga0587073_0168109
1871 Ga0587073_0179273
1872 Ga0587073_0274677
1873 Ga0587073_0294866
1874 Ga0587077_095821
1875 Ga0587080_123629
1876 Ga0587080_135832
1877 Ga0587082_078791
1878 Ga0587082_084640
1879 Ga0587083_0038990
1880 Ga0587083_0215446
1881 Ga0587085_126315
1882 Ga0587085_132014
1883 Ga0587086_087395
1884 Ga0587086_087670
1885 Ga0587086_092800
1886 Ga0587088_100208
1887 Ga0587089_090275
1888 Ga0587089_100265
1889 Ga0587090_058002
1890 Ga0587090_079098
1891 Ga0587090_137982
1892 Ga0587091_085544
1893 Ga0587091_104714
1894 Ga0587091_188255
1895 Ga0587092_105043
1896 Ga0587092_109522
1897 Ga0587094_049988
1898 Ga0587094_118190
1899 Ga0587094_120394
1900 Ga0587095_042182
1901 Ga0587098_029596
1902 Ga0587106_032717
1903 Ga0587106_060370
1904 Ga0587106_106587
1905 Ga0587129_013458
1906 Ga0587099_019322
1907 Ga0587099_046241
1908 Ga0587099_054607
1909 Ga0587101_128489
1910 Ga0587109_101942
1911 Ga0587113_016745
1912 Ga0587113_034552
1913 Ga0587115_075823
1914 Ga0587122_014419
1915 Ga0587128_042347
1916 Ga0587128_063783
1917 Ga0587128_081058
1918 Ga0587128_103809
1919 Ga0587130_027322
1920 Ga0587130_043050
1921 Ga0587067_049979
1922 Ga0587067_092343
1923 Ga0587067_174189
1924 Ga0587067_185936
1925 Ga0587067_190818
1926 Ga0587067_236033
1927 Ga0587068_040150
1928 Ga0587068_138597
1929 Ga0587069_060010
1930 Ga0587069_060133
1931 Ga0587069_088558
1932 Ga0587069_104651
1933 Ga0587069_138201
1934 Ga0587075_050973
1935 Ga0587075_057723
1936 Ga0587075_060047
1937 Ga0587075_078247
1938 Ga0587076_054659
1939 Ga0587076_057258
1940 Ga0587076_075029
1941 Ga0587076_090219
1942 Ga0587079_098300
1943 Ga0587079_191683
1944 Ga0587100_043739
1945 Ga0587107_069764
1946 Ga0587107_126542
1947 Ga0587107_142883
1948 Ga0587114_055332
1949 Ga0587114_062937
1950 Ga0587114_068245
1951 Ga0587114_097970
1952 Ga0587119_026366
1953 Ga0587071_061297
1954 Ga0466962_0040787
1955 Ga0466962_0175028
1956 Ga0466962_0714048
1957 2501945236
1958 2515498359
1959 2515722787
1960 2515759628
1961 2516087001
1962 2516092057
1963 2552106614
1964 2559425982
1965 2623499741
1966 2623591234
1967 2753272073
1968 2772647165
1969 2816508677
1970 2831938478
1971 2832005375
1972 2855674015
1973 2855677031
1974 2855688794
1975 2856858179
1976 2857295431
1977 2858852708
1978 2858886543
1979 2858894241
1980 2858898249
1981 2866065285
1982 2867307710
1983 2867316492
1984 2867324872
1985 2869054697
1986 2869066840
1987 2869072662
1988 2880495887
1989 2880496479
1990 2887480673
1991 2902584805
1992 2915364145
1993 2929225122
1994 2929231912
1995 2996225799
1996 649813580
1997 8001786119
1998 8003832142
1999 8003862625
2000 8003873935
2001 8054473259
2002 8054705198
2003 8054730611
2004 8054736932
2005 8055415408
2006 8056057533

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00829

Ribosomal_L21p

Ribosomal prokaryotic L21 protein

1

100

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvm-assembly1.cif.gz_q cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9345 1 102
7y41-assembly1.cif.gz_S mycobacterium smegmatis 50s ribosomal subunit from log phase of growth 0.9262 1 100
7msm-assembly1.cif.gz_R mtb 70sic in complex with mtbetta at trans_r0 state 0.9235 1 100
7y41-assembly1.cif.gz_S mycobacterium smegmatis 50s ribosomal subunit from log phase of growth 0.9175 1 100
7msm-assembly1.cif.gz_R mtb 70sic in complex with mtbetta at trans_r0 state 0.9149 1 100
ID Description Score Start End Superfamily
af_P9WHC3_3_102_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.9367 1 100 2.40.10.190
af_P9WHC3_3_102_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.9279 1 100 2.40.10.190
af_P0AG48_1_101_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.9114 1 100 2.40.10.190
af_Q4DUK1_23_123_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9093 1 100 2.40.50.140
af_C0H4Y5_87_186_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.9008 2 99 2.40.10.190
ID Description Score Start End GO Terms
AF-E6D663-F1-model_v4 deleted 0.9667 2 102
AF-A0A3D5DWU6-F1-model_v4 Large ribosomal subunit protein bL21 0.9652 1 101 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A4R4ZVZ2-F1-model_v4 Large ribosomal subunit protein bL21 0.9647 1 101 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6N7IIT1-F1-model_v4 Large ribosomal subunit protein bL21 0.9636 1 102 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-L1PLH8-F1-model_v4 deleted 0.9621 2 101

Map