F487928
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1003 | 519 | 2006 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10453065|Ga0105244_104530651 |
| Length | 116 |
| Sequence | MYAIVKTGGKQYKVAVDDVVTVEKIDGAPGDEISLVPVLLVDGEDLTTAADALASATVSAKVVEHTKGPKIRIHKFKNKTGYHKRQGHRQPLTQVKVTGISASSRAEQRGNSSSGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 19 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 22 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 23 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 26 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009835 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B | Metatranscriptome | Rhizosphere |
| 123 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 124 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 128 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 129 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 130 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 131 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 153 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 160 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300029276 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 220 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 221 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 222 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 223 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 224 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 225 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 226 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 227 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 232 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 247 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 248 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 272 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 273 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 274 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 275 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 276 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 280 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 283 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 284 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 285 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 286 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 287 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 288 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 289 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 290 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 291 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 292 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 293 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 294 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 295 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 296 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 297 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 298 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 299 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 300 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 301 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 302 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 303 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 304 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 305 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 306 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 307 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 308 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 309 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 310 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 311 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 312 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 313 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 314 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 315 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 316 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 317 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 362 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 363 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 364 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 365 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 366 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 367 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 368 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 369 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 409 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 410 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 411 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 412 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 415 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 416 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 419 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 420 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 423 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 424 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 425 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 426 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 427 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 428 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 429 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 470 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 471 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 472 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 473 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 474 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 475 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 476 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 477 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 478 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 479 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 480 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 481 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 482 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 483 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 484 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 485 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 486 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 487 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 488 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 489 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 490 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 491 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 492 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 493 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 494 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 495 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 496 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 497 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 498 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 499 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 500 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 501 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 502 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 503 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 504 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 505 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 506 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 507 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 508 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 509 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 510 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 511 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 512 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 513 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 514 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 515 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 516 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 517 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 518 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 519 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.98 |
| Metatranscriptomes | 23.03 |
| Isolates | 4.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.69 |
| Nodule | 0.6 |
| Rhizoplane | 4.39 |
| Rhizosphere | 83.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105244_10453065 | 3300009036 | Bacteria | 590 |
| 2 | 2214744876 | 2209111006 | Bacteria | 501 |
| 3 | LJQas_1014194 | 3300000549 | Bacteria | 935 |
| 4 | JGI24739J22299_10240319 | 3300001989 | Bacteria | 530 |
| 5 | JGI24745J21846_1036060 | 3300002073 | Bacteria | 605 |
| 6 | JGI24034J26672_10058467 | 3300002239 | Bacteria | 673 |
| 7 | Ga0006778J45830_1009023 | 3300003162 | Bacteria | 551 |
| 8 | Ga0006778J45830_1016377 | 3300003162 | Bacteria | 570 |
| 9 | Ga0006778J45830_1041840 | 3300003162 | Bacteria | 680 |
| 10 | Ga0006759J45824_1013206 | 3300003163 | Bacteria | 618 |
| 11 | Ga0006759J45824_1014821 | 3300003163 | Bacteria | 731 |
| 12 | JGI25406J46586_10009537 | 3300003203 | Bacteria | 4346 |
| 13 | JGI25406J46586_10011374 | 3300003203 | Bacteria | 3906 |
| 14 | JGI25406J46586_10088159 | 3300003203 | Bacteria | 940 |
| 15 | JGI25406J46586_10123475 | 3300003203 | Bacteria | 761 |
| 16 | rootH2_10085212 | 3300003320 | Bacteria | 1467 |
| 17 | Ga0007417J51691_1007731 | 3300003544 | Bacteria | 625 |
| 18 | Ga0007417J51691_1036457 | 3300003544 | Bacteria | 529 |
| 19 | Ga0007417J51691_1036609 | 3300003544 | Bacteria | 732 |
| 20 | Ga0007417J51691_1037507 | 3300003544 | Bacteria | 505 |
| 21 | Ga0007427J51700_104985 | 3300003559 | Bacteria | 508 |
| 22 | Ga0006781J51513_1010662 | 3300003568 | Bacteria | 597 |
| 23 | Ga0006781J51513_1029898 | 3300003568 | Bacteria | 724 |
| 24 | Ga0007410J51695_1032791 | 3300003574 | Bacteria | 743 |
| 25 | Ga0007410J51695_1047814 | 3300003574 | Bacteria | 697 |
| 26 | Ga0007409J51694_1033305 | 3300003575 | Bacteria | 730 |
| 27 | Ga0007409J51694_1042642 | 3300003575 | Bacteria | 550 |
| 28 | Ga0007416J51690_1011182 | 3300003577 | Bacteria | 502 |
| 29 | Ga0007416J51690_1034645 | 3300003577 | Bacteria | 725 |
| 30 | Ga0007416J51690_1057945 | 3300003577 | Bacteria | 698 |
| 31 | Ga0007429J51699_1014261 | 3300003579 | Bacteria | 674 |
| 32 | Ga0007429J51699_1029843 | 3300003579 | Bacteria | 722 |
| 33 | Ga0007429J51699_1056898 | 3300003579 | Bacteria | 796 |
| 34 | Ga0007429J51699_1057006 | 3300003579 | Bacteria | 657 |
| 35 | Ga0007429J51699_1059000 | 3300003579 | Bacteria | 692 |
| 36 | JGI25404J52841_10068869 | 3300003659 | Bacteria | 740 |
| 37 | Ga0032354_1007423 | 3300003693 | Bacteria | 622 |
| 38 | Ga0032354_1034419 | 3300003693 | Bacteria | 727 |
| 39 | Ga0032354_1059346 | 3300003693 | Bacteria | 659 |
| 40 | Ga0032354_1070627 | 3300003693 | Bacteria | 728 |
| 41 | Ga0006780_1008494 | 3300003735 | Bacteria | 705 |
| 42 | Ga0006780_1016201 | 3300003735 | Bacteria | 617 |
| 43 | Ga0006780_1026420 | 3300003735 | Bacteria | 670 |
| 44 | Ga0006780_1027665 | 3300003735 | Bacteria | 659 |
| 45 | Ga0058858_1385167 | 3300004785 | Bacteria | 512 |
| 46 | Ga0058859_10043114 | 3300004798 | Bacteria | 829 |
| 47 | Ga0058859_10045571 | 3300004798 | Bacteria | 661 |
| 48 | Ga0058859_11823711 | 3300004798 | Bacteria | 731 |
| 49 | Ga0058859_11831572 | 3300004798 | Bacteria | 554 |
| 50 | Ga0058863_10016284 | 3300004799 | Bacteria | 802 |
| 51 | Ga0058863_11874610 | 3300004799 | Bacteria | 691 |
| 52 | Ga0058861_10006413 | 3300004800 | Bacteria | 613 |
| 53 | Ga0058861_10034986 | 3300004800 | Bacteria | 578 |
| 54 | Ga0058861_10046471 | 3300004800 | Bacteria | 623 |
| 55 | Ga0058861_11988158 | 3300004800 | Bacteria | 871 |
| 56 | Ga0058860_10003778 | 3300004801 | Bacteria | 772 |
| 57 | Ga0058860_10010621 | 3300004801 | Bacteria | 710 |
| 58 | Ga0058860_10085527 | 3300004801 | Bacteria | 702 |
| 59 | Ga0058860_12242734 | 3300004801 | Bacteria | 598 |
| 60 | Ga0058862_10078798 | 3300004803 | Bacteria | 805 |
| 61 | Ga0058862_10083481 | 3300004803 | Bacteria | 660 |
| 62 | Ga0058862_10152929 | 3300004803 | Bacteria | 659 |
| 63 | Ga0070658_10005407 | 3300005327 | Bacteria | 10364 |
| 64 | Ga0070658_10470811 | 3300005327 | Bacteria | 1084 |
| 65 | Ga0070658_10625737 | 3300005327 | Bacteria | 933 |
| 66 | Ga0070658_11405653 | 3300005327 | Bacteria | 605 |
| 67 | Ga0070676_10714872 | 3300005328 | Bacteria | 733 |
| 68 | Ga0070676_11021511 | 3300005328 | Bacteria | 621 |
| 69 | Ga0070683_100826319 | 3300005329 | Bacteria | 888 |
| 70 | Ga0070683_100871583 | 3300005329 | Bacteria | 863 |
| 71 | Ga0070683_100933687 | 3300005329 | Bacteria | 833 |
| 72 | Ga0070683_101091467 | 3300005329 | Bacteria | 767 |
| 73 | Ga0070690_100458257 | 3300005330 | Bacteria | 947 |
| 74 | Ga0070670_100054419 | 3300005331 | Bacteria | 3436 |
| 75 | Ga0070670_100984546 | 3300005331 | Bacteria | 766 |
| 76 | Ga0070670_101735610 | 3300005331 | Bacteria | 574 |
| 77 | Ga0070677_10702317 | 3300005333 | Bacteria | 570 |
| 78 | Ga0068869_100002500 | 3300005334 | Bacteria | 11085 |
| 79 | Ga0068869_100265062 | 3300005334 | Bacteria | 1376 |
| 80 | Ga0068869_100346208 | 3300005334 | Bacteria | 1210 |
| 81 | Ga0068869_100376417 | 3300005334 | Bacteria | 1163 |
| 82 | Ga0068869_102124055 | 3300005334 | Bacteria | 505 |
| 83 | Ga0070666_10111724 | 3300005335 | Bacteria | 1890 |
| 84 | Ga0070680_100464388 | 3300005336 | Bacteria | 1082 |
| 85 | Ga0070680_100485254 | 3300005336 | Bacteria | 1056 |
| 86 | Ga0070680_100637339 | 3300005336 | Bacteria | 915 |
| 87 | Ga0070680_101082942 | 3300005336 | Bacteria | 692 |
| 88 | Ga0070682_100167871 | 3300005337 | Bacteria | 1522 |
| 89 | Ga0070682_100497853 | 3300005337 | Bacteria | 944 |
| 90 | Ga0070682_100936204 | 3300005337 | Bacteria | 714 |
| 91 | Ga0068868_100474765 | 3300005338 | Bacteria | 1091 |
| 92 | Ga0070660_100308392 | 3300005339 | Bacteria | 1298 |
| 93 | Ga0070660_100712854 | 3300005339 | Bacteria | 841 |
| 94 | Ga0070689_101058379 | 3300005340 | Bacteria | 724 |
| 95 | Ga0070687_100032777 | 3300005343 | Bacteria | 2559 |
| 96 | Ga0070687_100092980 | 3300005343 | Bacteria | 1672 |
| 97 | Ga0070687_100442326 | 3300005343 | Bacteria | 863 |
| 98 | Ga0070661_100006334 | 3300005344 | Bacteria | 8165 |
| 99 | Ga0070661_100341267 | 3300005344 | Bacteria | 1173 |
| 100 | Ga0070661_100370410 | 3300005344 | Bacteria | 1127 |
| 101 | Ga0070661_100737984 | 3300005344 | Bacteria | 804 |
| 102 | Ga0070692_10369427 | 3300005345 | Bacteria | 897 |
| 103 | Ga0070692_11012353 | 3300005345 | Bacteria | 582 |
| 104 | Ga0070668_100000590 | 3300005347 | Bacteria | 24324 |
| 105 | Ga0070668_100314078 | 3300005347 | Bacteria | 1318 |
| 106 | Ga0070668_100352577 | 3300005347 | Bacteria | 1246 |
| 107 | Ga0070668_100726423 | 3300005347 | Bacteria | 877 |
| 108 | Ga0070669_100115761 | 3300005353 | Bacteria | 2040 |
| 109 | Ga0070675_100002055 | 3300005354 | Bacteria | 14941 |
| 110 | Ga0070675_100190511 | 3300005354 | Bacteria | 1777 |
| 111 | Ga0070675_100627890 | 3300005354 | Bacteria | 976 |
| 112 | Ga0070671_100002585 | 3300005355 | Bacteria | 14021 |
| 113 | Ga0070674_100414612 | 3300005356 | Bacteria | 1103 |
| 114 | Ga0070674_101030568 | 3300005356 | Bacteria | 723 |
| 115 | Ga0070674_101299798 | 3300005356 | Bacteria | 648 |
| 116 | Ga0070674_101565720 | 3300005356 | Bacteria | 594 |
| 117 | Ga0070688_100733883 | 3300005365 | Bacteria | 768 |
| 118 | Ga0070659_100166722 | 3300005366 | Bacteria | 1803 |
| 119 | Ga0070659_100604768 | 3300005366 | Bacteria | 942 |
| 120 | Ga0070667_100126394 | 3300005367 | Bacteria | 2228 |
| 121 | Ga0070667_100164713 | 3300005367 | Bacteria | 1955 |
| 122 | Ga0070667_100432841 | 3300005367 | Bacteria | 1200 |
| 123 | Ga0070667_100972086 | 3300005367 | Bacteria | 792 |
| 124 | Ga0070709_10404720 | 3300005434 | Bacteria | 1020 |
| 125 | Ga0070714_100399422 | 3300005435 | Bacteria | 1299 |
| 126 | Ga0070714_100536709 | 3300005435 | Bacteria | 1119 |
| 127 | Ga0070713_100113101 | 3300005436 | Bacteria | 2369 |
| 128 | Ga0070713_100511581 | 3300005436 | Bacteria | 1134 |
| 129 | Ga0070713_101370933 | 3300005436 | Bacteria | 685 |
| 130 | Ga0070710_11124928 | 3300005437 | Bacteria | 578 |
| 131 | Ga0070701_10239972 | 3300005438 | Bacteria | 1090 |
| 132 | Ga0070701_10406859 | 3300005438 | Bacteria | 863 |
| 133 | Ga0070705_100987385 | 3300005440 | Bacteria | 683 |
| 134 | Ga0070700_100109967 | 3300005441 | Bacteria | 1831 |
| 135 | Ga0070700_100295851 | 3300005441 | Bacteria | 1180 |
| 136 | Ga0070700_100571114 | 3300005441 | Bacteria | 882 |
| 137 | Ga0070700_100586016 | 3300005441 | Bacteria | 872 |
| 138 | Ga0070708_101579300 | 3300005445 | Bacteria | 611 |
| 139 | Ga0070708_102098192 | 3300005445 | Bacteria | 523 |
| 140 | Ga0070663_100024264 | 3300005455 | Bacteria | 4079 |
| 141 | Ga0070663_100184012 | 3300005455 | Bacteria | 1622 |
| 142 | Ga0070678_100143704 | 3300005456 | Bacteria | 1913 |
| 143 | Ga0070678_100398905 | 3300005456 | Bacteria | 1194 |
| 144 | Ga0070678_100936525 | 3300005456 | Bacteria | 793 |
| 145 | Ga0070662_100003769 | 3300005457 | Bacteria | 9485 |
| 146 | Ga0070681_10036758 | 3300005458 | Bacteria | 4917 |
| 147 | Ga0070681_10324639 | 3300005458 | Bacteria | 1449 |
| 148 | Ga0070681_10439495 | 3300005458 | Bacteria | 1216 |
| 149 | Ga0068867_100792016 | 3300005459 | Bacteria | 845 |
| 150 | Ga0070685_10058492 | 3300005466 | Bacteria | 2247 |
| 151 | Ga0070685_10172560 | 3300005466 | Bacteria | 1387 |
| 152 | Ga0070685_10260667 | 3300005466 | Bacteria | 1152 |
| 153 | Ga0070685_11356243 | 3300005466 | Bacteria | 545 |
| 154 | Ga0070707_100871511 | 3300005468 | Bacteria | 865 |
| 155 | Ga0070698_100894043 | 3300005471 | Bacteria | 834 |
| 156 | Ga0070679_100016277 | 3300005530 | Bacteria | 7166 |
| 157 | Ga0070679_100222880 | 3300005530 | Bacteria | 1846 |
| 158 | Ga0070679_100943019 | 3300005530 | Bacteria | 807 |
| 159 | Ga0070684_100138123 | 3300005535 | Bacteria | 2202 |
| 160 | Ga0070684_100266548 | 3300005535 | Bacteria | 1567 |
| 161 | Ga0070684_101171883 | 3300005535 | Bacteria | 723 |
| 162 | Ga0068853_100406738 | 3300005539 | Bacteria | 1275 |
| 163 | Ga0068853_100628804 | 3300005539 | Bacteria | 1021 |
| 164 | Ga0070672_100507706 | 3300005543 | Bacteria | 1043 |
| 165 | Ga0070672_101859996 | 3300005543 | Bacteria | 542 |
| 166 | Ga0070686_101685403 | 3300005544 | Bacteria | 538 |
| 167 | Ga0070696_101735053 | 3300005546 | Bacteria | 539 |
| 168 | Ga0070693_100099800 | 3300005547 | Bacteria | 1767 |
| 169 | Ga0070693_100309508 | 3300005547 | Bacteria | 1068 |
| 170 | Ga0070693_100617661 | 3300005547 | Bacteria | 784 |
| 171 | Ga0070665_100005910 | 3300005548 | Bacteria | 12537 |
| 172 | Ga0070665_100233199 | 3300005548 | Bacteria | 1841 |
| 173 | Ga0070665_100821318 | 3300005548 | Bacteria | 943 |
| 174 | Ga0070665_100963511 | 3300005548 | Bacteria | 865 |
| 175 | Ga0070665_101174394 | 3300005548 | Bacteria | 778 |
| 176 | Ga0070665_101257487 | 3300005548 | Bacteria | 750 |
| 177 | Ga0070665_101598516 | 3300005548 | Bacteria | 660 |
| 178 | Ga0070704_101972481 | 3300005549 | Bacteria | 542 |
| 179 | Ga0068855_100434995 | 3300005563 | Bacteria | 1433 |
| 180 | Ga0068855_100604971 | 3300005563 | Bacteria | 1182 |
| 181 | Ga0070664_100009670 | 3300005564 | Bacteria | 7823 |
| 182 | Ga0070664_100064658 | 3300005564 | Bacteria | 3120 |
| 183 | Ga0070664_100161857 | 3300005564 | Bacteria | 1980 |
| 184 | Ga0070664_100555630 | 3300005564 | Bacteria | 1062 |
| 185 | Ga0070664_100587223 | 3300005564 | Bacteria | 1032 |
| 186 | Ga0070664_101047315 | 3300005564 | Bacteria | 767 |
| 187 | Ga0068857_100060657 | 3300005577 | Bacteria | 3360 |
| 188 | Ga0068857_100201896 | 3300005577 | Bacteria | 1812 |
| 189 | Ga0068857_100213364 | 3300005577 | Bacteria | 1762 |
| 190 | Ga0068857_100558759 | 3300005577 | Bacteria | 1079 |
| 191 | Ga0068857_101470352 | 3300005577 | Bacteria | 664 |
| 192 | Ga0068857_101622646 | 3300005577 | Bacteria | 631 |
| 193 | Ga0068857_101658876 | 3300005577 | Bacteria | 625 |
| 194 | Ga0068854_100065864 | 3300005578 | Bacteria | 2635 |
| 195 | Ga0068854_100703324 | 3300005578 | Bacteria | 872 |
| 196 | Ga0068854_102178772 | 3300005578 | Bacteria | 512 |
| 197 | Ga0068856_100420401 | 3300005614 | Bacteria | 1356 |
| 198 | Ga0068856_100510156 | 3300005614 | Bacteria | 1224 |
| 199 | Ga0068856_100556139 | 3300005614 | Bacteria | 1169 |
| 200 | Ga0068856_100665689 | 3300005614 | Bacteria | 1062 |
| 201 | Ga0070702_100057530 | 3300005615 | Bacteria | 2249 |
| 202 | Ga0070702_100261013 | 3300005615 | Bacteria | 1179 |
| 203 | Ga0070702_100289858 | 3300005615 | Bacteria | 1127 |
| 204 | Ga0070702_100614966 | 3300005615 | Bacteria | 817 |
| 205 | Ga0068852_100190769 | 3300005616 | Bacteria | 1934 |
| 206 | Ga0068852_100308948 | 3300005616 | Bacteria | 1532 |
| 207 | Ga0068859_100385328 | 3300005617 | Bacteria | 1497 |
| 208 | Ga0068859_100572094 | 3300005617 | Bacteria | 1224 |
| 209 | Ga0068859_100778888 | 3300005617 | Bacteria | 1045 |
| 210 | Ga0068859_102656885 | 3300005617 | Bacteria | 550 |
| 211 | Ga0068864_100080993 | 3300005618 | Bacteria | 2845 |
| 212 | Ga0068864_100703296 | 3300005618 | Bacteria | 987 |
| 213 | Ga0068864_100830671 | 3300005618 | Bacteria | 909 |
| 214 | Ga0068864_101824209 | 3300005618 | Bacteria | 614 |
| 215 | Ga0068866_10586168 | 3300005718 | Bacteria | 751 |
| 216 | Ga0068861_100058071 | 3300005719 | Bacteria | 2958 |
| 217 | Ga0068861_100552459 | 3300005719 | Bacteria | 1049 |
| 218 | Ga0068861_100977619 | 3300005719 | Bacteria | 806 |
| 219 | Ga0068861_101585484 | 3300005719 | Bacteria | 645 |
| 220 | Ga0068851_10343743 | 3300005834 | Bacteria | 866 |
| 221 | Ga0068863_100002283 | 3300005841 | Bacteria | 19063 |
| 222 | Ga0068863_100023910 | 3300005841 | Bacteria | 5831 |
| 223 | Ga0068863_100359361 | 3300005841 | Bacteria | 1419 |
| 224 | Ga0068863_101234369 | 3300005841 | Bacteria | 754 |
| 225 | Ga0068863_101798098 | 3300005841 | Bacteria | 623 |
| 226 | Ga0068863_102341471 | 3300005841 | Bacteria | 544 |
| 227 | Ga0068858_100579055 | 3300005842 | Bacteria | 1088 |
| 228 | Ga0068858_100947657 | 3300005842 | Bacteria | 842 |
| 229 | Ga0068860_100041221 | 3300005843 | Bacteria | 4410 |
| 230 | Ga0068860_100218746 | 3300005843 | Bacteria | 1849 |
| 231 | Ga0068862_100171644 | 3300005844 | Bacteria | 1942 |
| 232 | Ga0068862_100175192 | 3300005844 | Bacteria | 1922 |
| 233 | Ga0068862_100686570 | 3300005844 | Bacteria | 991 |
| 234 | Ga0068862_101150884 | 3300005844 | Bacteria | 773 |
| 235 | Ga0081455_10067796 | 3300005937 | Bacteria | 2972 |
| 236 | Ga0081455_10814569 | 3300005937 | Bacteria | 585 |
| 237 | Ga0081538_10258058 | 3300005981 | Bacteria | 660 |
| 238 | Ga0081540_1003296 | 3300005983 | Bacteria | 12805 |
| 239 | Ga0081540_1008757 | 3300005983 | Bacteria | 7036 |
| 240 | Ga0081540_1283097 | 3300005983 | Bacteria | 572 |
| 241 | Ga0081539_10000682 | 3300005985 | Bacteria | 67986 |
| 242 | Ga0081539_10001171 | 3300005985 | Bacteria | 47476 |
| 243 | Ga0081539_10002170 | 3300005985 | Bacteria | 28828 |
| 244 | Ga0081539_10006340 | 3300005985 | Bacteria | 11401 |
| 245 | Ga0081539_10020403 | 3300005985 | Bacteria | 4480 |
| 246 | Ga0081539_10198185 | 3300005985 | Bacteria | 930 |
| 247 | Ga0081539_10416293 | 3300005985 | Bacteria | 558 |
| 248 | Ga0070717_10843886 | 3300006028 | Bacteria | 834 |
| 249 | Ga0070717_11346416 | 3300006028 | Bacteria | 649 |
| 250 | Ga0075364_10177057 | 3300006051 | Bacteria | 1443 |
| 251 | Ga0075432_10437413 | 3300006058 | Bacteria | 572 |
| 252 | Ga0070716_100252708 | 3300006173 | Bacteria | 1202 |
| 253 | Ga0070712_100970098 | 3300006175 | Bacteria | 735 |
| 254 | Ga0070712_101363018 | 3300006175 | Bacteria | 618 |
| 255 | Ga0097621_100727152 | 3300006237 | Bacteria | 915 |
| 256 | Ga0068871_100314868 | 3300006358 | Bacteria | 1376 |
| 257 | Ga0075428_100278660 | 3300006844 | Bacteria | 1799 |
| 258 | Ga0075428_102406418 | 3300006844 | Bacteria | 541 |
| 259 | Ga0075430_100616051 | 3300006846 | Bacteria | 895 |
| 260 | Ga0075430_100762342 | 3300006846 | Bacteria | 797 |
| 261 | Ga0075431_100068735 | 3300006847 | Bacteria | 3655 |
| 262 | Ga0075431_101295915 | 3300006847 | Bacteria | 689 |
| 263 | Ga0075431_101597553 | 3300006847 | Bacteria | 610 |
| 264 | Ga0075431_101913437 | 3300006847 | Bacteria | 549 |
| 265 | Ga0075434_102293646 | 3300006871 | Bacteria | 543 |
| 266 | Ga0075429_100089212 | 3300006880 | Bacteria | 2687 |
| 267 | Ga0075429_100557017 | 3300006880 | Bacteria | 1005 |
| 268 | Ga0075429_100668930 | 3300006880 | Bacteria | 910 |
| 269 | Ga0068865_100413367 | 3300006881 | Bacteria | 1107 |
| 270 | Ga0097620_100385341 | 3300006931 | Bacteria | 1497 |
| 271 | Ga0097620_100572103 | 3300006931 | Bacteria | 1224 |
| 272 | Ga0097620_100778945 | 3300006931 | Bacteria | 1045 |
| 273 | Ga0097620_102656899 | 3300006931 | Bacteria | 550 |
| 274 | Ga0075435_101392319 | 3300007076 | Bacteria | 615 |
| 275 | Ga0105251_10330246 | 3300009011 | Bacteria | 694 |
| 276 | Ga0105244_10270956 | 3300009036 | Bacteria | 789 |
| 277 | Ga0105250_10173063 | 3300009092 | Bacteria | 904 |
| 278 | Ga0111539_10025315 | 3300009094 | Bacteria | 7274 |
| 279 | Ga0111539_11939622 | 3300009094 | Bacteria | 683 |
| 280 | Ga0105245_10074465 | 3300009098 | Bacteria | 3090 |
| 281 | Ga0105245_11397817 | 3300009098 | Bacteria | 750 |
| 282 | Ga0114129_10000056 | 3300009147 | Bacteria | 99329 |
| 283 | Ga0114129_10062051 | 3300009147 | Bacteria | 5222 |
| 284 | Ga0114129_11138613 | 3300009147 | Bacteria | 975 |
| 285 | Ga0114129_12295499 | 3300009147 | Bacteria | 648 |
| 286 | Ga0105243_10466530 | 3300009148 | Bacteria | 1188 |
| 287 | Ga0105242_12178815 | 3300009176 | Bacteria | 599 |
| 288 | Ga0105248_10212790 | 3300009177 | Bacteria | 2178 |
| 289 | Ga0105248_10502943 | 3300009177 | Bacteria | 1366 |
| 290 | Ga0105248_12677037 | 3300009177 | Bacteria | 569 |
| 291 | Ga0105237_10597377 | 3300009545 | Bacteria | 1111 |
| 292 | Ga0105237_11468134 | 3300009545 | Bacteria | 688 |
| 293 | Ga0105238_10479737 | 3300009551 | Bacteria | 1243 |
| 294 | Ga0105238_10517128 | 3300009551 | Bacteria | 1196 |
| 295 | Ga0105249_10556529 | 3300009553 | Bacteria | 1198 |
| 296 | Ga0105249_11371881 | 3300009553 | Bacteria | 779 |
| 297 | Ga0105249_12470939 | 3300009553 | Bacteria | 592 |
| 298 | Ga0130084_1120475 | 3300009835 | Bacteria | 545 |
| 299 | Ga0105032_101594 | 3300009979 | Bacteria | 2063 |
| 300 | Ga0105028_106121 | 3300009993 | Bacteria | 1255 |
| 301 | Ga0105239_10089155 | 3300010375 | Bacteria | 3401 |
| 302 | Ga0105239_10399074 | 3300010375 | Bacteria | 1556 |
| 303 | Ga0105239_10830829 | 3300010375 | Bacteria | 1059 |
| 304 | Ga0105239_11508849 | 3300010375 | Bacteria | 777 |
| 305 | Ga0105246_10447390 | 3300011119 | Bacteria | 1085 |
| 306 | Ga0105246_10516710 | 3300011119 | Bacteria | 1017 |
| 307 | Ga0105246_10544662 | 3300011119 | Bacteria | 993 |
| 308 | Ga0105246_11640567 | 3300011119 | Bacteria | 609 |
| 309 | Ga0157320_1016578 | 3300012481 | Bacteria | 634 |
| 310 | Ga0157341_1016358 | 3300012494 | Bacteria | 690 |
| 311 | Ga0157339_1041555 | 3300012505 | Bacteria | 579 |
| 312 | Ga0157338_1031337 | 3300012515 | Bacteria | 679 |
| 313 | Ga0154012_115786 | 3300013059 | Bacteria | 578 |
| 314 | Ga0154012_176035 | 3300013059 | Bacteria | 755 |
| 315 | Ga0154010_157036 | 3300013062 | Bacteria | 703 |
| 316 | Ga0157371_10418815 | 3300013102 | Bacteria | 982 |
| 317 | Ga0157369_10021627 | 3300013105 | Bacteria | 7193 |
| 318 | Ga0157369_10236478 | 3300013105 | Bacteria | 1909 |
| 319 | Ga0157369_10313236 | 3300013105 | Bacteria | 1632 |
| 320 | Ga0157369_11900178 | 3300013105 | Bacteria | 604 |
| 321 | Ga0157374_10606082 | 3300013296 | Bacteria | 1105 |
| 322 | Ga0157374_11479369 | 3300013296 | Bacteria | 702 |
| 323 | Ga0157374_12075113 | 3300013296 | Bacteria | 595 |
| 324 | Ga0157378_10148347 | 3300013297 | Bacteria | 2184 |
| 325 | Ga0157378_11661326 | 3300013297 | Bacteria | 685 |
| 326 | Ga0163162_10193492 | 3300013306 | Bacteria | 2162 |
| 327 | Ga0163162_12099418 | 3300013306 | Bacteria | 648 |
| 328 | Ga0157372_10209745 | 3300013307 | Bacteria | 2257 |
| 329 | Ga0157372_10461374 | 3300013307 | Bacteria | 1480 |
| 330 | Ga0157372_11426663 | 3300013307 | Bacteria | 798 |
| 331 | Ga0157372_12138646 | 3300013307 | Bacteria | 643 |
| 332 | Ga0157372_12351401 | 3300013307 | Bacteria | 612 |
| 333 | Ga0157375_11156048 | 3300013308 | Bacteria | 907 |
| 334 | Ga0157375_12916398 | 3300013308 | Bacteria | 571 |
| 335 | Ga0163163_10111596 | 3300014325 | Bacteria | 2763 |
| 336 | Ga0163163_10436355 | 3300014325 | Bacteria | 1369 |
| 337 | Ga0163163_11158352 | 3300014325 | Bacteria | 836 |
| 338 | Ga0163163_12398254 | 3300014325 | Bacteria | 586 |
| 339 | Ga0157380_10195782 | 3300014326 | Bacteria | 1789 |
| 340 | Ga0157380_11393062 | 3300014326 | Bacteria | 751 |
| 341 | Ga0157380_11816662 | 3300014326 | Bacteria | 669 |
| 342 | Ga0182008_10150045 | 3300014497 | Bacteria | 1169 |
| 343 | Ga0157377_10068917 | 3300014745 | Bacteria | 2040 |
| 344 | Ga0157377_10112134 | 3300014745 | Bacteria | 1641 |
| 345 | Ga0157377_10495787 | 3300014745 | Bacteria | 852 |
| 346 | Ga0157377_11728632 | 3300014745 | Bacteria | 506 |
| 347 | Ga0157379_10004447 | 3300014968 | Bacteria | 12020 |
| 348 | Ga0157379_10114482 | 3300014968 | Bacteria | 2424 |
| 349 | Ga0157379_10237366 | 3300014968 | Bacteria | 1653 |
| 350 | Ga0157376_10716337 | 3300014969 | Bacteria | 1007 |
| 351 | Ga0182006_1308336 | 3300015261 | Bacteria | 520 |
| 352 | Ga0182007_10078659 | 3300015262 | Bacteria | 1081 |
| 353 | Ga0163161_10980819 | 3300017792 | Bacteria | 720 |
| 354 | Ga0197907_10130848 | 3300020069 | Bacteria | 581 |
| 355 | Ga0197907_10290521 | 3300020069 | Bacteria | 514 |
| 356 | Ga0197907_10931216 | 3300020069 | Bacteria | 750 |
| 357 | Ga0197907_11094761 | 3300020069 | Bacteria | 641 |
| 358 | Ga0197907_11335908 | 3300020069 | Bacteria | 984 |
| 359 | Ga0206356_10176895 | 3300020070 | Bacteria | 614 |
| 360 | Ga0206356_10900112 | 3300020070 | Bacteria | 618 |
| 361 | Ga0206356_11071879 | 3300020070 | Bacteria | 614 |
| 362 | Ga0206356_11079847 | 3300020070 | Bacteria | 772 |
| 363 | Ga0206349_1221287 | 3300020075 | Bacteria | 838 |
| 364 | Ga0206349_1252883 | 3300020075 | Bacteria | 632 |
| 365 | Ga0206349_1512573 | 3300020075 | Bacteria | 756 |
| 366 | Ga0206349_1601640 | 3300020075 | Bacteria | 593 |
| 367 | Ga0206349_1646595 | 3300020075 | Bacteria | 518 |
| 368 | Ga0206355_1000167 | 3300020076 | Bacteria | 664 |
| 369 | Ga0206355_1093080 | 3300020076 | Bacteria | 710 |
| 370 | Ga0206355_1263721 | 3300020076 | Bacteria | 845 |
| 371 | Ga0206355_1631847 | 3300020076 | Bacteria | 637 |
| 372 | Ga0206355_1680853 | 3300020076 | Bacteria | 801 |
| 373 | Ga0206351_10073110 | 3300020077 | Bacteria | 828 |
| 374 | Ga0206351_10810188 | 3300020077 | Bacteria | 656 |
| 375 | Ga0206351_10815273 | 3300020077 | Bacteria | 674 |
| 376 | Ga0206351_10926472 | 3300020077 | Bacteria | 609 |
| 377 | Ga0206352_10175716 | 3300020078 | Bacteria | 794 |
| 378 | Ga0206352_10339378 | 3300020078 | Bacteria | 732 |
| 379 | Ga0206352_10527522 | 3300020078 | Bacteria | 677 |
| 380 | Ga0206352_10543400 | 3300020078 | Bacteria | 788 |
| 381 | Ga0206352_10978437 | 3300020078 | Bacteria | 562 |
| 382 | Ga0206352_11123643 | 3300020078 | Bacteria | 903 |
| 383 | Ga0206350_10081742 | 3300020080 | Bacteria | 791 |
| 384 | Ga0206350_10471505 | 3300020080 | Bacteria | 786 |
| 385 | Ga0206350_11228157 | 3300020080 | Bacteria | 659 |
| 386 | Ga0206354_10004381 | 3300020081 | Bacteria | 683 |
| 387 | Ga0206354_10370725 | 3300020081 | Bacteria | 1470 |
| 388 | Ga0206354_10456219 | 3300020081 | Bacteria | 630 |
| 389 | Ga0206354_10748701 | 3300020081 | Bacteria | 594 |
| 390 | Ga0206354_11017929 | 3300020081 | Bacteria | 1669 |
| 391 | Ga0206354_11539509 | 3300020081 | Bacteria | 1253 |
| 392 | Ga0206354_11564612 | 3300020081 | Bacteria | 791 |
| 393 | Ga0206354_11673340 | 3300020081 | Bacteria | 506 |
| 394 | Ga0206353_10069880 | 3300020082 | Bacteria | 1274 |
| 395 | Ga0206353_10271544 | 3300020082 | Bacteria | 840 |
| 396 | Ga0206353_11798783 | 3300020082 | Bacteria | 996 |
| 397 | Ga0154015_1238497 | 3300020610 | Bacteria | 596 |
| 398 | Ga0154015_1258986 | 3300020610 | Bacteria | 777 |
| 399 | Ga0154015_1455192 | 3300020610 | Bacteria | 739 |
| 400 | Ga0213875_10443638 | 3300021388 | Bacteria | 621 |
| 401 | Ga0224712_10171710 | 3300022467 | Bacteria | 973 |
| 402 | Ga0224712_10277696 | 3300022467 | Bacteria | 779 |
| 403 | Ga0224712_10293906 | 3300022467 | Bacteria | 758 |
| 404 | Ga0224712_10576527 | 3300022467 | Bacteria | 548 |
| 405 | Ga0256720_132808 | 3300023438 | Bacteria | 522 |
| 406 | Ga0207656_10747959 | 3300025321 | Bacteria | 501 |
| 407 | Ga0207653_10334711 | 3300025885 | Bacteria | 590 |
| 408 | Ga0207692_10142356 | 3300025898 | Bacteria | 1365 |
| 409 | Ga0207692_11029744 | 3300025898 | Bacteria | 544 |
| 410 | Ga0207688_10219580 | 3300025901 | Bacteria | 1145 |
| 411 | Ga0207688_10289700 | 3300025901 | Bacteria | 999 |
| 412 | Ga0207688_10571697 | 3300025901 | Bacteria | 711 |
| 413 | Ga0207647_10368871 | 3300025904 | Bacteria | 812 |
| 414 | Ga0207699_10945381 | 3300025906 | Bacteria | 636 |
| 415 | Ga0207645_10239301 | 3300025907 | Bacteria | 1199 |
| 416 | Ga0207645_10741759 | 3300025907 | Bacteria | 668 |
| 417 | Ga0207643_10423994 | 3300025908 | Bacteria | 844 |
| 418 | Ga0207643_11128438 | 3300025908 | Bacteria | 505 |
| 419 | Ga0207705_10316856 | 3300025909 | Bacteria | 1198 |
| 420 | Ga0207707_10205767 | 3300025912 | Bacteria | 1715 |
| 421 | Ga0207671_10992206 | 3300025914 | Bacteria | 662 |
| 422 | Ga0207671_10998404 | 3300025914 | Bacteria | 660 |
| 423 | Ga0207660_10065813 | 3300025917 | Bacteria | 2620 |
| 424 | Ga0207662_10116313 | 3300025918 | Bacteria | 1672 |
| 425 | Ga0207662_10147625 | 3300025918 | Bacteria | 1494 |
| 426 | Ga0207662_10384455 | 3300025918 | Bacteria | 949 |
| 427 | Ga0207657_10145026 | 3300025919 | Bacteria | 1937 |
| 428 | Ga0207657_10464775 | 3300025919 | Bacteria | 992 |
| 429 | Ga0207649_10002678 | 3300025920 | Bacteria | 9878 |
| 430 | Ga0207649_10542764 | 3300025920 | Bacteria | 889 |
| 431 | Ga0207694_10459128 | 3300025924 | Bacteria | 1064 |
| 432 | Ga0207694_10916182 | 3300025924 | Bacteria | 741 |
| 433 | Ga0207659_10011915 | 3300025926 | Bacteria | 5507 |
| 434 | Ga0207659_10502290 | 3300025926 | Bacteria | 1027 |
| 435 | Ga0207687_11191090 | 3300025927 | Bacteria | 655 |
| 436 | Ga0207687_11901013 | 3300025927 | Bacteria | 509 |
| 437 | Ga0207700_10129871 | 3300025928 | Bacteria | 2056 |
| 438 | Ga0207664_10958261 | 3300025929 | Bacteria | 767 |
| 439 | Ga0207664_11143239 | 3300025929 | Bacteria | 695 |
| 440 | Ga0207664_11340623 | 3300025929 | Bacteria | 636 |
| 441 | Ga0207644_10074847 | 3300025931 | Bacteria | 2486 |
| 442 | Ga0207690_10287790 | 3300025932 | Bacteria | 1282 |
| 443 | Ga0207690_10431242 | 3300025932 | Bacteria | 1056 |
| 444 | Ga0207690_10444134 | 3300025932 | Bacteria | 1041 |
| 445 | Ga0207706_10005117 | 3300025933 | Bacteria | 12240 |
| 446 | Ga0207706_10264937 | 3300025933 | Bacteria | 1500 |
| 447 | Ga0207706_10372934 | 3300025933 | Bacteria | 1239 |
| 448 | Ga0207686_11366543 | 3300025934 | Bacteria | 582 |
| 449 | Ga0207709_10374346 | 3300025935 | Bacteria | 1082 |
| 450 | Ga0207670_11403836 | 3300025936 | Bacteria | 593 |
| 451 | Ga0207670_11676106 | 3300025936 | Bacteria | 541 |
| 452 | Ga0207669_10265770 | 3300025937 | Bacteria | 1286 |
| 453 | Ga0207704_10537559 | 3300025938 | Bacteria | 948 |
| 454 | Ga0207704_10726401 | 3300025938 | Bacteria | 824 |
| 455 | Ga0207665_10162579 | 3300025939 | Bacteria | 1607 |
| 456 | Ga0207665_10180237 | 3300025939 | Bacteria | 1530 |
| 457 | Ga0207691_10423862 | 3300025940 | Bacteria | 1134 |
| 458 | Ga0207691_10703054 | 3300025940 | Bacteria | 852 |
| 459 | Ga0207711_10545247 | 3300025941 | Bacteria | 1082 |
| 460 | Ga0207711_11425732 | 3300025941 | Bacteria | 635 |
| 461 | Ga0207689_10006565 | 3300025942 | Bacteria | 10257 |
| 462 | Ga0207689_10040371 | 3300025942 | Bacteria | 3862 |
| 463 | Ga0207689_10217264 | 3300025942 | Bacteria | 1579 |
| 464 | Ga0207689_10360629 | 3300025942 | Bacteria | 1209 |
| 465 | Ga0207661_10058262 | 3300025944 | Bacteria | 3108 |
| 466 | Ga0207661_10104262 | 3300025944 | Bacteria | 2387 |
| 467 | Ga0207679_10134757 | 3300025945 | Bacteria | 1987 |
| 468 | Ga0207679_11860078 | 3300025945 | Bacteria | 549 |
| 469 | Ga0207667_11480546 | 3300025949 | Bacteria | 650 |
| 470 | Ga0207651_11258734 | 3300025960 | Bacteria | 665 |
| 471 | Ga0207712_10399851 | 3300025961 | Bacteria | 1154 |
| 472 | Ga0207668_10006800 | 3300025972 | Bacteria | 6774 |
| 473 | Ga0207668_10085199 | 3300025972 | Bacteria | 2305 |
| 474 | Ga0207668_10086405 | 3300025972 | Bacteria | 2291 |
| 475 | Ga0207640_10361078 | 3300025981 | Bacteria | 1170 |
| 476 | Ga0207640_10529240 | 3300025981 | Bacteria | 987 |
| 477 | Ga0207677_10354280 | 3300026023 | Bacteria | 1231 |
| 478 | Ga0207677_12103370 | 3300026023 | Bacteria | 525 |
| 479 | Ga0207703_10395320 | 3300026035 | Bacteria | 1281 |
| 480 | Ga0207703_10642435 | 3300026035 | Bacteria | 1006 |
| 481 | Ga0207703_10883365 | 3300026035 | Bacteria | 856 |
| 482 | Ga0207703_11375450 | 3300026035 | Bacteria | 679 |
| 483 | Ga0207678_10009672 | 3300026067 | Bacteria | 8480 |
| 484 | Ga0207678_10117774 | 3300026067 | Bacteria | 2266 |
| 485 | Ga0207708_10103253 | 3300026075 | Bacteria | 2208 |
| 486 | Ga0207708_10144910 | 3300026075 | Bacteria | 1866 |
| 487 | Ga0207708_10771973 | 3300026075 | Bacteria | 826 |
| 488 | Ga0207708_11130501 | 3300026075 | Bacteria | 683 |
| 489 | Ga0207702_10186996 | 3300026078 | Bacteria | 1911 |
| 490 | Ga0207702_10296670 | 3300026078 | Bacteria | 1533 |
| 491 | Ga0207702_10390241 | 3300026078 | Bacteria | 1340 |
| 492 | Ga0207702_11145137 | 3300026078 | Bacteria | 772 |
| 493 | Ga0207641_10000419 | 3300026088 | Bacteria | 49566 |
| 494 | Ga0207641_10037929 | 3300026088 | Bacteria | 4027 |
| 495 | Ga0207641_10063495 | 3300026088 | Bacteria | 3154 |
| 496 | Ga0207641_11742074 | 3300026088 | Bacteria | 625 |
| 497 | Ga0207648_10137534 | 3300026089 | Bacteria | 2152 |
| 498 | Ga0207648_10198771 | 3300026089 | Bacteria | 1778 |
| 499 | Ga0207648_10576250 | 3300026089 | Bacteria | 1036 |
| 500 | Ga0207676_10296215 | 3300026095 | Bacteria | 1475 |
| 501 | Ga0207676_10339051 | 3300026095 | Bacteria | 1386 |
| 502 | Ga0207676_10410277 | 3300026095 | Bacteria | 1268 |
| 503 | Ga0207674_10051595 | 3300026116 | Bacteria | 4197 |
| 504 | Ga0207674_10101881 | 3300026116 | Bacteria | 2852 |
| 505 | Ga0207674_10106532 | 3300026116 | Bacteria | 2781 |
| 506 | Ga0207674_10155538 | 3300026116 | Bacteria | 2242 |
| 507 | Ga0207675_100085150 | 3300026118 | Bacteria | 2966 |
| 508 | Ga0207675_100471478 | 3300026118 | Bacteria | 1246 |
| 509 | Ga0207675_100918867 | 3300026118 | Bacteria | 892 |
| 510 | Ga0207675_101183950 | 3300026118 | Bacteria | 784 |
| 511 | Ga0207675_101272078 | 3300026118 | Bacteria | 756 |
| 512 | Ga0207683_10059946 | 3300026121 | Bacteria | 3344 |
| 513 | Ga0207683_10209105 | 3300026121 | Bacteria | 1775 |
| 514 | Ga0207683_10437002 | 3300026121 | Bacteria | 1206 |
| 515 | Ga0207683_10916546 | 3300026121 | Bacteria | 814 |
| 516 | Ga0207698_10451519 | 3300026142 | Bacteria | 1241 |
| 517 | Ga0207428_10175714 | 3300027907 | Bacteria | 1620 |
| 518 | Ga0207428_10176902 | 3300027907 | Bacteria | 1613 |
| 519 | Ga0268266_10002878 | 3300028379 | Bacteria | 17879 |
| 520 | Ga0268266_10487636 | 3300028379 | Bacteria | 1175 |
| 521 | Ga0268266_11077608 | 3300028379 | Bacteria | 777 |
| 522 | Ga0268266_11312153 | 3300028379 | Bacteria | 699 |
| 523 | Ga0268266_11931642 | 3300028379 | Bacteria | 564 |
| 524 | Ga0268265_10153413 | 3300028380 | Bacteria | 1946 |
| 525 | Ga0268265_11046874 | 3300028380 | Bacteria | 808 |
| 526 | Ga0265337_1095228 | 3300028556 | Bacteria | 811 |
| 527 | Ga0307517_10162993 | 3300028786 | Bacteria | 1490 |
| 528 | Ga0307515_10000148 | 3300028794 | Bacteria | 170303 |
| 529 | Ga0307515_10057219 | 3300028794 | Bacteria | 5647 |
| 530 | Ga0307515_10167936 | 3300028794 | Bacteria | 2202 |
| 531 | Ga0311004_156697 | 3300029276 | Bacteria | 597 |
| 532 | Ga0311001_1067596 | 3300029277 | Bacteria | 599 |
| 533 | Ga0310981_1045895 | 3300029285 | Bacteria | 691 |
| 534 | Ga0307511_10000442 | 3300030521 | Bacteria | 44415 |
| 535 | Ga0307511_10167736 | 3300030521 | Bacteria | 1215 |
| 536 | Ga0307512_10023306 | 3300030522 | Bacteria | 5535 |
| 537 | Ga0307512_10050742 | 3300030522 | Bacteria | 3328 |
| 538 | Ga0316180_1086595 | 3300030736 | Bacteria | 514 |
| 539 | Ga0316183_1000667 | 3300030742 | Bacteria | 696 |
| 540 | Ga0316182_1051395 | 3300030745 | Bacteria | 1149 |
| 541 | Ga0265328_10068246 | 3300031239 | Bacteria | 1306 |
| 542 | Ga0307513_10000002 | 3300031456 | Bacteria | 842612 |
| 543 | Ga0307513_10002320 | 3300031456 | Bacteria | 26540 |
| 544 | Ga0307513_10082362 | 3300031456 | Bacteria | 3313 |
| 545 | Ga0307509_10009471 | 3300031507 | Bacteria | 12168 |
| 546 | Ga0307408_100375079 | 3300031548 | Bacteria | 1214 |
| 547 | Ga0307408_100416224 | 3300031548 | Bacteria | 1158 |
| 548 | Ga0307408_100708943 | 3300031548 | Bacteria | 905 |
| 549 | Ga0307408_100724508 | 3300031548 | Bacteria | 896 |
| 550 | Ga0307508_10007906 | 3300031616 | Bacteria | 9869 |
| 551 | Ga0307508_10022643 | 3300031616 | Bacteria | 5710 |
| 552 | Ga0307508_10024389 | 3300031616 | Bacteria | 5489 |
| 553 | Ga0307514_10350755 | 3300031649 | Bacteria | 787 |
| 554 | Ga0307514_10359352 | 3300031649 | Bacteria | 770 |
| 555 | Ga0307516_10003585 | 3300031730 | Bacteria | 19795 |
| 556 | Ga0307516_10088874 | 3300031730 | Bacteria | 2921 |
| 557 | Ga0307516_10147657 | 3300031730 | Bacteria | 2115 |
| 558 | Ga0307405_10143152 | 3300031731 | Bacteria | 1670 |
| 559 | Ga0307405_10173496 | 3300031731 | Bacteria | 1540 |
| 560 | Ga0307413_10534776 | 3300031824 | Bacteria | 948 |
| 561 | Ga0307410_10068505 | 3300031852 | Bacteria | 2451 |
| 562 | Ga0307410_10266182 | 3300031852 | Unclassified | 1339 |
| 563 | Ga0307410_10401544 | 3300031852 | Bacteria | 1107 |
| 564 | Ga0307410_10655088 | 3300031852 | Bacteria | 881 |
| 565 | Ga0307410_11123488 | 3300031852 | Bacteria | 682 |
| 566 | Ga0307410_11468154 | 3300031852 | Bacteria | 600 |
| 567 | Ga0307406_10000856 | 3300031901 | Bacteria | 17128 |
| 568 | Ga0307406_10071795 | 3300031901 | Bacteria | 2270 |
| 569 | Ga0307406_10516412 | 3300031901 | Bacteria | 971 |
| 570 | Ga0307406_12096970 | 3300031901 | Bacteria | 506 |
| 571 | Ga0307407_10049499 | 3300031903 | Bacteria | 2399 |
| 572 | Ga0307412_10121539 | 3300031911 | Bacteria | 1881 |
| 573 | Ga0307409_100038755 | 3300031995 | Bacteria | 3528 |
| 574 | Ga0307409_100242668 | 3300031995 | Bacteria | 1641 |
| 575 | Ga0307409_100824913 | 3300031995 | Bacteria | 936 |
| 576 | Ga0307416_100102513 | 3300032002 | Bacteria | 2495 |
| 577 | Ga0307416_100171696 | 3300032002 | Bacteria | 2019 |
| 578 | Ga0307416_100578772 | 3300032002 | Bacteria | 1200 |
| 579 | Ga0307416_101544704 | 3300032002 | Bacteria | 769 |
| 580 | Ga0307416_102749958 | 3300032002 | Unclassified | 588 |
| 581 | Ga0307416_103254378 | 3300032002 | Bacteria | 543 |
| 582 | Ga0307414_10255234 | 3300032004 | Bacteria | 1460 |
| 583 | Ga0307414_11750102 | 3300032004 | Bacteria | 580 |
| 584 | Ga0307411_10984297 | 3300032005 | Bacteria | 754 |
| 585 | Ga0307411_11747421 | 3300032005 | Bacteria | 576 |
| 586 | Ga0307415_100008707 | 3300032126 | Bacteria | 5645 |
| 587 | Ga0307415_100067194 | 3300032126 | Bacteria | 2504 |
| 588 | Ga0307415_100113492 | 3300032126 | Bacteria | 2015 |
| 589 | Ga0307415_100371260 | 3300032126 | Bacteria | 1211 |
| 590 | Ga0307415_100426882 | 3300032126 | Bacteria | 1139 |
| 591 | Ga0307415_100615632 | 3300032126 | Bacteria | 968 |
| 592 | Ga0307415_101385280 | 3300032126 | Bacteria | 669 |
| 593 | Ga0307415_101502427 | 3300032126 | Bacteria | 644 |
| 594 | Ga0316593_10135718 | 3300032168 | Bacteria | 890 |
| 595 | Ga0307507_10275880 | 3300033179 | Bacteria | 1056 |
| 596 | Ga0307510_10529989 | 3300033180 | Bacteria | 622 |
| 597 | Ga0373930_0056376 | 3300034816 | Bacteria | 868 |
| 598 | Ga0373929_0151525 | 3300035085 | Bacteria | 622 |
| 599 | Ga0373951_0000077 | 3300035091 | Bacteria | 38676 |
| 600 | Ga0373932_0088562 | 3300035112 | Bacteria | 989 |
| 601 | Ga0373939_0178085 | 3300035114 | Bacteria | 791 |
| 602 | Ga0373941_0099891 | 3300035115 | Bacteria | 1008 |
| 603 | Ga0373954_0527839 | 3300035118 | Bacteria | 585 |
| 604 | Ga0373956_0000255 | 3300035119 | Bacteria | 21213 |
| 605 | Ga0373943_0492358 | 3300035170 | Bacteria | 716 |
| 606 | Ga0373955_0325886 | 3300035172 | Bacteria | 928 |
| 607 | Ga0373942_0003991 | 3300035207 | Bacteria | 3442 |
| 608 | Ga0373942_0045220 | 3300035207 | Bacteria | 1216 |
| 609 | Ga0373962_0001763 | 3300035242 | Bacteria | 5150 |
| 610 | Ga0373924_0407941 | 3300035410 | Bacteria | 608 |
| 611 | Ga0373931_0496328 | 3300035691 | Bacteria | 787 |
| 612 | Ga0373931_1013333 | 3300035691 | Bacteria | 562 |
| 613 | Ga0373935_0178931 | 3300035692 | Bacteria | 1455 |
| 614 | Ga0373927_0495995 | 3300035695 | Bacteria | 807 |
| 615 | Ga0373925_0452932 | 3300037068 | Bacteria | 1051 |
| 616 | Ga0373925_1137328 | 3300037068 | Bacteria | 642 |
| 617 | Ga0373925_1369960 | 3300037068 | Bacteria | 580 |
| 618 | Ga0395899_0691500 | 3300037312 | Bacteria | 640 |
| 619 | Ga0395900_0017058 | 3300037418 | Bacteria | 7413 |
| 620 | Ga0395900_0178726 | 3300037418 | Bacteria | 2158 |
| 621 | Ga0395900_0416874 | 3300037418 | Bacteria | 1304 |
| 622 | Ga0395898_0017301 | 3300037466 | Bacteria | 7365 |
| 623 | Ga0395898_0063355 | 3300037466 | Bacteria | 3588 |
| 624 | Ga0395898_1219123 | 3300037466 | Bacteria | 683 |
| 625 | Ga0395905_0025967 | 3300037471 | Bacteria | 5522 |
| 626 | Ga0395905_1341435 | 3300037471 | Bacteria | 619 |
| 627 | Ga0436364_0843409 | 3300037853 | Bacteria | 976 |
| 628 | Ga0395901_0006306 | 3300038443 | Bacteria | 12014 |
| 629 | Ga0395901_0216316 | 3300038443 | Bacteria | 2004 |
| 630 | Ga0395901_2094819 | 3300038443 | Bacteria | 511 |
| 631 | Ga0439436_0045199 | 3300041404 | Bacteria | 1253 |
| 632 | Ga0439439_0004566 | 3300041406 | Bacteria | 3130 |
| 633 | Ga0439466_0038464 | 3300041411 | Bacteria | 1607 |
| 634 | Ga0439465_0363526 | 3300041413 | Bacteria | 548 |
| 635 | Ga0451792_08217 | 3300041445 | Bacteria | 555 |
| 636 | Ga0451793_1559054 | 3300041452 | Bacteria | 819 |
| 637 | Ga0451797_0420750 | 3300041453 | Bacteria | 712 |
| 638 | Ga0451797_1374646 | 3300041453 | Bacteria | 837 |
| 639 | Ga0451802_1014310 | 3300041460 | Bacteria | 687 |
| 640 | Ga0451805_106874 | 3300041461 | Bacteria | 624 |
| 641 | Ga0451804_0022812 | 3300041463 | Bacteria | 909 |
| 642 | Ga0451807_0695240 | 3300041486 | Bacteria | 887 |
| 643 | Ga0451807_0770464 | 3300041486 | Bacteria | 612 |
| 644 | Ga0451833_0517963 | 3300041491 | Bacteria | 933 |
| 645 | Ga0451837_1200754 | 3300041494 | Bacteria | 802 |
| 646 | Ga0451839_1160533 | 3300041496 | Bacteria | 1028 |
| 647 | Ga0451840_23904 | 3300041497 | Bacteria | 606 |
| 648 | Ga0451841_0484083 | 3300041498 | Bacteria | 788 |
| 649 | Ga0451846_62652 | 3300041502 | Bacteria | 619 |
| 650 | Ga0451850_61463 | 3300041506 | Bacteria | 681 |
| 651 | Ga0451854_00925 | 3300041510 | Bacteria | 710 |
| 652 | Ga0451855_1976416 | 3300041511 | Bacteria | 585 |
| 653 | Ga0451853_3684749 | 3300041512 | Bacteria | 633 |
| 654 | Ga0439433_0106745 | 3300041999 | Bacteria | 698 |
| 655 | Ga0439448_0113420 | 3300042005 | Bacteria | 927 |
| 656 | Ga0439449_0019645 | 3300042007 | Bacteria | 2532 |
| 657 | Ga0439449_0431918 | 3300042007 | Bacteria | 500 |
| 658 | Ga0439455_0153397 | 3300042012 | Bacteria | 656 |
| 659 | Ga0439457_002664 | 3300042014 | Bacteria | 5031 |
| 660 | Ga0439462_0244260 | 3300042015 | Bacteria | 516 |
| 661 | Ga0439463_205356 | 3300042016 | Bacteria | 512 |
| 662 | Ga0450890_034518 | 3300042127 | Bacteria | 731 |
| 663 | Ga0450891_031721 | 3300042129 | Bacteria | 549 |
| 664 | Ga0450907_048730 | 3300042146 | Bacteria | 727 |
| 665 | Ga0439458_0099147 | 3300042157 | Bacteria | 755 |
| 666 | Ga0439460_0157239 | 3300042461 | Bacteria | 761 |
| 667 | Ga0450916_054246 | 3300042530 | Bacteria | 639 |
| 668 | Ga0450916_080381 | 3300042530 | Bacteria | 556 |
| 669 | Ga0439440_0117683 | 3300042993 | Bacteria | 737 |
| 670 | Ga0466969_0018202 | 3300044656 | Bacteria | 3662 |
| 671 | Ga0466972_0008350 | 3300044658 | Bacteria | 5190 |
| 672 | Ga0466965_0010254 | 3300044683 | Bacteria | 4365 |
| 673 | Ga0466965_0086124 | 3300044683 | Bacteria | 1593 |
| 674 | Ga0466965_0929169 | 3300044683 | Bacteria | 508 |
| 675 | Ga0466966_0001061 | 3300044684 | Bacteria | 17560 |
| 676 | Ga0466966_0116988 | 3300044684 | Bacteria | 1640 |
| 677 | Ga0466966_0158096 | 3300044684 | Bacteria | 1380 |
| 678 | Ga0466961_0045785 | 3300044693 | Bacteria | 2798 |
| 679 | Ga0466961_0166202 | 3300044693 | Bacteria | 1373 |
| 680 | Ga0466961_0202773 | 3300044693 | Bacteria | 1226 |
| 681 | Ga0466963_0165271 | 3300044694 | Bacteria | 1541 |
| 682 | Ga0466963_0226003 | 3300044694 | Bacteria | 1311 |
| 683 | Ga0466963_0635468 | 3300044694 | Bacteria | 753 |
| 684 | Ga0466963_1008406 | 3300044694 | Bacteria | 586 |
| 685 | Ga0466963_1072156 | 3300044694 | Bacteria | 567 |
| 686 | Ga0466964_0393964 | 3300044706 | Bacteria | 722 |
| 687 | Ga0466971_0088779 | 3300044719 | Bacteria | 1414 |
| 688 | Ga0466971_0387714 | 3300044719 | Bacteria | 680 |
| 689 | Ga0466970_0004599 | 3300044765 | Bacteria | 6809 |
| 690 | Ga0466970_0102599 | 3300044765 | Bacteria | 1558 |
| 691 | Ga0466957_0058510 | 3300044842 | Bacteria | 2361 |
| 692 | Ga0466957_0600378 | 3300044842 | Bacteria | 770 |
| 693 | Ga0466960_0000951 | 3300044901 | Bacteria | 10271 |
| 694 | Ga0466960_0218205 | 3300044901 | Bacteria | 1048 |
| 695 | Ga0466960_0267624 | 3300044901 | Bacteria | 954 |
| 696 | Ga0466959_0006875 | 3300045049 | Bacteria | 7935 |
| 697 | Ga0466959_0034988 | 3300045049 | Bacteria | 3715 |
| 698 | Ga0466959_0518013 | 3300045049 | Bacteria | 805 |
| 699 | Ga0466958_0179691 | 3300045836 | Bacteria | 1342 |
| 700 | Ga0466958_0325340 | 3300045836 | Bacteria | 988 |
| 701 | Ga0466958_0630727 | 3300045836 | Bacteria | 697 |
| 702 | Ga0466958_1081724 | 3300045836 | Bacteria | 523 |
| 703 | Ga0466967_0186810 | 3300045976 | Bacteria | 1957 |
| 704 | Ga0466967_0760305 | 3300045976 | Bacteria | 961 |
| 705 | Ga0466967_1834271 | 3300045976 | Bacteria | 603 |
| 706 | Ga0495603_0020570 | 3300046455 | Bacteria | 3998 |
| 707 | Ga0495603_0178051 | 3300046455 | Bacteria | 1231 |
| 708 | Ga0495603_0479913 | 3300046455 | Bacteria | 712 |
| 709 | Ga0495629_0014670 | 3300046459 | Bacteria | 5636 |
| 710 | Ga0495638_0159213 | 3300046460 | Bacteria | 1304 |
| 711 | Ga0495641_0031083 | 3300046461 | Bacteria | 2554 |
| 712 | Ga0495641_0417016 | 3300046461 | Bacteria | 609 |
| 713 | Ga0495582_0010933 | 3300046473 | Bacteria | 4995 |
| 714 | Ga0495662_0033040 | 3300046476 | Bacteria | 2500 |
| 715 | Ga0495662_0630683 | 3300046476 | Bacteria | 524 |
| 716 | Ga0495585_0289287 | 3300046492 | Bacteria | 808 |
| 717 | Ga0495594_0027313 | 3300046499 | Bacteria | 3075 |
| 718 | Ga0495594_0106681 | 3300046499 | Bacteria | 1578 |
| 719 | Ga0495606_0012057 | 3300046507 | Bacteria | 6975 |
| 720 | Ga0495630_1386487 | 3300046517 | Bacteria | 529 |
| 721 | Ga0495640_0015877 | 3300046533 | Bacteria | 5650 |
| 722 | Ga0495645_0575155 | 3300046543 | Bacteria | 696 |
| 723 | Ga0495668_0000213 | 3300046616 | Bacteria | 84412 |
| 724 | Ga0495634_0053960 | 3300046642 | Bacteria | 2691 |
| 725 | Ga0495625_0012217 | 3300046660 | Bacteria | 6965 |
| 726 | Ga0495625_0917893 | 3300046660 | Bacteria | 501 |
| 727 | Ga0495658_0101826 | 3300046683 | Bacteria | 1715 |
| 728 | Ga0495613_0865175 | 3300046689 | Bacteria | 587 |
| 729 | Ga0495624_0074271 | 3300046690 | Bacteria | 2113 |
| 730 | Ga0495649_0523856 | 3300046694 | Bacteria | 588 |
| 731 | Ga0495581_0917504 | 3300047315 | Bacteria | 500 |
| 732 | Ga0495636_0382446 | 3300047318 | Bacteria | 668 |
| 733 | Ga0495683_0408413 | 3300047323 | Bacteria | 563 |
| 734 | Ga0495675_0416186 | 3300047444 | Bacteria | 782 |
| 735 | Ga0495593_0340094 | 3300047673 | Bacteria | 750 |
| 736 | Ga0495626_0005869 | 3300048091 | Bacteria | 7075 |
| 737 | Ga0496100_0002555 | 3300048903 | Bacteria | 9274 |
| 738 | Ga0496100_1084651 | 3300048903 | Bacteria | 631 |
| 739 | Ga0496101_0170148 | 3300048904 | Bacteria | 1674 |
| 740 | Ga0496101_0887299 | 3300048904 | Bacteria | 702 |
| 741 | Ga0496101_1150931 | 3300048904 | Bacteria | 609 |
| 742 | Ga0496102_0000222 | 3300048905 | Bacteria | 75152 |
| 743 | Ga0496103_0000179 | 3300048906 | Bacteria | 64934 |
| 744 | Ga0496103_1062419 | 3300048906 | Bacteria | 502 |
| 745 | Ga0496104_0173411 | 3300048907 | Bacteria | 2067 |
| 746 | Ga0496104_0179122 | 3300048907 | Bacteria | 2030 |
| 747 | Ga0496104_0311805 | 3300048907 | Bacteria | 1486 |
| 748 | Ga0496104_1712313 | 3300048907 | Bacteria | 531 |
| 749 | Ga0496105_0040289 | 3300048908 | Bacteria | 3851 |
| 750 | Ga0496105_0507949 | 3300048908 | Bacteria | 945 |
| 751 | Ga0496105_1076309 | 3300048908 | Bacteria | 598 |
| 752 | Ga0496106_0331240 | 3300048909 | Bacteria | 1222 |
| 753 | Ga0496107_0270229 | 3300048910 | Bacteria | 1265 |
| 754 | Ga0496108_0000065 | 3300048911 | Bacteria | 117405 |
| 755 | Ga0496108_0339622 | 3300048911 | Bacteria | 1310 |
| 756 | Ga0496108_0509882 | 3300048911 | Bacteria | 1050 |
| 757 | Ga0496108_0848060 | 3300048911 | Bacteria | 786 |
| 758 | Ga0496108_1173632 | 3300048911 | Bacteria | 650 |
| 759 | Ga0496109_0168214 | 3300048912 | Bacteria | 2056 |
| 760 | Ga0496109_1209056 | 3300048912 | Bacteria | 692 |
| 761 | Ga0496109_1543252 | 3300048912 | Bacteria | 599 |
| 762 | Ga0496109_1577902 | 3300048912 | Bacteria | 591 |
| 763 | Ga0496110_0640672 | 3300048913 | Bacteria | 962 |
| 764 | Ga0496110_1445963 | 3300048913 | Bacteria | 597 |
| 765 | Ga0496111_0147266 | 3300048914 | Bacteria | 1746 |
| 766 | Ga0496112_0108341 | 3300048915 | Bacteria | 2748 |
| 767 | Ga0496112_0210902 | 3300048915 | Bacteria | 1899 |
| 768 | Ga0496113_1411458 | 3300048916 | Bacteria | 539 |
| 769 | Ga0496114_0148461 | 3300048917 | Bacteria | 2033 |
| 770 | Ga0496114_1029793 | 3300048917 | Bacteria | 707 |
| 771 | Ga0496115_0457950 | 3300048918 | Bacteria | 1029 |
| 772 | Ga0496116_0000481 | 3300048919 | Bacteria | 54969 |
| 773 | Ga0496117_0000242 | 3300048920 | Bacteria | 103350 |
| 774 | Ga0496118_0000412 | 3300048921 | Bacteria | 71447 |
| 775 | Ga0496119_0013023 | 3300048922 | Bacteria | 6676 |
| 776 | Ga0496120_0003152 | 3300048923 | Bacteria | 15386 |
| 777 | Ga0496121_0002113 | 3300048924 | Bacteria | 31255 |
| 778 | Ga0496122_0107771 | 3300048925 | Bacteria | 1840 |
| 779 | Ga0496124_0028247 | 3300048927 | Bacteria | 5021 |
| 780 | Ga0496125_0077747 | 3300048928 | Bacteria | 2555 |
| 781 | Ga0496126_0000521 | 3300048929 | Bacteria | 74946 |
| 782 | Ga0496126_0403213 | 3300048929 | Bacteria | 1109 |
| 783 | Ga0501306_026908 | 3300049127 | Bacteria | 835 |
| 784 | Ga0501308_039955 | 3300049128 | Bacteria | 658 |
| 785 | Ga0501309_054766 | 3300049129 | Bacteria | 632 |
| 786 | Ga0501309_080375 | 3300049129 | Bacteria | 546 |
| 787 | Ga0501307_036786 | 3300049162 | Bacteria | 699 |
| 788 | Ga0501311_042223 | 3300049527 | Bacteria | 694 |
| 789 | Ga0501311_065165 | 3300049527 | Bacteria | 595 |
| 790 | Ga0501311_089539 | 3300049527 | Bacteria | 533 |
| 791 | Ga0501312_101412 | 3300049528 | Bacteria | 540 |
| 792 | Ga0501312_106094 | 3300049528 | Bacteria | 531 |
| 793 | Ga0501315_065039 | 3300049531 | Bacteria | 596 |
| 794 | Ga0501315_072729 | 3300049531 | Bacteria | 573 |
| 795 | Ga0501316_053986 | 3300049532 | Bacteria | 583 |
| 796 | Ga0501317_097649 | 3300049533 | Bacteria | 527 |
| 797 | Ga0501318_036492 | 3300049534 | Bacteria | 688 |
| 798 | Ga0501318_042966 | 3300049534 | Bacteria | 652 |
| 799 | Ga0501320_021563 | 3300049536 | Bacteria | 749 |
| 800 | Ga0501320_022750 | 3300049536 | Bacteria | 737 |
| 801 | Ga0501321_045840 | 3300049537 | Bacteria | 627 |
| 802 | Ga0501322_014138 | 3300049538 | Bacteria | 649 |
| 803 | Ga0501323_035375 | 3300049539 | Bacteria | 716 |
| 804 | Ga0501325_025402 | 3300049541 | Bacteria | 650 |
| 805 | Ga0501325_039029 | 3300049541 | Bacteria | 572 |
| 806 | Ga0501325_046295 | 3300049541 | Bacteria | 543 |
| 807 | Ga0501031_0621082 | 3300049568 | Bacteria | 695 |
| 808 | Ga0501040_0939010 | 3300049576 | Bacteria | 627 |
| 809 | Ga0501042_0337365 | 3300049578 | Bacteria | 1090 |
| 810 | Ga0501042_0610898 | 3300049578 | Bacteria | 793 |
| 811 | Ga0501042_1148701 | 3300049578 | Bacteria | 566 |
| 812 | Ga0501043_0789770 | 3300049579 | Bacteria | 687 |
| 813 | Ga0501047_0043781 | 3300049581 | Bacteria | 4324 |
| 814 | Ga0501070_0325459 | 3300049586 | Bacteria | 1250 |
| 815 | Ga0501071_1357103 | 3300049587 | Bacteria | 549 |
| 816 | Ga0501072_1204745 | 3300049588 | Bacteria | 588 |
| 817 | Ga0501073_1123314 | 3300049589 | Bacteria | 540 |
| 818 | Ga0501257_193330 | 3300049686 | Bacteria | 582 |
| 819 | Ga0501044_0950220 | 3300049823 | Bacteria | 733 |
| 820 | nmdc:mga00v17_134291_c1 | 3300050491 | Bacteria | 1583 |
| 821 | nmdc:mga05p37_43650_c1 | 3300050507 | Bacteria | 5516 |
| 822 | nmdc:mga05p37_6610_c1 | 3300050507 | Bacteria | 13668 |
| 823 | nmdc:mga09592_437295_c1 | 3300050508 | Bacteria | 1129 |
| 824 | nmdc:mga09592_59221_c1 | 3300050508 | Bacteria | 3238 |
| 825 | nmdc:mga09592_92293_c1 | 3300050508 | Bacteria | 2588 |
| 826 | nmdc:mga0qj67_312095_c1 | 3300050509 | Bacteria | 1273 |
| 827 | nmdc:mga06r32_8857_c1 | 3300050510 | Bacteria | 9069 |
| 828 | nmdc:mga08y16_38963_c1 | 3300050511 | Bacteria | 4988 |
| 829 | nmdc:mga0n895_1716881_c1 | 3300050512 | Bacteria | 590 |
| 830 | nmdc:mga0rr50_144385_c1 | 3300050513 | Bacteria | 1917 |
| 831 | nmdc:mga0rr50_355518_c1 | 3300050513 | Bacteria | 1232 |
| 832 | nmdc:mga08x19_968998_c1 | 3300050514 | Bacteria | 604 |
| 833 | nmdc:mga0a205_773109_c1 | 3300050515 | Bacteria | 808 |
| 834 | Ga0500644_0103302 | 3300053088 | Bacteria | 1086 |
| 835 | Ga0500646_0001171 | 3300053090 | Bacteria | 7073 |
| 836 | Ga0500583_0005277 | 3300053092 | Bacteria | 4313 |
| 837 | Ga0500583_0206079 | 3300053092 | Bacteria | 977 |
| 838 | Ga0500651_0219695 | 3300053093 | Bacteria | 1115 |
| 839 | Ga0500651_0613695 | 3300053093 | Bacteria | 589 |
| 840 | Ga0500641_0251238 | 3300053096 | Bacteria | 741 |
| 841 | Ga0500641_0382371 | 3300053096 | Bacteria | 558 |
| 842 | Ga0500650_0120431 | 3300053098 | Bacteria | 1223 |
| 843 | Ga0500556_0251196 | 3300053104 | Bacteria | 696 |
| 844 | Ga0500562_094148 | 3300053108 | Bacteria | 814 |
| 845 | Ga0500569_049329 | 3300053109 | Bacteria | 1264 |
| 846 | Ga0500572_240015 | 3300053111 | Bacteria | 591 |
| 847 | Ga0500594_0011394 | 3300053118 | Bacteria | 2075 |
| 848 | Ga0500652_066448 | 3300053131 | Bacteria | 1490 |
| 849 | Ga0500655_108929 | 3300053133 | Bacteria | 584 |
| 850 | Ga0500559_0282774 | 3300053136 | Bacteria | 780 |
| 851 | Ga0500568_0147348 | 3300053139 | Bacteria | 872 |
| 852 | Ga0500579_175879 | 3300053143 | Bacteria | 857 |
| 853 | Ga0500588_0001715 | 3300053146 | Bacteria | 4256 |
| 854 | Ga0500600_0058151 | 3300053149 | Bacteria | 2166 |
| 855 | Ga0500622_0299608 | 3300053156 | Bacteria | 686 |
| 856 | Ga0500633_0203585 | 3300053160 | Bacteria | 741 |
| 857 | Ga0500611_078197 | 3300053727 | Bacteria | 820 |
| 858 | Ga0500587_022858 | 3300053739 | Bacteria | 824 |
| 859 | Ga0587084_060986 | 3300059477 | Bacteria | 691 |
| 860 | Ga0587084_090669 | 3300059477 | Bacteria | 606 |
| 861 | Ga0587093_063957 | 3300059478 | Bacteria | 606 |
| 862 | Ga0587066_103943 | 3300059490 | Bacteria | 649 |
| 863 | Ga0587066_178793 | 3300059490 | Bacteria | 545 |
| 864 | Ga0587070_095813 | 3300059491 | Bacteria | 675 |
| 865 | Ga0587070_157689 | 3300059491 | Bacteria | 574 |
| 866 | Ga0587073_0086985 | 3300059492 | Bacteria | 787 |
| 867 | Ga0587073_0168109 | 3300059492 | Bacteria | 634 |
| 868 | Ga0587073_0179273 | 3300059492 | Bacteria | 621 |
| 869 | Ga0587073_0274677 | 3300059492 | Bacteria | 538 |
| 870 | Ga0587073_0294866 | 3300059492 | Bacteria | 526 |
| 871 | Ga0587077_095821 | 3300059493 | Bacteria | 705 |
| 872 | Ga0587080_123629 | 3300059503 | Bacteria | 576 |
| 873 | Ga0587080_135832 | 3300059503 | Bacteria | 558 |
| 874 | Ga0587082_078791 | 3300059504 | Bacteria | 683 |
| 875 | Ga0587082_084640 | 3300059504 | Bacteria | 667 |
| 876 | Ga0587083_0038990 | 3300059505 | Bacteria | 985 |
| 877 | Ga0587083_0215446 | 3300059505 | Bacteria | 556 |
| 878 | Ga0587085_126315 | 3300059506 | Bacteria | 567 |
| 879 | Ga0587085_132014 | 3300059506 | Bacteria | 559 |
| 880 | Ga0587086_087395 | 3300059507 | Bacteria | 558 |
| 881 | Ga0587086_087670 | 3300059507 | Bacteria | 557 |
| 882 | Ga0587086_092800 | 3300059507 | Bacteria | 547 |
| 883 | Ga0587088_100208 | 3300059508 | Bacteria | 646 |
| 884 | Ga0587089_090275 | 3300059509 | Bacteria | 544 |
| 885 | Ga0587089_100265 | 3300059509 | Bacteria | 525 |
| 886 | Ga0587090_058002 | 3300059510 | Bacteria | 727 |
| 887 | Ga0587090_079098 | 3300059510 | Bacteria | 655 |
| 888 | Ga0587090_137982 | 3300059510 | Bacteria | 543 |
| 889 | Ga0587091_085544 | 3300059511 | Bacteria | 715 |
| 890 | Ga0587091_104714 | 3300059511 | Bacteria | 668 |
| 891 | Ga0587091_188255 | 3300059511 | Bacteria | 547 |
| 892 | Ga0587092_105043 | 3300059512 | Bacteria | 587 |
| 893 | Ga0587092_109522 | 3300059512 | Bacteria | 578 |
| 894 | Ga0587094_049988 | 3300059513 | Bacteria | 706 |
| 895 | Ga0587094_118190 | 3300059513 | Bacteria | 528 |
| 896 | Ga0587094_120394 | 3300059513 | Bacteria | 525 |
| 897 | Ga0587095_042182 | 3300059514 | Bacteria | 501 |
| 898 | Ga0587098_029596 | 3300059604 | Bacteria | 746 |
| 899 | Ga0587106_032717 | 3300059605 | Bacteria | 843 |
| 900 | Ga0587106_060370 | 3300059605 | Bacteria | 695 |
| 901 | Ga0587106_106587 | 3300059605 | Bacteria | 579 |
| 902 | Ga0587129_013458 | 3300059608 | Bacteria | 663 |
| 903 | Ga0587099_019322 | 3300059622 | Bacteria | 758 |
| 904 | Ga0587099_046241 | 3300059622 | Bacteria | 570 |
| 905 | Ga0587099_054607 | 3300059622 | Bacteria | 540 |
| 906 | Ga0587101_128489 | 3300059623 | Bacteria | 531 |
| 907 | Ga0587109_101942 | 3300059624 | Bacteria | 661 |
| 908 | Ga0587113_016745 | 3300059625 | Bacteria | 738 |
| 909 | Ga0587113_034552 | 3300059625 | Bacteria | 586 |
| 910 | Ga0587115_075823 | 3300059626 | Bacteria | 588 |
| 911 | Ga0587122_014419 | 3300059628 | Bacteria | 797 |
| 912 | Ga0587128_042347 | 3300059630 | Bacteria | 802 |
| 913 | Ga0587128_063783 | 3300059630 | Bacteria | 702 |
| 914 | Ga0587128_081058 | 3300059630 | Bacteria | 650 |
| 915 | Ga0587128_103809 | 3300059630 | Bacteria | 599 |
| 916 | Ga0587130_027322 | 3300059631 | Bacteria | 644 |
| 917 | Ga0587130_043050 | 3300059631 | Bacteria | 550 |
| 918 | Ga0587067_049979 | 3300059640 | Bacteria | 843 |
| 919 | Ga0587067_092343 | 3300059640 | Bacteria | 688 |
| 920 | Ga0587067_174189 | 3300059640 | Bacteria | 556 |
| 921 | Ga0587067_185936 | 3300059640 | Bacteria | 544 |
| 922 | Ga0587067_190818 | 3300059640 | Bacteria | 539 |
| 923 | Ga0587067_236033 | 3300059640 | Bacteria | 502 |
| 924 | Ga0587068_040150 | 3300059641 | Bacteria | 844 |
| 925 | Ga0587068_138597 | 3300059641 | Bacteria | 541 |
| 926 | Ga0587069_060010 | 3300059642 | Bacteria | 698 |
| 927 | Ga0587069_060133 | 3300059642 | Bacteria | 698 |
| 928 | Ga0587069_088558 | 3300059642 | Bacteria | 615 |
| 929 | Ga0587069_104651 | 3300059642 | Bacteria | 582 |
| 930 | Ga0587069_138201 | 3300059642 | Bacteria | 531 |
| 931 | Ga0587075_050973 | 3300059644 | Bacteria | 722 |
| 932 | Ga0587075_057723 | 3300059644 | Bacteria | 693 |
| 933 | Ga0587075_060047 | 3300059644 | Bacteria | 684 |
| 934 | Ga0587075_078247 | 3300059644 | Bacteria | 626 |
| 935 | Ga0587076_054659 | 3300059645 | Bacteria | 788 |
| 936 | Ga0587076_057258 | 3300059645 | Bacteria | 777 |
| 937 | Ga0587076_075029 | 3300059645 | Bacteria | 710 |
| 938 | Ga0587076_090219 | 3300059645 | Bacteria | 669 |
| 939 | Ga0587079_098300 | 3300059647 | Bacteria | 695 |
| 940 | Ga0587079_191683 | 3300059647 | Bacteria | 553 |
| 941 | Ga0587100_043739 | 3300059648 | Bacteria | 511 |
| 942 | Ga0587107_069764 | 3300059652 | Bacteria | 639 |
| 943 | Ga0587107_126542 | 3300059652 | Bacteria | 532 |
| 944 | Ga0587107_142883 | 3300059652 | Bacteria | 513 |
| 945 | Ga0587114_055332 | 3300059655 | Bacteria | 682 |
| 946 | Ga0587114_062937 | 3300059655 | Bacteria | 655 |
| 947 | Ga0587114_068245 | 3300059655 | Bacteria | 639 |
| 948 | Ga0587114_097970 | 3300059655 | Bacteria | 568 |
| 949 | Ga0587119_026366 | 3300059658 | Bacteria | 771 |
| 950 | Ga0587071_061297 | 3300060344 | Bacteria | 800 |
| 951 | Ga0466962_0040787 | 3300061719 | Bacteria | 2221 |
| 952 | Ga0466962_0175028 | 3300061719 | Bacteria | 1045 |
| 953 | Ga0466962_0714048 | 3300061719 | Bacteria | 514 |
| 954 | 2501945236 | 2501939600 | Bacteria | 6907073 |
| 955 | 2515498359 | 2515154088 | Bacteria | 5526283 |
| 956 | 2515722787 | 2515154129 | Bacteria | 5584369 |
| 957 | 2515759628 | 2515154137 | Bacteria | 5711575 |
| 958 | 2516087001 | 2515154202 | Bacteria | 5471270 |
| 959 | 2516092057 | 2515154203 | Bacteria | 5458536 |
| 960 | 2552106614 | 2551306166 | Bacteria | 9731570 |
| 961 | 2559425982 | 2558860280 | Bacteria | 11429938 |
| 962 | 2623499741 | 2622736605 | Bacteria | 4992138 |
| 963 | 2623591234 | 2622736626 | Bacteria | 7181580 |
| 964 | 2753272073 | 2751185782 | Bacteria | 11227053 |
| 965 | 2772647165 | 2772190715 | Bacteria | 6959372 |
| 966 | 2816508677 | 2816332139 | Bacteria | 9138787 |
| 967 | 2831938478 | 2831935698 | Bacteria | 5963223 |
| 968 | 2832005375 | 2832004796 | Bacteria | 6538017 |
| 969 | 2855674015 | 2855670206 | Bacteria | 7120389 |
| 970 | 2855677031 | 2855676851 | Bacteria | 7063653 |
| 971 | 2855688794 | 2855683550 | Bacteria | 7134265 |
| 972 | 2856858179 | 2856858025 | Bacteria | 7255264 |
| 973 | 2857295431 | 2857288857 | Bacteria | 7189066 |
| 974 | 2858852708 | 2858848962 | Bacteria | 6963058 |
| 975 | 2858886543 | 2858882152 | Bacteria | 7230291 |
| 976 | 2858894241 | 2858888857 | Bacteria | 7060307 |
| 977 | 2858898249 | 2858895516 | Bacteria | 7378898 |
| 978 | 2866065285 | 2866065130 | Bacteria | 6518152 |
| 979 | 2867307710 | 2867302475 | Bacteria | 7087181 |
| 980 | 2867316492 | 2867312974 | Bacteria | 7058875 |
| 981 | 2867324872 | 2867319477 | Bacteria | 7069771 |
| 982 | 2869054697 | 2869048445 | Bacteria | 6875584 |
| 983 | 2869066840 | 2869061728 | Bacteria | 7112407 |
| 984 | 2869072662 | 2869068681 | Bacteria | 7205615 |
| 985 | 2880495887 | 2880489317 | Bacteria | 7096270 |
| 986 | 2880496479 | 2880495981 | Bacteria | 7340502 |
| 987 | 2887480673 | 2887478801 | Bacteria | 8972725 |
| 988 | 2902584805 | 2902582711 | Bacteria | 6187705 |
| 989 | 2915364145 | 2915358134 | Bacteria | 6050864 |
| 990 | 2929225122 | 2929219909 | Bacteria | 6984360 |
| 991 | 2929231912 | 2929226422 | Bacteria | 7248583 |
| 992 | 2996225799 | 2996221748 | Bacteria | 6799777 |
| 993 | 649813580 | 649633069 | Bacteria | 6962533 |
| 994 | 8001786119 | 8001781756 | Bacteria | 9586736 |
| 995 | 8003832142 | 8003830390 | Bacteria | 6541657 |
| 996 | 8003862625 | 8003856774 | Bacteria | 7675274 |
| 997 | 8003873935 | 8003870546 | Bacteria | 7396674 |
| 998 | 8054473259 | 8054472261 | Bacteria | 7464355 |
| 999 | 8054705198 | 8054704163 | Bacteria | 7247792 |
| 1000 | 8054730611 | 8054727385 | Bacteria | 7558670 |
| 1001 | 8054736932 | 8054734606 | Bacteria | 6947278 |
| 1002 | 8055415408 | 8055412473 | Bacteria | 6257500 |
| 1003 | 8056057533 | 8056054917 | Bacteria | 5736694 |
| 1004 | Ga0105244_10453065 | |||
| 1005 | 2214744876 | |||
| 1006 | LJQas_1014194 | |||
| 1007 | JGI24739J22299_10240319 | |||
| 1008 | JGI24745J21846_1036060 | |||
| 1009 | JGI24034J26672_10058467 | |||
| 1010 | Ga0006778J45830_1009023 | |||
| 1011 | Ga0006778J45830_1016377 | |||
| 1012 | Ga0006778J45830_1041840 | |||
| 1013 | Ga0006759J45824_1013206 | |||
| 1014 | Ga0006759J45824_1014821 | |||
| 1015 | JGI25406J46586_10009537 | |||
| 1016 | JGI25406J46586_10011374 | |||
| 1017 | JGI25406J46586_10088159 | |||
| 1018 | JGI25406J46586_10123475 | |||
| 1019 | rootH2_10085212 | |||
| 1020 | Ga0007417J51691_1007731 | |||
| 1021 | Ga0007417J51691_1036457 | |||
| 1022 | Ga0007417J51691_1036609 | |||
| 1023 | Ga0007417J51691_1037507 | |||
| 1024 | Ga0007427J51700_104985 | |||
| 1025 | Ga0006781J51513_1010662 | |||
| 1026 | Ga0006781J51513_1029898 | |||
| 1027 | Ga0007410J51695_1032791 | |||
| 1028 | Ga0007410J51695_1047814 | |||
| 1029 | Ga0007409J51694_1033305 | |||
| 1030 | Ga0007409J51694_1042642 | |||
| 1031 | Ga0007416J51690_1011182 | |||
| 1032 | Ga0007416J51690_1034645 | |||
| 1033 | Ga0007416J51690_1057945 | |||
| 1034 | Ga0007429J51699_1014261 | |||
| 1035 | Ga0007429J51699_1029843 | |||
| 1036 | Ga0007429J51699_1056898 | |||
| 1037 | Ga0007429J51699_1057006 | |||
| 1038 | Ga0007429J51699_1059000 | |||
| 1039 | JGI25404J52841_10068869 | |||
| 1040 | Ga0032354_1007423 | |||
| 1041 | Ga0032354_1034419 | |||
| 1042 | Ga0032354_1059346 | |||
| 1043 | Ga0032354_1070627 | |||
| 1044 | Ga0006780_1008494 | |||
| 1045 | Ga0006780_1016201 | |||
| 1046 | Ga0006780_1026420 | |||
| 1047 | Ga0006780_1027665 | |||
| 1048 | Ga0058858_1385167 | |||
| 1049 | Ga0058859_10043114 | |||
| 1050 | Ga0058859_10045571 | |||
| 1051 | Ga0058859_11823711 | |||
| 1052 | Ga0058859_11831572 | |||
| 1053 | Ga0058863_10016284 | |||
| 1054 | Ga0058863_11874610 | |||
| 1055 | Ga0058861_10006413 | |||
| 1056 | Ga0058861_10034986 | |||
| 1057 | Ga0058861_10046471 | |||
| 1058 | Ga0058861_11988158 | |||
| 1059 | Ga0058860_10003778 | |||
| 1060 | Ga0058860_10010621 | |||
| 1061 | Ga0058860_10085527 | |||
| 1062 | Ga0058860_12242734 | |||
| 1063 | Ga0058862_10078798 | |||
| 1064 | Ga0058862_10083481 | |||
| 1065 | Ga0058862_10152929 | |||
| 1066 | Ga0070658_10005407 | |||
| 1067 | Ga0070658_10470811 | |||
| 1068 | Ga0070658_10625737 | |||
| 1069 | Ga0070658_11405653 | |||
| 1070 | Ga0070676_10714872 | |||
| 1071 | Ga0070676_11021511 | |||
| 1072 | Ga0070683_100826319 | |||
| 1073 | Ga0070683_100871583 | |||
| 1074 | Ga0070683_100933687 | |||
| 1075 | Ga0070683_101091467 | |||
| 1076 | Ga0070690_100458257 | |||
| 1077 | Ga0070670_100054419 | |||
| 1078 | Ga0070670_100984546 | |||
| 1079 | Ga0070670_101735610 | |||
| 1080 | Ga0070677_10702317 | |||
| 1081 | Ga0068869_100002500 | |||
| 1082 | Ga0068869_100265062 | |||
| 1083 | Ga0068869_100346208 | |||
| 1084 | Ga0068869_100376417 | |||
| 1085 | Ga0068869_102124055 | |||
| 1086 | Ga0070666_10111724 | |||
| 1087 | Ga0070680_100464388 | |||
| 1088 | Ga0070680_100485254 | |||
| 1089 | Ga0070680_100637339 | |||
| 1090 | Ga0070680_101082942 | |||
| 1091 | Ga0070682_100167871 | |||
| 1092 | Ga0070682_100497853 | |||
| 1093 | Ga0070682_100936204 | |||
| 1094 | Ga0068868_100474765 | |||
| 1095 | Ga0070660_100308392 | |||
| 1096 | Ga0070660_100712854 | |||
| 1097 | Ga0070689_101058379 | |||
| 1098 | Ga0070687_100032777 | |||
| 1099 | Ga0070687_100092980 | |||
| 1100 | Ga0070687_100442326 | |||
| 1101 | Ga0070661_100006334 | |||
| 1102 | Ga0070661_100341267 | |||
| 1103 | Ga0070661_100370410 | |||
| 1104 | Ga0070661_100737984 | |||
| 1105 | Ga0070692_10369427 | |||
| 1106 | Ga0070692_11012353 | |||
| 1107 | Ga0070668_100000590 | |||
| 1108 | Ga0070668_100314078 | |||
| 1109 | Ga0070668_100352577 | |||
| 1110 | Ga0070668_100726423 | |||
| 1111 | Ga0070669_100115761 | |||
| 1112 | Ga0070675_100002055 | |||
| 1113 | Ga0070675_100190511 | |||
| 1114 | Ga0070675_100627890 | |||
| 1115 | Ga0070671_100002585 | |||
| 1116 | Ga0070674_100414612 | |||
| 1117 | Ga0070674_101030568 | |||
| 1118 | Ga0070674_101299798 | |||
| 1119 | Ga0070674_101565720 | |||
| 1120 | Ga0070688_100733883 | |||
| 1121 | Ga0070659_100166722 | |||
| 1122 | Ga0070659_100604768 | |||
| 1123 | Ga0070667_100126394 | |||
| 1124 | Ga0070667_100164713 | |||
| 1125 | Ga0070667_100432841 | |||
| 1126 | Ga0070667_100972086 | |||
| 1127 | Ga0070709_10404720 | |||
| 1128 | Ga0070714_100399422 | |||
| 1129 | Ga0070714_100536709 | |||
| 1130 | Ga0070713_100113101 | |||
| 1131 | Ga0070713_100511581 | |||
| 1132 | Ga0070713_101370933 | |||
| 1133 | Ga0070710_11124928 | |||
| 1134 | Ga0070701_10239972 | |||
| 1135 | Ga0070701_10406859 | |||
| 1136 | Ga0070705_100987385 | |||
| 1137 | Ga0070700_100109967 | |||
| 1138 | Ga0070700_100295851 | |||
| 1139 | Ga0070700_100571114 | |||
| 1140 | Ga0070700_100586016 | |||
| 1141 | Ga0070708_101579300 | |||
| 1142 | Ga0070708_102098192 | |||
| 1143 | Ga0070663_100024264 | |||
| 1144 | Ga0070663_100184012 | |||
| 1145 | Ga0070678_100143704 | |||
| 1146 | Ga0070678_100398905 | |||
| 1147 | Ga0070678_100936525 | |||
| 1148 | Ga0070662_100003769 | |||
| 1149 | Ga0070681_10036758 | |||
| 1150 | Ga0070681_10324639 | |||
| 1151 | Ga0070681_10439495 | |||
| 1152 | Ga0068867_100792016 | |||
| 1153 | Ga0070685_10058492 | |||
| 1154 | Ga0070685_10172560 | |||
| 1155 | Ga0070685_10260667 | |||
| 1156 | Ga0070685_11356243 | |||
| 1157 | Ga0070707_100871511 | |||
| 1158 | Ga0070698_100894043 | |||
| 1159 | Ga0070679_100016277 | |||
| 1160 | Ga0070679_100222880 | |||
| 1161 | Ga0070679_100943019 | |||
| 1162 | Ga0070684_100138123 | |||
| 1163 | Ga0070684_100266548 | |||
| 1164 | Ga0070684_101171883 | |||
| 1165 | Ga0068853_100406738 | |||
| 1166 | Ga0068853_100628804 | |||
| 1167 | Ga0070672_100507706 | |||
| 1168 | Ga0070672_101859996 | |||
| 1169 | Ga0070686_101685403 | |||
| 1170 | Ga0070696_101735053 | |||
| 1171 | Ga0070693_100099800 | |||
| 1172 | Ga0070693_100309508 | |||
| 1173 | Ga0070693_100617661 | |||
| 1174 | Ga0070665_100005910 | |||
| 1175 | Ga0070665_100233199 | |||
| 1176 | Ga0070665_100821318 | |||
| 1177 | Ga0070665_100963511 | |||
| 1178 | Ga0070665_101174394 | |||
| 1179 | Ga0070665_101257487 | |||
| 1180 | Ga0070665_101598516 | |||
| 1181 | Ga0070704_101972481 | |||
| 1182 | Ga0068855_100434995 | |||
| 1183 | Ga0068855_100604971 | |||
| 1184 | Ga0070664_100009670 | |||
| 1185 | Ga0070664_100064658 | |||
| 1186 | Ga0070664_100161857 | |||
| 1187 | Ga0070664_100555630 | |||
| 1188 | Ga0070664_100587223 | |||
| 1189 | Ga0070664_101047315 | |||
| 1190 | Ga0068857_100060657 | |||
| 1191 | Ga0068857_100201896 | |||
| 1192 | Ga0068857_100213364 | |||
| 1193 | Ga0068857_100558759 | |||
| 1194 | Ga0068857_101470352 | |||
| 1195 | Ga0068857_101622646 | |||
| 1196 | Ga0068857_101658876 | |||
| 1197 | Ga0068854_100065864 | |||
| 1198 | Ga0068854_100703324 | |||
| 1199 | Ga0068854_102178772 | |||
| 1200 | Ga0068856_100420401 | |||
| 1201 | Ga0068856_100510156 | |||
| 1202 | Ga0068856_100556139 | |||
| 1203 | Ga0068856_100665689 | |||
| 1204 | Ga0070702_100057530 | |||
| 1205 | Ga0070702_100261013 | |||
| 1206 | Ga0070702_100289858 | |||
| 1207 | Ga0070702_100614966 | |||
| 1208 | Ga0068852_100190769 | |||
| 1209 | Ga0068852_100308948 | |||
| 1210 | Ga0068859_100385328 | |||
| 1211 | Ga0068859_100572094 | |||
| 1212 | Ga0068859_100778888 | |||
| 1213 | Ga0068859_102656885 | |||
| 1214 | Ga0068864_100080993 | |||
| 1215 | Ga0068864_100703296 | |||
| 1216 | Ga0068864_100830671 | |||
| 1217 | Ga0068864_101824209 | |||
| 1218 | Ga0068866_10586168 | |||
| 1219 | Ga0068861_100058071 | |||
| 1220 | Ga0068861_100552459 | |||
| 1221 | Ga0068861_100977619 | |||
| 1222 | Ga0068861_101585484 | |||
| 1223 | Ga0068851_10343743 | |||
| 1224 | Ga0068863_100002283 | |||
| 1225 | Ga0068863_100023910 | |||
| 1226 | Ga0068863_100359361 | |||
| 1227 | Ga0068863_101234369 | |||
| 1228 | Ga0068863_101798098 | |||
| 1229 | Ga0068863_102341471 | |||
| 1230 | Ga0068858_100579055 | |||
| 1231 | Ga0068858_100947657 | |||
| 1232 | Ga0068860_100041221 | |||
| 1233 | Ga0068860_100218746 | |||
| 1234 | Ga0068862_100171644 | |||
| 1235 | Ga0068862_100175192 | |||
| 1236 | Ga0068862_100686570 | |||
| 1237 | Ga0068862_101150884 | |||
| 1238 | Ga0081455_10067796 | |||
| 1239 | Ga0081455_10814569 | |||
| 1240 | Ga0081538_10258058 | |||
| 1241 | Ga0081540_1003296 | |||
| 1242 | Ga0081540_1008757 | |||
| 1243 | Ga0081540_1283097 | |||
| 1244 | Ga0081539_10000682 | |||
| 1245 | Ga0081539_10001171 | |||
| 1246 | Ga0081539_10002170 | |||
| 1247 | Ga0081539_10006340 | |||
| 1248 | Ga0081539_10020403 | |||
| 1249 | Ga0081539_10198185 | |||
| 1250 | Ga0081539_10416293 | |||
| 1251 | Ga0070717_10843886 | |||
| 1252 | Ga0070717_11346416 | |||
| 1253 | Ga0075364_10177057 | |||
| 1254 | Ga0075432_10437413 | |||
| 1255 | Ga0070716_100252708 | |||
| 1256 | Ga0070712_100970098 | |||
| 1257 | Ga0070712_101363018 | |||
| 1258 | Ga0097621_100727152 | |||
| 1259 | Ga0068871_100314868 | |||
| 1260 | Ga0075428_100278660 | |||
| 1261 | Ga0075428_102406418 | |||
| 1262 | Ga0075430_100616051 | |||
| 1263 | Ga0075430_100762342 | |||
| 1264 | Ga0075431_100068735 | |||
| 1265 | Ga0075431_101295915 | |||
| 1266 | Ga0075431_101597553 | |||
| 1267 | Ga0075431_101913437 | |||
| 1268 | Ga0075434_102293646 | |||
| 1269 | Ga0075429_100089212 | |||
| 1270 | Ga0075429_100557017 | |||
| 1271 | Ga0075429_100668930 | |||
| 1272 | Ga0068865_100413367 | |||
| 1273 | Ga0097620_100385341 | |||
| 1274 | Ga0097620_100572103 | |||
| 1275 | Ga0097620_100778945 | |||
| 1276 | Ga0097620_102656899 | |||
| 1277 | Ga0075435_101392319 | |||
| 1278 | Ga0105251_10330246 | |||
| 1279 | Ga0105244_10270956 | |||
| 1280 | Ga0105250_10173063 | |||
| 1281 | Ga0111539_10025315 | |||
| 1282 | Ga0111539_11939622 | |||
| 1283 | Ga0105245_10074465 | |||
| 1284 | Ga0105245_11397817 | |||
| 1285 | Ga0114129_10000056 | |||
| 1286 | Ga0114129_10062051 | |||
| 1287 | Ga0114129_11138613 | |||
| 1288 | Ga0114129_12295499 | |||
| 1289 | Ga0105243_10466530 | |||
| 1290 | Ga0105242_12178815 | |||
| 1291 | Ga0105248_10212790 | |||
| 1292 | Ga0105248_10502943 | |||
| 1293 | Ga0105248_12677037 | |||
| 1294 | Ga0105237_10597377 | |||
| 1295 | Ga0105237_11468134 | |||
| 1296 | Ga0105238_10479737 | |||
| 1297 | Ga0105238_10517128 | |||
| 1298 | Ga0105249_10556529 | |||
| 1299 | Ga0105249_11371881 | |||
| 1300 | Ga0105249_12470939 | |||
| 1301 | Ga0130084_1120475 | |||
| 1302 | Ga0105032_101594 | |||
| 1303 | Ga0105028_106121 | |||
| 1304 | Ga0105239_10089155 | |||
| 1305 | Ga0105239_10399074 | |||
| 1306 | Ga0105239_10830829 | |||
| 1307 | Ga0105239_11508849 | |||
| 1308 | Ga0105246_10447390 | |||
| 1309 | Ga0105246_10516710 | |||
| 1310 | Ga0105246_10544662 | |||
| 1311 | Ga0105246_11640567 | |||
| 1312 | Ga0157320_1016578 | |||
| 1313 | Ga0157341_1016358 | |||
| 1314 | Ga0157339_1041555 | |||
| 1315 | Ga0157338_1031337 | |||
| 1316 | Ga0154012_115786 | |||
| 1317 | Ga0154012_176035 | |||
| 1318 | Ga0154010_157036 | |||
| 1319 | Ga0157371_10418815 | |||
| 1320 | Ga0157369_10021627 | |||
| 1321 | Ga0157369_10236478 | |||
| 1322 | Ga0157369_10313236 | |||
| 1323 | Ga0157369_11900178 | |||
| 1324 | Ga0157374_10606082 | |||
| 1325 | Ga0157374_11479369 | |||
| 1326 | Ga0157374_12075113 | |||
| 1327 | Ga0157378_10148347 | |||
| 1328 | Ga0157378_11661326 | |||
| 1329 | Ga0163162_10193492 | |||
| 1330 | Ga0163162_12099418 | |||
| 1331 | Ga0157372_10209745 | |||
| 1332 | Ga0157372_10461374 | |||
| 1333 | Ga0157372_11426663 | |||
| 1334 | Ga0157372_12138646 | |||
| 1335 | Ga0157372_12351401 | |||
| 1336 | Ga0157375_11156048 | |||
| 1337 | Ga0157375_12916398 | |||
| 1338 | Ga0163163_10111596 | |||
| 1339 | Ga0163163_10436355 | |||
| 1340 | Ga0163163_11158352 | |||
| 1341 | Ga0163163_12398254 | |||
| 1342 | Ga0157380_10195782 | |||
| 1343 | Ga0157380_11393062 | |||
| 1344 | Ga0157380_11816662 | |||
| 1345 | Ga0182008_10150045 | |||
| 1346 | Ga0157377_10068917 | |||
| 1347 | Ga0157377_10112134 | |||
| 1348 | Ga0157377_10495787 | |||
| 1349 | Ga0157377_11728632 | |||
| 1350 | Ga0157379_10004447 | |||
| 1351 | Ga0157379_10114482 | |||
| 1352 | Ga0157379_10237366 | |||
| 1353 | Ga0157376_10716337 | |||
| 1354 | Ga0182006_1308336 | |||
| 1355 | Ga0182007_10078659 | |||
| 1356 | Ga0163161_10980819 | |||
| 1357 | Ga0197907_10130848 | |||
| 1358 | Ga0197907_10290521 | |||
| 1359 | Ga0197907_10931216 | |||
| 1360 | Ga0197907_11094761 | |||
| 1361 | Ga0197907_11335908 | |||
| 1362 | Ga0206356_10176895 | |||
| 1363 | Ga0206356_10900112 | |||
| 1364 | Ga0206356_11071879 | |||
| 1365 | Ga0206356_11079847 | |||
| 1366 | Ga0206349_1221287 | |||
| 1367 | Ga0206349_1252883 | |||
| 1368 | Ga0206349_1512573 | |||
| 1369 | Ga0206349_1601640 | |||
| 1370 | Ga0206349_1646595 | |||
| 1371 | Ga0206355_1000167 | |||
| 1372 | Ga0206355_1093080 | |||
| 1373 | Ga0206355_1263721 | |||
| 1374 | Ga0206355_1631847 | |||
| 1375 | Ga0206355_1680853 | |||
| 1376 | Ga0206351_10073110 | |||
| 1377 | Ga0206351_10810188 | |||
| 1378 | Ga0206351_10815273 | |||
| 1379 | Ga0206351_10926472 | |||
| 1380 | Ga0206352_10175716 | |||
| 1381 | Ga0206352_10339378 | |||
| 1382 | Ga0206352_10527522 | |||
| 1383 | Ga0206352_10543400 | |||
| 1384 | Ga0206352_10978437 | |||
| 1385 | Ga0206352_11123643 | |||
| 1386 | Ga0206350_10081742 | |||
| 1387 | Ga0206350_10471505 | |||
| 1388 | Ga0206350_11228157 | |||
| 1389 | Ga0206354_10004381 | |||
| 1390 | Ga0206354_10370725 | |||
| 1391 | Ga0206354_10456219 | |||
| 1392 | Ga0206354_10748701 | |||
| 1393 | Ga0206354_11017929 | |||
| 1394 | Ga0206354_11539509 | |||
| 1395 | Ga0206354_11564612 | |||
| 1396 | Ga0206354_11673340 | |||
| 1397 | Ga0206353_10069880 | |||
| 1398 | Ga0206353_10271544 | |||
| 1399 | Ga0206353_11798783 | |||
| 1400 | Ga0154015_1238497 | |||
| 1401 | Ga0154015_1258986 | |||
| 1402 | Ga0154015_1455192 | |||
| 1403 | Ga0213875_10443638 | |||
| 1404 | Ga0224712_10171710 | |||
| 1405 | Ga0224712_10277696 | |||
| 1406 | Ga0224712_10293906 | |||
| 1407 | Ga0224712_10576527 | |||
| 1408 | Ga0256720_132808 | |||
| 1409 | Ga0207656_10747959 | |||
| 1410 | Ga0207653_10334711 | |||
| 1411 | Ga0207692_10142356 | |||
| 1412 | Ga0207692_11029744 | |||
| 1413 | Ga0207688_10219580 | |||
| 1414 | Ga0207688_10289700 | |||
| 1415 | Ga0207688_10571697 | |||
| 1416 | Ga0207647_10368871 | |||
| 1417 | Ga0207699_10945381 | |||
| 1418 | Ga0207645_10239301 | |||
| 1419 | Ga0207645_10741759 | |||
| 1420 | Ga0207643_10423994 | |||
| 1421 | Ga0207643_11128438 | |||
| 1422 | Ga0207705_10316856 | |||
| 1423 | Ga0207707_10205767 | |||
| 1424 | Ga0207671_10992206 | |||
| 1425 | Ga0207671_10998404 | |||
| 1426 | Ga0207660_10065813 | |||
| 1427 | Ga0207662_10116313 | |||
| 1428 | Ga0207662_10147625 | |||
| 1429 | Ga0207662_10384455 | |||
| 1430 | Ga0207657_10145026 | |||
| 1431 | Ga0207657_10464775 | |||
| 1432 | Ga0207649_10002678 | |||
| 1433 | Ga0207649_10542764 | |||
| 1434 | Ga0207694_10459128 | |||
| 1435 | Ga0207694_10916182 | |||
| 1436 | Ga0207659_10011915 | |||
| 1437 | Ga0207659_10502290 | |||
| 1438 | Ga0207687_11191090 | |||
| 1439 | Ga0207687_11901013 | |||
| 1440 | Ga0207700_10129871 | |||
| 1441 | Ga0207664_10958261 | |||
| 1442 | Ga0207664_11143239 | |||
| 1443 | Ga0207664_11340623 | |||
| 1444 | Ga0207644_10074847 | |||
| 1445 | Ga0207690_10287790 | |||
| 1446 | Ga0207690_10431242 | |||
| 1447 | Ga0207690_10444134 | |||
| 1448 | Ga0207706_10005117 | |||
| 1449 | Ga0207706_10264937 | |||
| 1450 | Ga0207706_10372934 | |||
| 1451 | Ga0207686_11366543 | |||
| 1452 | Ga0207709_10374346 | |||
| 1453 | Ga0207670_11403836 | |||
| 1454 | Ga0207670_11676106 | |||
| 1455 | Ga0207669_10265770 | |||
| 1456 | Ga0207704_10537559 | |||
| 1457 | Ga0207704_10726401 | |||
| 1458 | Ga0207665_10162579 | |||
| 1459 | Ga0207665_10180237 | |||
| 1460 | Ga0207691_10423862 | |||
| 1461 | Ga0207691_10703054 | |||
| 1462 | Ga0207711_10545247 | |||
| 1463 | Ga0207711_11425732 | |||
| 1464 | Ga0207689_10006565 | |||
| 1465 | Ga0207689_10040371 | |||
| 1466 | Ga0207689_10217264 | |||
| 1467 | Ga0207689_10360629 | |||
| 1468 | Ga0207661_10058262 | |||
| 1469 | Ga0207661_10104262 | |||
| 1470 | Ga0207679_10134757 | |||
| 1471 | Ga0207679_11860078 | |||
| 1472 | Ga0207667_11480546 | |||
| 1473 | Ga0207651_11258734 | |||
| 1474 | Ga0207712_10399851 | |||
| 1475 | Ga0207668_10006800 | |||
| 1476 | Ga0207668_10085199 | |||
| 1477 | Ga0207668_10086405 | |||
| 1478 | Ga0207640_10361078 | |||
| 1479 | Ga0207640_10529240 | |||
| 1480 | Ga0207677_10354280 | |||
| 1481 | Ga0207677_12103370 | |||
| 1482 | Ga0207703_10395320 | |||
| 1483 | Ga0207703_10642435 | |||
| 1484 | Ga0207703_10883365 | |||
| 1485 | Ga0207703_11375450 | |||
| 1486 | Ga0207678_10009672 | |||
| 1487 | Ga0207678_10117774 | |||
| 1488 | Ga0207708_10103253 | |||
| 1489 | Ga0207708_10144910 | |||
| 1490 | Ga0207708_10771973 | |||
| 1491 | Ga0207708_11130501 | |||
| 1492 | Ga0207702_10186996 | |||
| 1493 | Ga0207702_10296670 | |||
| 1494 | Ga0207702_10390241 | |||
| 1495 | Ga0207702_11145137 | |||
| 1496 | Ga0207641_10000419 | |||
| 1497 | Ga0207641_10037929 | |||
| 1498 | Ga0207641_10063495 | |||
| 1499 | Ga0207641_11742074 | |||
| 1500 | Ga0207648_10137534 | |||
| 1501 | Ga0207648_10198771 | |||
| 1502 | Ga0207648_10576250 | |||
| 1503 | Ga0207676_10296215 | |||
| 1504 | Ga0207676_10339051 | |||
| 1505 | Ga0207676_10410277 | |||
| 1506 | Ga0207674_10051595 | |||
| 1507 | Ga0207674_10101881 | |||
| 1508 | Ga0207674_10106532 | |||
| 1509 | Ga0207674_10155538 | |||
| 1510 | Ga0207675_100085150 | |||
| 1511 | Ga0207675_100471478 | |||
| 1512 | Ga0207675_100918867 | |||
| 1513 | Ga0207675_101183950 | |||
| 1514 | Ga0207675_101272078 | |||
| 1515 | Ga0207683_10059946 | |||
| 1516 | Ga0207683_10209105 | |||
| 1517 | Ga0207683_10437002 | |||
| 1518 | Ga0207683_10916546 | |||
| 1519 | Ga0207698_10451519 | |||
| 1520 | Ga0207428_10175714 | |||
| 1521 | Ga0207428_10176902 | |||
| 1522 | Ga0268266_10002878 | |||
| 1523 | Ga0268266_10487636 | |||
| 1524 | Ga0268266_11077608 | |||
| 1525 | Ga0268266_11312153 | |||
| 1526 | Ga0268266_11931642 | |||
| 1527 | Ga0268265_10153413 | |||
| 1528 | Ga0268265_11046874 | |||
| 1529 | Ga0265337_1095228 | |||
| 1530 | Ga0307517_10162993 | |||
| 1531 | Ga0307515_10000148 | |||
| 1532 | Ga0307515_10057219 | |||
| 1533 | Ga0307515_10167936 | |||
| 1534 | Ga0311004_156697 | |||
| 1535 | Ga0311001_1067596 | |||
| 1536 | Ga0310981_1045895 | |||
| 1537 | Ga0307511_10000442 | |||
| 1538 | Ga0307511_10167736 | |||
| 1539 | Ga0307512_10023306 | |||
| 1540 | Ga0307512_10050742 | |||
| 1541 | Ga0316180_1086595 | |||
| 1542 | Ga0316183_1000667 | |||
| 1543 | Ga0316182_1051395 | |||
| 1544 | Ga0265328_10068246 | |||
| 1545 | Ga0307513_10000002 | |||
| 1546 | Ga0307513_10002320 | |||
| 1547 | Ga0307513_10082362 | |||
| 1548 | Ga0307509_10009471 | |||
| 1549 | Ga0307408_100375079 | |||
| 1550 | Ga0307408_100416224 | |||
| 1551 | Ga0307408_100708943 | |||
| 1552 | Ga0307408_100724508 | |||
| 1553 | Ga0307508_10007906 | |||
| 1554 | Ga0307508_10022643 | |||
| 1555 | Ga0307508_10024389 | |||
| 1556 | Ga0307514_10350755 | |||
| 1557 | Ga0307514_10359352 | |||
| 1558 | Ga0307516_10003585 | |||
| 1559 | Ga0307516_10088874 | |||
| 1560 | Ga0307516_10147657 | |||
| 1561 | Ga0307405_10143152 | |||
| 1562 | Ga0307405_10173496 | |||
| 1563 | Ga0307413_10534776 | |||
| 1564 | Ga0307410_10068505 | |||
| 1565 | Ga0307410_10266182 | |||
| 1566 | Ga0307410_10401544 | |||
| 1567 | Ga0307410_10655088 | |||
| 1568 | Ga0307410_11123488 | |||
| 1569 | Ga0307410_11468154 | |||
| 1570 | Ga0307406_10000856 | |||
| 1571 | Ga0307406_10071795 | |||
| 1572 | Ga0307406_10516412 | |||
| 1573 | Ga0307406_12096970 | |||
| 1574 | Ga0307407_10049499 | |||
| 1575 | Ga0307412_10121539 | |||
| 1576 | Ga0307409_100038755 | |||
| 1577 | Ga0307409_100242668 | |||
| 1578 | Ga0307409_100824913 | |||
| 1579 | Ga0307416_100102513 | |||
| 1580 | Ga0307416_100171696 | |||
| 1581 | Ga0307416_100578772 | |||
| 1582 | Ga0307416_101544704 | |||
| 1583 | Ga0307416_102749958 | |||
| 1584 | Ga0307416_103254378 | |||
| 1585 | Ga0307414_10255234 | |||
| 1586 | Ga0307414_11750102 | |||
| 1587 | Ga0307411_10984297 | |||
| 1588 | Ga0307411_11747421 | |||
| 1589 | Ga0307415_100008707 | |||
| 1590 | Ga0307415_100067194 | |||
| 1591 | Ga0307415_100113492 | |||
| 1592 | Ga0307415_100371260 | |||
| 1593 | Ga0307415_100426882 | |||
| 1594 | Ga0307415_100615632 | |||
| 1595 | Ga0307415_101385280 | |||
| 1596 | Ga0307415_101502427 | |||
| 1597 | Ga0316593_10135718 | |||
| 1598 | Ga0307507_10275880 | |||
| 1599 | Ga0307510_10529989 | |||
| 1600 | Ga0373930_0056376 | |||
| 1601 | Ga0373929_0151525 | |||
| 1602 | Ga0373951_0000077 | |||
| 1603 | Ga0373932_0088562 | |||
| 1604 | Ga0373939_0178085 | |||
| 1605 | Ga0373941_0099891 | |||
| 1606 | Ga0373954_0527839 | |||
| 1607 | Ga0373956_0000255 | |||
| 1608 | Ga0373943_0492358 | |||
| 1609 | Ga0373955_0325886 | |||
| 1610 | Ga0373942_0003991 | |||
| 1611 | Ga0373942_0045220 | |||
| 1612 | Ga0373962_0001763 | |||
| 1613 | Ga0373924_0407941 | |||
| 1614 | Ga0373931_0496328 | |||
| 1615 | Ga0373931_1013333 | |||
| 1616 | Ga0373935_0178931 | |||
| 1617 | Ga0373927_0495995 | |||
| 1618 | Ga0373925_0452932 | |||
| 1619 | Ga0373925_1137328 | |||
| 1620 | Ga0373925_1369960 | |||
| 1621 | Ga0395899_0691500 | |||
| 1622 | Ga0395900_0017058 | |||
| 1623 | Ga0395900_0178726 | |||
| 1624 | Ga0395900_0416874 | |||
| 1625 | Ga0395898_0017301 | |||
| 1626 | Ga0395898_0063355 | |||
| 1627 | Ga0395898_1219123 | |||
| 1628 | Ga0395905_0025967 | |||
| 1629 | Ga0395905_1341435 | |||
| 1630 | Ga0436364_0843409 | |||
| 1631 | Ga0395901_0006306 | |||
| 1632 | Ga0395901_0216316 | |||
| 1633 | Ga0395901_2094819 | |||
| 1634 | Ga0439436_0045199 | |||
| 1635 | Ga0439439_0004566 | |||
| 1636 | Ga0439466_0038464 | |||
| 1637 | Ga0439465_0363526 | |||
| 1638 | Ga0451792_08217 | |||
| 1639 | Ga0451793_1559054 | |||
| 1640 | Ga0451797_0420750 | |||
| 1641 | Ga0451797_1374646 | |||
| 1642 | Ga0451802_1014310 | |||
| 1643 | Ga0451805_106874 | |||
| 1644 | Ga0451804_0022812 | |||
| 1645 | Ga0451807_0695240 | |||
| 1646 | Ga0451807_0770464 | |||
| 1647 | Ga0451833_0517963 | |||
| 1648 | Ga0451837_1200754 | |||
| 1649 | Ga0451839_1160533 | |||
| 1650 | Ga0451840_23904 | |||
| 1651 | Ga0451841_0484083 | |||
| 1652 | Ga0451846_62652 | |||
| 1653 | Ga0451850_61463 | |||
| 1654 | Ga0451854_00925 | |||
| 1655 | Ga0451855_1976416 | |||
| 1656 | Ga0451853_3684749 | |||
| 1657 | Ga0439433_0106745 | |||
| 1658 | Ga0439448_0113420 | |||
| 1659 | Ga0439449_0019645 | |||
| 1660 | Ga0439449_0431918 | |||
| 1661 | Ga0439455_0153397 | |||
| 1662 | Ga0439457_002664 | |||
| 1663 | Ga0439462_0244260 | |||
| 1664 | Ga0439463_205356 | |||
| 1665 | Ga0450890_034518 | |||
| 1666 | Ga0450891_031721 | |||
| 1667 | Ga0450907_048730 | |||
| 1668 | Ga0439458_0099147 | |||
| 1669 | Ga0439460_0157239 | |||
| 1670 | Ga0450916_054246 | |||
| 1671 | Ga0450916_080381 | |||
| 1672 | Ga0439440_0117683 | |||
| 1673 | Ga0466969_0018202 | |||
| 1674 | Ga0466972_0008350 | |||
| 1675 | Ga0466965_0010254 | |||
| 1676 | Ga0466965_0086124 | |||
| 1677 | Ga0466965_0929169 | |||
| 1678 | Ga0466966_0001061 | |||
| 1679 | Ga0466966_0116988 | |||
| 1680 | Ga0466966_0158096 | |||
| 1681 | Ga0466961_0045785 | |||
| 1682 | Ga0466961_0166202 | |||
| 1683 | Ga0466961_0202773 | |||
| 1684 | Ga0466963_0165271 | |||
| 1685 | Ga0466963_0226003 | |||
| 1686 | Ga0466963_0635468 | |||
| 1687 | Ga0466963_1008406 | |||
| 1688 | Ga0466963_1072156 | |||
| 1689 | Ga0466964_0393964 | |||
| 1690 | Ga0466971_0088779 | |||
| 1691 | Ga0466971_0387714 | |||
| 1692 | Ga0466970_0004599 | |||
| 1693 | Ga0466970_0102599 | |||
| 1694 | Ga0466957_0058510 | |||
| 1695 | Ga0466957_0600378 | |||
| 1696 | Ga0466960_0000951 | |||
| 1697 | Ga0466960_0218205 | |||
| 1698 | Ga0466960_0267624 | |||
| 1699 | Ga0466959_0006875 | |||
| 1700 | Ga0466959_0034988 | |||
| 1701 | Ga0466959_0518013 | |||
| 1702 | Ga0466958_0179691 | |||
| 1703 | Ga0466958_0325340 | |||
| 1704 | Ga0466958_0630727 | |||
| 1705 | Ga0466958_1081724 | |||
| 1706 | Ga0466967_0186810 | |||
| 1707 | Ga0466967_0760305 | |||
| 1708 | Ga0466967_1834271 | |||
| 1709 | Ga0495603_0020570 | |||
| 1710 | Ga0495603_0178051 | |||
| 1711 | Ga0495603_0479913 | |||
| 1712 | Ga0495629_0014670 | |||
| 1713 | Ga0495638_0159213 | |||
| 1714 | Ga0495641_0031083 | |||
| 1715 | Ga0495641_0417016 | |||
| 1716 | Ga0495582_0010933 | |||
| 1717 | Ga0495662_0033040 | |||
| 1718 | Ga0495662_0630683 | |||
| 1719 | Ga0495585_0289287 | |||
| 1720 | Ga0495594_0027313 | |||
| 1721 | Ga0495594_0106681 | |||
| 1722 | Ga0495606_0012057 | |||
| 1723 | Ga0495630_1386487 | |||
| 1724 | Ga0495640_0015877 | |||
| 1725 | Ga0495645_0575155 | |||
| 1726 | Ga0495668_0000213 | |||
| 1727 | Ga0495634_0053960 | |||
| 1728 | Ga0495625_0012217 | |||
| 1729 | Ga0495625_0917893 | |||
| 1730 | Ga0495658_0101826 | |||
| 1731 | Ga0495613_0865175 | |||
| 1732 | Ga0495624_0074271 | |||
| 1733 | Ga0495649_0523856 | |||
| 1734 | Ga0495581_0917504 | |||
| 1735 | Ga0495636_0382446 | |||
| 1736 | Ga0495683_0408413 | |||
| 1737 | Ga0495675_0416186 | |||
| 1738 | Ga0495593_0340094 | |||
| 1739 | Ga0495626_0005869 | |||
| 1740 | Ga0496100_0002555 | |||
| 1741 | Ga0496100_1084651 | |||
| 1742 | Ga0496101_0170148 | |||
| 1743 | Ga0496101_0887299 | |||
| 1744 | Ga0496101_1150931 | |||
| 1745 | Ga0496102_0000222 | |||
| 1746 | Ga0496103_0000179 | |||
| 1747 | Ga0496103_1062419 | |||
| 1748 | Ga0496104_0173411 | |||
| 1749 | Ga0496104_0179122 | |||
| 1750 | Ga0496104_0311805 | |||
| 1751 | Ga0496104_1712313 | |||
| 1752 | Ga0496105_0040289 | |||
| 1753 | Ga0496105_0507949 | |||
| 1754 | Ga0496105_1076309 | |||
| 1755 | Ga0496106_0331240 | |||
| 1756 | Ga0496107_0270229 | |||
| 1757 | Ga0496108_0000065 | |||
| 1758 | Ga0496108_0339622 | |||
| 1759 | Ga0496108_0509882 | |||
| 1760 | Ga0496108_0848060 | |||
| 1761 | Ga0496108_1173632 | |||
| 1762 | Ga0496109_0168214 | |||
| 1763 | Ga0496109_1209056 | |||
| 1764 | Ga0496109_1543252 | |||
| 1765 | Ga0496109_1577902 | |||
| 1766 | Ga0496110_0640672 | |||
| 1767 | Ga0496110_1445963 | |||
| 1768 | Ga0496111_0147266 | |||
| 1769 | Ga0496112_0108341 | |||
| 1770 | Ga0496112_0210902 | |||
| 1771 | Ga0496113_1411458 | |||
| 1772 | Ga0496114_0148461 | |||
| 1773 | Ga0496114_1029793 | |||
| 1774 | Ga0496115_0457950 | |||
| 1775 | Ga0496116_0000481 | |||
| 1776 | Ga0496117_0000242 | |||
| 1777 | Ga0496118_0000412 | |||
| 1778 | Ga0496119_0013023 | |||
| 1779 | Ga0496120_0003152 | |||
| 1780 | Ga0496121_0002113 | |||
| 1781 | Ga0496122_0107771 | |||
| 1782 | Ga0496124_0028247 | |||
| 1783 | Ga0496125_0077747 | |||
| 1784 | Ga0496126_0000521 | |||
| 1785 | Ga0496126_0403213 | |||
| 1786 | Ga0501306_026908 | |||
| 1787 | Ga0501308_039955 | |||
| 1788 | Ga0501309_054766 | |||
| 1789 | Ga0501309_080375 | |||
| 1790 | Ga0501307_036786 | |||
| 1791 | Ga0501311_042223 | |||
| 1792 | Ga0501311_065165 | |||
| 1793 | Ga0501311_089539 | |||
| 1794 | Ga0501312_101412 | |||
| 1795 | Ga0501312_106094 | |||
| 1796 | Ga0501315_065039 | |||
| 1797 | Ga0501315_072729 | |||
| 1798 | Ga0501316_053986 | |||
| 1799 | Ga0501317_097649 | |||
| 1800 | Ga0501318_036492 | |||
| 1801 | Ga0501318_042966 | |||
| 1802 | Ga0501320_021563 | |||
| 1803 | Ga0501320_022750 | |||
| 1804 | Ga0501321_045840 | |||
| 1805 | Ga0501322_014138 | |||
| 1806 | Ga0501323_035375 | |||
| 1807 | Ga0501325_025402 | |||
| 1808 | Ga0501325_039029 | |||
| 1809 | Ga0501325_046295 | |||
| 1810 | Ga0501031_0621082 | |||
| 1811 | Ga0501040_0939010 | |||
| 1812 | Ga0501042_0337365 | |||
| 1813 | Ga0501042_0610898 | |||
| 1814 | Ga0501042_1148701 | |||
| 1815 | Ga0501043_0789770 | |||
| 1816 | Ga0501047_0043781 | |||
| 1817 | Ga0501070_0325459 | |||
| 1818 | Ga0501071_1357103 | |||
| 1819 | Ga0501072_1204745 | |||
| 1820 | Ga0501073_1123314 | |||
| 1821 | Ga0501257_193330 | |||
| 1822 | Ga0501044_0950220 | |||
| 1823 | nmdc:mga00v17_134291_c1 | |||
| 1824 | nmdc:mga05p37_43650_c1 | |||
| 1825 | nmdc:mga05p37_6610_c1 | |||
| 1826 | nmdc:mga09592_437295_c1 | |||
| 1827 | nmdc:mga09592_59221_c1 | |||
| 1828 | nmdc:mga09592_92293_c1 | |||
| 1829 | nmdc:mga0qj67_312095_c1 | |||
| 1830 | nmdc:mga06r32_8857_c1 | |||
| 1831 | nmdc:mga08y16_38963_c1 | |||
| 1832 | nmdc:mga0n895_1716881_c1 | |||
| 1833 | nmdc:mga0rr50_144385_c1 | |||
| 1834 | nmdc:mga0rr50_355518_c1 | |||
| 1835 | nmdc:mga08x19_968998_c1 | |||
| 1836 | nmdc:mga0a205_773109_c1 | |||
| 1837 | Ga0500644_0103302 | |||
| 1838 | Ga0500646_0001171 | |||
| 1839 | Ga0500583_0005277 | |||
| 1840 | Ga0500583_0206079 | |||
| 1841 | Ga0500651_0219695 | |||
| 1842 | Ga0500651_0613695 | |||
| 1843 | Ga0500641_0251238 | |||
| 1844 | Ga0500641_0382371 | |||
| 1845 | Ga0500650_0120431 | |||
| 1846 | Ga0500556_0251196 | |||
| 1847 | Ga0500562_094148 | |||
| 1848 | Ga0500569_049329 | |||
| 1849 | Ga0500572_240015 | |||
| 1850 | Ga0500594_0011394 | |||
| 1851 | Ga0500652_066448 | |||
| 1852 | Ga0500655_108929 | |||
| 1853 | Ga0500559_0282774 | |||
| 1854 | Ga0500568_0147348 | |||
| 1855 | Ga0500579_175879 | |||
| 1856 | Ga0500588_0001715 | |||
| 1857 | Ga0500600_0058151 | |||
| 1858 | Ga0500622_0299608 | |||
| 1859 | Ga0500633_0203585 | |||
| 1860 | Ga0500611_078197 | |||
| 1861 | Ga0500587_022858 | |||
| 1862 | Ga0587084_060986 | |||
| 1863 | Ga0587084_090669 | |||
| 1864 | Ga0587093_063957 | |||
| 1865 | Ga0587066_103943 | |||
| 1866 | Ga0587066_178793 | |||
| 1867 | Ga0587070_095813 | |||
| 1868 | Ga0587070_157689 | |||
| 1869 | Ga0587073_0086985 | |||
| 1870 | Ga0587073_0168109 | |||
| 1871 | Ga0587073_0179273 | |||
| 1872 | Ga0587073_0274677 | |||
| 1873 | Ga0587073_0294866 | |||
| 1874 | Ga0587077_095821 | |||
| 1875 | Ga0587080_123629 | |||
| 1876 | Ga0587080_135832 | |||
| 1877 | Ga0587082_078791 | |||
| 1878 | Ga0587082_084640 | |||
| 1879 | Ga0587083_0038990 | |||
| 1880 | Ga0587083_0215446 | |||
| 1881 | Ga0587085_126315 | |||
| 1882 | Ga0587085_132014 | |||
| 1883 | Ga0587086_087395 | |||
| 1884 | Ga0587086_087670 | |||
| 1885 | Ga0587086_092800 | |||
| 1886 | Ga0587088_100208 | |||
| 1887 | Ga0587089_090275 | |||
| 1888 | Ga0587089_100265 | |||
| 1889 | Ga0587090_058002 | |||
| 1890 | Ga0587090_079098 | |||
| 1891 | Ga0587090_137982 | |||
| 1892 | Ga0587091_085544 | |||
| 1893 | Ga0587091_104714 | |||
| 1894 | Ga0587091_188255 | |||
| 1895 | Ga0587092_105043 | |||
| 1896 | Ga0587092_109522 | |||
| 1897 | Ga0587094_049988 | |||
| 1898 | Ga0587094_118190 | |||
| 1899 | Ga0587094_120394 | |||
| 1900 | Ga0587095_042182 | |||
| 1901 | Ga0587098_029596 | |||
| 1902 | Ga0587106_032717 | |||
| 1903 | Ga0587106_060370 | |||
| 1904 | Ga0587106_106587 | |||
| 1905 | Ga0587129_013458 | |||
| 1906 | Ga0587099_019322 | |||
| 1907 | Ga0587099_046241 | |||
| 1908 | Ga0587099_054607 | |||
| 1909 | Ga0587101_128489 | |||
| 1910 | Ga0587109_101942 | |||
| 1911 | Ga0587113_016745 | |||
| 1912 | Ga0587113_034552 | |||
| 1913 | Ga0587115_075823 | |||
| 1914 | Ga0587122_014419 | |||
| 1915 | Ga0587128_042347 | |||
| 1916 | Ga0587128_063783 | |||
| 1917 | Ga0587128_081058 | |||
| 1918 | Ga0587128_103809 | |||
| 1919 | Ga0587130_027322 | |||
| 1920 | Ga0587130_043050 | |||
| 1921 | Ga0587067_049979 | |||
| 1922 | Ga0587067_092343 | |||
| 1923 | Ga0587067_174189 | |||
| 1924 | Ga0587067_185936 | |||
| 1925 | Ga0587067_190818 | |||
| 1926 | Ga0587067_236033 | |||
| 1927 | Ga0587068_040150 | |||
| 1928 | Ga0587068_138597 | |||
| 1929 | Ga0587069_060010 | |||
| 1930 | Ga0587069_060133 | |||
| 1931 | Ga0587069_088558 | |||
| 1932 | Ga0587069_104651 | |||
| 1933 | Ga0587069_138201 | |||
| 1934 | Ga0587075_050973 | |||
| 1935 | Ga0587075_057723 | |||
| 1936 | Ga0587075_060047 | |||
| 1937 | Ga0587075_078247 | |||
| 1938 | Ga0587076_054659 | |||
| 1939 | Ga0587076_057258 | |||
| 1940 | Ga0587076_075029 | |||
| 1941 | Ga0587076_090219 | |||
| 1942 | Ga0587079_098300 | |||
| 1943 | Ga0587079_191683 | |||
| 1944 | Ga0587100_043739 | |||
| 1945 | Ga0587107_069764 | |||
| 1946 | Ga0587107_126542 | |||
| 1947 | Ga0587107_142883 | |||
| 1948 | Ga0587114_055332 | |||
| 1949 | Ga0587114_062937 | |||
| 1950 | Ga0587114_068245 | |||
| 1951 | Ga0587114_097970 | |||
| 1952 | Ga0587119_026366 | |||
| 1953 | Ga0587071_061297 | |||
| 1954 | Ga0466962_0040787 | |||
| 1955 | Ga0466962_0175028 | |||
| 1956 | Ga0466962_0714048 | |||
| 1957 | 2501945236 | |||
| 1958 | 2515498359 | |||
| 1959 | 2515722787 | |||
| 1960 | 2515759628 | |||
| 1961 | 2516087001 | |||
| 1962 | 2516092057 | |||
| 1963 | 2552106614 | |||
| 1964 | 2559425982 | |||
| 1965 | 2623499741 | |||
| 1966 | 2623591234 | |||
| 1967 | 2753272073 | |||
| 1968 | 2772647165 | |||
| 1969 | 2816508677 | |||
| 1970 | 2831938478 | |||
| 1971 | 2832005375 | |||
| 1972 | 2855674015 | |||
| 1973 | 2855677031 | |||
| 1974 | 2855688794 | |||
| 1975 | 2856858179 | |||
| 1976 | 2857295431 | |||
| 1977 | 2858852708 | |||
| 1978 | 2858886543 | |||
| 1979 | 2858894241 | |||
| 1980 | 2858898249 | |||
| 1981 | 2866065285 | |||
| 1982 | 2867307710 | |||
| 1983 | 2867316492 | |||
| 1984 | 2867324872 | |||
| 1985 | 2869054697 | |||
| 1986 | 2869066840 | |||
| 1987 | 2869072662 | |||
| 1988 | 2880495887 | |||
| 1989 | 2880496479 | |||
| 1990 | 2887480673 | |||
| 1991 | 2902584805 | |||
| 1992 | 2915364145 | |||
| 1993 | 2929225122 | |||
| 1994 | 2929231912 | |||
| 1995 | 2996225799 | |||
| 1996 | 649813580 | |||
| 1997 | 8001786119 | |||
| 1998 | 8003832142 | |||
| 1999 | 8003862625 | |||
| 2000 | 8003873935 | |||
| 2001 | 8054473259 | |||
| 2002 | 8054705198 | |||
| 2003 | 8054730611 | |||
| 2004 | 8054736932 | |||
| 2005 | 8055415408 | |||
| 2006 | 8056057533 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cvm-assembly1.cif.gz_q | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9345 | 1 | 102 |
| 7y41-assembly1.cif.gz_S | mycobacterium smegmatis 50s ribosomal subunit from log phase of growth | 0.9262 | 1 | 100 |
| 7msm-assembly1.cif.gz_R | mtb 70sic in complex with mtbetta at trans_r0 state | 0.9235 | 1 | 100 |
| 7y41-assembly1.cif.gz_S | mycobacterium smegmatis 50s ribosomal subunit from log phase of growth | 0.9175 | 1 | 100 |
| 7msm-assembly1.cif.gz_R | mtb 70sic in complex with mtbetta at trans_r0 state | 0.9149 | 1 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHC3_3_102_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.9367 | 1 | 100 | 2.40.10.190 |
| af_P9WHC3_3_102_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.9279 | 1 | 100 | 2.40.10.190 |
| af_P0AG48_1_101_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.9114 | 1 | 100 | 2.40.10.190 |
| af_Q4DUK1_23_123_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9093 | 1 | 100 | 2.40.50.140 |
| af_C0H4Y5_87_186_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.9008 | 2 | 99 | 2.40.10.190 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E6D663-F1-model_v4 | deleted | 0.9667 | 2 | 102 |
|
| AF-A0A3D5DWU6-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9652 | 1 | 101 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A4R4ZVZ2-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9647 | 1 | 101 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A6N7IIT1-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9636 | 1 | 102 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-L1PLH8-F1-model_v4 | deleted | 0.9621 | 2 | 101 |
|