F487929

General Info

Members Datasets Scaffolds Average Seq Length
1003 490 2004 243

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10000124|Ga0111539_1000012423
Length 275
Sequence MHAHRWALDRHHKGQARHPVGSLRQIRLVVIGRIVRKKSGTGAKLMTRRLEGKVAVVTGASKGISSREGAERVVADINARGGKAIAVQGDVSKPAHIERLFSETDKAFGRVDILVNNAGVYEFAPLEDVTAELFHKQFDLNVLGLMLTTREAVKRMGAGGGSIINIGSVASAVRPPNSSVYAGSKAAVDAITGVLAKELGPRGIRVNSINPGMIETEGVHAAGLVGSDFQKMIETQAPLGRMGHPDDIAPTAVYLASSDSKYMTGESLLVSGGLR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
188 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
189 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
190 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
197 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
198 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
199 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
238 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
345 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
346 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
347 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
348 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
349 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
350 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
351 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
352 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
353 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
354 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
355 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
356 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
357 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
358 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
359 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
360 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
361 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
362 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
363 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
364 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
365 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
366 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
367 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
371 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
372 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
373 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
374 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
375 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
376 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
377 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
380 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
381 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
382 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
383 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
384 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
385 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
386 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
387 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
388 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
389 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
390 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
391 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
392 2818991435 Caulobacter henricii 536 Isolate Unclassified
393 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
394 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
395 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
396 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
397 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
398 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
399 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
400 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
401 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
402 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
403 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
404 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
405 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
406 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
407 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
408 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
409 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
410 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
411 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
412 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
413 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
414 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
415 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
416 2922368715
417 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
418 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
419 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
420 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
421 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
422 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
423 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
424 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
425 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
426 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
427 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
428 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
429 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
430 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
431 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
432 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
433 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
434 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
435 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
436 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
437 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
438 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
439 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
440 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
441 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
442 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
443 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
444 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
445 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
446 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
447 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
448 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
449 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
450 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
451 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
452 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
453 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
454 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
455 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
456 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
457 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
458 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
459 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
460 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
461 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
462 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
463 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
464 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
465 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
466 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
467 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
468 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
469 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
470 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
471 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
472 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
473 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
474 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
475 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
476 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
477 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
478 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
479 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
480 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
481 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
482 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
483 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
484 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
485 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
486 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
487 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
488 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
489 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
490 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.32
Metatranscriptomes 0.1
Isolates 10.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.58
Nodule 8.57
Rhizoplane 1.5
Rhizosphere 78.17
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10000124 3300009094 Bacteria 86595
2 JGI24739J22299_10026551 3300001989 Bacteria 2031
3 JGI24033J26618_1005198 3300002155 Bacteria 1428
4 JGI25154J39366_1000042 3300002738 Bacteria 143170
5 JGI25157J39369_1007330 3300002741 Bacteria 1599
6 JGI25406J46586_10008012 3300003203 Bacteria 4801
7 JGI25153J46596_10015034 3300003215 Bacteria 3177
8 JGI25153J46596_10036606 3300003215 Bacteria 1570
9 rootH1_10143667 3300003316 Bacteria 3299
10 rootH1_10074313 3300003323 Bacteria 4900
11 Ga0055542_1007622 3300003762 Bacteria 2182
12 Ga0065712_10069273 3300005290 Bacteria 7621
13 Ga0065707_10095389 3300005295 Bacteria 3384
14 Ga0065707_10268601 3300005295 Bacteria 1077
15 Ga0070658_10014419 3300005327 Bacteria 6342
16 Ga0070658_10095108 3300005327 Bacteria 2459
17 Ga0070658_10346476 3300005327 Bacteria 1271
18 Ga0070683_100000653 3300005329 Bacteria 25046
19 Ga0070683_100030692 3300005329 Bacteria 4882
20 Ga0070683_100042961 3300005329 Bacteria 4164
21 Ga0070683_100094168 3300005329 Bacteria 2815
22 Ga0070670_100000238 3300005331 Bacteria 49857
23 Ga0070670_100007809 3300005331 Bacteria 9102
24 Ga0070670_100387881 3300005331 Bacteria 1231
25 Ga0068869_100000067 3300005334 Bacteria 47134
26 Ga0068869_100000317 3300005334 Bacteria 25598
27 Ga0070666_10000392 3300005335 Bacteria 27574
28 Ga0070682_100142815 3300005337 Bacteria 1634
29 Ga0068868_100003498 3300005338 Bacteria 10934
30 Ga0068868_100008842 3300005338 Bacteria 7216
31 Ga0070660_100637995 3300005339 Bacteria 892
32 Ga0070689_100206570 3300005340 Bacteria 1606
33 Ga0070689_100320801 3300005340 Bacteria 1294
34 Ga0070661_100003268 3300005344 Bacteria 11189
35 Ga0070661_100009743 3300005344 Bacteria 6662
36 Ga0070661_100020351 3300005344 Bacteria 4730
37 Ga0070661_100335738 3300005344 Bacteria 1183
38 Ga0070692_10281344 3300005345 Bacteria 1008
39 Ga0070668_100021274 3300005347 Bacteria 4903
40 Ga0070669_100000023 3300005353 Bacteria 174496
41 Ga0070669_100190355 3300005353 Bacteria 1609
42 Ga0070671_100000017 3300005355 Bacteria 154265
43 Ga0070671_100005568 3300005355 Bacteria 10035
44 Ga0070671_100042886 3300005355 Bacteria 3762
45 Ga0070671_100064979 3300005355 Bacteria 3039
46 Ga0070674_100022177 3300005356 Bacteria 4092
47 Ga0070673_100220636 3300005364 Bacteria 1641
48 Ga0070667_100001098 3300005367 Bacteria 24799
49 Ga0070667_100002059 3300005367 Bacteria 17798
50 Ga0070709_10037141 3300005434 Bacteria 2973
51 Ga0070714_100017532 3300005435 Bacteria 5802
52 Ga0070714_100079799 3300005435 Bacteria 2846
53 Ga0070713_100286889 3300005436 Bacteria 1512
54 Ga0070710_10093877 3300005437 Bacteria 1774
55 Ga0070711_100007475 3300005439 Bacteria 6648
56 Ga0070711_100629387 3300005439 Bacteria 898
57 Ga0070711_100679699 3300005439 Bacteria 865
58 Ga0070705_100073458 3300005440 Bacteria 2075
59 Ga0070700_100000048 3300005441 Bacteria 89854
60 Ga0070700_100314978 3300005441 Bacteria 1147
61 Ga0070694_100039963 3300005444 Bacteria 3125
62 Ga0070694_100311791 3300005444 Bacteria 1208
63 Ga0070708_100004926 3300005445 Bacteria 10554
64 Ga0070708_100132079 3300005445 Bacteria 2311
65 Ga0070708_100246322 3300005445 Bacteria 1678
66 Ga0070663_100095338 3300005455 Bacteria 2211
67 Ga0070663_100244262 3300005455 Bacteria 1418
68 Ga0070663_100356706 3300005455 Bacteria 1185
69 Ga0070681_10008494 3300005458 Bacteria 10053
70 Ga0070681_10210331 3300005458 Bacteria 1861
71 Ga0068867_100002198 3300005459 Bacteria 13683
72 Ga0068867_100023944 3300005459 Bacteria 4374
73 Ga0070706_100000217 3300005467 Bacteria 70703
74 Ga0070706_100007572 3300005467 Bacteria 10169
75 Ga0070706_100011580 3300005467 Bacteria 8194
76 Ga0070706_100026756 3300005467 Bacteria 5305
77 Ga0070706_100132316 3300005467 Bacteria 2328
78 Ga0070706_100162411 3300005467 Bacteria 2086
79 Ga0070706_100322229 3300005467 Bacteria 1441
80 Ga0070707_100101895 3300005468 Bacteria 2782
81 Ga0070707_100102208 3300005468 Bacteria 2777
82 Ga0070707_100133924 3300005468 Bacteria 2411
83 Ga0070698_100009817 3300005471 Bacteria 10232
84 Ga0070698_100116999 3300005471 Bacteria 2628
85 Ga0070698_100287323 3300005471 Bacteria 1576
86 Ga0070698_100498490 3300005471 Bacteria 1156
87 Ga0070698_100566472 3300005471 Bacteria 1076
88 Ga0070699_100023313 3300005518 Bacteria 5331
89 Ga0070699_100098998 3300005518 Bacteria 2555
90 Ga0070699_100137314 3300005518 Bacteria 2157
91 Ga0070699_100155627 3300005518 Bacteria 2023
92 Ga0070679_100268064 3300005530 Bacteria 1662
93 Ga0070684_100002903 3300005535 Bacteria 12732
94 Ga0070684_100022171 3300005535 Bacteria 5293
95 Ga0070697_100005321 3300005536 Bacteria 9890
96 Ga0070697_100056221 3300005536 Bacteria 3201
97 Ga0068853_100000120 3300005539 Bacteria 52962
98 Ga0068853_100068285 3300005539 Bacteria 3090
99 Ga0068853_100347451 3300005539 Bacteria 1379
100 Ga0068853_100573807 3300005539 Unclassified 1070
101 Ga0068853_100585676 3300005539 Bacteria 1059
102 Ga0070672_100218412 3300005543 Bacteria 1598
103 Ga0070686_100043461 3300005544 Bacteria 2819
104 Ga0070695_100043651 3300005545 Bacteria 2851
105 Ga0070696_100056178 3300005546 Bacteria 2746
106 Ga0070693_100035242 3300005547 Unclassified 2774
107 Ga0070693_100279932 3300005547 Bacteria 1117
108 Ga0070665_100000059 3300005548 Bacteria 224560
109 Ga0070665_100025245 3300005548 Bacteria 5987
110 Ga0070665_100064489 3300005548 Bacteria 3674
111 Ga0070665_100075935 3300005548 Unclassified 3367
112 Ga0070665_100225177 3300005548 Bacteria 1876
113 Ga0070665_100292496 3300005548 Bacteria 1631
114 Ga0070665_100302119 3300005548 Bacteria 1603
115 Ga0070665_100371322 3300005548 Bacteria 1437
116 Ga0070665_100508397 3300005548 Bacteria 1216
117 Ga0070665_100583965 3300005548 Bacteria 1130
118 Ga0068855_100000801 3300005563 Bacteria 38932
119 Ga0068855_100001583 3300005563 Bacteria 28580
120 Ga0068855_100033069 3300005563 Bacteria 6174
121 Ga0068855_100057116 3300005563 Bacteria 4576
122 Ga0068855_100121429 3300005563 Bacteria 2990
123 Ga0068855_100161719 3300005563 Bacteria 2540
124 Ga0068855_100426960 3300005563 Bacteria 1449
125 Ga0070664_100042294 3300005564 Bacteria 3847
126 Ga0070664_100228588 3300005564 Bacteria 1667
127 Ga0070664_100304367 3300005564 Unclassified 1441
128 Ga0070664_100618901 3300005564 Bacteria 1005
129 Ga0068857_100000210 3300005577 Bacteria 38134
130 Ga0068857_100097493 3300005577 Bacteria 2636
131 Ga0068857_100195875 3300005577 Bacteria 1841
132 Ga0068854_100068907 3300005578 Bacteria 2581
133 Ga0068854_100072632 3300005578 Bacteria 2519
134 Ga0068856_100003788 3300005614 Bacteria 15149
135 Ga0068856_100014791 3300005614 Bacteria 7534
136 Ga0068856_100029262 3300005614 Bacteria 5380
137 Ga0068856_100062137 3300005614 Bacteria 3689
138 Ga0068856_100184405 3300005614 Bacteria 2100
139 Ga0068856_100820127 3300005614 Bacteria 950
140 Ga0070702_100069585 3300005615 Bacteria 2074
141 Ga0068852_100000077 3300005616 Bacteria 69050
142 Ga0068852_100000299 3300005616 Bacteria 33328
143 Ga0068852_100061407 3300005616 Bacteria 3266
144 Ga0068852_100432772 3300005616 Bacteria 1299
145 Ga0068859_100000207 3300005617 Bacteria 58182
146 Ga0068859_100005717 3300005617 Bacteria 12651
147 Ga0068859_100050561 3300005617 Bacteria 4175
148 Ga0068859_100168760 3300005617 Bacteria 2269
149 Ga0068859_100264094 3300005617 Bacteria 1813
150 Ga0068859_100279285 3300005617 Bacteria 1763
151 Ga0068859_100285311 3300005617 Bacteria 1744
152 Ga0068859_100449484 3300005617 Bacteria 1385
153 Ga0068864_100000362 3300005618 Bacteria 39889
154 Ga0068864_100048434 3300005618 Bacteria 3653
155 Ga0068864_100129961 3300005618 Bacteria 2261
156 Ga0068864_100388811 3300005618 Bacteria 1324
157 Ga0068861_100000038 3300005719 Bacteria 60215
158 Ga0068851_10034499 3300005834 Bacteria 2526
159 Ga0068851_10062543 3300005834 Unclassified 1910
160 Ga0068863_100000356 3300005841 Bacteria 46496
161 Ga0068863_100001238 3300005841 Bacteria 25440
162 Ga0068863_100031933 3300005841 Bacteria 5023
163 Ga0068863_100192701 3300005841 Bacteria 1959
164 Ga0068863_100224850 3300005841 Bacteria 1809
165 Ga0068863_100367798 3300005841 Bacteria 1403
166 Ga0068858_100000553 3300005842 Bacteria 38986
167 Ga0068858_100363386 3300005842 Bacteria 1387
168 Ga0068860_100000847 3300005843 Bacteria 34239
169 Ga0068860_100009837 3300005843 Bacteria 9488
170 Ga0068860_100149226 3300005843 Bacteria 2251
171 Ga0068860_100410871 3300005843 Bacteria 1340
172 Ga0068862_100000425 3300005844 Bacteria 45885
173 Ga0068862_100048432 3300005844 Bacteria 3628
174 Ga0081455_10030952 3300005937 Bacteria 4850
175 Ga0081540_1000033 3300005983 Bacteria 142902
176 Ga0081539_10000044 3300005985 Bacteria 284021
177 Ga0070717_10040036 3300006028 Bacteria 3816
178 Ga0075364_10068455 3300006051 Bacteria 2335
179 Ga0070715_10079449 3300006163 Bacteria 1485
180 Ga0070715_10104422 3300006163 Bacteria 1327
181 Ga0070716_100009776 3300006173 Bacteria 4792
182 Ga0070712_100016224 3300006175 Bacteria 4809
183 Ga0070712_100219333 3300006175 Bacteria 1505
184 Ga0075367_10135195 3300006178 Bacteria 1525
185 Ga0075369_10056613 3300006186 Bacteria 1704
186 Ga0097621_100001698 3300006237 Bacteria 15068
187 Ga0097621_100003988 3300006237 Bacteria 10227
188 Ga0097621_100028237 3300006237 Unclassified 4422
189 Ga0097621_100051057 3300006237 Bacteria 3364
190 Ga0097621_100313979 3300006237 Bacteria 1387
191 Ga0097621_100889840 3300006237 Bacteria 829
192 Ga0068871_100006805 3300006358 Bacteria 8127
193 Ga0068871_100054226 3300006358 Unclassified 3252
194 Ga0068871_100084506 3300006358 Bacteria 2634
195 Ga0068871_100157403 3300006358 Bacteria 1941
196 Ga0068871_100403968 3300006358 Bacteria 1217
197 Ga0075428_100067581 3300006844 Bacteria 3911
198 Ga0075428_100536448 3300006844 Bacteria 1251
199 Ga0075430_100000047 3300006846 Bacteria 63972
200 Ga0075430_100055604 3300006846 Bacteria 3328
201 Ga0075431_100000424 3300006847 Bacteria 34431
202 Ga0075431_100103111 3300006847 Bacteria 2944
203 Ga0075431_100425316 3300006847 Bacteria 1327
204 Ga0075431_100492845 3300006847 Bacteria 1217
205 Ga0075433_10011760 3300006852 Bacteria 7050
206 Ga0075433_10018309 3300006852 Bacteria 5818
207 Ga0075433_10156477 3300006852 Bacteria 2028
208 Ga0075434_100006316 3300006871 Bacteria 10863
209 Ga0075434_100009371 3300006871 Bacteria 9128
210 Ga0075434_100011894 3300006871 Bacteria 8230
211 Ga0075434_100015814 3300006871 Bacteria 7244
212 Ga0075434_100022949 3300006871 Bacteria 6074
213 Ga0075434_100113211 3300006871 Bacteria 2725
214 Ga0075429_100011933 3300006880 Bacteria 7533
215 Ga0075429_100275321 3300006880 Bacteria 1474
216 Ga0068865_100000627 3300006881 Bacteria 19886
217 Ga0068865_100007260 3300006881 Bacteria 6811
218 Ga0075436_100015719 3300006914 Bacteria 5182
219 Ga0075436_100100116 3300006914 Bacteria 2018
220 Ga0097620_100000207 3300006931 Bacteria 58182
221 Ga0097620_100005717 3300006931 Bacteria 12651
222 Ga0097620_100050561 3300006931 Bacteria 4175
223 Ga0097620_100168768 3300006931 Bacteria 2269
224 Ga0097620_100264134 3300006931 Bacteria 1813
225 Ga0097620_100279255 3300006931 Bacteria 1763
226 Ga0097620_100285306 3300006931 Bacteria 1744
227 Ga0097620_100449468 3300006931 Bacteria 1385
228 Ga0075435_100000840 3300007076 Bacteria 19163
229 Ga0075435_100022120 3300007076 Bacteria 4902
230 Ga0075435_100196046 3300007076 Bacteria 1710
231 Ga0075435_100564981 3300007076 Bacteria 986
232 Ga0099794_10000036 3300007265 Bacteria 55505
233 Ga0099794_10011369 3300007265 Bacteria 3808
234 Ga0099795_10042058 3300007788 Bacteria 1630
235 Ga0105251_10000069 3300009011 Bacteria 98334
236 Ga0105240_10001995 3300009093 Bacteria 33699
237 Ga0105240_10002454 3300009093 Bacteria 29791
238 Ga0105240_10002492 3300009093 Bacteria 29572
239 Ga0105240_10004354 3300009093 Bacteria 21617
240 Ga0105240_10007653 3300009093 Bacteria 15643
241 Ga0105240_10018634 3300009093 Bacteria 9307
242 Ga0105240_10088483 3300009093 Bacteria 3789
243 Ga0105240_10178425 3300009093 Unclassified 2509
244 Ga0105240_10312980 3300009093 Bacteria 1792
245 Ga0105240_10476448 3300009093 Bacteria 1392
246 Ga0111539_10013523 3300009094 Bacteria 10200
247 Ga0105245_10001344 3300009098 Bacteria 22283
248 Ga0105245_10001394 3300009098 Bacteria 21888
249 Ga0105245_10026017 3300009098 Bacteria 5149
250 Ga0105245_10074990 3300009098 Bacteria 3079
251 Ga0105245_10129000 3300009098 Bacteria 2370
252 Ga0105245_10641985 3300009098 Bacteria 1091
253 Ga0105247_10000419 3300009101 Bacteria 36032
254 Ga0105247_10000705 3300009101 Bacteria 26025
255 Ga0105247_10293332 3300009101 Bacteria 1126
256 Ga0114129_10003490 3300009147 Bacteria 22112
257 Ga0114129_10007054 3300009147 Bacteria 15997
258 Ga0114129_10065912 3300009147 Bacteria 5052
259 Ga0114129_10086903 3300009147 Bacteria 4336
260 Ga0114129_10203693 3300009147 Bacteria 2678
261 Ga0114129_10396049 3300009147 Bacteria 1821
262 Ga0114129_10429735 3300009147 Bacteria 1735
263 Ga0114129_10939751 3300009147 Bacteria 1093
264 Ga0105243_10302435 3300009148 Bacteria 1450
265 Ga0105243_10629321 3300009148 Bacteria 1037
266 Ga0105241_10000236 3300009174 Bacteria 41893
267 Ga0105241_10000876 3300009174 Bacteria 22778
268 Ga0105241_10049206 3300009174 Bacteria 3209
269 Ga0105241_10085093 3300009174 Bacteria 2484
270 Ga0105241_10111086 3300009174 Bacteria 2194
271 Ga0105241_10111491 3300009174 Bacteria 2190
272 Ga0105241_10198588 3300009174 Unclassified 1674
273 Ga0105241_10249516 3300009174 Bacteria 1504
274 Ga0105242_10000994 3300009176 Bacteria 22207
275 Ga0105242_10066502 3300009176 Bacteria 2977
276 Ga0105242_10073061 3300009176 Bacteria 2850
277 Ga0105242_10303734 3300009176 Bacteria 1458
278 Ga0105242_10352713 3300009176 Bacteria 1359
279 Ga0105248_10001452 3300009177 Bacteria 26385
280 Ga0105248_10003640 3300009177 Bacteria 17111
281 Ga0105248_10017256 3300009177 Bacteria 7954
282 Ga0105248_10059934 3300009177 Bacteria 4275
283 Ga0105248_10177580 3300009177 Bacteria 2400
284 Ga0105248_10503619 3300009177 Bacteria 1365
285 Ga0105237_10000607 3300009545 Bacteria 49998
286 Ga0105237_10003722 3300009545 Bacteria 17960
287 Ga0105237_10004802 3300009545 Bacteria 15528
288 Ga0105237_10108163 3300009545 Bacteria 2772
289 Ga0105237_10109467 3300009545 Bacteria 2755
290 Ga0105238_10000332 3300009551 Bacteria 51604
291 Ga0105238_10001334 3300009551 Bacteria 24769
292 Ga0105238_10003045 3300009551 Bacteria 16718
293 Ga0105238_10003716 3300009551 Bacteria 15185
294 Ga0105238_10011626 3300009551 Bacteria 8867
295 Ga0105238_10019773 3300009551 Bacteria 6856
296 Ga0105238_10020974 3300009551 Bacteria 6657
297 Ga0105238_10027134 3300009551 Bacteria 5837
298 Ga0105238_10180525 3300009551 Bacteria 2088
299 Ga0105238_10590569 3300009551 Bacteria 1118
300 Ga0105249_10000897 3300009553 Bacteria 26313
301 Ga0105249_10151207 3300009553 Bacteria 2235
302 Ga0105249_10493407 3300009553 Unclassified 1269
303 Ga0105239_10001070 3300010375 Bacteria 38047
304 Ga0105239_10006507 3300010375 Bacteria 13544
305 Ga0105239_10008238 3300010375 Bacteria 11886
306 Ga0105239_10014870 3300010375 Bacteria 8628
307 Ga0105239_10039009 3300010375 Bacteria 5203
308 Ga0105239_10065685 3300010375 Bacteria 3985
309 Ga0105239_10075102 3300010375 Bacteria 3716
310 Ga0105239_10140092 3300010375 Bacteria 2695
311 Ga0105239_10151474 3300010375 Unclassified 2588
312 Ga0105239_10492132 3300010375 Bacteria 1394
313 Ga0105239_10993573 3300010375 Bacteria 965
314 Ga0105246_10001976 3300011119 Bacteria 12363
315 Ga0105246_10247614 3300011119 Bacteria 1412
316 Ga0157373_10053796 3300013100 Bacteria 2862
317 Ga0157370_10000003 3300013104 Bacteria 367417
318 Ga0157370_10813845 3300013104 Bacteria 850
319 Ga0157369_10001336 3300013105 Bacteria 30468
320 Ga0157369_10001406 3300013105 Bacteria 29579
321 Ga0157369_10002432 3300013105 Bacteria 22368
322 Ga0157369_10134016 3300013105 Bacteria 2623
323 Ga0157374_10007610 3300013296 Bacteria 9245
324 Ga0157374_10007832 3300013296 Bacteria 9119
325 Ga0157374_10008356 3300013296 Bacteria 8841
326 Ga0157374_10032674 3300013296 Bacteria 4740
327 Ga0157374_10038494 3300013296 Bacteria 4396
328 Ga0157374_10220809 3300013296 Unclassified 1860
329 Ga0157374_10251522 3300013296 Bacteria 1739
330 Ga0157374_10347980 3300013296 Bacteria 1472
331 Ga0157374_10570362 3300013296 Bacteria 1140
332 Ga0157374_10876969 3300013296 Bacteria 915
333 Ga0157378_10004490 3300013297 Bacteria 12249
334 Ga0157378_10044280 3300013297 Bacteria 3952
335 Ga0157378_10083281 3300013297 Bacteria 2894
336 Ga0157378_10261305 3300013297 Bacteria 1661
337 Ga0163162_10000207 3300013306 Bacteria 54515
338 Ga0163162_10002925 3300013306 Bacteria 16285
339 Ga0163162_10473143 3300013306 Bacteria 1384
340 Ga0157372_10000482 3300013307 Bacteria 44071
341 Ga0157372_10009981 3300013307 Bacteria 10099
342 Ga0157372_10124067 3300013307 Unclassified 2969
343 Ga0157372_10144260 3300013307 Unclassified 2746
344 Ga0157375_10017482 3300013308 Bacteria 6472
345 Ga0157375_10151335 3300013308 Bacteria 2456
346 Ga0157375_10235330 3300013308 Bacteria 1991
347 Ga0157375_10275291 3300013308 Bacteria 1845
348 Ga0157375_10442933 3300013308 Bacteria 1465
349 Ga0157375_10580202 3300013308 Bacteria 1282
350 Ga0163163_10003816 3300014325 Bacteria 12841
351 Ga0163163_10008980 3300014325 Bacteria 8906
352 Ga0163163_10131114 3300014325 Bacteria 2547
353 Ga0163163_10233912 3300014325 Unclassified 1887
354 Ga0163163_10746429 3300014325 Bacteria 1042
355 Ga0157379_10000580 3300014968 Bacteria 29631
356 Ga0157379_10003472 3300014968 Bacteria 13341
357 Ga0157379_10148140 3300014968 Bacteria 2117
358 Ga0157376_10000008 3300014969 Bacteria 351192
359 Ga0157376_10019251 3300014969 Bacteria 5256
360 Ga0157376_10036898 3300014969 Bacteria 3962
361 Ga0157376_10515924 3300014969 Bacteria 1177
362 Ga0209563_109893 3300025230 Bacteria 1422
363 Ga0209646_1000017 3300025246 Bacteria 488265
364 Ga0209026_1000196 3300025250 Bacteria 84284
365 Ga0209677_107140 3300025253 Bacteria 2448
366 Ga0209758_1003363 3300025297 Bacteria 14655
367 Ga0209758_1003511 3300025297 Bacteria 14157
368 Ga0207426_1000279 3300025302 Bacteria 105187
369 Ga0207426_1001701 3300025302 Bacteria 16936
370 Ga0209257_1000447 3300025304 Bacteria 77552
371 Ga0207697_10000005 3300025315 Bacteria 85907
372 Ga0207656_10069611 3300025321 Bacteria 1561
373 Ga0207656_10098863 3300025321 Bacteria 1335
374 Ga0207642_10088454 3300025899 Bacteria 1524
375 Ga0207710_10176211 3300025900 Bacteria 1047
376 Ga0207680_10000062 3300025903 Bacteria 48850
377 Ga0207647_10081520 3300025904 Bacteria 1939
378 Ga0207699_10001086 3300025906 Bacteria 12839
379 Ga0207705_10183543 3300025909 Bacteria 1580
380 Ga0207705_10276190 3300025909 Bacteria 1285
381 Ga0207705_10323445 3300025909 Bacteria 1185
382 Ga0207684_10000062 3300025910 Bacteria 202863
383 Ga0207684_10000134 3300025910 Bacteria 133720
384 Ga0207684_10016373 3300025910 Bacteria 6368
385 Ga0207684_10067520 3300025910 Bacteria 3039
386 Ga0207684_10071306 3300025910 Bacteria 2952
387 Ga0207684_10128142 3300025910 Bacteria 2178
388 Ga0207684_10148855 3300025910 Bacteria 2014
389 Ga0207684_10208837 3300025910 Bacteria 1684
390 Ga0207654_10000114 3300025911 Bacteria 51955
391 Ga0207654_10000167 3300025911 Bacteria 41661
392 Ga0207654_10000601 3300025911 Bacteria 20297
393 Ga0207654_10027681 3300025911 Bacteria 3083
394 Ga0207654_10089813 3300025911 Bacteria 1870
395 Ga0207654_10137032 3300025911 Bacteria 1556
396 Ga0207654_10189108 3300025911 Bacteria 1348
397 Ga0207707_10022166 3300025912 Bacteria 5552
398 Ga0207707_10093022 3300025912 Bacteria 2634
399 Ga0207695_10000059 3300025913 Bacteria 363920
400 Ga0207695_10000129 3300025913 Bacteria 225939
401 Ga0207695_10000194 3300025913 Bacteria 171422
402 Ga0207695_10000428 3300025913 Bacteria 93076
403 Ga0207695_10000696 3300025913 Bacteria 65853
404 Ga0207695_10015961 3300025913 Bacteria 8816
405 Ga0207695_10054324 3300025913 Bacteria 4184
406 Ga0207695_10175792 3300025913 Bacteria 2064
407 Ga0207695_10400478 3300025913 Bacteria 1257
408 Ga0207671_10000221 3300025914 Bacteria 85673
409 Ga0207671_10000805 3300025914 Bacteria 39642
410 Ga0207671_10002131 3300025914 Bacteria 21605
411 Ga0207671_10094042 3300025914 Bacteria 2262
412 Ga0207671_10225227 3300025914 Bacteria 1470
413 Ga0207671_10314305 3300025914 Unclassified 1239
414 Ga0207693_10193481 3300025915 Bacteria 1600
415 Ga0207663_10020527 3300025916 Bacteria 3743
416 Ga0207657_10091833 3300025919 Bacteria 2531
417 Ga0207649_10005714 3300025920 Bacteria 6732
418 Ga0207649_10006733 3300025920 Bacteria 6243
419 Ga0207649_10109951 3300025920 Bacteria 1839
420 Ga0207652_10385513 3300025921 Bacteria 1265
421 Ga0207652_10547690 3300025921 Bacteria 1040
422 Ga0207646_10003284 3300025922 Bacteria 18418
423 Ga0207646_10023859 3300025922 Bacteria 5613
424 Ga0207646_10026024 3300025922 Bacteria 5347
425 Ga0207646_10042291 3300025922 Bacteria 4093
426 Ga0207681_10000004 3300025923 Bacteria 559005
427 Ga0207681_10017272 3300025923 Bacteria 4529
428 Ga0207694_10000036 3300025924 Bacteria 194034
429 Ga0207694_10000602 3300025924 Bacteria 32538
430 Ga0207694_10001006 3300025924 Bacteria 24616
431 Ga0207694_10005288 3300025924 Bacteria 9947
432 Ga0207694_10006876 3300025924 Bacteria 8641
433 Ga0207694_10097045 3300025924 Bacteria 2331
434 Ga0207694_10151252 3300025924 Bacteria 1870
435 Ga0207694_10267306 3300025924 Bacteria 1402
436 Ga0207694_10280286 3300025924 Bacteria 1369
437 Ga0207694_10535772 3300025924 Bacteria 982
438 Ga0207650_10000432 3300025925 Bacteria 36576
439 Ga0207650_10000919 3300025925 Bacteria 22217
440 Ga0207650_10309619 3300025925 Bacteria 1291
441 Ga0207687_10004559 3300025927 Bacteria 9221
442 Ga0207687_10133000 3300025927 Bacteria 1878
443 Ga0207687_10333075 3300025927 Bacteria 1232
444 Ga0207687_10399892 3300025927 Bacteria 1130
445 Ga0207700_10383277 3300025928 Bacteria 1230
446 Ga0207700_10830296 3300025928 Bacteria 827
447 Ga0207664_10064179 3300025929 Bacteria 2936
448 Ga0207644_10000024 3300025931 Bacteria 154283
449 Ga0207644_10001597 3300025931 Bacteria 14631
450 Ga0207644_10017485 3300025931 Bacteria 4843
451 Ga0207644_10037783 3300025931 Bacteria 3399
452 Ga0207644_10260312 3300025931 Bacteria 1387
453 Ga0207690_10035980 3300025932 Bacteria 3203
454 Ga0207686_10010450 3300025934 Bacteria 5055
455 Ga0207686_10019144 3300025934 Bacteria 3888
456 Ga0207686_10096300 3300025934 Bacteria 1966
457 Ga0207709_10237882 3300025935 Bacteria 1323
458 Ga0207669_10370352 3300025937 Bacteria 1113
459 Ga0207704_10002724 3300025938 Bacteria 7971
460 Ga0207704_10006060 3300025938 Bacteria 5604
461 Ga0207665_10005224 3300025939 Bacteria 8671
462 Ga0207665_10093799 3300025939 Bacteria 2084
463 Ga0207691_10276502 3300025940 Bacteria 1445
464 Ga0207711_10005653 3300025941 Bacteria 10564
465 Ga0207711_10006162 3300025941 Bacteria 10135
466 Ga0207711_10009617 3300025941 Bacteria 8057
467 Ga0207711_10060389 3300025941 Bacteria 3267
468 Ga0207711_10079812 3300025941 Bacteria 2857
469 Ga0207711_10289612 3300025941 Bacteria 1509
470 Ga0207711_10299587 3300025941 Bacteria 1483
471 Ga0207689_10000211 3300025942 Bacteria 51556
472 Ga0207689_10001823 3300025942 Bacteria 20138
473 Ga0207661_10001902 3300025944 Bacteria 14322
474 Ga0207661_10111957 3300025944 Bacteria 2310
475 Ga0207661_10176782 3300025944 Bacteria 1862
476 Ga0207661_10395156 3300025944 Bacteria 1253
477 Ga0207661_10434743 3300025944 Bacteria 1193
478 Ga0207679_10022496 3300025945 Bacteria 4295
479 Ga0207679_10140225 3300025945 Bacteria 1953
480 Ga0207679_10251056 3300025945 Unclassified 1504
481 Ga0207667_10000507 3300025949 Bacteria 51449
482 Ga0207667_10001798 3300025949 Bacteria 27011
483 Ga0207667_10003545 3300025949 Bacteria 19302
484 Ga0207667_10111796 3300025949 Bacteria 2817
485 Ga0207667_10371762 3300025949 Bacteria 1457
486 Ga0207712_10136873 3300025961 Bacteria 1874
487 Ga0207712_10785062 3300025961 Bacteria 836
488 Ga0207668_10000121 3300025972 Bacteria 54684
489 Ga0207640_10148197 3300025981 Bacteria 1720
490 Ga0207640_10266142 3300025981 Bacteria 1339
491 Ga0207658_10000782 3300025986 Bacteria 27180
492 Ga0207677_10000791 3300026023 Bacteria 18120
493 Ga0207703_10001222 3300026035 Bacteria 24015
494 Ga0207703_10044183 3300026035 Bacteria 3580
495 Ga0207703_10189561 3300026035 Bacteria 1820
496 Ga0207703_10789826 3300026035 Bacteria 906
497 Ga0207639_10000049 3300026041 Bacteria 124603
498 Ga0207639_10025400 3300026041 Bacteria 4295
499 Ga0207639_10251094 3300026041 Bacteria 1542
500 Ga0207639_10391627 3300026041 Bacteria 1250
501 Ga0207639_10494943 3300026041 Bacteria 1116
502 Ga0207678_10116124 3300026067 Bacteria 2283
503 Ga0207708_10000054 3300026075 Bacteria 103599
504 Ga0207708_10180638 3300026075 Bacteria 1675
505 Ga0207702_10003184 3300026078 Bacteria 15173
506 Ga0207702_10005573 3300026078 Bacteria 10997
507 Ga0207702_10005904 3300026078 Bacteria 10648
508 Ga0207702_10094371 3300026078 Bacteria 2626
509 Ga0207702_10235905 3300026078 Unclassified 1711
510 Ga0207641_10000443 3300026088 Bacteria 47443
511 Ga0207641_10001096 3300026088 Bacteria 27229
512 Ga0207641_10001319 3300026088 Bacteria 24549
513 Ga0207641_10042261 3300026088 Bacteria 3824
514 Ga0207648_10001703 3300026089 Bacteria 24050
515 Ga0207648_10072751 3300026089 Bacteria 2996
516 Ga0207648_10301092 3300026089 Bacteria 1438
517 Ga0207676_10042854 3300026095 Bacteria 3481
518 Ga0207676_10132522 3300026095 Bacteria 2121
519 Ga0207676_10275553 3300026095 Bacteria 1525
520 Ga0207676_10451140 3300026095 Bacteria 1212
521 Ga0207674_10001069 3300026116 Bacteria 35647
522 Ga0207674_10025752 3300026116 Bacteria 6265
523 Ga0207674_10045501 3300026116 Bacteria 4514
524 Ga0207674_10066687 3300026116 Bacteria 3624
525 Ga0207674_10143410 3300026116 Bacteria 2347
526 Ga0207674_10173762 3300026116 Bacteria 2107
527 Ga0207674_10247375 3300026116 Bacteria 1730
528 Ga0207675_100000028 3300026118 Bacteria 109884
529 Ga0207683_10071303 3300026121 Bacteria 3071
530 Ga0207698_10000027 3300026142 Bacteria 119295
531 Ga0207698_10000037 3300026142 Bacteria 103991
532 Ga0207698_10002184 3300026142 Bacteria 11581
533 Ga0209588_1000020 3300027671 Bacteria 93596
534 Ga0207428_10000314 3300027907 Bacteria 64160
535 Ga0207428_10283567 3300027907 Bacteria 1229
536 Ga0268266_10000226 3300028379 Bacteria 97913
537 Ga0268266_10000859 3300028379 Bacteria 39577
538 Ga0268266_10065148 3300028379 Bacteria 3150
539 Ga0268266_10077410 3300028379 Bacteria 2892
540 Ga0268266_10236872 3300028379 Bacteria 1683
541 Ga0268266_10414662 3300028379 Bacteria 1275
542 Ga0268265_10000046 3300028380 Bacteria 179361
543 Ga0268265_10116671 3300028380 Bacteria 2191
544 Ga0268265_10330097 3300028380 Bacteria 1385
545 Ga0268264_10000180 3300028381 Bacteria 134339
546 Ga0268264_10007721 3300028381 Bacteria 8960
547 Ga0268264_10368694 3300028381 Bacteria 1372
548 Ga0268264_10369439 3300028381 Bacteria 1371
549 Ga0268264_10868456 3300028381 Bacteria 904
550 Ga0265326_10022631 3300028558 Bacteria 1799
551 Ga0265319_1007674 3300028563 Bacteria 4818
552 Ga0265318_10056705 3300028577 Bacteria 1464
553 Ga0265323_10051918 3300028653 Bacteria 1452
554 Ga0265336_10000350 3300028666 Bacteria 30111
555 Ga0307515_10000008 3300028794 Bacteria 663660
556 Ga0265338_10000086 3300028800 Bacteria 175026
557 Ga0265338_10000160 3300028800 Bacteria 122713
558 Ga0265338_10082988 3300028800 Unclassified 2682
559 Ga0265338_10154894 3300028800 Bacteria 1776
560 Ga0265338_10183859 3300028800 Bacteria 1591
561 Ga0265324_10012189 3300029957 Bacteria 3251
562 Ga0265324_10025764 3300029957 Bacteria 2083
563 Ga0265765_1003956 3300030879 Bacteria 1507
564 Ga0265330_10045318 3300031235 Bacteria 1939
565 Ga0265330_10050899 3300031235 Bacteria 1816
566 Ga0265332_10049301 3300031238 Bacteria 1811
567 Ga0265328_10040231 3300031239 Bacteria 1723
568 Ga0265320_10087257 3300031240 Bacteria 1449
569 Ga0265325_10028791 3300031241 Bacteria 2990
570 Ga0265340_10082455 3300031247 Bacteria 1512
571 Ga0265340_10150446 3300031247 Bacteria 1061
572 Ga0265327_10001103 3300031251 Bacteria 37426
573 Ga0265316_10065636 3300031344 Bacteria 2811
574 Ga0265316_10132163 3300031344 Bacteria 1879
575 Ga0265313_10025006 3300031595 Bacteria 3175
576 Ga0307508_10000214 3300031616 Bacteria 70115
577 Ga0265314_10002933 3300031711 Bacteria 16916
578 Ga0265314_10003720 3300031711 Bacteria 14594
579 Ga0265314_10037211 3300031711 Bacteria 3529
580 Ga0265314_10093037 3300031711 Bacteria 1958
581 Ga0265314_10170609 3300031711 Bacteria 1314
582 Ga0265342_10008129 3300031712 Bacteria 7573
583 Ga0265342_10124122 3300031712 Bacteria 1451
584 Ga0307516_10023011 3300031730 Bacteria 6393
585 Ga0307516_10037947 3300031730 Bacteria 4812
586 Ga0307516_10406724 3300031730 Bacteria 1020
587 Ga0307413_10345528 3300031824 Bacteria 1146
588 Ga0307410_10190105 3300031852 Bacteria 1561
589 Ga0307510_10000955 3300033180 Bacteria 30549
590 Ga0373940_0020682 3300035088 Bacteria 1675
591 Ga0373923_0088850 3300035111 Unclassified 1349
592 Ga0373953_0218019 3300035117 Bacteria 826
593 Ga0373954_0003984 3300035118 Bacteria 6312
594 Ga0373957_0033066 3300035120 Bacteria 1909
595 Ga0373955_0026260 3300035172 Bacteria 2998
596 Ga0373962_0029082 3300035242 Bacteria 1504
597 Ga0373924_0072171 3300035410 Bacteria 1458
598 Ga0373931_0007102 3300035691 Bacteria 5266
599 Ga0373933_0010365 3300035724 Bacteria 5109
600 Ga0373937_0008928 3300036401 Bacteria 8703
601 Ga0373937_0024449 3300036401 Bacteria 5449
602 Ga0373937_0484509 3300036401 Bacteria 1175
603 Ga0373937_0608921 3300036401 Bacteria 1037
604 Ga0373925_0004993 3300037068 Bacteria 9960
605 Ga0373925_0236564 3300037068 Bacteria 1462
606 Ga0395900_0115765 3300037418 Bacteria 2751
607 Ga0395900_0511921 3300037418 Bacteria 1149
608 Ga0395900_0569018 3300037418 Bacteria 1076
609 Ga0395898_0241088 3300037466 Bacteria 1724
610 Ga0395898_0495101 3300037466 Bacteria 1163
611 Ga0436365_0923788 3300039437 Bacteria 1385
612 Ga0436365_1874016 3300039437 Bacteria 1973
613 Ga0436361_1204031 3300039447 Bacteria 2707
614 Ga0439459_0005415 3300042438 Bacteria 2098
615 Ga0451577_0050187 3300042876 Bacteria 3725
616 Ga0451577_0052904 3300042876 Bacteria 3626
617 Ga0451577_0054652 3300042876 Bacteria 3564
618 Ga0466972_0019787 3300044658 Bacteria 3365
619 Ga0453683_0098308 3300044673 Bacteria 1837
620 Ga0466963_0025955 3300044694 Bacteria 3742
621 Ga0453684_0000185 3300044712 Bacteria 274418
622 Ga0453684_0048166 3300044712 Bacteria 5641
623 Ga0453684_0179472 3300044712 Bacteria 2487
624 Ga0466960_0130493 3300044901 Bacteria 1325
625 Ga0451576_0393709 3300045051 Bacteria 1452
626 Ga0466967_0008873 3300045976 Bacteria 7414
627 Ga0466967_0189096 3300045976 Bacteria 1945
628 Ga0495617_078056 3300046452 Bacteria 1086
629 Ga0495627_000711 3300046453 Bacteria 25361
630 Ga0495592_0086088 3300046454 Bacteria 2264
631 Ga0495629_0002619 3300046459 Bacteria 13796
632 Ga0495638_0079331 3300046460 Bacteria 1996
633 Ga0495641_0014302 3300046461 Bacteria 4300
634 Ga0495651_0001592 3300046462 Bacteria 17551
635 Ga0495651_0094285 3300046462 Bacteria 2240
636 Ga0495653_0128098 3300046463 Bacteria 1800
637 Ga0495580_0004204 3300046472 Bacteria 12104
638 Ga0495580_0045352 3300046472 Bacteria 3123
639 Ga0495580_0048120 3300046472 Bacteria 3021
640 Ga0495639_0037568 3300046475 Bacteria 2171
641 Ga0495662_0027324 3300046476 Bacteria 2757
642 Ga0495662_0157580 3300046476 Bacteria 1118
643 Ga0495664_0013202 3300046477 Bacteria 4685
644 Ga0495584_0058278 3300046491 Bacteria 1943
645 Ga0495594_0116450 3300046499 Bacteria 1509
646 Ga0495594_0290816 3300046499 Bacteria 931
647 Ga0495606_0057204 3300046507 Bacteria 2512
648 Ga0495610_0018098 3300046512 Bacteria 3991
649 Ga0495618_0155892 3300046514 Bacteria 1457
650 Ga0495618_0283079 3300046514 Bacteria 1034
651 Ga0495628_0123004 3300046516 Bacteria 1989
652 Ga0495628_0230608 3300046516 Bacteria 1388
653 Ga0495628_0247015 3300046516 Bacteria 1333
654 Ga0495628_0273224 3300046516 Bacteria 1257
655 Ga0495630_0000001 3300046517 Bacteria 1687293
656 Ga0495648_0068879 3300046524 Bacteria 2062
657 Ga0495652_0003794 3300046529 Bacteria 14754
658 Ga0495652_0049165 3300046529 Bacteria 3611
659 Ga0495652_0120401 3300046529 Bacteria 2095
660 Ga0495652_0162238 3300046529 Bacteria 1734
661 Ga0495587_0012596 3300046536 Bacteria 5319
662 Ga0495587_0127901 3300046536 Bacteria 1453
663 Ga0495645_0137711 3300046543 Bacteria 1706
664 Ga0495645_0162428 3300046543 Bacteria 1543
665 Ga0495667_0007233 3300046559 Bacteria 7534
666 Ga0495667_0018550 3300046559 Unclassified 4700
667 Ga0495667_0046646 3300046559 Bacteria 2865
668 Ga0495667_0388400 3300046559 Bacteria 880
669 Ga0495668_0076166 3300046616 Bacteria 1842
670 Ga0495634_0129520 3300046642 Bacteria 1610
671 Ga0495634_0176238 3300046642 Bacteria 1341
672 Ga0495625_0079449 3300046660 Bacteria 2287
673 Ga0495625_0188374 3300046660 Bacteria 1368
674 Ga0495625_0271206 3300046660 Bacteria 1095
675 Ga0495635_0001132 3300046663 Bacteria 17770
676 Ga0495635_0022927 3300046663 Bacteria 4352
677 Ga0495659_0042771 3300046664 Bacteria 1623
678 Ga0495588_0016886 3300046674 Bacteria 3535
679 Ga0495657_0027407 3300046675 Bacteria 4021
680 Ga0495657_0033401 3300046675 Bacteria 3582
681 Ga0495599_0077050 3300046678 Bacteria 2082
682 Ga0495599_0148560 3300046678 Bacteria 1452
683 Ga0495599_0184565 3300046678 Bacteria 1285
684 Ga0495623_0010103 3300046679 Bacteria 6110
685 Ga0495623_0026832 3300046679 Bacteria 3707
686 Ga0495646_0031794 3300046680 Bacteria 3287
687 Ga0495646_0077375 3300046680 Bacteria 1946
688 Ga0495613_0011390 3300046689 Bacteria 6608
689 Ga0495613_0123028 3300046689 Bacteria 1862
690 Ga0495613_0126713 3300046689 Bacteria 1831
691 Ga0495613_0396913 3300046689 Bacteria 941
692 Ga0495670_0031961 3300046691 Bacteria 2616
693 Ga0495649_0090461 3300046694 Bacteria 1632
694 Ga0495589_0006775 3300046794 Bacteria 6034
695 Ga0495589_0152526 3300046794 Bacteria 1103
696 Ga0495600_0001360 3300046809 Bacteria 13506
697 Ga0495600_0105185 3300046809 Bacteria 1839
698 Ga0495581_0136911 3300047315 Bacteria 1428
699 Ga0495604_0008401 3300047317 Bacteria 8161
700 Ga0495604_0277004 3300047317 Bacteria 1134
701 Ga0495674_0021099 3300047319 Bacteria 6027
702 Ga0495674_0090827 3300047319 Bacteria 2609
703 Ga0495674_0324017 3300047319 Bacteria 1255
704 Ga0495672_0008826 3300047320 Bacteria 7379
705 Ga0495676_0018510 3300047321 Bacteria 6142
706 Ga0495676_0124706 3300047321 Unclassified 1868
707 Ga0495680_0004905 3300047322 Bacteria 12674
708 Ga0495680_0417871 3300047322 Bacteria 923
709 Ga0495683_0054075 3300047323 Bacteria 2002
710 Ga0495675_0018271 3300047444 Bacteria 4450
711 Ga0495679_007235 3300047446 Bacteria 4656
712 Ga0495684_0000364 3300047471 Bacteria 36846
713 Ga0495684_0022288 3300047471 Bacteria 4876
714 Ga0495684_0026426 3300047471 Bacteria 4462
715 Ga0495684_0074058 3300047471 Bacteria 2587
716 Ga0495684_0308365 3300047471 Bacteria 1135
717 Ga0495686_0050683 3300047472 Bacteria 2608
718 Ga0495686_0111680 3300047472 Bacteria 1638
719 Ga0495686_0218786 3300047472 Bacteria 1084
720 Ga0495593_0029368 3300047673 Bacteria 3015
721 Ga0495602_0005811 3300048088 Bacteria 12950
722 Ga0495602_0049129 3300048088 Bacteria 3782
723 Ga0495602_0060836 3300048088 Bacteria 3288
724 Ga0495602_0064361 3300048088 Bacteria 3171
725 Ga0496102_0005344 3300048905 Bacteria 10902
726 Ga0496102_0747258 3300048905 Bacteria 901
727 Ga0496104_0006263 3300048907 Bacteria 10459
728 Ga0496104_0021646 3300048907 Bacteria 5904
729 Ga0496105_0018216 3300048908 Bacteria 5639
730 Ga0496105_0075831 3300048908 Bacteria 2777
731 Ga0496106_0431044 3300048909 Bacteria 1059
732 Ga0496108_0345187 3300048911 Bacteria 1299
733 Ga0496109_0514494 3300048912 Bacteria 1130
734 Ga0496109_0710264 3300048912 Bacteria 943
735 Ga0496114_0232128 3300048917 Bacteria 1621
736 Ga0496115_0002166 3300048918 Bacteria 14052
737 Ga0496115_0011264 3300048918 Bacteria 6701
738 Ga0496116_0005936 3300048919 Bacteria 11199
739 Ga0496117_0022494 3300048920 Bacteria 5054
740 Ga0496118_0009619 3300048921 Bacteria 9729
741 Ga0496118_0028759 3300048921 Bacteria 4674
742 Ga0496119_0014813 3300048922 Bacteria 6067
743 Ga0496119_0133575 3300048922 Bacteria 1349
744 Ga0496120_0014944 3300048923 Bacteria 5144
745 Ga0496120_0020206 3300048923 Bacteria 4240
746 Ga0496121_0013413 3300048924 Bacteria 8809
747 Ga0496121_0019990 3300048924 Bacteria 6661
748 Ga0496121_0021352 3300048924 Bacteria 6345
749 Ga0496122_0072136 3300048925 Bacteria 2456
750 Ga0496124_0001004 3300048927 Bacteria 44711
751 Ga0496124_0204807 3300048927 Bacteria 1497
752 Ga0496124_0247149 3300048927 Bacteria 1322
753 Ga0496125_0000092 3300048928 Bacteria 211050
754 Ga0496125_0002341 3300048928 Bacteria 24847
755 Ga0496125_0006440 3300048928 Bacteria 12690
756 Ga0496125_0163445 3300048928 Bacteria 1508
757 Ga0496126_0036454 3300048929 Bacteria 4598
758 Ga0496126_0038039 3300048929 Bacteria 4479
759 Ga0501031_0001375 3300049568 Bacteria 15032
760 Ga0501032_0006786 3300049569 Bacteria 8400
761 Ga0501033_0003741 3300049570 Bacteria 12372
762 Ga0501034_0000831 3300049571 Bacteria 45945
763 Ga0501034_0005434 3300049571 Bacteria 13930
764 Ga0501034_0044153 3300049571 Bacteria 4508
765 Ga0501034_0263329 3300049571 Bacteria 1666
766 Ga0501036_0012120 3300049572 Bacteria 7146
767 Ga0501037_0004091 3300049573 Bacteria 10573
768 Ga0501037_0009808 3300049573 Bacteria 7028
769 Ga0501038_0000073 3300049574 Bacteria 83508
770 Ga0501038_0060624 3300049574 Bacteria 3237
771 Ga0501039_0004136 3300049575 Bacteria 10917
772 Ga0501039_0105628 3300049575 Bacteria 2199
773 Ga0501040_0483300 3300049576 Bacteria 892
774 Ga0501042_0062937 3300049578 Bacteria 2651
775 Ga0501043_0000609 3300049579 Bacteria 31671
776 Ga0501043_0035977 3300049579 Bacteria 3894
777 Ga0501043_0123461 3300049579 Bacteria 2031
778 Ga0501046_0000020 3300049580 Bacteria 218268
779 Ga0501046_0000911 3300049580 Bacteria 28909
780 Ga0501046_0008367 3300049580 Bacteria 9022
781 Ga0501047_0009250 3300049581 Bacteria 9304
782 Ga0501047_0037175 3300049581 Bacteria 4707
783 Ga0501047_0058858 3300049581 Bacteria 3711
784 Ga0501047_0113673 3300049581 Bacteria 2590
785 Ga0501048_0000276 3300049582 Bacteria 34594
786 Ga0501048_0022094 3300049582 Bacteria 4655
787 Ga0501067_0002927 3300049583 Bacteria 9412
788 Ga0501069_0002719 3300049585 Bacteria 9028
789 Ga0501069_0012510 3300049585 Bacteria 4514
790 Ga0501070_0003152 3300049586 Bacteria 14359
791 Ga0501070_0027889 3300049586 Bacteria 4737
792 Ga0501070_0326634 3300049586 Bacteria 1247
793 Ga0501071_0163128 3300049587 Bacteria 1666
794 Ga0501072_0014591 3300049588 Bacteria 6022
795 Ga0501072_0089696 3300049588 Bacteria 2441
796 Ga0501073_0009784 3300049589 Bacteria 7057
797 Ga0501073_0017715 3300049589 Bacteria 5156
798 Ga0501074_0003592 3300049590 Bacteria 11011
799 Ga0501074_0159383 3300049590 Bacteria 1611
800 Ga0501079_0003469 3300049741 Bacteria 11592
801 Ga0501080_0091317 3300049742 Bacteria 2828
802 Ga0501080_0100647 3300049742 Bacteria 2681
803 Ga0501080_0388270 3300049742 Bacteria 1257
804 Ga0501083_0000005 3300049744 Bacteria 206200
805 Ga0501083_0011237 3300049744 Bacteria 6283
806 Ga0501083_0125575 3300049744 Bacteria 1682
807 Ga0501035_0058520 3300049822 Bacteria 3433
808 Ga0501035_0172775 3300049822 Bacteria 1866
809 Ga0501035_0465833 3300049822 Bacteria 1044
810 Ga0501044_0031001 3300049823 Bacteria 5629
811 Ga0501044_0058302 3300049823 Bacteria 3960
812 Ga0501044_0206932 3300049823 Bacteria 1918
813 nmdc:mga00v17_9282_c1 3300050491 Bacteria 5318
814 nmdc:mga0yw44_13180_c1 3300050492 Bacteria 4343
815 nmdc:mga0yw44_5651_c1 3300050492 Bacteria 5948
816 nmdc:mga05p37_36371_c1 3300050507 Bacteria 6041
817 nmdc:mga05p37_502743_c1 3300050507 Bacteria 1391
818 nmdc:mga05p37_573042_c1 3300050507 Bacteria 1280
819 nmdc:mga05p37_81121_c1 3300050507 Bacteria 3996
820 nmdc:mga05p37_8360_c2 3300050507 Bacteria 6613
821 nmdc:mga09592_18178_c1 3300050508 Bacteria 5764
822 nmdc:mga0qj67_99338_c1 3300050509 Bacteria 2345
823 nmdc:mga06r32_125328_c1 3300050510 Bacteria 2536
824 nmdc:mga06r32_148299_c1 3300050510 Bacteria 2323
825 nmdc:mga06r32_33075_c1 3300050510 Bacteria 4869
826 nmdc:mga06r32_432487_c1 3300050510 Bacteria 1297
827 nmdc:mga06r32_8053_c1 3300050510 Bacteria 9484
828 nmdc:mga08y16_359779_c1 3300050511 Bacteria 1494
829 nmdc:mga08y16_3745_c1 3300050511 Bacteria 15833
830 nmdc:mga0n895_102632_c1 3300050512 Bacteria 2871
831 nmdc:mga0n895_175808_c1 3300050512 Bacteria 2172
832 nmdc:mga0n895_537280_c1 3300050512 Bacteria 1176
833 nmdc:mga0n895_62033_c1 3300050512 Bacteria 3693
834 nmdc:mga0n895_66565_c1 3300050512 Bacteria 3568
835 nmdc:mga0rr50_185187_c1 3300050513 Bacteria 1704
836 nmdc:mga0rr50_279104_c1 3300050513 Bacteria 1394
837 nmdc:mga0rr50_52726_c1 3300050513 Bacteria 3024
838 nmdc:mga0rr50_769448_c1 3300050513 Bacteria 822
839 nmdc:mga0rr50_89940_c1 3300050513 Bacteria 2388
840 nmdc:mga0a205_114036_c1 3300050515 Bacteria 2601
841 nmdc:mga0a205_11548_c1 3300050515 Bacteria 8137
842 nmdc:mga0a205_37316_c1 3300050515 Bacteria 4673
843 nmdc:mga0a205_56692_c1 3300050515 Bacteria 3782
844 nmdc:mga0a205_94617_c1 3300050515 Bacteria 2886
845 nmdc:mga0sz30_1962_c1 3300050516 Bacteria 7360
846 Ga0500635_0021659 3300053080 Bacteria 1983
847 Ga0500578_0037339 3300053086 Bacteria 3120
848 Ga0500643_000048 3300053087 Bacteria 147879
849 Ga0500643_022191 3300053087 Bacteria 2047
850 Ga0500644_0005789 3300053088 Bacteria 3133
851 Ga0500581_032426 3300053089 Bacteria 2674
852 Ga0500646_0072437 3300053090 Bacteria 1036
853 Ga0500651_0046502 3300053093 Bacteria 2730
854 Ga0500566_0000466 3300053094 Bacteria 22535
855 Ga0500566_0014261 3300053094 Bacteria 4673
856 Ga0500640_114588 3300053095 Bacteria 1091
857 Ga0500648_171458 3300053097 Bacteria 1129
858 Ga0500650_0254473 3300053098 Bacteria 787
859 Ga0500555_003969 3300053103 Bacteria 4202
860 Ga0500556_0000024 3300053104 Bacteria 167556
861 Ga0500556_0007119 3300053104 Bacteria 3196
862 Ga0500557_000355 3300053105 Bacteria 5998
863 Ga0500562_006937 3300053108 Bacteria 2858
864 Ga0500569_076333 3300053109 Bacteria 1064
865 Ga0500572_007323 3300053111 Bacteria 2554
866 Ga0500593_026264 3300053117 Bacteria 2594
867 Ga0500595_027716 3300053119 Bacteria 1937
868 Ga0500607_012481 3300053121 Bacteria 4984
869 Ga0500608_014653 3300053122 Bacteria 3505
870 Ga0500618_003931 3300053125 Bacteria 4934
871 Ga0500642_0000035 3300053130 Bacteria 106656
872 Ga0500642_0012927 3300053130 Bacteria 3047
873 Ga0500652_000134 3300053131 Bacteria 27819
874 Ga0500658_0049494 3300053134 Bacteria 1713
875 Ga0500658_0158252 3300053134 Bacteria 1024
876 Ga0500559_0002381 3300053136 Bacteria 9790
877 Ga0500559_0019519 3300053136 Bacteria 2863
878 Ga0500559_0179752 3300053136 Bacteria 996
879 Ga0500564_070132 3300053138 Bacteria 1581
880 Ga0500577_0001590 3300053142 Bacteria 5816
881 Ga0500590_111728 3300053148 Bacteria 1295
882 Ga0500616_0000122 3300053153 Bacteria 140228
883 Ga0500616_0147834 3300053153 Bacteria 1091
884 Ga0500622_0001726 3300053156 Bacteria 16902
885 Ga0500622_0002746 3300053156 Bacteria 12421
886 Ga0500633_0017745 3300053160 Bacteria 2095
887 Ga0500636_0000080 3300053177 Bacteria 47438
888 Ga0500636_0005624 3300053177 Bacteria 7161
889 Ga0500625_027612 3300053729 Bacteria 2693
890 Ga0500645_033387 3300053730 Bacteria 1540
891 Ga0500596_009867 3300053735 Bacteria 1483
892 Ga0500599_000096 3300053736 Bacteria 8015
893 Ga0500601_000167 3300053737 Bacteria 13797
894 Ga0501084_0023284 3300054114 Bacteria 5171
895 Ga0500661_001708 3300055283 Bacteria 4132
896 2508540056 2508501009 Bacteria 7784016
897 2511123935 2510917020 Bacteria 5657507
898 2513649830 2513237095 Bacteria 8976980
899 2515631695 2515154112 Bacteria 8294334
900 2528851387 2528768022 Bacteria 10457665
901 2603861087 2602042107 Bacteria 6226103
902 2671118159 2667528175 Bacteria 7532676
903 2818240830 2816332527 Bacteria 8933356
904 2819539123 2818991435 Bacteria 5433759
905 2819647998 2818991454 Bacteria 5563326
906 2824605566 2824600985 Bacteria 8488197
907 2824610864 2824609381 Bacteria 8672835
908 2824653915 2824653114 Bacteria 8493680
909 2824663680 2824661429 Bacteria 9877870
910 2842401190 2842395702 Bacteria 6780583
911 2844321525 2844315083 Bacteria 8138177
912 2857528785 2857524615 Bacteria 6615449
913 2874596399 2874590934 Bacteria 8299676
914 2874650386 2874645413 Bacteria 8214782
915 2876776864 2876771140 Bacteria 8287509
916 2876824654 2876818435 Bacteria 8274608
917 2879081001 2879074833 Bacteria 8279565
918 2879106561 2879099564 Bacteria 10442239
919 2879128231 2879127579 Bacteria 8294491
920 2879143526 2879142872 Bacteria 8267021
921 2888387779 2888378607 Bacteria 9652610
922 2888389999 2888388044 Bacteria 7304136
923 2889420898 2889415604 Bacteria 8048700
924 2893068980 2893066018 Bacteria 6158120
925 2903727896 2903727486 Bacteria 8281579
926 2906602620 2906602504 Bacteria 8295279
927 2906631936 2906626472 Bacteria 8826946
928 2922377545
929 2929622329 2929615660 Bacteria 9193770
930 2929630025 2929624759 Bacteria 9339455
931 2932788042 2932784394 Bacteria 9704911
932 2932799473 2932794094 Bacteria 7915132
933 2932805221 2932801729 Bacteria 7987968
934 2932813417 2932809354 Bacteria 9135765
935 2932820114 2932818245 Bacteria 9955613
936 2932832822 2932828146 Bacteria 9745859
937 2933584057 2933577622 Bacteria 9116884
938 2935620307 2935616580 Bacteria 9032984
939 2935640632 2935638405 Bacteria 10015038
940 2935649320 2935648319 Bacteria 8801166
941 2935657908 2935656913 Bacteria 8965014
942 2935668824 2935665750 Bacteria 9571747
943 2935681450 2935675223 Bacteria 9928132
944 2935687132 2935684952 Bacteria 9590419
945 2935696897 2935694250 Bacteria 9291695
946 2935709011 2935703347 Bacteria 10242284
947 2935716820 2935713505 Bacteria 9608509
948 2935723055 2935722832 Bacteria 9608746
949 2935734612 2935732158 Bacteria 9706831
950 2935744597 2935741537 Bacteria 9707219
951 2935753098 2935750917 Bacteria 9590372
952 2935767502 2935760218 Bacteria 9817913
953 2935770147 2935769743 Bacteria 7878163
954 2935777823 2935777560 Bacteria 8077691
955 2935786799 2935785616 Bacteria 7962367
956 2935794853 2935793552 Bacteria 8012592
957 2935804741 2935801545 Bacteria 9301974
958 2935815891 2935810662 Bacteria 9401221
959 2935832138 2935827899 Bacteria 10038562
960 2935841032 2935837841 Bacteria 9454360
961 2935859193 2935855204 Bacteria 9035059
962 2935864377 2935864058 Bacteria 9784707
963 2935875271 2935873716 Bacteria 9632195
964 2935887690 2935883170 Bacteria 7964738
965 2935978280 2935975950 Bacteria 8347125
966 2935985596 2935984226 Bacteria 8302647
967 2935995754 2935992306 Bacteria 9802711
968 2936005665 2936002035 Bacteria 9362176
969 2936012127 2936011229 Bacteria 8801034
970 2936020792 2936019824 Bacteria 8804134
971 2936029420 2936028420 Bacteria 8965941
972 2936041794 2936037263 Bacteria 9446081
973 2936048256 2936046547 Bacteria 8903709
974 2940559011 2940556831 Bacteria 9590747
975 2941541706 2941538514 Bacteria 9402094
976 8005697202 8005695170 Bacteria 6912330
977 8006933416 8006926726 Bacteria 6749210
978 8016517394 8016511872 Bacteria 9921665
979 8016526896 8016522445 Bacteria 8156687
980 8016531983 8016530956 Bacteria 8155261
981 8016545187 8016539877 Bacteria 8155419
982 8016556892 8016548790 Bacteria 8155074
983 8016565245 8016557553 Bacteria 8154380
984 8016570270 8016566248 Bacteria 8158151
985 8016582821 8016575299 Bacteria 8154085
986 8016602887 8016595262 Bacteria 8149947
987 8016605760 8016603502 Bacteria 8731218
988 8016617667 8016613128 Bacteria 8794220
989 8016623903 8016622563 Bacteria 7999408
990 8017059215 8017057580 Bacteria 10023680
991 8019531800 8019530166 Bacteria 8155624
992 8019539725 8019538911 Bacteria 7872763
993 8019550922 8019547302 Bacteria 7996444
994 8019576418 8019576017 Bacteria 10049540
995 8019607272 8019597564 Bacteria 10041141
996 8019611245 8019608314 Bacteria 10042931
997 8019639328 8019638758 Bacteria 9062356
998 8019668100 8019659431 Bacteria 8577854
999 8019677566 8019668869 Bacteria 8791617
1000 8019687383 8019678201 Bacteria 8863603
1001 8055743421 8055742211 Bacteria 9226248
1002 8056975399 8056967851 Bacteria 9038162
1003 Ga0111539_10000124
1004 JGI24739J22299_10026551
1005 JGI24033J26618_1005198
1006 JGI25154J39366_1000042
1007 JGI25157J39369_1007330
1008 JGI25406J46586_10008012
1009 JGI25153J46596_10015034
1010 JGI25153J46596_10036606
1011 rootH1_10143667
1012 rootH1_10074313
1013 Ga0055542_1007622
1014 Ga0065712_10069273
1015 Ga0065707_10095389
1016 Ga0065707_10268601
1017 Ga0070658_10014419
1018 Ga0070658_10095108
1019 Ga0070658_10346476
1020 Ga0070683_100000653
1021 Ga0070683_100030692
1022 Ga0070683_100042961
1023 Ga0070683_100094168
1024 Ga0070670_100000238
1025 Ga0070670_100007809
1026 Ga0070670_100387881
1027 Ga0068869_100000067
1028 Ga0068869_100000317
1029 Ga0070666_10000392
1030 Ga0070682_100142815
1031 Ga0068868_100003498
1032 Ga0068868_100008842
1033 Ga0070660_100637995
1034 Ga0070689_100206570
1035 Ga0070689_100320801
1036 Ga0070661_100003268
1037 Ga0070661_100009743
1038 Ga0070661_100020351
1039 Ga0070661_100335738
1040 Ga0070692_10281344
1041 Ga0070668_100021274
1042 Ga0070669_100000023
1043 Ga0070669_100190355
1044 Ga0070671_100000017
1045 Ga0070671_100005568
1046 Ga0070671_100042886
1047 Ga0070671_100064979
1048 Ga0070674_100022177
1049 Ga0070673_100220636
1050 Ga0070667_100001098
1051 Ga0070667_100002059
1052 Ga0070709_10037141
1053 Ga0070714_100017532
1054 Ga0070714_100079799
1055 Ga0070713_100286889
1056 Ga0070710_10093877
1057 Ga0070711_100007475
1058 Ga0070711_100629387
1059 Ga0070711_100679699
1060 Ga0070705_100073458
1061 Ga0070700_100000048
1062 Ga0070700_100314978
1063 Ga0070694_100039963
1064 Ga0070694_100311791
1065 Ga0070708_100004926
1066 Ga0070708_100132079
1067 Ga0070708_100246322
1068 Ga0070663_100095338
1069 Ga0070663_100244262
1070 Ga0070663_100356706
1071 Ga0070681_10008494
1072 Ga0070681_10210331
1073 Ga0068867_100002198
1074 Ga0068867_100023944
1075 Ga0070706_100000217
1076 Ga0070706_100007572
1077 Ga0070706_100011580
1078 Ga0070706_100026756
1079 Ga0070706_100132316
1080 Ga0070706_100162411
1081 Ga0070706_100322229
1082 Ga0070707_100101895
1083 Ga0070707_100102208
1084 Ga0070707_100133924
1085 Ga0070698_100009817
1086 Ga0070698_100116999
1087 Ga0070698_100287323
1088 Ga0070698_100498490
1089 Ga0070698_100566472
1090 Ga0070699_100023313
1091 Ga0070699_100098998
1092 Ga0070699_100137314
1093 Ga0070699_100155627
1094 Ga0070679_100268064
1095 Ga0070684_100002903
1096 Ga0070684_100022171
1097 Ga0070697_100005321
1098 Ga0070697_100056221
1099 Ga0068853_100000120
1100 Ga0068853_100068285
1101 Ga0068853_100347451
1102 Ga0068853_100573807
1103 Ga0068853_100585676
1104 Ga0070672_100218412
1105 Ga0070686_100043461
1106 Ga0070695_100043651
1107 Ga0070696_100056178
1108 Ga0070693_100035242
1109 Ga0070693_100279932
1110 Ga0070665_100000059
1111 Ga0070665_100025245
1112 Ga0070665_100064489
1113 Ga0070665_100075935
1114 Ga0070665_100225177
1115 Ga0070665_100292496
1116 Ga0070665_100302119
1117 Ga0070665_100371322
1118 Ga0070665_100508397
1119 Ga0070665_100583965
1120 Ga0068855_100000801
1121 Ga0068855_100001583
1122 Ga0068855_100033069
1123 Ga0068855_100057116
1124 Ga0068855_100121429
1125 Ga0068855_100161719
1126 Ga0068855_100426960
1127 Ga0070664_100042294
1128 Ga0070664_100228588
1129 Ga0070664_100304367
1130 Ga0070664_100618901
1131 Ga0068857_100000210
1132 Ga0068857_100097493
1133 Ga0068857_100195875
1134 Ga0068854_100068907
1135 Ga0068854_100072632
1136 Ga0068856_100003788
1137 Ga0068856_100014791
1138 Ga0068856_100029262
1139 Ga0068856_100062137
1140 Ga0068856_100184405
1141 Ga0068856_100820127
1142 Ga0070702_100069585
1143 Ga0068852_100000077
1144 Ga0068852_100000299
1145 Ga0068852_100061407
1146 Ga0068852_100432772
1147 Ga0068859_100000207
1148 Ga0068859_100005717
1149 Ga0068859_100050561
1150 Ga0068859_100168760
1151 Ga0068859_100264094
1152 Ga0068859_100279285
1153 Ga0068859_100285311
1154 Ga0068859_100449484
1155 Ga0068864_100000362
1156 Ga0068864_100048434
1157 Ga0068864_100129961
1158 Ga0068864_100388811
1159 Ga0068861_100000038
1160 Ga0068851_10034499
1161 Ga0068851_10062543
1162 Ga0068863_100000356
1163 Ga0068863_100001238
1164 Ga0068863_100031933
1165 Ga0068863_100192701
1166 Ga0068863_100224850
1167 Ga0068863_100367798
1168 Ga0068858_100000553
1169 Ga0068858_100363386
1170 Ga0068860_100000847
1171 Ga0068860_100009837
1172 Ga0068860_100149226
1173 Ga0068860_100410871
1174 Ga0068862_100000425
1175 Ga0068862_100048432
1176 Ga0081455_10030952
1177 Ga0081540_1000033
1178 Ga0081539_10000044
1179 Ga0070717_10040036
1180 Ga0075364_10068455
1181 Ga0070715_10079449
1182 Ga0070715_10104422
1183 Ga0070716_100009776
1184 Ga0070712_100016224
1185 Ga0070712_100219333
1186 Ga0075367_10135195
1187 Ga0075369_10056613
1188 Ga0097621_100001698
1189 Ga0097621_100003988
1190 Ga0097621_100028237
1191 Ga0097621_100051057
1192 Ga0097621_100313979
1193 Ga0097621_100889840
1194 Ga0068871_100006805
1195 Ga0068871_100054226
1196 Ga0068871_100084506
1197 Ga0068871_100157403
1198 Ga0068871_100403968
1199 Ga0075428_100067581
1200 Ga0075428_100536448
1201 Ga0075430_100000047
1202 Ga0075430_100055604
1203 Ga0075431_100000424
1204 Ga0075431_100103111
1205 Ga0075431_100425316
1206 Ga0075431_100492845
1207 Ga0075433_10011760
1208 Ga0075433_10018309
1209 Ga0075433_10156477
1210 Ga0075434_100006316
1211 Ga0075434_100009371
1212 Ga0075434_100011894
1213 Ga0075434_100015814
1214 Ga0075434_100022949
1215 Ga0075434_100113211
1216 Ga0075429_100011933
1217 Ga0075429_100275321
1218 Ga0068865_100000627
1219 Ga0068865_100007260
1220 Ga0075436_100015719
1221 Ga0075436_100100116
1222 Ga0097620_100000207
1223 Ga0097620_100005717
1224 Ga0097620_100050561
1225 Ga0097620_100168768
1226 Ga0097620_100264134
1227 Ga0097620_100279255
1228 Ga0097620_100285306
1229 Ga0097620_100449468
1230 Ga0075435_100000840
1231 Ga0075435_100022120
1232 Ga0075435_100196046
1233 Ga0075435_100564981
1234 Ga0099794_10000036
1235 Ga0099794_10011369
1236 Ga0099795_10042058
1237 Ga0105251_10000069
1238 Ga0105240_10001995
1239 Ga0105240_10002454
1240 Ga0105240_10002492
1241 Ga0105240_10004354
1242 Ga0105240_10007653
1243 Ga0105240_10018634
1244 Ga0105240_10088483
1245 Ga0105240_10178425
1246 Ga0105240_10312980
1247 Ga0105240_10476448
1248 Ga0111539_10013523
1249 Ga0105245_10001344
1250 Ga0105245_10001394
1251 Ga0105245_10026017
1252 Ga0105245_10074990
1253 Ga0105245_10129000
1254 Ga0105245_10641985
1255 Ga0105247_10000419
1256 Ga0105247_10000705
1257 Ga0105247_10293332
1258 Ga0114129_10003490
1259 Ga0114129_10007054
1260 Ga0114129_10065912
1261 Ga0114129_10086903
1262 Ga0114129_10203693
1263 Ga0114129_10396049
1264 Ga0114129_10429735
1265 Ga0114129_10939751
1266 Ga0105243_10302435
1267 Ga0105243_10629321
1268 Ga0105241_10000236
1269 Ga0105241_10000876
1270 Ga0105241_10049206
1271 Ga0105241_10085093
1272 Ga0105241_10111086
1273 Ga0105241_10111491
1274 Ga0105241_10198588
1275 Ga0105241_10249516
1276 Ga0105242_10000994
1277 Ga0105242_10066502
1278 Ga0105242_10073061
1279 Ga0105242_10303734
1280 Ga0105242_10352713
1281 Ga0105248_10001452
1282 Ga0105248_10003640
1283 Ga0105248_10017256
1284 Ga0105248_10059934
1285 Ga0105248_10177580
1286 Ga0105248_10503619
1287 Ga0105237_10000607
1288 Ga0105237_10003722
1289 Ga0105237_10004802
1290 Ga0105237_10108163
1291 Ga0105237_10109467
1292 Ga0105238_10000332
1293 Ga0105238_10001334
1294 Ga0105238_10003045
1295 Ga0105238_10003716
1296 Ga0105238_10011626
1297 Ga0105238_10019773
1298 Ga0105238_10020974
1299 Ga0105238_10027134
1300 Ga0105238_10180525
1301 Ga0105238_10590569
1302 Ga0105249_10000897
1303 Ga0105249_10151207
1304 Ga0105249_10493407
1305 Ga0105239_10001070
1306 Ga0105239_10006507
1307 Ga0105239_10008238
1308 Ga0105239_10014870
1309 Ga0105239_10039009
1310 Ga0105239_10065685
1311 Ga0105239_10075102
1312 Ga0105239_10140092
1313 Ga0105239_10151474
1314 Ga0105239_10492132
1315 Ga0105239_10993573
1316 Ga0105246_10001976
1317 Ga0105246_10247614
1318 Ga0157373_10053796
1319 Ga0157370_10000003
1320 Ga0157370_10813845
1321 Ga0157369_10001336
1322 Ga0157369_10001406
1323 Ga0157369_10002432
1324 Ga0157369_10134016
1325 Ga0157374_10007610
1326 Ga0157374_10007832
1327 Ga0157374_10008356
1328 Ga0157374_10032674
1329 Ga0157374_10038494
1330 Ga0157374_10220809
1331 Ga0157374_10251522
1332 Ga0157374_10347980
1333 Ga0157374_10570362
1334 Ga0157374_10876969
1335 Ga0157378_10004490
1336 Ga0157378_10044280
1337 Ga0157378_10083281
1338 Ga0157378_10261305
1339 Ga0163162_10000207
1340 Ga0163162_10002925
1341 Ga0163162_10473143
1342 Ga0157372_10000482
1343 Ga0157372_10009981
1344 Ga0157372_10124067
1345 Ga0157372_10144260
1346 Ga0157375_10017482
1347 Ga0157375_10151335
1348 Ga0157375_10235330
1349 Ga0157375_10275291
1350 Ga0157375_10442933
1351 Ga0157375_10580202
1352 Ga0163163_10003816
1353 Ga0163163_10008980
1354 Ga0163163_10131114
1355 Ga0163163_10233912
1356 Ga0163163_10746429
1357 Ga0157379_10000580
1358 Ga0157379_10003472
1359 Ga0157379_10148140
1360 Ga0157376_10000008
1361 Ga0157376_10019251
1362 Ga0157376_10036898
1363 Ga0157376_10515924
1364 Ga0209563_109893
1365 Ga0209646_1000017
1366 Ga0209026_1000196
1367 Ga0209677_107140
1368 Ga0209758_1003363
1369 Ga0209758_1003511
1370 Ga0207426_1000279
1371 Ga0207426_1001701
1372 Ga0209257_1000447
1373 Ga0207697_10000005
1374 Ga0207656_10069611
1375 Ga0207656_10098863
1376 Ga0207642_10088454
1377 Ga0207710_10176211
1378 Ga0207680_10000062
1379 Ga0207647_10081520
1380 Ga0207699_10001086
1381 Ga0207705_10183543
1382 Ga0207705_10276190
1383 Ga0207705_10323445
1384 Ga0207684_10000062
1385 Ga0207684_10000134
1386 Ga0207684_10016373
1387 Ga0207684_10067520
1388 Ga0207684_10071306
1389 Ga0207684_10128142
1390 Ga0207684_10148855
1391 Ga0207684_10208837
1392 Ga0207654_10000114
1393 Ga0207654_10000167
1394 Ga0207654_10000601
1395 Ga0207654_10027681
1396 Ga0207654_10089813
1397 Ga0207654_10137032
1398 Ga0207654_10189108
1399 Ga0207707_10022166
1400 Ga0207707_10093022
1401 Ga0207695_10000059
1402 Ga0207695_10000129
1403 Ga0207695_10000194
1404 Ga0207695_10000428
1405 Ga0207695_10000696
1406 Ga0207695_10015961
1407 Ga0207695_10054324
1408 Ga0207695_10175792
1409 Ga0207695_10400478
1410 Ga0207671_10000221
1411 Ga0207671_10000805
1412 Ga0207671_10002131
1413 Ga0207671_10094042
1414 Ga0207671_10225227
1415 Ga0207671_10314305
1416 Ga0207693_10193481
1417 Ga0207663_10020527
1418 Ga0207657_10091833
1419 Ga0207649_10005714
1420 Ga0207649_10006733
1421 Ga0207649_10109951
1422 Ga0207652_10385513
1423 Ga0207652_10547690
1424 Ga0207646_10003284
1425 Ga0207646_10023859
1426 Ga0207646_10026024
1427 Ga0207646_10042291
1428 Ga0207681_10000004
1429 Ga0207681_10017272
1430 Ga0207694_10000036
1431 Ga0207694_10000602
1432 Ga0207694_10001006
1433 Ga0207694_10005288
1434 Ga0207694_10006876
1435 Ga0207694_10097045
1436 Ga0207694_10151252
1437 Ga0207694_10267306
1438 Ga0207694_10280286
1439 Ga0207694_10535772
1440 Ga0207650_10000432
1441 Ga0207650_10000919
1442 Ga0207650_10309619
1443 Ga0207687_10004559
1444 Ga0207687_10133000
1445 Ga0207687_10333075
1446 Ga0207687_10399892
1447 Ga0207700_10383277
1448 Ga0207700_10830296
1449 Ga0207664_10064179
1450 Ga0207644_10000024
1451 Ga0207644_10001597
1452 Ga0207644_10017485
1453 Ga0207644_10037783
1454 Ga0207644_10260312
1455 Ga0207690_10035980
1456 Ga0207686_10010450
1457 Ga0207686_10019144
1458 Ga0207686_10096300
1459 Ga0207709_10237882
1460 Ga0207669_10370352
1461 Ga0207704_10002724
1462 Ga0207704_10006060
1463 Ga0207665_10005224
1464 Ga0207665_10093799
1465 Ga0207691_10276502
1466 Ga0207711_10005653
1467 Ga0207711_10006162
1468 Ga0207711_10009617
1469 Ga0207711_10060389
1470 Ga0207711_10079812
1471 Ga0207711_10289612
1472 Ga0207711_10299587
1473 Ga0207689_10000211
1474 Ga0207689_10001823
1475 Ga0207661_10001902
1476 Ga0207661_10111957
1477 Ga0207661_10176782
1478 Ga0207661_10395156
1479 Ga0207661_10434743
1480 Ga0207679_10022496
1481 Ga0207679_10140225
1482 Ga0207679_10251056
1483 Ga0207667_10000507
1484 Ga0207667_10001798
1485 Ga0207667_10003545
1486 Ga0207667_10111796
1487 Ga0207667_10371762
1488 Ga0207712_10136873
1489 Ga0207712_10785062
1490 Ga0207668_10000121
1491 Ga0207640_10148197
1492 Ga0207640_10266142
1493 Ga0207658_10000782
1494 Ga0207677_10000791
1495 Ga0207703_10001222
1496 Ga0207703_10044183
1497 Ga0207703_10189561
1498 Ga0207703_10789826
1499 Ga0207639_10000049
1500 Ga0207639_10025400
1501 Ga0207639_10251094
1502 Ga0207639_10391627
1503 Ga0207639_10494943
1504 Ga0207678_10116124
1505 Ga0207708_10000054
1506 Ga0207708_10180638
1507 Ga0207702_10003184
1508 Ga0207702_10005573
1509 Ga0207702_10005904
1510 Ga0207702_10094371
1511 Ga0207702_10235905
1512 Ga0207641_10000443
1513 Ga0207641_10001096
1514 Ga0207641_10001319
1515 Ga0207641_10042261
1516 Ga0207648_10001703
1517 Ga0207648_10072751
1518 Ga0207648_10301092
1519 Ga0207676_10042854
1520 Ga0207676_10132522
1521 Ga0207676_10275553
1522 Ga0207676_10451140
1523 Ga0207674_10001069
1524 Ga0207674_10025752
1525 Ga0207674_10045501
1526 Ga0207674_10066687
1527 Ga0207674_10143410
1528 Ga0207674_10173762
1529 Ga0207674_10247375
1530 Ga0207675_100000028
1531 Ga0207683_10071303
1532 Ga0207698_10000027
1533 Ga0207698_10000037
1534 Ga0207698_10002184
1535 Ga0209588_1000020
1536 Ga0207428_10000314
1537 Ga0207428_10283567
1538 Ga0268266_10000226
1539 Ga0268266_10000859
1540 Ga0268266_10065148
1541 Ga0268266_10077410
1542 Ga0268266_10236872
1543 Ga0268266_10414662
1544 Ga0268265_10000046
1545 Ga0268265_10116671
1546 Ga0268265_10330097
1547 Ga0268264_10000180
1548 Ga0268264_10007721
1549 Ga0268264_10368694
1550 Ga0268264_10369439
1551 Ga0268264_10868456
1552 Ga0265326_10022631
1553 Ga0265319_1007674
1554 Ga0265318_10056705
1555 Ga0265323_10051918
1556 Ga0265336_10000350
1557 Ga0307515_10000008
1558 Ga0265338_10000086
1559 Ga0265338_10000160
1560 Ga0265338_10082988
1561 Ga0265338_10154894
1562 Ga0265338_10183859
1563 Ga0265324_10012189
1564 Ga0265324_10025764
1565 Ga0265765_1003956
1566 Ga0265330_10045318
1567 Ga0265330_10050899
1568 Ga0265332_10049301
1569 Ga0265328_10040231
1570 Ga0265320_10087257
1571 Ga0265325_10028791
1572 Ga0265340_10082455
1573 Ga0265340_10150446
1574 Ga0265327_10001103
1575 Ga0265316_10065636
1576 Ga0265316_10132163
1577 Ga0265313_10025006
1578 Ga0307508_10000214
1579 Ga0265314_10002933
1580 Ga0265314_10003720
1581 Ga0265314_10037211
1582 Ga0265314_10093037
1583 Ga0265314_10170609
1584 Ga0265342_10008129
1585 Ga0265342_10124122
1586 Ga0307516_10023011
1587 Ga0307516_10037947
1588 Ga0307516_10406724
1589 Ga0307413_10345528
1590 Ga0307410_10190105
1591 Ga0307510_10000955
1592 Ga0373940_0020682
1593 Ga0373923_0088850
1594 Ga0373953_0218019
1595 Ga0373954_0003984
1596 Ga0373957_0033066
1597 Ga0373955_0026260
1598 Ga0373962_0029082
1599 Ga0373924_0072171
1600 Ga0373931_0007102
1601 Ga0373933_0010365
1602 Ga0373937_0008928
1603 Ga0373937_0024449
1604 Ga0373937_0484509
1605 Ga0373937_0608921
1606 Ga0373925_0004993
1607 Ga0373925_0236564
1608 Ga0395900_0115765
1609 Ga0395900_0511921
1610 Ga0395900_0569018
1611 Ga0395898_0241088
1612 Ga0395898_0495101
1613 Ga0436365_0923788
1614 Ga0436365_1874016
1615 Ga0436361_1204031
1616 Ga0439459_0005415
1617 Ga0451577_0050187
1618 Ga0451577_0052904
1619 Ga0451577_0054652
1620 Ga0466972_0019787
1621 Ga0453683_0098308
1622 Ga0466963_0025955
1623 Ga0453684_0000185
1624 Ga0453684_0048166
1625 Ga0453684_0179472
1626 Ga0466960_0130493
1627 Ga0451576_0393709
1628 Ga0466967_0008873
1629 Ga0466967_0189096
1630 Ga0495617_078056
1631 Ga0495627_000711
1632 Ga0495592_0086088
1633 Ga0495629_0002619
1634 Ga0495638_0079331
1635 Ga0495641_0014302
1636 Ga0495651_0001592
1637 Ga0495651_0094285
1638 Ga0495653_0128098
1639 Ga0495580_0004204
1640 Ga0495580_0045352
1641 Ga0495580_0048120
1642 Ga0495639_0037568
1643 Ga0495662_0027324
1644 Ga0495662_0157580
1645 Ga0495664_0013202
1646 Ga0495584_0058278
1647 Ga0495594_0116450
1648 Ga0495594_0290816
1649 Ga0495606_0057204
1650 Ga0495610_0018098
1651 Ga0495618_0155892
1652 Ga0495618_0283079
1653 Ga0495628_0123004
1654 Ga0495628_0230608
1655 Ga0495628_0247015
1656 Ga0495628_0273224
1657 Ga0495630_0000001
1658 Ga0495648_0068879
1659 Ga0495652_0003794
1660 Ga0495652_0049165
1661 Ga0495652_0120401
1662 Ga0495652_0162238
1663 Ga0495587_0012596
1664 Ga0495587_0127901
1665 Ga0495645_0137711
1666 Ga0495645_0162428
1667 Ga0495667_0007233
1668 Ga0495667_0018550
1669 Ga0495667_0046646
1670 Ga0495667_0388400
1671 Ga0495668_0076166
1672 Ga0495634_0129520
1673 Ga0495634_0176238
1674 Ga0495625_0079449
1675 Ga0495625_0188374
1676 Ga0495625_0271206
1677 Ga0495635_0001132
1678 Ga0495635_0022927
1679 Ga0495659_0042771
1680 Ga0495588_0016886
1681 Ga0495657_0027407
1682 Ga0495657_0033401
1683 Ga0495599_0077050
1684 Ga0495599_0148560
1685 Ga0495599_0184565
1686 Ga0495623_0010103
1687 Ga0495623_0026832
1688 Ga0495646_0031794
1689 Ga0495646_0077375
1690 Ga0495613_0011390
1691 Ga0495613_0123028
1692 Ga0495613_0126713
1693 Ga0495613_0396913
1694 Ga0495670_0031961
1695 Ga0495649_0090461
1696 Ga0495589_0006775
1697 Ga0495589_0152526
1698 Ga0495600_0001360
1699 Ga0495600_0105185
1700 Ga0495581_0136911
1701 Ga0495604_0008401
1702 Ga0495604_0277004
1703 Ga0495674_0021099
1704 Ga0495674_0090827
1705 Ga0495674_0324017
1706 Ga0495672_0008826
1707 Ga0495676_0018510
1708 Ga0495676_0124706
1709 Ga0495680_0004905
1710 Ga0495680_0417871
1711 Ga0495683_0054075
1712 Ga0495675_0018271
1713 Ga0495679_007235
1714 Ga0495684_0000364
1715 Ga0495684_0022288
1716 Ga0495684_0026426
1717 Ga0495684_0074058
1718 Ga0495684_0308365
1719 Ga0495686_0050683
1720 Ga0495686_0111680
1721 Ga0495686_0218786
1722 Ga0495593_0029368
1723 Ga0495602_0005811
1724 Ga0495602_0049129
1725 Ga0495602_0060836
1726 Ga0495602_0064361
1727 Ga0496102_0005344
1728 Ga0496102_0747258
1729 Ga0496104_0006263
1730 Ga0496104_0021646
1731 Ga0496105_0018216
1732 Ga0496105_0075831
1733 Ga0496106_0431044
1734 Ga0496108_0345187
1735 Ga0496109_0514494
1736 Ga0496109_0710264
1737 Ga0496114_0232128
1738 Ga0496115_0002166
1739 Ga0496115_0011264
1740 Ga0496116_0005936
1741 Ga0496117_0022494
1742 Ga0496118_0009619
1743 Ga0496118_0028759
1744 Ga0496119_0014813
1745 Ga0496119_0133575
1746 Ga0496120_0014944
1747 Ga0496120_0020206
1748 Ga0496121_0013413
1749 Ga0496121_0019990
1750 Ga0496121_0021352
1751 Ga0496122_0072136
1752 Ga0496124_0001004
1753 Ga0496124_0204807
1754 Ga0496124_0247149
1755 Ga0496125_0000092
1756 Ga0496125_0002341
1757 Ga0496125_0006440
1758 Ga0496125_0163445
1759 Ga0496126_0036454
1760 Ga0496126_0038039
1761 Ga0501031_0001375
1762 Ga0501032_0006786
1763 Ga0501033_0003741
1764 Ga0501034_0000831
1765 Ga0501034_0005434
1766 Ga0501034_0044153
1767 Ga0501034_0263329
1768 Ga0501036_0012120
1769 Ga0501037_0004091
1770 Ga0501037_0009808
1771 Ga0501038_0000073
1772 Ga0501038_0060624
1773 Ga0501039_0004136
1774 Ga0501039_0105628
1775 Ga0501040_0483300
1776 Ga0501042_0062937
1777 Ga0501043_0000609
1778 Ga0501043_0035977
1779 Ga0501043_0123461
1780 Ga0501046_0000020
1781 Ga0501046_0000911
1782 Ga0501046_0008367
1783 Ga0501047_0009250
1784 Ga0501047_0037175
1785 Ga0501047_0058858
1786 Ga0501047_0113673
1787 Ga0501048_0000276
1788 Ga0501048_0022094
1789 Ga0501067_0002927
1790 Ga0501069_0002719
1791 Ga0501069_0012510
1792 Ga0501070_0003152
1793 Ga0501070_0027889
1794 Ga0501070_0326634
1795 Ga0501071_0163128
1796 Ga0501072_0014591
1797 Ga0501072_0089696
1798 Ga0501073_0009784
1799 Ga0501073_0017715
1800 Ga0501074_0003592
1801 Ga0501074_0159383
1802 Ga0501079_0003469
1803 Ga0501080_0091317
1804 Ga0501080_0100647
1805 Ga0501080_0388270
1806 Ga0501083_0000005
1807 Ga0501083_0011237
1808 Ga0501083_0125575
1809 Ga0501035_0058520
1810 Ga0501035_0172775
1811 Ga0501035_0465833
1812 Ga0501044_0031001
1813 Ga0501044_0058302
1814 Ga0501044_0206932
1815 nmdc:mga00v17_9282_c1
1816 nmdc:mga0yw44_13180_c1
1817 nmdc:mga0yw44_5651_c1
1818 nmdc:mga05p37_36371_c1
1819 nmdc:mga05p37_502743_c1
1820 nmdc:mga05p37_573042_c1
1821 nmdc:mga05p37_81121_c1
1822 nmdc:mga05p37_8360_c2
1823 nmdc:mga09592_18178_c1
1824 nmdc:mga0qj67_99338_c1
1825 nmdc:mga06r32_125328_c1
1826 nmdc:mga06r32_148299_c1
1827 nmdc:mga06r32_33075_c1
1828 nmdc:mga06r32_432487_c1
1829 nmdc:mga06r32_8053_c1
1830 nmdc:mga08y16_359779_c1
1831 nmdc:mga08y16_3745_c1
1832 nmdc:mga0n895_102632_c1
1833 nmdc:mga0n895_175808_c1
1834 nmdc:mga0n895_537280_c1
1835 nmdc:mga0n895_62033_c1
1836 nmdc:mga0n895_66565_c1
1837 nmdc:mga0rr50_185187_c1
1838 nmdc:mga0rr50_279104_c1
1839 nmdc:mga0rr50_52726_c1
1840 nmdc:mga0rr50_769448_c1
1841 nmdc:mga0rr50_89940_c1
1842 nmdc:mga0a205_114036_c1
1843 nmdc:mga0a205_11548_c1
1844 nmdc:mga0a205_37316_c1
1845 nmdc:mga0a205_56692_c1
1846 nmdc:mga0a205_94617_c1
1847 nmdc:mga0sz30_1962_c1
1848 Ga0500635_0021659
1849 Ga0500578_0037339
1850 Ga0500643_000048
1851 Ga0500643_022191
1852 Ga0500644_0005789
1853 Ga0500581_032426
1854 Ga0500646_0072437
1855 Ga0500651_0046502
1856 Ga0500566_0000466
1857 Ga0500566_0014261
1858 Ga0500640_114588
1859 Ga0500648_171458
1860 Ga0500650_0254473
1861 Ga0500555_003969
1862 Ga0500556_0000024
1863 Ga0500556_0007119
1864 Ga0500557_000355
1865 Ga0500562_006937
1866 Ga0500569_076333
1867 Ga0500572_007323
1868 Ga0500593_026264
1869 Ga0500595_027716
1870 Ga0500607_012481
1871 Ga0500608_014653
1872 Ga0500618_003931
1873 Ga0500642_0000035
1874 Ga0500642_0012927
1875 Ga0500652_000134
1876 Ga0500658_0049494
1877 Ga0500658_0158252
1878 Ga0500559_0002381
1879 Ga0500559_0019519
1880 Ga0500559_0179752
1881 Ga0500564_070132
1882 Ga0500577_0001590
1883 Ga0500590_111728
1884 Ga0500616_0000122
1885 Ga0500616_0147834
1886 Ga0500622_0001726
1887 Ga0500622_0002746
1888 Ga0500633_0017745
1889 Ga0500636_0000080
1890 Ga0500636_0005624
1891 Ga0500625_027612
1892 Ga0500645_033387
1893 Ga0500596_009867
1894 Ga0500599_000096
1895 Ga0500601_000167
1896 Ga0501084_0023284
1897 Ga0500661_001708
1898 2508540056
1899 2511123935
1900 2513649830
1901 2515631695
1902 2528851387
1903 2603861087
1904 2671118159
1905 2818240830
1906 2819539123
1907 2819647998
1908 2824605566
1909 2824610864
1910 2824653915
1911 2824663680
1912 2842401190
1913 2844321525
1914 2857528785
1915 2874596399
1916 2874650386
1917 2876776864
1918 2876824654
1919 2879081001
1920 2879106561
1921 2879128231
1922 2879143526
1923 2888387779
1924 2888389999
1925 2889420898
1926 2893068980
1927 2903727896
1928 2906602620
1929 2906631936
1930 2922377545
1931 2929622329
1932 2929630025
1933 2932788042
1934 2932799473
1935 2932805221
1936 2932813417
1937 2932820114
1938 2932832822
1939 2933584057
1940 2935620307
1941 2935640632
1942 2935649320
1943 2935657908
1944 2935668824
1945 2935681450
1946 2935687132
1947 2935696897
1948 2935709011
1949 2935716820
1950 2935723055
1951 2935734612
1952 2935744597
1953 2935753098
1954 2935767502
1955 2935770147
1956 2935777823
1957 2935786799
1958 2935794853
1959 2935804741
1960 2935815891
1961 2935832138
1962 2935841032
1963 2935859193
1964 2935864377
1965 2935875271
1966 2935887690
1967 2935978280
1968 2935985596
1969 2935995754
1970 2936005665
1971 2936012127
1972 2936020792
1973 2936029420
1974 2936041794
1975 2936048256
1976 2940559011
1977 2941541706
1978 8005697202
1979 8006933416
1980 8016517394
1981 8016526896
1982 8016531983
1983 8016545187
1984 8016556892
1985 8016565245
1986 8016570270
1987 8016582821
1988 8016602887
1989 8016605760
1990 8016617667
1991 8016623903
1992 8017059215
1993 8019531800
1994 8019539725
1995 8019550922
1996 8019576418
1997 8019607272
1998 8019611245
1999 8019639328
2000 8019668100
2001 8019677566
2002 8019687383
2003 8055743421
2004 8056975399

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

65

223

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

275

0.93

PF08659

KR

KR domain

39

216

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v0h-assembly1.cif.gz_B crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with nadp and a potential reaction product 0.9766 2 217
7v0h-assembly1.cif.gz_B crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with nadp and a potential reaction product 0.9678 2 217
4bms-assembly1.cif.gz_F short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.9559 1 216
4bms-assembly2.cif.gz_E-2 short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.9547 3 216
4bms-assembly1.cif.gz_B short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.9544 1 216
ID Description Score Start End Superfamily
af_Q54QN6_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9524 5 216 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9514 2 217 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9485 3 150 3.40.50.720
3nugC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9449 1 217 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9429 2 216 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W7GTV1-F1-model_v4 deleted 0.9936 1 217
AF-A0A6P2XBE5-F1-model_v4 deleted 0.9911 1 217
AF-A0A2W7GTV1-F1-model_v4 deleted 0.9891 1 217
AF-A0A511EWG1-F1-model_v4 deleted 0.9877 1 217
AF-A0A6P2XBE5-F1-model_v4 deleted 0.9866 1 217

Map