F487929
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1003 | 490 | 2004 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10000124|Ga0111539_1000012423 |
| Length | 275 |
| Sequence | MHAHRWALDRHHKGQARHPVGSLRQIRLVVIGRIVRKKSGTGAKLMTRRLEGKVAVVTGASKGISSREGAERVVADINARGGKAIAVQGDVSKPAHIERLFSETDKAFGRVDILVNNAGVYEFAPLEDVTAELFHKQFDLNVLGLMLTTREAVKRMGAGGGSIINIGSVASAVRPPNSSVYAGSKAAVDAITGVLAKELGPRGIRVNSINPGMIETEGVHAAGLVGSDFQKMIETQAPLGRMGHPDDIAPTAVYLASSDSKYMTGESLLVSGGLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 231 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 301 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 334 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 345 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 346 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 347 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 349 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 350 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 351 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 352 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 353 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 354 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 355 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 357 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 358 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 359 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 360 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 361 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 362 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 364 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 365 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 367 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 368 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 372 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 373 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 374 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 375 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 376 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 378 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 379 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 382 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 384 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 385 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 386 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 387 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 388 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 389 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 390 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 391 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 392 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 393 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 394 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 395 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 396 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 397 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 398 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 399 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 400 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 401 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 402 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 403 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 404 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 405 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 406 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 407 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 408 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 409 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 410 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 411 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 412 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 413 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 414 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 415 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 416 | 2922368715 | |||
| 417 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 418 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 419 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 420 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 421 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 422 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 423 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 424 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 425 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 426 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 427 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 428 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 429 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 430 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 431 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 432 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 433 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 434 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 435 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 436 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 437 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 438 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 439 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 440 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 441 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 442 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 443 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 444 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 445 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 446 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 447 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 448 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 449 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 450 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 451 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 452 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 453 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 454 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 455 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 456 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 457 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 458 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 459 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 460 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 461 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 462 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 463 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 464 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 465 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 466 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 467 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 468 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 469 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 470 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 471 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 472 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 473 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 474 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 475 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 476 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 477 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 478 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 479 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 480 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 481 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 482 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 483 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 484 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 485 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 486 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 487 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 488 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 489 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 490 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.32 |
| Metatranscriptomes | 0.1 |
| Isolates | 10.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.58 |
| Nodule | 8.57 |
| Rhizoplane | 1.5 |
| Rhizosphere | 78.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10000124 | 3300009094 | Bacteria | 86595 |
| 2 | JGI24739J22299_10026551 | 3300001989 | Bacteria | 2031 |
| 3 | JGI24033J26618_1005198 | 3300002155 | Bacteria | 1428 |
| 4 | JGI25154J39366_1000042 | 3300002738 | Bacteria | 143170 |
| 5 | JGI25157J39369_1007330 | 3300002741 | Bacteria | 1599 |
| 6 | JGI25406J46586_10008012 | 3300003203 | Bacteria | 4801 |
| 7 | JGI25153J46596_10015034 | 3300003215 | Bacteria | 3177 |
| 8 | JGI25153J46596_10036606 | 3300003215 | Bacteria | 1570 |
| 9 | rootH1_10143667 | 3300003316 | Bacteria | 3299 |
| 10 | rootH1_10074313 | 3300003323 | Bacteria | 4900 |
| 11 | Ga0055542_1007622 | 3300003762 | Bacteria | 2182 |
| 12 | Ga0065712_10069273 | 3300005290 | Bacteria | 7621 |
| 13 | Ga0065707_10095389 | 3300005295 | Bacteria | 3384 |
| 14 | Ga0065707_10268601 | 3300005295 | Bacteria | 1077 |
| 15 | Ga0070658_10014419 | 3300005327 | Bacteria | 6342 |
| 16 | Ga0070658_10095108 | 3300005327 | Bacteria | 2459 |
| 17 | Ga0070658_10346476 | 3300005327 | Bacteria | 1271 |
| 18 | Ga0070683_100000653 | 3300005329 | Bacteria | 25046 |
| 19 | Ga0070683_100030692 | 3300005329 | Bacteria | 4882 |
| 20 | Ga0070683_100042961 | 3300005329 | Bacteria | 4164 |
| 21 | Ga0070683_100094168 | 3300005329 | Bacteria | 2815 |
| 22 | Ga0070670_100000238 | 3300005331 | Bacteria | 49857 |
| 23 | Ga0070670_100007809 | 3300005331 | Bacteria | 9102 |
| 24 | Ga0070670_100387881 | 3300005331 | Bacteria | 1231 |
| 25 | Ga0068869_100000067 | 3300005334 | Bacteria | 47134 |
| 26 | Ga0068869_100000317 | 3300005334 | Bacteria | 25598 |
| 27 | Ga0070666_10000392 | 3300005335 | Bacteria | 27574 |
| 28 | Ga0070682_100142815 | 3300005337 | Bacteria | 1634 |
| 29 | Ga0068868_100003498 | 3300005338 | Bacteria | 10934 |
| 30 | Ga0068868_100008842 | 3300005338 | Bacteria | 7216 |
| 31 | Ga0070660_100637995 | 3300005339 | Bacteria | 892 |
| 32 | Ga0070689_100206570 | 3300005340 | Bacteria | 1606 |
| 33 | Ga0070689_100320801 | 3300005340 | Bacteria | 1294 |
| 34 | Ga0070661_100003268 | 3300005344 | Bacteria | 11189 |
| 35 | Ga0070661_100009743 | 3300005344 | Bacteria | 6662 |
| 36 | Ga0070661_100020351 | 3300005344 | Bacteria | 4730 |
| 37 | Ga0070661_100335738 | 3300005344 | Bacteria | 1183 |
| 38 | Ga0070692_10281344 | 3300005345 | Bacteria | 1008 |
| 39 | Ga0070668_100021274 | 3300005347 | Bacteria | 4903 |
| 40 | Ga0070669_100000023 | 3300005353 | Bacteria | 174496 |
| 41 | Ga0070669_100190355 | 3300005353 | Bacteria | 1609 |
| 42 | Ga0070671_100000017 | 3300005355 | Bacteria | 154265 |
| 43 | Ga0070671_100005568 | 3300005355 | Bacteria | 10035 |
| 44 | Ga0070671_100042886 | 3300005355 | Bacteria | 3762 |
| 45 | Ga0070671_100064979 | 3300005355 | Bacteria | 3039 |
| 46 | Ga0070674_100022177 | 3300005356 | Bacteria | 4092 |
| 47 | Ga0070673_100220636 | 3300005364 | Bacteria | 1641 |
| 48 | Ga0070667_100001098 | 3300005367 | Bacteria | 24799 |
| 49 | Ga0070667_100002059 | 3300005367 | Bacteria | 17798 |
| 50 | Ga0070709_10037141 | 3300005434 | Bacteria | 2973 |
| 51 | Ga0070714_100017532 | 3300005435 | Bacteria | 5802 |
| 52 | Ga0070714_100079799 | 3300005435 | Bacteria | 2846 |
| 53 | Ga0070713_100286889 | 3300005436 | Bacteria | 1512 |
| 54 | Ga0070710_10093877 | 3300005437 | Bacteria | 1774 |
| 55 | Ga0070711_100007475 | 3300005439 | Bacteria | 6648 |
| 56 | Ga0070711_100629387 | 3300005439 | Bacteria | 898 |
| 57 | Ga0070711_100679699 | 3300005439 | Bacteria | 865 |
| 58 | Ga0070705_100073458 | 3300005440 | Bacteria | 2075 |
| 59 | Ga0070700_100000048 | 3300005441 | Bacteria | 89854 |
| 60 | Ga0070700_100314978 | 3300005441 | Bacteria | 1147 |
| 61 | Ga0070694_100039963 | 3300005444 | Bacteria | 3125 |
| 62 | Ga0070694_100311791 | 3300005444 | Bacteria | 1208 |
| 63 | Ga0070708_100004926 | 3300005445 | Bacteria | 10554 |
| 64 | Ga0070708_100132079 | 3300005445 | Bacteria | 2311 |
| 65 | Ga0070708_100246322 | 3300005445 | Bacteria | 1678 |
| 66 | Ga0070663_100095338 | 3300005455 | Bacteria | 2211 |
| 67 | Ga0070663_100244262 | 3300005455 | Bacteria | 1418 |
| 68 | Ga0070663_100356706 | 3300005455 | Bacteria | 1185 |
| 69 | Ga0070681_10008494 | 3300005458 | Bacteria | 10053 |
| 70 | Ga0070681_10210331 | 3300005458 | Bacteria | 1861 |
| 71 | Ga0068867_100002198 | 3300005459 | Bacteria | 13683 |
| 72 | Ga0068867_100023944 | 3300005459 | Bacteria | 4374 |
| 73 | Ga0070706_100000217 | 3300005467 | Bacteria | 70703 |
| 74 | Ga0070706_100007572 | 3300005467 | Bacteria | 10169 |
| 75 | Ga0070706_100011580 | 3300005467 | Bacteria | 8194 |
| 76 | Ga0070706_100026756 | 3300005467 | Bacteria | 5305 |
| 77 | Ga0070706_100132316 | 3300005467 | Bacteria | 2328 |
| 78 | Ga0070706_100162411 | 3300005467 | Bacteria | 2086 |
| 79 | Ga0070706_100322229 | 3300005467 | Bacteria | 1441 |
| 80 | Ga0070707_100101895 | 3300005468 | Bacteria | 2782 |
| 81 | Ga0070707_100102208 | 3300005468 | Bacteria | 2777 |
| 82 | Ga0070707_100133924 | 3300005468 | Bacteria | 2411 |
| 83 | Ga0070698_100009817 | 3300005471 | Bacteria | 10232 |
| 84 | Ga0070698_100116999 | 3300005471 | Bacteria | 2628 |
| 85 | Ga0070698_100287323 | 3300005471 | Bacteria | 1576 |
| 86 | Ga0070698_100498490 | 3300005471 | Bacteria | 1156 |
| 87 | Ga0070698_100566472 | 3300005471 | Bacteria | 1076 |
| 88 | Ga0070699_100023313 | 3300005518 | Bacteria | 5331 |
| 89 | Ga0070699_100098998 | 3300005518 | Bacteria | 2555 |
| 90 | Ga0070699_100137314 | 3300005518 | Bacteria | 2157 |
| 91 | Ga0070699_100155627 | 3300005518 | Bacteria | 2023 |
| 92 | Ga0070679_100268064 | 3300005530 | Bacteria | 1662 |
| 93 | Ga0070684_100002903 | 3300005535 | Bacteria | 12732 |
| 94 | Ga0070684_100022171 | 3300005535 | Bacteria | 5293 |
| 95 | Ga0070697_100005321 | 3300005536 | Bacteria | 9890 |
| 96 | Ga0070697_100056221 | 3300005536 | Bacteria | 3201 |
| 97 | Ga0068853_100000120 | 3300005539 | Bacteria | 52962 |
| 98 | Ga0068853_100068285 | 3300005539 | Bacteria | 3090 |
| 99 | Ga0068853_100347451 | 3300005539 | Bacteria | 1379 |
| 100 | Ga0068853_100573807 | 3300005539 | Unclassified | 1070 |
| 101 | Ga0068853_100585676 | 3300005539 | Bacteria | 1059 |
| 102 | Ga0070672_100218412 | 3300005543 | Bacteria | 1598 |
| 103 | Ga0070686_100043461 | 3300005544 | Bacteria | 2819 |
| 104 | Ga0070695_100043651 | 3300005545 | Bacteria | 2851 |
| 105 | Ga0070696_100056178 | 3300005546 | Bacteria | 2746 |
| 106 | Ga0070693_100035242 | 3300005547 | Unclassified | 2774 |
| 107 | Ga0070693_100279932 | 3300005547 | Bacteria | 1117 |
| 108 | Ga0070665_100000059 | 3300005548 | Bacteria | 224560 |
| 109 | Ga0070665_100025245 | 3300005548 | Bacteria | 5987 |
| 110 | Ga0070665_100064489 | 3300005548 | Bacteria | 3674 |
| 111 | Ga0070665_100075935 | 3300005548 | Unclassified | 3367 |
| 112 | Ga0070665_100225177 | 3300005548 | Bacteria | 1876 |
| 113 | Ga0070665_100292496 | 3300005548 | Bacteria | 1631 |
| 114 | Ga0070665_100302119 | 3300005548 | Bacteria | 1603 |
| 115 | Ga0070665_100371322 | 3300005548 | Bacteria | 1437 |
| 116 | Ga0070665_100508397 | 3300005548 | Bacteria | 1216 |
| 117 | Ga0070665_100583965 | 3300005548 | Bacteria | 1130 |
| 118 | Ga0068855_100000801 | 3300005563 | Bacteria | 38932 |
| 119 | Ga0068855_100001583 | 3300005563 | Bacteria | 28580 |
| 120 | Ga0068855_100033069 | 3300005563 | Bacteria | 6174 |
| 121 | Ga0068855_100057116 | 3300005563 | Bacteria | 4576 |
| 122 | Ga0068855_100121429 | 3300005563 | Bacteria | 2990 |
| 123 | Ga0068855_100161719 | 3300005563 | Bacteria | 2540 |
| 124 | Ga0068855_100426960 | 3300005563 | Bacteria | 1449 |
| 125 | Ga0070664_100042294 | 3300005564 | Bacteria | 3847 |
| 126 | Ga0070664_100228588 | 3300005564 | Bacteria | 1667 |
| 127 | Ga0070664_100304367 | 3300005564 | Unclassified | 1441 |
| 128 | Ga0070664_100618901 | 3300005564 | Bacteria | 1005 |
| 129 | Ga0068857_100000210 | 3300005577 | Bacteria | 38134 |
| 130 | Ga0068857_100097493 | 3300005577 | Bacteria | 2636 |
| 131 | Ga0068857_100195875 | 3300005577 | Bacteria | 1841 |
| 132 | Ga0068854_100068907 | 3300005578 | Bacteria | 2581 |
| 133 | Ga0068854_100072632 | 3300005578 | Bacteria | 2519 |
| 134 | Ga0068856_100003788 | 3300005614 | Bacteria | 15149 |
| 135 | Ga0068856_100014791 | 3300005614 | Bacteria | 7534 |
| 136 | Ga0068856_100029262 | 3300005614 | Bacteria | 5380 |
| 137 | Ga0068856_100062137 | 3300005614 | Bacteria | 3689 |
| 138 | Ga0068856_100184405 | 3300005614 | Bacteria | 2100 |
| 139 | Ga0068856_100820127 | 3300005614 | Bacteria | 950 |
| 140 | Ga0070702_100069585 | 3300005615 | Bacteria | 2074 |
| 141 | Ga0068852_100000077 | 3300005616 | Bacteria | 69050 |
| 142 | Ga0068852_100000299 | 3300005616 | Bacteria | 33328 |
| 143 | Ga0068852_100061407 | 3300005616 | Bacteria | 3266 |
| 144 | Ga0068852_100432772 | 3300005616 | Bacteria | 1299 |
| 145 | Ga0068859_100000207 | 3300005617 | Bacteria | 58182 |
| 146 | Ga0068859_100005717 | 3300005617 | Bacteria | 12651 |
| 147 | Ga0068859_100050561 | 3300005617 | Bacteria | 4175 |
| 148 | Ga0068859_100168760 | 3300005617 | Bacteria | 2269 |
| 149 | Ga0068859_100264094 | 3300005617 | Bacteria | 1813 |
| 150 | Ga0068859_100279285 | 3300005617 | Bacteria | 1763 |
| 151 | Ga0068859_100285311 | 3300005617 | Bacteria | 1744 |
| 152 | Ga0068859_100449484 | 3300005617 | Bacteria | 1385 |
| 153 | Ga0068864_100000362 | 3300005618 | Bacteria | 39889 |
| 154 | Ga0068864_100048434 | 3300005618 | Bacteria | 3653 |
| 155 | Ga0068864_100129961 | 3300005618 | Bacteria | 2261 |
| 156 | Ga0068864_100388811 | 3300005618 | Bacteria | 1324 |
| 157 | Ga0068861_100000038 | 3300005719 | Bacteria | 60215 |
| 158 | Ga0068851_10034499 | 3300005834 | Bacteria | 2526 |
| 159 | Ga0068851_10062543 | 3300005834 | Unclassified | 1910 |
| 160 | Ga0068863_100000356 | 3300005841 | Bacteria | 46496 |
| 161 | Ga0068863_100001238 | 3300005841 | Bacteria | 25440 |
| 162 | Ga0068863_100031933 | 3300005841 | Bacteria | 5023 |
| 163 | Ga0068863_100192701 | 3300005841 | Bacteria | 1959 |
| 164 | Ga0068863_100224850 | 3300005841 | Bacteria | 1809 |
| 165 | Ga0068863_100367798 | 3300005841 | Bacteria | 1403 |
| 166 | Ga0068858_100000553 | 3300005842 | Bacteria | 38986 |
| 167 | Ga0068858_100363386 | 3300005842 | Bacteria | 1387 |
| 168 | Ga0068860_100000847 | 3300005843 | Bacteria | 34239 |
| 169 | Ga0068860_100009837 | 3300005843 | Bacteria | 9488 |
| 170 | Ga0068860_100149226 | 3300005843 | Bacteria | 2251 |
| 171 | Ga0068860_100410871 | 3300005843 | Bacteria | 1340 |
| 172 | Ga0068862_100000425 | 3300005844 | Bacteria | 45885 |
| 173 | Ga0068862_100048432 | 3300005844 | Bacteria | 3628 |
| 174 | Ga0081455_10030952 | 3300005937 | Bacteria | 4850 |
| 175 | Ga0081540_1000033 | 3300005983 | Bacteria | 142902 |
| 176 | Ga0081539_10000044 | 3300005985 | Bacteria | 284021 |
| 177 | Ga0070717_10040036 | 3300006028 | Bacteria | 3816 |
| 178 | Ga0075364_10068455 | 3300006051 | Bacteria | 2335 |
| 179 | Ga0070715_10079449 | 3300006163 | Bacteria | 1485 |
| 180 | Ga0070715_10104422 | 3300006163 | Bacteria | 1327 |
| 181 | Ga0070716_100009776 | 3300006173 | Bacteria | 4792 |
| 182 | Ga0070712_100016224 | 3300006175 | Bacteria | 4809 |
| 183 | Ga0070712_100219333 | 3300006175 | Bacteria | 1505 |
| 184 | Ga0075367_10135195 | 3300006178 | Bacteria | 1525 |
| 185 | Ga0075369_10056613 | 3300006186 | Bacteria | 1704 |
| 186 | Ga0097621_100001698 | 3300006237 | Bacteria | 15068 |
| 187 | Ga0097621_100003988 | 3300006237 | Bacteria | 10227 |
| 188 | Ga0097621_100028237 | 3300006237 | Unclassified | 4422 |
| 189 | Ga0097621_100051057 | 3300006237 | Bacteria | 3364 |
| 190 | Ga0097621_100313979 | 3300006237 | Bacteria | 1387 |
| 191 | Ga0097621_100889840 | 3300006237 | Bacteria | 829 |
| 192 | Ga0068871_100006805 | 3300006358 | Bacteria | 8127 |
| 193 | Ga0068871_100054226 | 3300006358 | Unclassified | 3252 |
| 194 | Ga0068871_100084506 | 3300006358 | Bacteria | 2634 |
| 195 | Ga0068871_100157403 | 3300006358 | Bacteria | 1941 |
| 196 | Ga0068871_100403968 | 3300006358 | Bacteria | 1217 |
| 197 | Ga0075428_100067581 | 3300006844 | Bacteria | 3911 |
| 198 | Ga0075428_100536448 | 3300006844 | Bacteria | 1251 |
| 199 | Ga0075430_100000047 | 3300006846 | Bacteria | 63972 |
| 200 | Ga0075430_100055604 | 3300006846 | Bacteria | 3328 |
| 201 | Ga0075431_100000424 | 3300006847 | Bacteria | 34431 |
| 202 | Ga0075431_100103111 | 3300006847 | Bacteria | 2944 |
| 203 | Ga0075431_100425316 | 3300006847 | Bacteria | 1327 |
| 204 | Ga0075431_100492845 | 3300006847 | Bacteria | 1217 |
| 205 | Ga0075433_10011760 | 3300006852 | Bacteria | 7050 |
| 206 | Ga0075433_10018309 | 3300006852 | Bacteria | 5818 |
| 207 | Ga0075433_10156477 | 3300006852 | Bacteria | 2028 |
| 208 | Ga0075434_100006316 | 3300006871 | Bacteria | 10863 |
| 209 | Ga0075434_100009371 | 3300006871 | Bacteria | 9128 |
| 210 | Ga0075434_100011894 | 3300006871 | Bacteria | 8230 |
| 211 | Ga0075434_100015814 | 3300006871 | Bacteria | 7244 |
| 212 | Ga0075434_100022949 | 3300006871 | Bacteria | 6074 |
| 213 | Ga0075434_100113211 | 3300006871 | Bacteria | 2725 |
| 214 | Ga0075429_100011933 | 3300006880 | Bacteria | 7533 |
| 215 | Ga0075429_100275321 | 3300006880 | Bacteria | 1474 |
| 216 | Ga0068865_100000627 | 3300006881 | Bacteria | 19886 |
| 217 | Ga0068865_100007260 | 3300006881 | Bacteria | 6811 |
| 218 | Ga0075436_100015719 | 3300006914 | Bacteria | 5182 |
| 219 | Ga0075436_100100116 | 3300006914 | Bacteria | 2018 |
| 220 | Ga0097620_100000207 | 3300006931 | Bacteria | 58182 |
| 221 | Ga0097620_100005717 | 3300006931 | Bacteria | 12651 |
| 222 | Ga0097620_100050561 | 3300006931 | Bacteria | 4175 |
| 223 | Ga0097620_100168768 | 3300006931 | Bacteria | 2269 |
| 224 | Ga0097620_100264134 | 3300006931 | Bacteria | 1813 |
| 225 | Ga0097620_100279255 | 3300006931 | Bacteria | 1763 |
| 226 | Ga0097620_100285306 | 3300006931 | Bacteria | 1744 |
| 227 | Ga0097620_100449468 | 3300006931 | Bacteria | 1385 |
| 228 | Ga0075435_100000840 | 3300007076 | Bacteria | 19163 |
| 229 | Ga0075435_100022120 | 3300007076 | Bacteria | 4902 |
| 230 | Ga0075435_100196046 | 3300007076 | Bacteria | 1710 |
| 231 | Ga0075435_100564981 | 3300007076 | Bacteria | 986 |
| 232 | Ga0099794_10000036 | 3300007265 | Bacteria | 55505 |
| 233 | Ga0099794_10011369 | 3300007265 | Bacteria | 3808 |
| 234 | Ga0099795_10042058 | 3300007788 | Bacteria | 1630 |
| 235 | Ga0105251_10000069 | 3300009011 | Bacteria | 98334 |
| 236 | Ga0105240_10001995 | 3300009093 | Bacteria | 33699 |
| 237 | Ga0105240_10002454 | 3300009093 | Bacteria | 29791 |
| 238 | Ga0105240_10002492 | 3300009093 | Bacteria | 29572 |
| 239 | Ga0105240_10004354 | 3300009093 | Bacteria | 21617 |
| 240 | Ga0105240_10007653 | 3300009093 | Bacteria | 15643 |
| 241 | Ga0105240_10018634 | 3300009093 | Bacteria | 9307 |
| 242 | Ga0105240_10088483 | 3300009093 | Bacteria | 3789 |
| 243 | Ga0105240_10178425 | 3300009093 | Unclassified | 2509 |
| 244 | Ga0105240_10312980 | 3300009093 | Bacteria | 1792 |
| 245 | Ga0105240_10476448 | 3300009093 | Bacteria | 1392 |
| 246 | Ga0111539_10013523 | 3300009094 | Bacteria | 10200 |
| 247 | Ga0105245_10001344 | 3300009098 | Bacteria | 22283 |
| 248 | Ga0105245_10001394 | 3300009098 | Bacteria | 21888 |
| 249 | Ga0105245_10026017 | 3300009098 | Bacteria | 5149 |
| 250 | Ga0105245_10074990 | 3300009098 | Bacteria | 3079 |
| 251 | Ga0105245_10129000 | 3300009098 | Bacteria | 2370 |
| 252 | Ga0105245_10641985 | 3300009098 | Bacteria | 1091 |
| 253 | Ga0105247_10000419 | 3300009101 | Bacteria | 36032 |
| 254 | Ga0105247_10000705 | 3300009101 | Bacteria | 26025 |
| 255 | Ga0105247_10293332 | 3300009101 | Bacteria | 1126 |
| 256 | Ga0114129_10003490 | 3300009147 | Bacteria | 22112 |
| 257 | Ga0114129_10007054 | 3300009147 | Bacteria | 15997 |
| 258 | Ga0114129_10065912 | 3300009147 | Bacteria | 5052 |
| 259 | Ga0114129_10086903 | 3300009147 | Bacteria | 4336 |
| 260 | Ga0114129_10203693 | 3300009147 | Bacteria | 2678 |
| 261 | Ga0114129_10396049 | 3300009147 | Bacteria | 1821 |
| 262 | Ga0114129_10429735 | 3300009147 | Bacteria | 1735 |
| 263 | Ga0114129_10939751 | 3300009147 | Bacteria | 1093 |
| 264 | Ga0105243_10302435 | 3300009148 | Bacteria | 1450 |
| 265 | Ga0105243_10629321 | 3300009148 | Bacteria | 1037 |
| 266 | Ga0105241_10000236 | 3300009174 | Bacteria | 41893 |
| 267 | Ga0105241_10000876 | 3300009174 | Bacteria | 22778 |
| 268 | Ga0105241_10049206 | 3300009174 | Bacteria | 3209 |
| 269 | Ga0105241_10085093 | 3300009174 | Bacteria | 2484 |
| 270 | Ga0105241_10111086 | 3300009174 | Bacteria | 2194 |
| 271 | Ga0105241_10111491 | 3300009174 | Bacteria | 2190 |
| 272 | Ga0105241_10198588 | 3300009174 | Unclassified | 1674 |
| 273 | Ga0105241_10249516 | 3300009174 | Bacteria | 1504 |
| 274 | Ga0105242_10000994 | 3300009176 | Bacteria | 22207 |
| 275 | Ga0105242_10066502 | 3300009176 | Bacteria | 2977 |
| 276 | Ga0105242_10073061 | 3300009176 | Bacteria | 2850 |
| 277 | Ga0105242_10303734 | 3300009176 | Bacteria | 1458 |
| 278 | Ga0105242_10352713 | 3300009176 | Bacteria | 1359 |
| 279 | Ga0105248_10001452 | 3300009177 | Bacteria | 26385 |
| 280 | Ga0105248_10003640 | 3300009177 | Bacteria | 17111 |
| 281 | Ga0105248_10017256 | 3300009177 | Bacteria | 7954 |
| 282 | Ga0105248_10059934 | 3300009177 | Bacteria | 4275 |
| 283 | Ga0105248_10177580 | 3300009177 | Bacteria | 2400 |
| 284 | Ga0105248_10503619 | 3300009177 | Bacteria | 1365 |
| 285 | Ga0105237_10000607 | 3300009545 | Bacteria | 49998 |
| 286 | Ga0105237_10003722 | 3300009545 | Bacteria | 17960 |
| 287 | Ga0105237_10004802 | 3300009545 | Bacteria | 15528 |
| 288 | Ga0105237_10108163 | 3300009545 | Bacteria | 2772 |
| 289 | Ga0105237_10109467 | 3300009545 | Bacteria | 2755 |
| 290 | Ga0105238_10000332 | 3300009551 | Bacteria | 51604 |
| 291 | Ga0105238_10001334 | 3300009551 | Bacteria | 24769 |
| 292 | Ga0105238_10003045 | 3300009551 | Bacteria | 16718 |
| 293 | Ga0105238_10003716 | 3300009551 | Bacteria | 15185 |
| 294 | Ga0105238_10011626 | 3300009551 | Bacteria | 8867 |
| 295 | Ga0105238_10019773 | 3300009551 | Bacteria | 6856 |
| 296 | Ga0105238_10020974 | 3300009551 | Bacteria | 6657 |
| 297 | Ga0105238_10027134 | 3300009551 | Bacteria | 5837 |
| 298 | Ga0105238_10180525 | 3300009551 | Bacteria | 2088 |
| 299 | Ga0105238_10590569 | 3300009551 | Bacteria | 1118 |
| 300 | Ga0105249_10000897 | 3300009553 | Bacteria | 26313 |
| 301 | Ga0105249_10151207 | 3300009553 | Bacteria | 2235 |
| 302 | Ga0105249_10493407 | 3300009553 | Unclassified | 1269 |
| 303 | Ga0105239_10001070 | 3300010375 | Bacteria | 38047 |
| 304 | Ga0105239_10006507 | 3300010375 | Bacteria | 13544 |
| 305 | Ga0105239_10008238 | 3300010375 | Bacteria | 11886 |
| 306 | Ga0105239_10014870 | 3300010375 | Bacteria | 8628 |
| 307 | Ga0105239_10039009 | 3300010375 | Bacteria | 5203 |
| 308 | Ga0105239_10065685 | 3300010375 | Bacteria | 3985 |
| 309 | Ga0105239_10075102 | 3300010375 | Bacteria | 3716 |
| 310 | Ga0105239_10140092 | 3300010375 | Bacteria | 2695 |
| 311 | Ga0105239_10151474 | 3300010375 | Unclassified | 2588 |
| 312 | Ga0105239_10492132 | 3300010375 | Bacteria | 1394 |
| 313 | Ga0105239_10993573 | 3300010375 | Bacteria | 965 |
| 314 | Ga0105246_10001976 | 3300011119 | Bacteria | 12363 |
| 315 | Ga0105246_10247614 | 3300011119 | Bacteria | 1412 |
| 316 | Ga0157373_10053796 | 3300013100 | Bacteria | 2862 |
| 317 | Ga0157370_10000003 | 3300013104 | Bacteria | 367417 |
| 318 | Ga0157370_10813845 | 3300013104 | Bacteria | 850 |
| 319 | Ga0157369_10001336 | 3300013105 | Bacteria | 30468 |
| 320 | Ga0157369_10001406 | 3300013105 | Bacteria | 29579 |
| 321 | Ga0157369_10002432 | 3300013105 | Bacteria | 22368 |
| 322 | Ga0157369_10134016 | 3300013105 | Bacteria | 2623 |
| 323 | Ga0157374_10007610 | 3300013296 | Bacteria | 9245 |
| 324 | Ga0157374_10007832 | 3300013296 | Bacteria | 9119 |
| 325 | Ga0157374_10008356 | 3300013296 | Bacteria | 8841 |
| 326 | Ga0157374_10032674 | 3300013296 | Bacteria | 4740 |
| 327 | Ga0157374_10038494 | 3300013296 | Bacteria | 4396 |
| 328 | Ga0157374_10220809 | 3300013296 | Unclassified | 1860 |
| 329 | Ga0157374_10251522 | 3300013296 | Bacteria | 1739 |
| 330 | Ga0157374_10347980 | 3300013296 | Bacteria | 1472 |
| 331 | Ga0157374_10570362 | 3300013296 | Bacteria | 1140 |
| 332 | Ga0157374_10876969 | 3300013296 | Bacteria | 915 |
| 333 | Ga0157378_10004490 | 3300013297 | Bacteria | 12249 |
| 334 | Ga0157378_10044280 | 3300013297 | Bacteria | 3952 |
| 335 | Ga0157378_10083281 | 3300013297 | Bacteria | 2894 |
| 336 | Ga0157378_10261305 | 3300013297 | Bacteria | 1661 |
| 337 | Ga0163162_10000207 | 3300013306 | Bacteria | 54515 |
| 338 | Ga0163162_10002925 | 3300013306 | Bacteria | 16285 |
| 339 | Ga0163162_10473143 | 3300013306 | Bacteria | 1384 |
| 340 | Ga0157372_10000482 | 3300013307 | Bacteria | 44071 |
| 341 | Ga0157372_10009981 | 3300013307 | Bacteria | 10099 |
| 342 | Ga0157372_10124067 | 3300013307 | Unclassified | 2969 |
| 343 | Ga0157372_10144260 | 3300013307 | Unclassified | 2746 |
| 344 | Ga0157375_10017482 | 3300013308 | Bacteria | 6472 |
| 345 | Ga0157375_10151335 | 3300013308 | Bacteria | 2456 |
| 346 | Ga0157375_10235330 | 3300013308 | Bacteria | 1991 |
| 347 | Ga0157375_10275291 | 3300013308 | Bacteria | 1845 |
| 348 | Ga0157375_10442933 | 3300013308 | Bacteria | 1465 |
| 349 | Ga0157375_10580202 | 3300013308 | Bacteria | 1282 |
| 350 | Ga0163163_10003816 | 3300014325 | Bacteria | 12841 |
| 351 | Ga0163163_10008980 | 3300014325 | Bacteria | 8906 |
| 352 | Ga0163163_10131114 | 3300014325 | Bacteria | 2547 |
| 353 | Ga0163163_10233912 | 3300014325 | Unclassified | 1887 |
| 354 | Ga0163163_10746429 | 3300014325 | Bacteria | 1042 |
| 355 | Ga0157379_10000580 | 3300014968 | Bacteria | 29631 |
| 356 | Ga0157379_10003472 | 3300014968 | Bacteria | 13341 |
| 357 | Ga0157379_10148140 | 3300014968 | Bacteria | 2117 |
| 358 | Ga0157376_10000008 | 3300014969 | Bacteria | 351192 |
| 359 | Ga0157376_10019251 | 3300014969 | Bacteria | 5256 |
| 360 | Ga0157376_10036898 | 3300014969 | Bacteria | 3962 |
| 361 | Ga0157376_10515924 | 3300014969 | Bacteria | 1177 |
| 362 | Ga0209563_109893 | 3300025230 | Bacteria | 1422 |
| 363 | Ga0209646_1000017 | 3300025246 | Bacteria | 488265 |
| 364 | Ga0209026_1000196 | 3300025250 | Bacteria | 84284 |
| 365 | Ga0209677_107140 | 3300025253 | Bacteria | 2448 |
| 366 | Ga0209758_1003363 | 3300025297 | Bacteria | 14655 |
| 367 | Ga0209758_1003511 | 3300025297 | Bacteria | 14157 |
| 368 | Ga0207426_1000279 | 3300025302 | Bacteria | 105187 |
| 369 | Ga0207426_1001701 | 3300025302 | Bacteria | 16936 |
| 370 | Ga0209257_1000447 | 3300025304 | Bacteria | 77552 |
| 371 | Ga0207697_10000005 | 3300025315 | Bacteria | 85907 |
| 372 | Ga0207656_10069611 | 3300025321 | Bacteria | 1561 |
| 373 | Ga0207656_10098863 | 3300025321 | Bacteria | 1335 |
| 374 | Ga0207642_10088454 | 3300025899 | Bacteria | 1524 |
| 375 | Ga0207710_10176211 | 3300025900 | Bacteria | 1047 |
| 376 | Ga0207680_10000062 | 3300025903 | Bacteria | 48850 |
| 377 | Ga0207647_10081520 | 3300025904 | Bacteria | 1939 |
| 378 | Ga0207699_10001086 | 3300025906 | Bacteria | 12839 |
| 379 | Ga0207705_10183543 | 3300025909 | Bacteria | 1580 |
| 380 | Ga0207705_10276190 | 3300025909 | Bacteria | 1285 |
| 381 | Ga0207705_10323445 | 3300025909 | Bacteria | 1185 |
| 382 | Ga0207684_10000062 | 3300025910 | Bacteria | 202863 |
| 383 | Ga0207684_10000134 | 3300025910 | Bacteria | 133720 |
| 384 | Ga0207684_10016373 | 3300025910 | Bacteria | 6368 |
| 385 | Ga0207684_10067520 | 3300025910 | Bacteria | 3039 |
| 386 | Ga0207684_10071306 | 3300025910 | Bacteria | 2952 |
| 387 | Ga0207684_10128142 | 3300025910 | Bacteria | 2178 |
| 388 | Ga0207684_10148855 | 3300025910 | Bacteria | 2014 |
| 389 | Ga0207684_10208837 | 3300025910 | Bacteria | 1684 |
| 390 | Ga0207654_10000114 | 3300025911 | Bacteria | 51955 |
| 391 | Ga0207654_10000167 | 3300025911 | Bacteria | 41661 |
| 392 | Ga0207654_10000601 | 3300025911 | Bacteria | 20297 |
| 393 | Ga0207654_10027681 | 3300025911 | Bacteria | 3083 |
| 394 | Ga0207654_10089813 | 3300025911 | Bacteria | 1870 |
| 395 | Ga0207654_10137032 | 3300025911 | Bacteria | 1556 |
| 396 | Ga0207654_10189108 | 3300025911 | Bacteria | 1348 |
| 397 | Ga0207707_10022166 | 3300025912 | Bacteria | 5552 |
| 398 | Ga0207707_10093022 | 3300025912 | Bacteria | 2634 |
| 399 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 400 | Ga0207695_10000129 | 3300025913 | Bacteria | 225939 |
| 401 | Ga0207695_10000194 | 3300025913 | Bacteria | 171422 |
| 402 | Ga0207695_10000428 | 3300025913 | Bacteria | 93076 |
| 403 | Ga0207695_10000696 | 3300025913 | Bacteria | 65853 |
| 404 | Ga0207695_10015961 | 3300025913 | Bacteria | 8816 |
| 405 | Ga0207695_10054324 | 3300025913 | Bacteria | 4184 |
| 406 | Ga0207695_10175792 | 3300025913 | Bacteria | 2064 |
| 407 | Ga0207695_10400478 | 3300025913 | Bacteria | 1257 |
| 408 | Ga0207671_10000221 | 3300025914 | Bacteria | 85673 |
| 409 | Ga0207671_10000805 | 3300025914 | Bacteria | 39642 |
| 410 | Ga0207671_10002131 | 3300025914 | Bacteria | 21605 |
| 411 | Ga0207671_10094042 | 3300025914 | Bacteria | 2262 |
| 412 | Ga0207671_10225227 | 3300025914 | Bacteria | 1470 |
| 413 | Ga0207671_10314305 | 3300025914 | Unclassified | 1239 |
| 414 | Ga0207693_10193481 | 3300025915 | Bacteria | 1600 |
| 415 | Ga0207663_10020527 | 3300025916 | Bacteria | 3743 |
| 416 | Ga0207657_10091833 | 3300025919 | Bacteria | 2531 |
| 417 | Ga0207649_10005714 | 3300025920 | Bacteria | 6732 |
| 418 | Ga0207649_10006733 | 3300025920 | Bacteria | 6243 |
| 419 | Ga0207649_10109951 | 3300025920 | Bacteria | 1839 |
| 420 | Ga0207652_10385513 | 3300025921 | Bacteria | 1265 |
| 421 | Ga0207652_10547690 | 3300025921 | Bacteria | 1040 |
| 422 | Ga0207646_10003284 | 3300025922 | Bacteria | 18418 |
| 423 | Ga0207646_10023859 | 3300025922 | Bacteria | 5613 |
| 424 | Ga0207646_10026024 | 3300025922 | Bacteria | 5347 |
| 425 | Ga0207646_10042291 | 3300025922 | Bacteria | 4093 |
| 426 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 427 | Ga0207681_10017272 | 3300025923 | Bacteria | 4529 |
| 428 | Ga0207694_10000036 | 3300025924 | Bacteria | 194034 |
| 429 | Ga0207694_10000602 | 3300025924 | Bacteria | 32538 |
| 430 | Ga0207694_10001006 | 3300025924 | Bacteria | 24616 |
| 431 | Ga0207694_10005288 | 3300025924 | Bacteria | 9947 |
| 432 | Ga0207694_10006876 | 3300025924 | Bacteria | 8641 |
| 433 | Ga0207694_10097045 | 3300025924 | Bacteria | 2331 |
| 434 | Ga0207694_10151252 | 3300025924 | Bacteria | 1870 |
| 435 | Ga0207694_10267306 | 3300025924 | Bacteria | 1402 |
| 436 | Ga0207694_10280286 | 3300025924 | Bacteria | 1369 |
| 437 | Ga0207694_10535772 | 3300025924 | Bacteria | 982 |
| 438 | Ga0207650_10000432 | 3300025925 | Bacteria | 36576 |
| 439 | Ga0207650_10000919 | 3300025925 | Bacteria | 22217 |
| 440 | Ga0207650_10309619 | 3300025925 | Bacteria | 1291 |
| 441 | Ga0207687_10004559 | 3300025927 | Bacteria | 9221 |
| 442 | Ga0207687_10133000 | 3300025927 | Bacteria | 1878 |
| 443 | Ga0207687_10333075 | 3300025927 | Bacteria | 1232 |
| 444 | Ga0207687_10399892 | 3300025927 | Bacteria | 1130 |
| 445 | Ga0207700_10383277 | 3300025928 | Bacteria | 1230 |
| 446 | Ga0207700_10830296 | 3300025928 | Bacteria | 827 |
| 447 | Ga0207664_10064179 | 3300025929 | Bacteria | 2936 |
| 448 | Ga0207644_10000024 | 3300025931 | Bacteria | 154283 |
| 449 | Ga0207644_10001597 | 3300025931 | Bacteria | 14631 |
| 450 | Ga0207644_10017485 | 3300025931 | Bacteria | 4843 |
| 451 | Ga0207644_10037783 | 3300025931 | Bacteria | 3399 |
| 452 | Ga0207644_10260312 | 3300025931 | Bacteria | 1387 |
| 453 | Ga0207690_10035980 | 3300025932 | Bacteria | 3203 |
| 454 | Ga0207686_10010450 | 3300025934 | Bacteria | 5055 |
| 455 | Ga0207686_10019144 | 3300025934 | Bacteria | 3888 |
| 456 | Ga0207686_10096300 | 3300025934 | Bacteria | 1966 |
| 457 | Ga0207709_10237882 | 3300025935 | Bacteria | 1323 |
| 458 | Ga0207669_10370352 | 3300025937 | Bacteria | 1113 |
| 459 | Ga0207704_10002724 | 3300025938 | Bacteria | 7971 |
| 460 | Ga0207704_10006060 | 3300025938 | Bacteria | 5604 |
| 461 | Ga0207665_10005224 | 3300025939 | Bacteria | 8671 |
| 462 | Ga0207665_10093799 | 3300025939 | Bacteria | 2084 |
| 463 | Ga0207691_10276502 | 3300025940 | Bacteria | 1445 |
| 464 | Ga0207711_10005653 | 3300025941 | Bacteria | 10564 |
| 465 | Ga0207711_10006162 | 3300025941 | Bacteria | 10135 |
| 466 | Ga0207711_10009617 | 3300025941 | Bacteria | 8057 |
| 467 | Ga0207711_10060389 | 3300025941 | Bacteria | 3267 |
| 468 | Ga0207711_10079812 | 3300025941 | Bacteria | 2857 |
| 469 | Ga0207711_10289612 | 3300025941 | Bacteria | 1509 |
| 470 | Ga0207711_10299587 | 3300025941 | Bacteria | 1483 |
| 471 | Ga0207689_10000211 | 3300025942 | Bacteria | 51556 |
| 472 | Ga0207689_10001823 | 3300025942 | Bacteria | 20138 |
| 473 | Ga0207661_10001902 | 3300025944 | Bacteria | 14322 |
| 474 | Ga0207661_10111957 | 3300025944 | Bacteria | 2310 |
| 475 | Ga0207661_10176782 | 3300025944 | Bacteria | 1862 |
| 476 | Ga0207661_10395156 | 3300025944 | Bacteria | 1253 |
| 477 | Ga0207661_10434743 | 3300025944 | Bacteria | 1193 |
| 478 | Ga0207679_10022496 | 3300025945 | Bacteria | 4295 |
| 479 | Ga0207679_10140225 | 3300025945 | Bacteria | 1953 |
| 480 | Ga0207679_10251056 | 3300025945 | Unclassified | 1504 |
| 481 | Ga0207667_10000507 | 3300025949 | Bacteria | 51449 |
| 482 | Ga0207667_10001798 | 3300025949 | Bacteria | 27011 |
| 483 | Ga0207667_10003545 | 3300025949 | Bacteria | 19302 |
| 484 | Ga0207667_10111796 | 3300025949 | Bacteria | 2817 |
| 485 | Ga0207667_10371762 | 3300025949 | Bacteria | 1457 |
| 486 | Ga0207712_10136873 | 3300025961 | Bacteria | 1874 |
| 487 | Ga0207712_10785062 | 3300025961 | Bacteria | 836 |
| 488 | Ga0207668_10000121 | 3300025972 | Bacteria | 54684 |
| 489 | Ga0207640_10148197 | 3300025981 | Bacteria | 1720 |
| 490 | Ga0207640_10266142 | 3300025981 | Bacteria | 1339 |
| 491 | Ga0207658_10000782 | 3300025986 | Bacteria | 27180 |
| 492 | Ga0207677_10000791 | 3300026023 | Bacteria | 18120 |
| 493 | Ga0207703_10001222 | 3300026035 | Bacteria | 24015 |
| 494 | Ga0207703_10044183 | 3300026035 | Bacteria | 3580 |
| 495 | Ga0207703_10189561 | 3300026035 | Bacteria | 1820 |
| 496 | Ga0207703_10789826 | 3300026035 | Bacteria | 906 |
| 497 | Ga0207639_10000049 | 3300026041 | Bacteria | 124603 |
| 498 | Ga0207639_10025400 | 3300026041 | Bacteria | 4295 |
| 499 | Ga0207639_10251094 | 3300026041 | Bacteria | 1542 |
| 500 | Ga0207639_10391627 | 3300026041 | Bacteria | 1250 |
| 501 | Ga0207639_10494943 | 3300026041 | Bacteria | 1116 |
| 502 | Ga0207678_10116124 | 3300026067 | Bacteria | 2283 |
| 503 | Ga0207708_10000054 | 3300026075 | Bacteria | 103599 |
| 504 | Ga0207708_10180638 | 3300026075 | Bacteria | 1675 |
| 505 | Ga0207702_10003184 | 3300026078 | Bacteria | 15173 |
| 506 | Ga0207702_10005573 | 3300026078 | Bacteria | 10997 |
| 507 | Ga0207702_10005904 | 3300026078 | Bacteria | 10648 |
| 508 | Ga0207702_10094371 | 3300026078 | Bacteria | 2626 |
| 509 | Ga0207702_10235905 | 3300026078 | Unclassified | 1711 |
| 510 | Ga0207641_10000443 | 3300026088 | Bacteria | 47443 |
| 511 | Ga0207641_10001096 | 3300026088 | Bacteria | 27229 |
| 512 | Ga0207641_10001319 | 3300026088 | Bacteria | 24549 |
| 513 | Ga0207641_10042261 | 3300026088 | Bacteria | 3824 |
| 514 | Ga0207648_10001703 | 3300026089 | Bacteria | 24050 |
| 515 | Ga0207648_10072751 | 3300026089 | Bacteria | 2996 |
| 516 | Ga0207648_10301092 | 3300026089 | Bacteria | 1438 |
| 517 | Ga0207676_10042854 | 3300026095 | Bacteria | 3481 |
| 518 | Ga0207676_10132522 | 3300026095 | Bacteria | 2121 |
| 519 | Ga0207676_10275553 | 3300026095 | Bacteria | 1525 |
| 520 | Ga0207676_10451140 | 3300026095 | Bacteria | 1212 |
| 521 | Ga0207674_10001069 | 3300026116 | Bacteria | 35647 |
| 522 | Ga0207674_10025752 | 3300026116 | Bacteria | 6265 |
| 523 | Ga0207674_10045501 | 3300026116 | Bacteria | 4514 |
| 524 | Ga0207674_10066687 | 3300026116 | Bacteria | 3624 |
| 525 | Ga0207674_10143410 | 3300026116 | Bacteria | 2347 |
| 526 | Ga0207674_10173762 | 3300026116 | Bacteria | 2107 |
| 527 | Ga0207674_10247375 | 3300026116 | Bacteria | 1730 |
| 528 | Ga0207675_100000028 | 3300026118 | Bacteria | 109884 |
| 529 | Ga0207683_10071303 | 3300026121 | Bacteria | 3071 |
| 530 | Ga0207698_10000027 | 3300026142 | Bacteria | 119295 |
| 531 | Ga0207698_10000037 | 3300026142 | Bacteria | 103991 |
| 532 | Ga0207698_10002184 | 3300026142 | Bacteria | 11581 |
| 533 | Ga0209588_1000020 | 3300027671 | Bacteria | 93596 |
| 534 | Ga0207428_10000314 | 3300027907 | Bacteria | 64160 |
| 535 | Ga0207428_10283567 | 3300027907 | Bacteria | 1229 |
| 536 | Ga0268266_10000226 | 3300028379 | Bacteria | 97913 |
| 537 | Ga0268266_10000859 | 3300028379 | Bacteria | 39577 |
| 538 | Ga0268266_10065148 | 3300028379 | Bacteria | 3150 |
| 539 | Ga0268266_10077410 | 3300028379 | Bacteria | 2892 |
| 540 | Ga0268266_10236872 | 3300028379 | Bacteria | 1683 |
| 541 | Ga0268266_10414662 | 3300028379 | Bacteria | 1275 |
| 542 | Ga0268265_10000046 | 3300028380 | Bacteria | 179361 |
| 543 | Ga0268265_10116671 | 3300028380 | Bacteria | 2191 |
| 544 | Ga0268265_10330097 | 3300028380 | Bacteria | 1385 |
| 545 | Ga0268264_10000180 | 3300028381 | Bacteria | 134339 |
| 546 | Ga0268264_10007721 | 3300028381 | Bacteria | 8960 |
| 547 | Ga0268264_10368694 | 3300028381 | Bacteria | 1372 |
| 548 | Ga0268264_10369439 | 3300028381 | Bacteria | 1371 |
| 549 | Ga0268264_10868456 | 3300028381 | Bacteria | 904 |
| 550 | Ga0265326_10022631 | 3300028558 | Bacteria | 1799 |
| 551 | Ga0265319_1007674 | 3300028563 | Bacteria | 4818 |
| 552 | Ga0265318_10056705 | 3300028577 | Bacteria | 1464 |
| 553 | Ga0265323_10051918 | 3300028653 | Bacteria | 1452 |
| 554 | Ga0265336_10000350 | 3300028666 | Bacteria | 30111 |
| 555 | Ga0307515_10000008 | 3300028794 | Bacteria | 663660 |
| 556 | Ga0265338_10000086 | 3300028800 | Bacteria | 175026 |
| 557 | Ga0265338_10000160 | 3300028800 | Bacteria | 122713 |
| 558 | Ga0265338_10082988 | 3300028800 | Unclassified | 2682 |
| 559 | Ga0265338_10154894 | 3300028800 | Bacteria | 1776 |
| 560 | Ga0265338_10183859 | 3300028800 | Bacteria | 1591 |
| 561 | Ga0265324_10012189 | 3300029957 | Bacteria | 3251 |
| 562 | Ga0265324_10025764 | 3300029957 | Bacteria | 2083 |
| 563 | Ga0265765_1003956 | 3300030879 | Bacteria | 1507 |
| 564 | Ga0265330_10045318 | 3300031235 | Bacteria | 1939 |
| 565 | Ga0265330_10050899 | 3300031235 | Bacteria | 1816 |
| 566 | Ga0265332_10049301 | 3300031238 | Bacteria | 1811 |
| 567 | Ga0265328_10040231 | 3300031239 | Bacteria | 1723 |
| 568 | Ga0265320_10087257 | 3300031240 | Bacteria | 1449 |
| 569 | Ga0265325_10028791 | 3300031241 | Bacteria | 2990 |
| 570 | Ga0265340_10082455 | 3300031247 | Bacteria | 1512 |
| 571 | Ga0265340_10150446 | 3300031247 | Bacteria | 1061 |
| 572 | Ga0265327_10001103 | 3300031251 | Bacteria | 37426 |
| 573 | Ga0265316_10065636 | 3300031344 | Bacteria | 2811 |
| 574 | Ga0265316_10132163 | 3300031344 | Bacteria | 1879 |
| 575 | Ga0265313_10025006 | 3300031595 | Bacteria | 3175 |
| 576 | Ga0307508_10000214 | 3300031616 | Bacteria | 70115 |
| 577 | Ga0265314_10002933 | 3300031711 | Bacteria | 16916 |
| 578 | Ga0265314_10003720 | 3300031711 | Bacteria | 14594 |
| 579 | Ga0265314_10037211 | 3300031711 | Bacteria | 3529 |
| 580 | Ga0265314_10093037 | 3300031711 | Bacteria | 1958 |
| 581 | Ga0265314_10170609 | 3300031711 | Bacteria | 1314 |
| 582 | Ga0265342_10008129 | 3300031712 | Bacteria | 7573 |
| 583 | Ga0265342_10124122 | 3300031712 | Bacteria | 1451 |
| 584 | Ga0307516_10023011 | 3300031730 | Bacteria | 6393 |
| 585 | Ga0307516_10037947 | 3300031730 | Bacteria | 4812 |
| 586 | Ga0307516_10406724 | 3300031730 | Bacteria | 1020 |
| 587 | Ga0307413_10345528 | 3300031824 | Bacteria | 1146 |
| 588 | Ga0307410_10190105 | 3300031852 | Bacteria | 1561 |
| 589 | Ga0307510_10000955 | 3300033180 | Bacteria | 30549 |
| 590 | Ga0373940_0020682 | 3300035088 | Bacteria | 1675 |
| 591 | Ga0373923_0088850 | 3300035111 | Unclassified | 1349 |
| 592 | Ga0373953_0218019 | 3300035117 | Bacteria | 826 |
| 593 | Ga0373954_0003984 | 3300035118 | Bacteria | 6312 |
| 594 | Ga0373957_0033066 | 3300035120 | Bacteria | 1909 |
| 595 | Ga0373955_0026260 | 3300035172 | Bacteria | 2998 |
| 596 | Ga0373962_0029082 | 3300035242 | Bacteria | 1504 |
| 597 | Ga0373924_0072171 | 3300035410 | Bacteria | 1458 |
| 598 | Ga0373931_0007102 | 3300035691 | Bacteria | 5266 |
| 599 | Ga0373933_0010365 | 3300035724 | Bacteria | 5109 |
| 600 | Ga0373937_0008928 | 3300036401 | Bacteria | 8703 |
| 601 | Ga0373937_0024449 | 3300036401 | Bacteria | 5449 |
| 602 | Ga0373937_0484509 | 3300036401 | Bacteria | 1175 |
| 603 | Ga0373937_0608921 | 3300036401 | Bacteria | 1037 |
| 604 | Ga0373925_0004993 | 3300037068 | Bacteria | 9960 |
| 605 | Ga0373925_0236564 | 3300037068 | Bacteria | 1462 |
| 606 | Ga0395900_0115765 | 3300037418 | Bacteria | 2751 |
| 607 | Ga0395900_0511921 | 3300037418 | Bacteria | 1149 |
| 608 | Ga0395900_0569018 | 3300037418 | Bacteria | 1076 |
| 609 | Ga0395898_0241088 | 3300037466 | Bacteria | 1724 |
| 610 | Ga0395898_0495101 | 3300037466 | Bacteria | 1163 |
| 611 | Ga0436365_0923788 | 3300039437 | Bacteria | 1385 |
| 612 | Ga0436365_1874016 | 3300039437 | Bacteria | 1973 |
| 613 | Ga0436361_1204031 | 3300039447 | Bacteria | 2707 |
| 614 | Ga0439459_0005415 | 3300042438 | Bacteria | 2098 |
| 615 | Ga0451577_0050187 | 3300042876 | Bacteria | 3725 |
| 616 | Ga0451577_0052904 | 3300042876 | Bacteria | 3626 |
| 617 | Ga0451577_0054652 | 3300042876 | Bacteria | 3564 |
| 618 | Ga0466972_0019787 | 3300044658 | Bacteria | 3365 |
| 619 | Ga0453683_0098308 | 3300044673 | Bacteria | 1837 |
| 620 | Ga0466963_0025955 | 3300044694 | Bacteria | 3742 |
| 621 | Ga0453684_0000185 | 3300044712 | Bacteria | 274418 |
| 622 | Ga0453684_0048166 | 3300044712 | Bacteria | 5641 |
| 623 | Ga0453684_0179472 | 3300044712 | Bacteria | 2487 |
| 624 | Ga0466960_0130493 | 3300044901 | Bacteria | 1325 |
| 625 | Ga0451576_0393709 | 3300045051 | Bacteria | 1452 |
| 626 | Ga0466967_0008873 | 3300045976 | Bacteria | 7414 |
| 627 | Ga0466967_0189096 | 3300045976 | Bacteria | 1945 |
| 628 | Ga0495617_078056 | 3300046452 | Bacteria | 1086 |
| 629 | Ga0495627_000711 | 3300046453 | Bacteria | 25361 |
| 630 | Ga0495592_0086088 | 3300046454 | Bacteria | 2264 |
| 631 | Ga0495629_0002619 | 3300046459 | Bacteria | 13796 |
| 632 | Ga0495638_0079331 | 3300046460 | Bacteria | 1996 |
| 633 | Ga0495641_0014302 | 3300046461 | Bacteria | 4300 |
| 634 | Ga0495651_0001592 | 3300046462 | Bacteria | 17551 |
| 635 | Ga0495651_0094285 | 3300046462 | Bacteria | 2240 |
| 636 | Ga0495653_0128098 | 3300046463 | Bacteria | 1800 |
| 637 | Ga0495580_0004204 | 3300046472 | Bacteria | 12104 |
| 638 | Ga0495580_0045352 | 3300046472 | Bacteria | 3123 |
| 639 | Ga0495580_0048120 | 3300046472 | Bacteria | 3021 |
| 640 | Ga0495639_0037568 | 3300046475 | Bacteria | 2171 |
| 641 | Ga0495662_0027324 | 3300046476 | Bacteria | 2757 |
| 642 | Ga0495662_0157580 | 3300046476 | Bacteria | 1118 |
| 643 | Ga0495664_0013202 | 3300046477 | Bacteria | 4685 |
| 644 | Ga0495584_0058278 | 3300046491 | Bacteria | 1943 |
| 645 | Ga0495594_0116450 | 3300046499 | Bacteria | 1509 |
| 646 | Ga0495594_0290816 | 3300046499 | Bacteria | 931 |
| 647 | Ga0495606_0057204 | 3300046507 | Bacteria | 2512 |
| 648 | Ga0495610_0018098 | 3300046512 | Bacteria | 3991 |
| 649 | Ga0495618_0155892 | 3300046514 | Bacteria | 1457 |
| 650 | Ga0495618_0283079 | 3300046514 | Bacteria | 1034 |
| 651 | Ga0495628_0123004 | 3300046516 | Bacteria | 1989 |
| 652 | Ga0495628_0230608 | 3300046516 | Bacteria | 1388 |
| 653 | Ga0495628_0247015 | 3300046516 | Bacteria | 1333 |
| 654 | Ga0495628_0273224 | 3300046516 | Bacteria | 1257 |
| 655 | Ga0495630_0000001 | 3300046517 | Bacteria | 1687293 |
| 656 | Ga0495648_0068879 | 3300046524 | Bacteria | 2062 |
| 657 | Ga0495652_0003794 | 3300046529 | Bacteria | 14754 |
| 658 | Ga0495652_0049165 | 3300046529 | Bacteria | 3611 |
| 659 | Ga0495652_0120401 | 3300046529 | Bacteria | 2095 |
| 660 | Ga0495652_0162238 | 3300046529 | Bacteria | 1734 |
| 661 | Ga0495587_0012596 | 3300046536 | Bacteria | 5319 |
| 662 | Ga0495587_0127901 | 3300046536 | Bacteria | 1453 |
| 663 | Ga0495645_0137711 | 3300046543 | Bacteria | 1706 |
| 664 | Ga0495645_0162428 | 3300046543 | Bacteria | 1543 |
| 665 | Ga0495667_0007233 | 3300046559 | Bacteria | 7534 |
| 666 | Ga0495667_0018550 | 3300046559 | Unclassified | 4700 |
| 667 | Ga0495667_0046646 | 3300046559 | Bacteria | 2865 |
| 668 | Ga0495667_0388400 | 3300046559 | Bacteria | 880 |
| 669 | Ga0495668_0076166 | 3300046616 | Bacteria | 1842 |
| 670 | Ga0495634_0129520 | 3300046642 | Bacteria | 1610 |
| 671 | Ga0495634_0176238 | 3300046642 | Bacteria | 1341 |
| 672 | Ga0495625_0079449 | 3300046660 | Bacteria | 2287 |
| 673 | Ga0495625_0188374 | 3300046660 | Bacteria | 1368 |
| 674 | Ga0495625_0271206 | 3300046660 | Bacteria | 1095 |
| 675 | Ga0495635_0001132 | 3300046663 | Bacteria | 17770 |
| 676 | Ga0495635_0022927 | 3300046663 | Bacteria | 4352 |
| 677 | Ga0495659_0042771 | 3300046664 | Bacteria | 1623 |
| 678 | Ga0495588_0016886 | 3300046674 | Bacteria | 3535 |
| 679 | Ga0495657_0027407 | 3300046675 | Bacteria | 4021 |
| 680 | Ga0495657_0033401 | 3300046675 | Bacteria | 3582 |
| 681 | Ga0495599_0077050 | 3300046678 | Bacteria | 2082 |
| 682 | Ga0495599_0148560 | 3300046678 | Bacteria | 1452 |
| 683 | Ga0495599_0184565 | 3300046678 | Bacteria | 1285 |
| 684 | Ga0495623_0010103 | 3300046679 | Bacteria | 6110 |
| 685 | Ga0495623_0026832 | 3300046679 | Bacteria | 3707 |
| 686 | Ga0495646_0031794 | 3300046680 | Bacteria | 3287 |
| 687 | Ga0495646_0077375 | 3300046680 | Bacteria | 1946 |
| 688 | Ga0495613_0011390 | 3300046689 | Bacteria | 6608 |
| 689 | Ga0495613_0123028 | 3300046689 | Bacteria | 1862 |
| 690 | Ga0495613_0126713 | 3300046689 | Bacteria | 1831 |
| 691 | Ga0495613_0396913 | 3300046689 | Bacteria | 941 |
| 692 | Ga0495670_0031961 | 3300046691 | Bacteria | 2616 |
| 693 | Ga0495649_0090461 | 3300046694 | Bacteria | 1632 |
| 694 | Ga0495589_0006775 | 3300046794 | Bacteria | 6034 |
| 695 | Ga0495589_0152526 | 3300046794 | Bacteria | 1103 |
| 696 | Ga0495600_0001360 | 3300046809 | Bacteria | 13506 |
| 697 | Ga0495600_0105185 | 3300046809 | Bacteria | 1839 |
| 698 | Ga0495581_0136911 | 3300047315 | Bacteria | 1428 |
| 699 | Ga0495604_0008401 | 3300047317 | Bacteria | 8161 |
| 700 | Ga0495604_0277004 | 3300047317 | Bacteria | 1134 |
| 701 | Ga0495674_0021099 | 3300047319 | Bacteria | 6027 |
| 702 | Ga0495674_0090827 | 3300047319 | Bacteria | 2609 |
| 703 | Ga0495674_0324017 | 3300047319 | Bacteria | 1255 |
| 704 | Ga0495672_0008826 | 3300047320 | Bacteria | 7379 |
| 705 | Ga0495676_0018510 | 3300047321 | Bacteria | 6142 |
| 706 | Ga0495676_0124706 | 3300047321 | Unclassified | 1868 |
| 707 | Ga0495680_0004905 | 3300047322 | Bacteria | 12674 |
| 708 | Ga0495680_0417871 | 3300047322 | Bacteria | 923 |
| 709 | Ga0495683_0054075 | 3300047323 | Bacteria | 2002 |
| 710 | Ga0495675_0018271 | 3300047444 | Bacteria | 4450 |
| 711 | Ga0495679_007235 | 3300047446 | Bacteria | 4656 |
| 712 | Ga0495684_0000364 | 3300047471 | Bacteria | 36846 |
| 713 | Ga0495684_0022288 | 3300047471 | Bacteria | 4876 |
| 714 | Ga0495684_0026426 | 3300047471 | Bacteria | 4462 |
| 715 | Ga0495684_0074058 | 3300047471 | Bacteria | 2587 |
| 716 | Ga0495684_0308365 | 3300047471 | Bacteria | 1135 |
| 717 | Ga0495686_0050683 | 3300047472 | Bacteria | 2608 |
| 718 | Ga0495686_0111680 | 3300047472 | Bacteria | 1638 |
| 719 | Ga0495686_0218786 | 3300047472 | Bacteria | 1084 |
| 720 | Ga0495593_0029368 | 3300047673 | Bacteria | 3015 |
| 721 | Ga0495602_0005811 | 3300048088 | Bacteria | 12950 |
| 722 | Ga0495602_0049129 | 3300048088 | Bacteria | 3782 |
| 723 | Ga0495602_0060836 | 3300048088 | Bacteria | 3288 |
| 724 | Ga0495602_0064361 | 3300048088 | Bacteria | 3171 |
| 725 | Ga0496102_0005344 | 3300048905 | Bacteria | 10902 |
| 726 | Ga0496102_0747258 | 3300048905 | Bacteria | 901 |
| 727 | Ga0496104_0006263 | 3300048907 | Bacteria | 10459 |
| 728 | Ga0496104_0021646 | 3300048907 | Bacteria | 5904 |
| 729 | Ga0496105_0018216 | 3300048908 | Bacteria | 5639 |
| 730 | Ga0496105_0075831 | 3300048908 | Bacteria | 2777 |
| 731 | Ga0496106_0431044 | 3300048909 | Bacteria | 1059 |
| 732 | Ga0496108_0345187 | 3300048911 | Bacteria | 1299 |
| 733 | Ga0496109_0514494 | 3300048912 | Bacteria | 1130 |
| 734 | Ga0496109_0710264 | 3300048912 | Bacteria | 943 |
| 735 | Ga0496114_0232128 | 3300048917 | Bacteria | 1621 |
| 736 | Ga0496115_0002166 | 3300048918 | Bacteria | 14052 |
| 737 | Ga0496115_0011264 | 3300048918 | Bacteria | 6701 |
| 738 | Ga0496116_0005936 | 3300048919 | Bacteria | 11199 |
| 739 | Ga0496117_0022494 | 3300048920 | Bacteria | 5054 |
| 740 | Ga0496118_0009619 | 3300048921 | Bacteria | 9729 |
| 741 | Ga0496118_0028759 | 3300048921 | Bacteria | 4674 |
| 742 | Ga0496119_0014813 | 3300048922 | Bacteria | 6067 |
| 743 | Ga0496119_0133575 | 3300048922 | Bacteria | 1349 |
| 744 | Ga0496120_0014944 | 3300048923 | Bacteria | 5144 |
| 745 | Ga0496120_0020206 | 3300048923 | Bacteria | 4240 |
| 746 | Ga0496121_0013413 | 3300048924 | Bacteria | 8809 |
| 747 | Ga0496121_0019990 | 3300048924 | Bacteria | 6661 |
| 748 | Ga0496121_0021352 | 3300048924 | Bacteria | 6345 |
| 749 | Ga0496122_0072136 | 3300048925 | Bacteria | 2456 |
| 750 | Ga0496124_0001004 | 3300048927 | Bacteria | 44711 |
| 751 | Ga0496124_0204807 | 3300048927 | Bacteria | 1497 |
| 752 | Ga0496124_0247149 | 3300048927 | Bacteria | 1322 |
| 753 | Ga0496125_0000092 | 3300048928 | Bacteria | 211050 |
| 754 | Ga0496125_0002341 | 3300048928 | Bacteria | 24847 |
| 755 | Ga0496125_0006440 | 3300048928 | Bacteria | 12690 |
| 756 | Ga0496125_0163445 | 3300048928 | Bacteria | 1508 |
| 757 | Ga0496126_0036454 | 3300048929 | Bacteria | 4598 |
| 758 | Ga0496126_0038039 | 3300048929 | Bacteria | 4479 |
| 759 | Ga0501031_0001375 | 3300049568 | Bacteria | 15032 |
| 760 | Ga0501032_0006786 | 3300049569 | Bacteria | 8400 |
| 761 | Ga0501033_0003741 | 3300049570 | Bacteria | 12372 |
| 762 | Ga0501034_0000831 | 3300049571 | Bacteria | 45945 |
| 763 | Ga0501034_0005434 | 3300049571 | Bacteria | 13930 |
| 764 | Ga0501034_0044153 | 3300049571 | Bacteria | 4508 |
| 765 | Ga0501034_0263329 | 3300049571 | Bacteria | 1666 |
| 766 | Ga0501036_0012120 | 3300049572 | Bacteria | 7146 |
| 767 | Ga0501037_0004091 | 3300049573 | Bacteria | 10573 |
| 768 | Ga0501037_0009808 | 3300049573 | Bacteria | 7028 |
| 769 | Ga0501038_0000073 | 3300049574 | Bacteria | 83508 |
| 770 | Ga0501038_0060624 | 3300049574 | Bacteria | 3237 |
| 771 | Ga0501039_0004136 | 3300049575 | Bacteria | 10917 |
| 772 | Ga0501039_0105628 | 3300049575 | Bacteria | 2199 |
| 773 | Ga0501040_0483300 | 3300049576 | Bacteria | 892 |
| 774 | Ga0501042_0062937 | 3300049578 | Bacteria | 2651 |
| 775 | Ga0501043_0000609 | 3300049579 | Bacteria | 31671 |
| 776 | Ga0501043_0035977 | 3300049579 | Bacteria | 3894 |
| 777 | Ga0501043_0123461 | 3300049579 | Bacteria | 2031 |
| 778 | Ga0501046_0000020 | 3300049580 | Bacteria | 218268 |
| 779 | Ga0501046_0000911 | 3300049580 | Bacteria | 28909 |
| 780 | Ga0501046_0008367 | 3300049580 | Bacteria | 9022 |
| 781 | Ga0501047_0009250 | 3300049581 | Bacteria | 9304 |
| 782 | Ga0501047_0037175 | 3300049581 | Bacteria | 4707 |
| 783 | Ga0501047_0058858 | 3300049581 | Bacteria | 3711 |
| 784 | Ga0501047_0113673 | 3300049581 | Bacteria | 2590 |
| 785 | Ga0501048_0000276 | 3300049582 | Bacteria | 34594 |
| 786 | Ga0501048_0022094 | 3300049582 | Bacteria | 4655 |
| 787 | Ga0501067_0002927 | 3300049583 | Bacteria | 9412 |
| 788 | Ga0501069_0002719 | 3300049585 | Bacteria | 9028 |
| 789 | Ga0501069_0012510 | 3300049585 | Bacteria | 4514 |
| 790 | Ga0501070_0003152 | 3300049586 | Bacteria | 14359 |
| 791 | Ga0501070_0027889 | 3300049586 | Bacteria | 4737 |
| 792 | Ga0501070_0326634 | 3300049586 | Bacteria | 1247 |
| 793 | Ga0501071_0163128 | 3300049587 | Bacteria | 1666 |
| 794 | Ga0501072_0014591 | 3300049588 | Bacteria | 6022 |
| 795 | Ga0501072_0089696 | 3300049588 | Bacteria | 2441 |
| 796 | Ga0501073_0009784 | 3300049589 | Bacteria | 7057 |
| 797 | Ga0501073_0017715 | 3300049589 | Bacteria | 5156 |
| 798 | Ga0501074_0003592 | 3300049590 | Bacteria | 11011 |
| 799 | Ga0501074_0159383 | 3300049590 | Bacteria | 1611 |
| 800 | Ga0501079_0003469 | 3300049741 | Bacteria | 11592 |
| 801 | Ga0501080_0091317 | 3300049742 | Bacteria | 2828 |
| 802 | Ga0501080_0100647 | 3300049742 | Bacteria | 2681 |
| 803 | Ga0501080_0388270 | 3300049742 | Bacteria | 1257 |
| 804 | Ga0501083_0000005 | 3300049744 | Bacteria | 206200 |
| 805 | Ga0501083_0011237 | 3300049744 | Bacteria | 6283 |
| 806 | Ga0501083_0125575 | 3300049744 | Bacteria | 1682 |
| 807 | Ga0501035_0058520 | 3300049822 | Bacteria | 3433 |
| 808 | Ga0501035_0172775 | 3300049822 | Bacteria | 1866 |
| 809 | Ga0501035_0465833 | 3300049822 | Bacteria | 1044 |
| 810 | Ga0501044_0031001 | 3300049823 | Bacteria | 5629 |
| 811 | Ga0501044_0058302 | 3300049823 | Bacteria | 3960 |
| 812 | Ga0501044_0206932 | 3300049823 | Bacteria | 1918 |
| 813 | nmdc:mga00v17_9282_c1 | 3300050491 | Bacteria | 5318 |
| 814 | nmdc:mga0yw44_13180_c1 | 3300050492 | Bacteria | 4343 |
| 815 | nmdc:mga0yw44_5651_c1 | 3300050492 | Bacteria | 5948 |
| 816 | nmdc:mga05p37_36371_c1 | 3300050507 | Bacteria | 6041 |
| 817 | nmdc:mga05p37_502743_c1 | 3300050507 | Bacteria | 1391 |
| 818 | nmdc:mga05p37_573042_c1 | 3300050507 | Bacteria | 1280 |
| 819 | nmdc:mga05p37_81121_c1 | 3300050507 | Bacteria | 3996 |
| 820 | nmdc:mga05p37_8360_c2 | 3300050507 | Bacteria | 6613 |
| 821 | nmdc:mga09592_18178_c1 | 3300050508 | Bacteria | 5764 |
| 822 | nmdc:mga0qj67_99338_c1 | 3300050509 | Bacteria | 2345 |
| 823 | nmdc:mga06r32_125328_c1 | 3300050510 | Bacteria | 2536 |
| 824 | nmdc:mga06r32_148299_c1 | 3300050510 | Bacteria | 2323 |
| 825 | nmdc:mga06r32_33075_c1 | 3300050510 | Bacteria | 4869 |
| 826 | nmdc:mga06r32_432487_c1 | 3300050510 | Bacteria | 1297 |
| 827 | nmdc:mga06r32_8053_c1 | 3300050510 | Bacteria | 9484 |
| 828 | nmdc:mga08y16_359779_c1 | 3300050511 | Bacteria | 1494 |
| 829 | nmdc:mga08y16_3745_c1 | 3300050511 | Bacteria | 15833 |
| 830 | nmdc:mga0n895_102632_c1 | 3300050512 | Bacteria | 2871 |
| 831 | nmdc:mga0n895_175808_c1 | 3300050512 | Bacteria | 2172 |
| 832 | nmdc:mga0n895_537280_c1 | 3300050512 | Bacteria | 1176 |
| 833 | nmdc:mga0n895_62033_c1 | 3300050512 | Bacteria | 3693 |
| 834 | nmdc:mga0n895_66565_c1 | 3300050512 | Bacteria | 3568 |
| 835 | nmdc:mga0rr50_185187_c1 | 3300050513 | Bacteria | 1704 |
| 836 | nmdc:mga0rr50_279104_c1 | 3300050513 | Bacteria | 1394 |
| 837 | nmdc:mga0rr50_52726_c1 | 3300050513 | Bacteria | 3024 |
| 838 | nmdc:mga0rr50_769448_c1 | 3300050513 | Bacteria | 822 |
| 839 | nmdc:mga0rr50_89940_c1 | 3300050513 | Bacteria | 2388 |
| 840 | nmdc:mga0a205_114036_c1 | 3300050515 | Bacteria | 2601 |
| 841 | nmdc:mga0a205_11548_c1 | 3300050515 | Bacteria | 8137 |
| 842 | nmdc:mga0a205_37316_c1 | 3300050515 | Bacteria | 4673 |
| 843 | nmdc:mga0a205_56692_c1 | 3300050515 | Bacteria | 3782 |
| 844 | nmdc:mga0a205_94617_c1 | 3300050515 | Bacteria | 2886 |
| 845 | nmdc:mga0sz30_1962_c1 | 3300050516 | Bacteria | 7360 |
| 846 | Ga0500635_0021659 | 3300053080 | Bacteria | 1983 |
| 847 | Ga0500578_0037339 | 3300053086 | Bacteria | 3120 |
| 848 | Ga0500643_000048 | 3300053087 | Bacteria | 147879 |
| 849 | Ga0500643_022191 | 3300053087 | Bacteria | 2047 |
| 850 | Ga0500644_0005789 | 3300053088 | Bacteria | 3133 |
| 851 | Ga0500581_032426 | 3300053089 | Bacteria | 2674 |
| 852 | Ga0500646_0072437 | 3300053090 | Bacteria | 1036 |
| 853 | Ga0500651_0046502 | 3300053093 | Bacteria | 2730 |
| 854 | Ga0500566_0000466 | 3300053094 | Bacteria | 22535 |
| 855 | Ga0500566_0014261 | 3300053094 | Bacteria | 4673 |
| 856 | Ga0500640_114588 | 3300053095 | Bacteria | 1091 |
| 857 | Ga0500648_171458 | 3300053097 | Bacteria | 1129 |
| 858 | Ga0500650_0254473 | 3300053098 | Bacteria | 787 |
| 859 | Ga0500555_003969 | 3300053103 | Bacteria | 4202 |
| 860 | Ga0500556_0000024 | 3300053104 | Bacteria | 167556 |
| 861 | Ga0500556_0007119 | 3300053104 | Bacteria | 3196 |
| 862 | Ga0500557_000355 | 3300053105 | Bacteria | 5998 |
| 863 | Ga0500562_006937 | 3300053108 | Bacteria | 2858 |
| 864 | Ga0500569_076333 | 3300053109 | Bacteria | 1064 |
| 865 | Ga0500572_007323 | 3300053111 | Bacteria | 2554 |
| 866 | Ga0500593_026264 | 3300053117 | Bacteria | 2594 |
| 867 | Ga0500595_027716 | 3300053119 | Bacteria | 1937 |
| 868 | Ga0500607_012481 | 3300053121 | Bacteria | 4984 |
| 869 | Ga0500608_014653 | 3300053122 | Bacteria | 3505 |
| 870 | Ga0500618_003931 | 3300053125 | Bacteria | 4934 |
| 871 | Ga0500642_0000035 | 3300053130 | Bacteria | 106656 |
| 872 | Ga0500642_0012927 | 3300053130 | Bacteria | 3047 |
| 873 | Ga0500652_000134 | 3300053131 | Bacteria | 27819 |
| 874 | Ga0500658_0049494 | 3300053134 | Bacteria | 1713 |
| 875 | Ga0500658_0158252 | 3300053134 | Bacteria | 1024 |
| 876 | Ga0500559_0002381 | 3300053136 | Bacteria | 9790 |
| 877 | Ga0500559_0019519 | 3300053136 | Bacteria | 2863 |
| 878 | Ga0500559_0179752 | 3300053136 | Bacteria | 996 |
| 879 | Ga0500564_070132 | 3300053138 | Bacteria | 1581 |
| 880 | Ga0500577_0001590 | 3300053142 | Bacteria | 5816 |
| 881 | Ga0500590_111728 | 3300053148 | Bacteria | 1295 |
| 882 | Ga0500616_0000122 | 3300053153 | Bacteria | 140228 |
| 883 | Ga0500616_0147834 | 3300053153 | Bacteria | 1091 |
| 884 | Ga0500622_0001726 | 3300053156 | Bacteria | 16902 |
| 885 | Ga0500622_0002746 | 3300053156 | Bacteria | 12421 |
| 886 | Ga0500633_0017745 | 3300053160 | Bacteria | 2095 |
| 887 | Ga0500636_0000080 | 3300053177 | Bacteria | 47438 |
| 888 | Ga0500636_0005624 | 3300053177 | Bacteria | 7161 |
| 889 | Ga0500625_027612 | 3300053729 | Bacteria | 2693 |
| 890 | Ga0500645_033387 | 3300053730 | Bacteria | 1540 |
| 891 | Ga0500596_009867 | 3300053735 | Bacteria | 1483 |
| 892 | Ga0500599_000096 | 3300053736 | Bacteria | 8015 |
| 893 | Ga0500601_000167 | 3300053737 | Bacteria | 13797 |
| 894 | Ga0501084_0023284 | 3300054114 | Bacteria | 5171 |
| 895 | Ga0500661_001708 | 3300055283 | Bacteria | 4132 |
| 896 | 2508540056 | 2508501009 | Bacteria | 7784016 |
| 897 | 2511123935 | 2510917020 | Bacteria | 5657507 |
| 898 | 2513649830 | 2513237095 | Bacteria | 8976980 |
| 899 | 2515631695 | 2515154112 | Bacteria | 8294334 |
| 900 | 2528851387 | 2528768022 | Bacteria | 10457665 |
| 901 | 2603861087 | 2602042107 | Bacteria | 6226103 |
| 902 | 2671118159 | 2667528175 | Bacteria | 7532676 |
| 903 | 2818240830 | 2816332527 | Bacteria | 8933356 |
| 904 | 2819539123 | 2818991435 | Bacteria | 5433759 |
| 905 | 2819647998 | 2818991454 | Bacteria | 5563326 |
| 906 | 2824605566 | 2824600985 | Bacteria | 8488197 |
| 907 | 2824610864 | 2824609381 | Bacteria | 8672835 |
| 908 | 2824653915 | 2824653114 | Bacteria | 8493680 |
| 909 | 2824663680 | 2824661429 | Bacteria | 9877870 |
| 910 | 2842401190 | 2842395702 | Bacteria | 6780583 |
| 911 | 2844321525 | 2844315083 | Bacteria | 8138177 |
| 912 | 2857528785 | 2857524615 | Bacteria | 6615449 |
| 913 | 2874596399 | 2874590934 | Bacteria | 8299676 |
| 914 | 2874650386 | 2874645413 | Bacteria | 8214782 |
| 915 | 2876776864 | 2876771140 | Bacteria | 8287509 |
| 916 | 2876824654 | 2876818435 | Bacteria | 8274608 |
| 917 | 2879081001 | 2879074833 | Bacteria | 8279565 |
| 918 | 2879106561 | 2879099564 | Bacteria | 10442239 |
| 919 | 2879128231 | 2879127579 | Bacteria | 8294491 |
| 920 | 2879143526 | 2879142872 | Bacteria | 8267021 |
| 921 | 2888387779 | 2888378607 | Bacteria | 9652610 |
| 922 | 2888389999 | 2888388044 | Bacteria | 7304136 |
| 923 | 2889420898 | 2889415604 | Bacteria | 8048700 |
| 924 | 2893068980 | 2893066018 | Bacteria | 6158120 |
| 925 | 2903727896 | 2903727486 | Bacteria | 8281579 |
| 926 | 2906602620 | 2906602504 | Bacteria | 8295279 |
| 927 | 2906631936 | 2906626472 | Bacteria | 8826946 |
| 928 | 2922377545 | |||
| 929 | 2929622329 | 2929615660 | Bacteria | 9193770 |
| 930 | 2929630025 | 2929624759 | Bacteria | 9339455 |
| 931 | 2932788042 | 2932784394 | Bacteria | 9704911 |
| 932 | 2932799473 | 2932794094 | Bacteria | 7915132 |
| 933 | 2932805221 | 2932801729 | Bacteria | 7987968 |
| 934 | 2932813417 | 2932809354 | Bacteria | 9135765 |
| 935 | 2932820114 | 2932818245 | Bacteria | 9955613 |
| 936 | 2932832822 | 2932828146 | Bacteria | 9745859 |
| 937 | 2933584057 | 2933577622 | Bacteria | 9116884 |
| 938 | 2935620307 | 2935616580 | Bacteria | 9032984 |
| 939 | 2935640632 | 2935638405 | Bacteria | 10015038 |
| 940 | 2935649320 | 2935648319 | Bacteria | 8801166 |
| 941 | 2935657908 | 2935656913 | Bacteria | 8965014 |
| 942 | 2935668824 | 2935665750 | Bacteria | 9571747 |
| 943 | 2935681450 | 2935675223 | Bacteria | 9928132 |
| 944 | 2935687132 | 2935684952 | Bacteria | 9590419 |
| 945 | 2935696897 | 2935694250 | Bacteria | 9291695 |
| 946 | 2935709011 | 2935703347 | Bacteria | 10242284 |
| 947 | 2935716820 | 2935713505 | Bacteria | 9608509 |
| 948 | 2935723055 | 2935722832 | Bacteria | 9608746 |
| 949 | 2935734612 | 2935732158 | Bacteria | 9706831 |
| 950 | 2935744597 | 2935741537 | Bacteria | 9707219 |
| 951 | 2935753098 | 2935750917 | Bacteria | 9590372 |
| 952 | 2935767502 | 2935760218 | Bacteria | 9817913 |
| 953 | 2935770147 | 2935769743 | Bacteria | 7878163 |
| 954 | 2935777823 | 2935777560 | Bacteria | 8077691 |
| 955 | 2935786799 | 2935785616 | Bacteria | 7962367 |
| 956 | 2935794853 | 2935793552 | Bacteria | 8012592 |
| 957 | 2935804741 | 2935801545 | Bacteria | 9301974 |
| 958 | 2935815891 | 2935810662 | Bacteria | 9401221 |
| 959 | 2935832138 | 2935827899 | Bacteria | 10038562 |
| 960 | 2935841032 | 2935837841 | Bacteria | 9454360 |
| 961 | 2935859193 | 2935855204 | Bacteria | 9035059 |
| 962 | 2935864377 | 2935864058 | Bacteria | 9784707 |
| 963 | 2935875271 | 2935873716 | Bacteria | 9632195 |
| 964 | 2935887690 | 2935883170 | Bacteria | 7964738 |
| 965 | 2935978280 | 2935975950 | Bacteria | 8347125 |
| 966 | 2935985596 | 2935984226 | Bacteria | 8302647 |
| 967 | 2935995754 | 2935992306 | Bacteria | 9802711 |
| 968 | 2936005665 | 2936002035 | Bacteria | 9362176 |
| 969 | 2936012127 | 2936011229 | Bacteria | 8801034 |
| 970 | 2936020792 | 2936019824 | Bacteria | 8804134 |
| 971 | 2936029420 | 2936028420 | Bacteria | 8965941 |
| 972 | 2936041794 | 2936037263 | Bacteria | 9446081 |
| 973 | 2936048256 | 2936046547 | Bacteria | 8903709 |
| 974 | 2940559011 | 2940556831 | Bacteria | 9590747 |
| 975 | 2941541706 | 2941538514 | Bacteria | 9402094 |
| 976 | 8005697202 | 8005695170 | Bacteria | 6912330 |
| 977 | 8006933416 | 8006926726 | Bacteria | 6749210 |
| 978 | 8016517394 | 8016511872 | Bacteria | 9921665 |
| 979 | 8016526896 | 8016522445 | Bacteria | 8156687 |
| 980 | 8016531983 | 8016530956 | Bacteria | 8155261 |
| 981 | 8016545187 | 8016539877 | Bacteria | 8155419 |
| 982 | 8016556892 | 8016548790 | Bacteria | 8155074 |
| 983 | 8016565245 | 8016557553 | Bacteria | 8154380 |
| 984 | 8016570270 | 8016566248 | Bacteria | 8158151 |
| 985 | 8016582821 | 8016575299 | Bacteria | 8154085 |
| 986 | 8016602887 | 8016595262 | Bacteria | 8149947 |
| 987 | 8016605760 | 8016603502 | Bacteria | 8731218 |
| 988 | 8016617667 | 8016613128 | Bacteria | 8794220 |
| 989 | 8016623903 | 8016622563 | Bacteria | 7999408 |
| 990 | 8017059215 | 8017057580 | Bacteria | 10023680 |
| 991 | 8019531800 | 8019530166 | Bacteria | 8155624 |
| 992 | 8019539725 | 8019538911 | Bacteria | 7872763 |
| 993 | 8019550922 | 8019547302 | Bacteria | 7996444 |
| 994 | 8019576418 | 8019576017 | Bacteria | 10049540 |
| 995 | 8019607272 | 8019597564 | Bacteria | 10041141 |
| 996 | 8019611245 | 8019608314 | Bacteria | 10042931 |
| 997 | 8019639328 | 8019638758 | Bacteria | 9062356 |
| 998 | 8019668100 | 8019659431 | Bacteria | 8577854 |
| 999 | 8019677566 | 8019668869 | Bacteria | 8791617 |
| 1000 | 8019687383 | 8019678201 | Bacteria | 8863603 |
| 1001 | 8055743421 | 8055742211 | Bacteria | 9226248 |
| 1002 | 8056975399 | 8056967851 | Bacteria | 9038162 |
| 1003 | Ga0111539_10000124 | |||
| 1004 | JGI24739J22299_10026551 | |||
| 1005 | JGI24033J26618_1005198 | |||
| 1006 | JGI25154J39366_1000042 | |||
| 1007 | JGI25157J39369_1007330 | |||
| 1008 | JGI25406J46586_10008012 | |||
| 1009 | JGI25153J46596_10015034 | |||
| 1010 | JGI25153J46596_10036606 | |||
| 1011 | rootH1_10143667 | |||
| 1012 | rootH1_10074313 | |||
| 1013 | Ga0055542_1007622 | |||
| 1014 | Ga0065712_10069273 | |||
| 1015 | Ga0065707_10095389 | |||
| 1016 | Ga0065707_10268601 | |||
| 1017 | Ga0070658_10014419 | |||
| 1018 | Ga0070658_10095108 | |||
| 1019 | Ga0070658_10346476 | |||
| 1020 | Ga0070683_100000653 | |||
| 1021 | Ga0070683_100030692 | |||
| 1022 | Ga0070683_100042961 | |||
| 1023 | Ga0070683_100094168 | |||
| 1024 | Ga0070670_100000238 | |||
| 1025 | Ga0070670_100007809 | |||
| 1026 | Ga0070670_100387881 | |||
| 1027 | Ga0068869_100000067 | |||
| 1028 | Ga0068869_100000317 | |||
| 1029 | Ga0070666_10000392 | |||
| 1030 | Ga0070682_100142815 | |||
| 1031 | Ga0068868_100003498 | |||
| 1032 | Ga0068868_100008842 | |||
| 1033 | Ga0070660_100637995 | |||
| 1034 | Ga0070689_100206570 | |||
| 1035 | Ga0070689_100320801 | |||
| 1036 | Ga0070661_100003268 | |||
| 1037 | Ga0070661_100009743 | |||
| 1038 | Ga0070661_100020351 | |||
| 1039 | Ga0070661_100335738 | |||
| 1040 | Ga0070692_10281344 | |||
| 1041 | Ga0070668_100021274 | |||
| 1042 | Ga0070669_100000023 | |||
| 1043 | Ga0070669_100190355 | |||
| 1044 | Ga0070671_100000017 | |||
| 1045 | Ga0070671_100005568 | |||
| 1046 | Ga0070671_100042886 | |||
| 1047 | Ga0070671_100064979 | |||
| 1048 | Ga0070674_100022177 | |||
| 1049 | Ga0070673_100220636 | |||
| 1050 | Ga0070667_100001098 | |||
| 1051 | Ga0070667_100002059 | |||
| 1052 | Ga0070709_10037141 | |||
| 1053 | Ga0070714_100017532 | |||
| 1054 | Ga0070714_100079799 | |||
| 1055 | Ga0070713_100286889 | |||
| 1056 | Ga0070710_10093877 | |||
| 1057 | Ga0070711_100007475 | |||
| 1058 | Ga0070711_100629387 | |||
| 1059 | Ga0070711_100679699 | |||
| 1060 | Ga0070705_100073458 | |||
| 1061 | Ga0070700_100000048 | |||
| 1062 | Ga0070700_100314978 | |||
| 1063 | Ga0070694_100039963 | |||
| 1064 | Ga0070694_100311791 | |||
| 1065 | Ga0070708_100004926 | |||
| 1066 | Ga0070708_100132079 | |||
| 1067 | Ga0070708_100246322 | |||
| 1068 | Ga0070663_100095338 | |||
| 1069 | Ga0070663_100244262 | |||
| 1070 | Ga0070663_100356706 | |||
| 1071 | Ga0070681_10008494 | |||
| 1072 | Ga0070681_10210331 | |||
| 1073 | Ga0068867_100002198 | |||
| 1074 | Ga0068867_100023944 | |||
| 1075 | Ga0070706_100000217 | |||
| 1076 | Ga0070706_100007572 | |||
| 1077 | Ga0070706_100011580 | |||
| 1078 | Ga0070706_100026756 | |||
| 1079 | Ga0070706_100132316 | |||
| 1080 | Ga0070706_100162411 | |||
| 1081 | Ga0070706_100322229 | |||
| 1082 | Ga0070707_100101895 | |||
| 1083 | Ga0070707_100102208 | |||
| 1084 | Ga0070707_100133924 | |||
| 1085 | Ga0070698_100009817 | |||
| 1086 | Ga0070698_100116999 | |||
| 1087 | Ga0070698_100287323 | |||
| 1088 | Ga0070698_100498490 | |||
| 1089 | Ga0070698_100566472 | |||
| 1090 | Ga0070699_100023313 | |||
| 1091 | Ga0070699_100098998 | |||
| 1092 | Ga0070699_100137314 | |||
| 1093 | Ga0070699_100155627 | |||
| 1094 | Ga0070679_100268064 | |||
| 1095 | Ga0070684_100002903 | |||
| 1096 | Ga0070684_100022171 | |||
| 1097 | Ga0070697_100005321 | |||
| 1098 | Ga0070697_100056221 | |||
| 1099 | Ga0068853_100000120 | |||
| 1100 | Ga0068853_100068285 | |||
| 1101 | Ga0068853_100347451 | |||
| 1102 | Ga0068853_100573807 | |||
| 1103 | Ga0068853_100585676 | |||
| 1104 | Ga0070672_100218412 | |||
| 1105 | Ga0070686_100043461 | |||
| 1106 | Ga0070695_100043651 | |||
| 1107 | Ga0070696_100056178 | |||
| 1108 | Ga0070693_100035242 | |||
| 1109 | Ga0070693_100279932 | |||
| 1110 | Ga0070665_100000059 | |||
| 1111 | Ga0070665_100025245 | |||
| 1112 | Ga0070665_100064489 | |||
| 1113 | Ga0070665_100075935 | |||
| 1114 | Ga0070665_100225177 | |||
| 1115 | Ga0070665_100292496 | |||
| 1116 | Ga0070665_100302119 | |||
| 1117 | Ga0070665_100371322 | |||
| 1118 | Ga0070665_100508397 | |||
| 1119 | Ga0070665_100583965 | |||
| 1120 | Ga0068855_100000801 | |||
| 1121 | Ga0068855_100001583 | |||
| 1122 | Ga0068855_100033069 | |||
| 1123 | Ga0068855_100057116 | |||
| 1124 | Ga0068855_100121429 | |||
| 1125 | Ga0068855_100161719 | |||
| 1126 | Ga0068855_100426960 | |||
| 1127 | Ga0070664_100042294 | |||
| 1128 | Ga0070664_100228588 | |||
| 1129 | Ga0070664_100304367 | |||
| 1130 | Ga0070664_100618901 | |||
| 1131 | Ga0068857_100000210 | |||
| 1132 | Ga0068857_100097493 | |||
| 1133 | Ga0068857_100195875 | |||
| 1134 | Ga0068854_100068907 | |||
| 1135 | Ga0068854_100072632 | |||
| 1136 | Ga0068856_100003788 | |||
| 1137 | Ga0068856_100014791 | |||
| 1138 | Ga0068856_100029262 | |||
| 1139 | Ga0068856_100062137 | |||
| 1140 | Ga0068856_100184405 | |||
| 1141 | Ga0068856_100820127 | |||
| 1142 | Ga0070702_100069585 | |||
| 1143 | Ga0068852_100000077 | |||
| 1144 | Ga0068852_100000299 | |||
| 1145 | Ga0068852_100061407 | |||
| 1146 | Ga0068852_100432772 | |||
| 1147 | Ga0068859_100000207 | |||
| 1148 | Ga0068859_100005717 | |||
| 1149 | Ga0068859_100050561 | |||
| 1150 | Ga0068859_100168760 | |||
| 1151 | Ga0068859_100264094 | |||
| 1152 | Ga0068859_100279285 | |||
| 1153 | Ga0068859_100285311 | |||
| 1154 | Ga0068859_100449484 | |||
| 1155 | Ga0068864_100000362 | |||
| 1156 | Ga0068864_100048434 | |||
| 1157 | Ga0068864_100129961 | |||
| 1158 | Ga0068864_100388811 | |||
| 1159 | Ga0068861_100000038 | |||
| 1160 | Ga0068851_10034499 | |||
| 1161 | Ga0068851_10062543 | |||
| 1162 | Ga0068863_100000356 | |||
| 1163 | Ga0068863_100001238 | |||
| 1164 | Ga0068863_100031933 | |||
| 1165 | Ga0068863_100192701 | |||
| 1166 | Ga0068863_100224850 | |||
| 1167 | Ga0068863_100367798 | |||
| 1168 | Ga0068858_100000553 | |||
| 1169 | Ga0068858_100363386 | |||
| 1170 | Ga0068860_100000847 | |||
| 1171 | Ga0068860_100009837 | |||
| 1172 | Ga0068860_100149226 | |||
| 1173 | Ga0068860_100410871 | |||
| 1174 | Ga0068862_100000425 | |||
| 1175 | Ga0068862_100048432 | |||
| 1176 | Ga0081455_10030952 | |||
| 1177 | Ga0081540_1000033 | |||
| 1178 | Ga0081539_10000044 | |||
| 1179 | Ga0070717_10040036 | |||
| 1180 | Ga0075364_10068455 | |||
| 1181 | Ga0070715_10079449 | |||
| 1182 | Ga0070715_10104422 | |||
| 1183 | Ga0070716_100009776 | |||
| 1184 | Ga0070712_100016224 | |||
| 1185 | Ga0070712_100219333 | |||
| 1186 | Ga0075367_10135195 | |||
| 1187 | Ga0075369_10056613 | |||
| 1188 | Ga0097621_100001698 | |||
| 1189 | Ga0097621_100003988 | |||
| 1190 | Ga0097621_100028237 | |||
| 1191 | Ga0097621_100051057 | |||
| 1192 | Ga0097621_100313979 | |||
| 1193 | Ga0097621_100889840 | |||
| 1194 | Ga0068871_100006805 | |||
| 1195 | Ga0068871_100054226 | |||
| 1196 | Ga0068871_100084506 | |||
| 1197 | Ga0068871_100157403 | |||
| 1198 | Ga0068871_100403968 | |||
| 1199 | Ga0075428_100067581 | |||
| 1200 | Ga0075428_100536448 | |||
| 1201 | Ga0075430_100000047 | |||
| 1202 | Ga0075430_100055604 | |||
| 1203 | Ga0075431_100000424 | |||
| 1204 | Ga0075431_100103111 | |||
| 1205 | Ga0075431_100425316 | |||
| 1206 | Ga0075431_100492845 | |||
| 1207 | Ga0075433_10011760 | |||
| 1208 | Ga0075433_10018309 | |||
| 1209 | Ga0075433_10156477 | |||
| 1210 | Ga0075434_100006316 | |||
| 1211 | Ga0075434_100009371 | |||
| 1212 | Ga0075434_100011894 | |||
| 1213 | Ga0075434_100015814 | |||
| 1214 | Ga0075434_100022949 | |||
| 1215 | Ga0075434_100113211 | |||
| 1216 | Ga0075429_100011933 | |||
| 1217 | Ga0075429_100275321 | |||
| 1218 | Ga0068865_100000627 | |||
| 1219 | Ga0068865_100007260 | |||
| 1220 | Ga0075436_100015719 | |||
| 1221 | Ga0075436_100100116 | |||
| 1222 | Ga0097620_100000207 | |||
| 1223 | Ga0097620_100005717 | |||
| 1224 | Ga0097620_100050561 | |||
| 1225 | Ga0097620_100168768 | |||
| 1226 | Ga0097620_100264134 | |||
| 1227 | Ga0097620_100279255 | |||
| 1228 | Ga0097620_100285306 | |||
| 1229 | Ga0097620_100449468 | |||
| 1230 | Ga0075435_100000840 | |||
| 1231 | Ga0075435_100022120 | |||
| 1232 | Ga0075435_100196046 | |||
| 1233 | Ga0075435_100564981 | |||
| 1234 | Ga0099794_10000036 | |||
| 1235 | Ga0099794_10011369 | |||
| 1236 | Ga0099795_10042058 | |||
| 1237 | Ga0105251_10000069 | |||
| 1238 | Ga0105240_10001995 | |||
| 1239 | Ga0105240_10002454 | |||
| 1240 | Ga0105240_10002492 | |||
| 1241 | Ga0105240_10004354 | |||
| 1242 | Ga0105240_10007653 | |||
| 1243 | Ga0105240_10018634 | |||
| 1244 | Ga0105240_10088483 | |||
| 1245 | Ga0105240_10178425 | |||
| 1246 | Ga0105240_10312980 | |||
| 1247 | Ga0105240_10476448 | |||
| 1248 | Ga0111539_10013523 | |||
| 1249 | Ga0105245_10001344 | |||
| 1250 | Ga0105245_10001394 | |||
| 1251 | Ga0105245_10026017 | |||
| 1252 | Ga0105245_10074990 | |||
| 1253 | Ga0105245_10129000 | |||
| 1254 | Ga0105245_10641985 | |||
| 1255 | Ga0105247_10000419 | |||
| 1256 | Ga0105247_10000705 | |||
| 1257 | Ga0105247_10293332 | |||
| 1258 | Ga0114129_10003490 | |||
| 1259 | Ga0114129_10007054 | |||
| 1260 | Ga0114129_10065912 | |||
| 1261 | Ga0114129_10086903 | |||
| 1262 | Ga0114129_10203693 | |||
| 1263 | Ga0114129_10396049 | |||
| 1264 | Ga0114129_10429735 | |||
| 1265 | Ga0114129_10939751 | |||
| 1266 | Ga0105243_10302435 | |||
| 1267 | Ga0105243_10629321 | |||
| 1268 | Ga0105241_10000236 | |||
| 1269 | Ga0105241_10000876 | |||
| 1270 | Ga0105241_10049206 | |||
| 1271 | Ga0105241_10085093 | |||
| 1272 | Ga0105241_10111086 | |||
| 1273 | Ga0105241_10111491 | |||
| 1274 | Ga0105241_10198588 | |||
| 1275 | Ga0105241_10249516 | |||
| 1276 | Ga0105242_10000994 | |||
| 1277 | Ga0105242_10066502 | |||
| 1278 | Ga0105242_10073061 | |||
| 1279 | Ga0105242_10303734 | |||
| 1280 | Ga0105242_10352713 | |||
| 1281 | Ga0105248_10001452 | |||
| 1282 | Ga0105248_10003640 | |||
| 1283 | Ga0105248_10017256 | |||
| 1284 | Ga0105248_10059934 | |||
| 1285 | Ga0105248_10177580 | |||
| 1286 | Ga0105248_10503619 | |||
| 1287 | Ga0105237_10000607 | |||
| 1288 | Ga0105237_10003722 | |||
| 1289 | Ga0105237_10004802 | |||
| 1290 | Ga0105237_10108163 | |||
| 1291 | Ga0105237_10109467 | |||
| 1292 | Ga0105238_10000332 | |||
| 1293 | Ga0105238_10001334 | |||
| 1294 | Ga0105238_10003045 | |||
| 1295 | Ga0105238_10003716 | |||
| 1296 | Ga0105238_10011626 | |||
| 1297 | Ga0105238_10019773 | |||
| 1298 | Ga0105238_10020974 | |||
| 1299 | Ga0105238_10027134 | |||
| 1300 | Ga0105238_10180525 | |||
| 1301 | Ga0105238_10590569 | |||
| 1302 | Ga0105249_10000897 | |||
| 1303 | Ga0105249_10151207 | |||
| 1304 | Ga0105249_10493407 | |||
| 1305 | Ga0105239_10001070 | |||
| 1306 | Ga0105239_10006507 | |||
| 1307 | Ga0105239_10008238 | |||
| 1308 | Ga0105239_10014870 | |||
| 1309 | Ga0105239_10039009 | |||
| 1310 | Ga0105239_10065685 | |||
| 1311 | Ga0105239_10075102 | |||
| 1312 | Ga0105239_10140092 | |||
| 1313 | Ga0105239_10151474 | |||
| 1314 | Ga0105239_10492132 | |||
| 1315 | Ga0105239_10993573 | |||
| 1316 | Ga0105246_10001976 | |||
| 1317 | Ga0105246_10247614 | |||
| 1318 | Ga0157373_10053796 | |||
| 1319 | Ga0157370_10000003 | |||
| 1320 | Ga0157370_10813845 | |||
| 1321 | Ga0157369_10001336 | |||
| 1322 | Ga0157369_10001406 | |||
| 1323 | Ga0157369_10002432 | |||
| 1324 | Ga0157369_10134016 | |||
| 1325 | Ga0157374_10007610 | |||
| 1326 | Ga0157374_10007832 | |||
| 1327 | Ga0157374_10008356 | |||
| 1328 | Ga0157374_10032674 | |||
| 1329 | Ga0157374_10038494 | |||
| 1330 | Ga0157374_10220809 | |||
| 1331 | Ga0157374_10251522 | |||
| 1332 | Ga0157374_10347980 | |||
| 1333 | Ga0157374_10570362 | |||
| 1334 | Ga0157374_10876969 | |||
| 1335 | Ga0157378_10004490 | |||
| 1336 | Ga0157378_10044280 | |||
| 1337 | Ga0157378_10083281 | |||
| 1338 | Ga0157378_10261305 | |||
| 1339 | Ga0163162_10000207 | |||
| 1340 | Ga0163162_10002925 | |||
| 1341 | Ga0163162_10473143 | |||
| 1342 | Ga0157372_10000482 | |||
| 1343 | Ga0157372_10009981 | |||
| 1344 | Ga0157372_10124067 | |||
| 1345 | Ga0157372_10144260 | |||
| 1346 | Ga0157375_10017482 | |||
| 1347 | Ga0157375_10151335 | |||
| 1348 | Ga0157375_10235330 | |||
| 1349 | Ga0157375_10275291 | |||
| 1350 | Ga0157375_10442933 | |||
| 1351 | Ga0157375_10580202 | |||
| 1352 | Ga0163163_10003816 | |||
| 1353 | Ga0163163_10008980 | |||
| 1354 | Ga0163163_10131114 | |||
| 1355 | Ga0163163_10233912 | |||
| 1356 | Ga0163163_10746429 | |||
| 1357 | Ga0157379_10000580 | |||
| 1358 | Ga0157379_10003472 | |||
| 1359 | Ga0157379_10148140 | |||
| 1360 | Ga0157376_10000008 | |||
| 1361 | Ga0157376_10019251 | |||
| 1362 | Ga0157376_10036898 | |||
| 1363 | Ga0157376_10515924 | |||
| 1364 | Ga0209563_109893 | |||
| 1365 | Ga0209646_1000017 | |||
| 1366 | Ga0209026_1000196 | |||
| 1367 | Ga0209677_107140 | |||
| 1368 | Ga0209758_1003363 | |||
| 1369 | Ga0209758_1003511 | |||
| 1370 | Ga0207426_1000279 | |||
| 1371 | Ga0207426_1001701 | |||
| 1372 | Ga0209257_1000447 | |||
| 1373 | Ga0207697_10000005 | |||
| 1374 | Ga0207656_10069611 | |||
| 1375 | Ga0207656_10098863 | |||
| 1376 | Ga0207642_10088454 | |||
| 1377 | Ga0207710_10176211 | |||
| 1378 | Ga0207680_10000062 | |||
| 1379 | Ga0207647_10081520 | |||
| 1380 | Ga0207699_10001086 | |||
| 1381 | Ga0207705_10183543 | |||
| 1382 | Ga0207705_10276190 | |||
| 1383 | Ga0207705_10323445 | |||
| 1384 | Ga0207684_10000062 | |||
| 1385 | Ga0207684_10000134 | |||
| 1386 | Ga0207684_10016373 | |||
| 1387 | Ga0207684_10067520 | |||
| 1388 | Ga0207684_10071306 | |||
| 1389 | Ga0207684_10128142 | |||
| 1390 | Ga0207684_10148855 | |||
| 1391 | Ga0207684_10208837 | |||
| 1392 | Ga0207654_10000114 | |||
| 1393 | Ga0207654_10000167 | |||
| 1394 | Ga0207654_10000601 | |||
| 1395 | Ga0207654_10027681 | |||
| 1396 | Ga0207654_10089813 | |||
| 1397 | Ga0207654_10137032 | |||
| 1398 | Ga0207654_10189108 | |||
| 1399 | Ga0207707_10022166 | |||
| 1400 | Ga0207707_10093022 | |||
| 1401 | Ga0207695_10000059 | |||
| 1402 | Ga0207695_10000129 | |||
| 1403 | Ga0207695_10000194 | |||
| 1404 | Ga0207695_10000428 | |||
| 1405 | Ga0207695_10000696 | |||
| 1406 | Ga0207695_10015961 | |||
| 1407 | Ga0207695_10054324 | |||
| 1408 | Ga0207695_10175792 | |||
| 1409 | Ga0207695_10400478 | |||
| 1410 | Ga0207671_10000221 | |||
| 1411 | Ga0207671_10000805 | |||
| 1412 | Ga0207671_10002131 | |||
| 1413 | Ga0207671_10094042 | |||
| 1414 | Ga0207671_10225227 | |||
| 1415 | Ga0207671_10314305 | |||
| 1416 | Ga0207693_10193481 | |||
| 1417 | Ga0207663_10020527 | |||
| 1418 | Ga0207657_10091833 | |||
| 1419 | Ga0207649_10005714 | |||
| 1420 | Ga0207649_10006733 | |||
| 1421 | Ga0207649_10109951 | |||
| 1422 | Ga0207652_10385513 | |||
| 1423 | Ga0207652_10547690 | |||
| 1424 | Ga0207646_10003284 | |||
| 1425 | Ga0207646_10023859 | |||
| 1426 | Ga0207646_10026024 | |||
| 1427 | Ga0207646_10042291 | |||
| 1428 | Ga0207681_10000004 | |||
| 1429 | Ga0207681_10017272 | |||
| 1430 | Ga0207694_10000036 | |||
| 1431 | Ga0207694_10000602 | |||
| 1432 | Ga0207694_10001006 | |||
| 1433 | Ga0207694_10005288 | |||
| 1434 | Ga0207694_10006876 | |||
| 1435 | Ga0207694_10097045 | |||
| 1436 | Ga0207694_10151252 | |||
| 1437 | Ga0207694_10267306 | |||
| 1438 | Ga0207694_10280286 | |||
| 1439 | Ga0207694_10535772 | |||
| 1440 | Ga0207650_10000432 | |||
| 1441 | Ga0207650_10000919 | |||
| 1442 | Ga0207650_10309619 | |||
| 1443 | Ga0207687_10004559 | |||
| 1444 | Ga0207687_10133000 | |||
| 1445 | Ga0207687_10333075 | |||
| 1446 | Ga0207687_10399892 | |||
| 1447 | Ga0207700_10383277 | |||
| 1448 | Ga0207700_10830296 | |||
| 1449 | Ga0207664_10064179 | |||
| 1450 | Ga0207644_10000024 | |||
| 1451 | Ga0207644_10001597 | |||
| 1452 | Ga0207644_10017485 | |||
| 1453 | Ga0207644_10037783 | |||
| 1454 | Ga0207644_10260312 | |||
| 1455 | Ga0207690_10035980 | |||
| 1456 | Ga0207686_10010450 | |||
| 1457 | Ga0207686_10019144 | |||
| 1458 | Ga0207686_10096300 | |||
| 1459 | Ga0207709_10237882 | |||
| 1460 | Ga0207669_10370352 | |||
| 1461 | Ga0207704_10002724 | |||
| 1462 | Ga0207704_10006060 | |||
| 1463 | Ga0207665_10005224 | |||
| 1464 | Ga0207665_10093799 | |||
| 1465 | Ga0207691_10276502 | |||
| 1466 | Ga0207711_10005653 | |||
| 1467 | Ga0207711_10006162 | |||
| 1468 | Ga0207711_10009617 | |||
| 1469 | Ga0207711_10060389 | |||
| 1470 | Ga0207711_10079812 | |||
| 1471 | Ga0207711_10289612 | |||
| 1472 | Ga0207711_10299587 | |||
| 1473 | Ga0207689_10000211 | |||
| 1474 | Ga0207689_10001823 | |||
| 1475 | Ga0207661_10001902 | |||
| 1476 | Ga0207661_10111957 | |||
| 1477 | Ga0207661_10176782 | |||
| 1478 | Ga0207661_10395156 | |||
| 1479 | Ga0207661_10434743 | |||
| 1480 | Ga0207679_10022496 | |||
| 1481 | Ga0207679_10140225 | |||
| 1482 | Ga0207679_10251056 | |||
| 1483 | Ga0207667_10000507 | |||
| 1484 | Ga0207667_10001798 | |||
| 1485 | Ga0207667_10003545 | |||
| 1486 | Ga0207667_10111796 | |||
| 1487 | Ga0207667_10371762 | |||
| 1488 | Ga0207712_10136873 | |||
| 1489 | Ga0207712_10785062 | |||
| 1490 | Ga0207668_10000121 | |||
| 1491 | Ga0207640_10148197 | |||
| 1492 | Ga0207640_10266142 | |||
| 1493 | Ga0207658_10000782 | |||
| 1494 | Ga0207677_10000791 | |||
| 1495 | Ga0207703_10001222 | |||
| 1496 | Ga0207703_10044183 | |||
| 1497 | Ga0207703_10189561 | |||
| 1498 | Ga0207703_10789826 | |||
| 1499 | Ga0207639_10000049 | |||
| 1500 | Ga0207639_10025400 | |||
| 1501 | Ga0207639_10251094 | |||
| 1502 | Ga0207639_10391627 | |||
| 1503 | Ga0207639_10494943 | |||
| 1504 | Ga0207678_10116124 | |||
| 1505 | Ga0207708_10000054 | |||
| 1506 | Ga0207708_10180638 | |||
| 1507 | Ga0207702_10003184 | |||
| 1508 | Ga0207702_10005573 | |||
| 1509 | Ga0207702_10005904 | |||
| 1510 | Ga0207702_10094371 | |||
| 1511 | Ga0207702_10235905 | |||
| 1512 | Ga0207641_10000443 | |||
| 1513 | Ga0207641_10001096 | |||
| 1514 | Ga0207641_10001319 | |||
| 1515 | Ga0207641_10042261 | |||
| 1516 | Ga0207648_10001703 | |||
| 1517 | Ga0207648_10072751 | |||
| 1518 | Ga0207648_10301092 | |||
| 1519 | Ga0207676_10042854 | |||
| 1520 | Ga0207676_10132522 | |||
| 1521 | Ga0207676_10275553 | |||
| 1522 | Ga0207676_10451140 | |||
| 1523 | Ga0207674_10001069 | |||
| 1524 | Ga0207674_10025752 | |||
| 1525 | Ga0207674_10045501 | |||
| 1526 | Ga0207674_10066687 | |||
| 1527 | Ga0207674_10143410 | |||
| 1528 | Ga0207674_10173762 | |||
| 1529 | Ga0207674_10247375 | |||
| 1530 | Ga0207675_100000028 | |||
| 1531 | Ga0207683_10071303 | |||
| 1532 | Ga0207698_10000027 | |||
| 1533 | Ga0207698_10000037 | |||
| 1534 | Ga0207698_10002184 | |||
| 1535 | Ga0209588_1000020 | |||
| 1536 | Ga0207428_10000314 | |||
| 1537 | Ga0207428_10283567 | |||
| 1538 | Ga0268266_10000226 | |||
| 1539 | Ga0268266_10000859 | |||
| 1540 | Ga0268266_10065148 | |||
| 1541 | Ga0268266_10077410 | |||
| 1542 | Ga0268266_10236872 | |||
| 1543 | Ga0268266_10414662 | |||
| 1544 | Ga0268265_10000046 | |||
| 1545 | Ga0268265_10116671 | |||
| 1546 | Ga0268265_10330097 | |||
| 1547 | Ga0268264_10000180 | |||
| 1548 | Ga0268264_10007721 | |||
| 1549 | Ga0268264_10368694 | |||
| 1550 | Ga0268264_10369439 | |||
| 1551 | Ga0268264_10868456 | |||
| 1552 | Ga0265326_10022631 | |||
| 1553 | Ga0265319_1007674 | |||
| 1554 | Ga0265318_10056705 | |||
| 1555 | Ga0265323_10051918 | |||
| 1556 | Ga0265336_10000350 | |||
| 1557 | Ga0307515_10000008 | |||
| 1558 | Ga0265338_10000086 | |||
| 1559 | Ga0265338_10000160 | |||
| 1560 | Ga0265338_10082988 | |||
| 1561 | Ga0265338_10154894 | |||
| 1562 | Ga0265338_10183859 | |||
| 1563 | Ga0265324_10012189 | |||
| 1564 | Ga0265324_10025764 | |||
| 1565 | Ga0265765_1003956 | |||
| 1566 | Ga0265330_10045318 | |||
| 1567 | Ga0265330_10050899 | |||
| 1568 | Ga0265332_10049301 | |||
| 1569 | Ga0265328_10040231 | |||
| 1570 | Ga0265320_10087257 | |||
| 1571 | Ga0265325_10028791 | |||
| 1572 | Ga0265340_10082455 | |||
| 1573 | Ga0265340_10150446 | |||
| 1574 | Ga0265327_10001103 | |||
| 1575 | Ga0265316_10065636 | |||
| 1576 | Ga0265316_10132163 | |||
| 1577 | Ga0265313_10025006 | |||
| 1578 | Ga0307508_10000214 | |||
| 1579 | Ga0265314_10002933 | |||
| 1580 | Ga0265314_10003720 | |||
| 1581 | Ga0265314_10037211 | |||
| 1582 | Ga0265314_10093037 | |||
| 1583 | Ga0265314_10170609 | |||
| 1584 | Ga0265342_10008129 | |||
| 1585 | Ga0265342_10124122 | |||
| 1586 | Ga0307516_10023011 | |||
| 1587 | Ga0307516_10037947 | |||
| 1588 | Ga0307516_10406724 | |||
| 1589 | Ga0307413_10345528 | |||
| 1590 | Ga0307410_10190105 | |||
| 1591 | Ga0307510_10000955 | |||
| 1592 | Ga0373940_0020682 | |||
| 1593 | Ga0373923_0088850 | |||
| 1594 | Ga0373953_0218019 | |||
| 1595 | Ga0373954_0003984 | |||
| 1596 | Ga0373957_0033066 | |||
| 1597 | Ga0373955_0026260 | |||
| 1598 | Ga0373962_0029082 | |||
| 1599 | Ga0373924_0072171 | |||
| 1600 | Ga0373931_0007102 | |||
| 1601 | Ga0373933_0010365 | |||
| 1602 | Ga0373937_0008928 | |||
| 1603 | Ga0373937_0024449 | |||
| 1604 | Ga0373937_0484509 | |||
| 1605 | Ga0373937_0608921 | |||
| 1606 | Ga0373925_0004993 | |||
| 1607 | Ga0373925_0236564 | |||
| 1608 | Ga0395900_0115765 | |||
| 1609 | Ga0395900_0511921 | |||
| 1610 | Ga0395900_0569018 | |||
| 1611 | Ga0395898_0241088 | |||
| 1612 | Ga0395898_0495101 | |||
| 1613 | Ga0436365_0923788 | |||
| 1614 | Ga0436365_1874016 | |||
| 1615 | Ga0436361_1204031 | |||
| 1616 | Ga0439459_0005415 | |||
| 1617 | Ga0451577_0050187 | |||
| 1618 | Ga0451577_0052904 | |||
| 1619 | Ga0451577_0054652 | |||
| 1620 | Ga0466972_0019787 | |||
| 1621 | Ga0453683_0098308 | |||
| 1622 | Ga0466963_0025955 | |||
| 1623 | Ga0453684_0000185 | |||
| 1624 | Ga0453684_0048166 | |||
| 1625 | Ga0453684_0179472 | |||
| 1626 | Ga0466960_0130493 | |||
| 1627 | Ga0451576_0393709 | |||
| 1628 | Ga0466967_0008873 | |||
| 1629 | Ga0466967_0189096 | |||
| 1630 | Ga0495617_078056 | |||
| 1631 | Ga0495627_000711 | |||
| 1632 | Ga0495592_0086088 | |||
| 1633 | Ga0495629_0002619 | |||
| 1634 | Ga0495638_0079331 | |||
| 1635 | Ga0495641_0014302 | |||
| 1636 | Ga0495651_0001592 | |||
| 1637 | Ga0495651_0094285 | |||
| 1638 | Ga0495653_0128098 | |||
| 1639 | Ga0495580_0004204 | |||
| 1640 | Ga0495580_0045352 | |||
| 1641 | Ga0495580_0048120 | |||
| 1642 | Ga0495639_0037568 | |||
| 1643 | Ga0495662_0027324 | |||
| 1644 | Ga0495662_0157580 | |||
| 1645 | Ga0495664_0013202 | |||
| 1646 | Ga0495584_0058278 | |||
| 1647 | Ga0495594_0116450 | |||
| 1648 | Ga0495594_0290816 | |||
| 1649 | Ga0495606_0057204 | |||
| 1650 | Ga0495610_0018098 | |||
| 1651 | Ga0495618_0155892 | |||
| 1652 | Ga0495618_0283079 | |||
| 1653 | Ga0495628_0123004 | |||
| 1654 | Ga0495628_0230608 | |||
| 1655 | Ga0495628_0247015 | |||
| 1656 | Ga0495628_0273224 | |||
| 1657 | Ga0495630_0000001 | |||
| 1658 | Ga0495648_0068879 | |||
| 1659 | Ga0495652_0003794 | |||
| 1660 | Ga0495652_0049165 | |||
| 1661 | Ga0495652_0120401 | |||
| 1662 | Ga0495652_0162238 | |||
| 1663 | Ga0495587_0012596 | |||
| 1664 | Ga0495587_0127901 | |||
| 1665 | Ga0495645_0137711 | |||
| 1666 | Ga0495645_0162428 | |||
| 1667 | Ga0495667_0007233 | |||
| 1668 | Ga0495667_0018550 | |||
| 1669 | Ga0495667_0046646 | |||
| 1670 | Ga0495667_0388400 | |||
| 1671 | Ga0495668_0076166 | |||
| 1672 | Ga0495634_0129520 | |||
| 1673 | Ga0495634_0176238 | |||
| 1674 | Ga0495625_0079449 | |||
| 1675 | Ga0495625_0188374 | |||
| 1676 | Ga0495625_0271206 | |||
| 1677 | Ga0495635_0001132 | |||
| 1678 | Ga0495635_0022927 | |||
| 1679 | Ga0495659_0042771 | |||
| 1680 | Ga0495588_0016886 | |||
| 1681 | Ga0495657_0027407 | |||
| 1682 | Ga0495657_0033401 | |||
| 1683 | Ga0495599_0077050 | |||
| 1684 | Ga0495599_0148560 | |||
| 1685 | Ga0495599_0184565 | |||
| 1686 | Ga0495623_0010103 | |||
| 1687 | Ga0495623_0026832 | |||
| 1688 | Ga0495646_0031794 | |||
| 1689 | Ga0495646_0077375 | |||
| 1690 | Ga0495613_0011390 | |||
| 1691 | Ga0495613_0123028 | |||
| 1692 | Ga0495613_0126713 | |||
| 1693 | Ga0495613_0396913 | |||
| 1694 | Ga0495670_0031961 | |||
| 1695 | Ga0495649_0090461 | |||
| 1696 | Ga0495589_0006775 | |||
| 1697 | Ga0495589_0152526 | |||
| 1698 | Ga0495600_0001360 | |||
| 1699 | Ga0495600_0105185 | |||
| 1700 | Ga0495581_0136911 | |||
| 1701 | Ga0495604_0008401 | |||
| 1702 | Ga0495604_0277004 | |||
| 1703 | Ga0495674_0021099 | |||
| 1704 | Ga0495674_0090827 | |||
| 1705 | Ga0495674_0324017 | |||
| 1706 | Ga0495672_0008826 | |||
| 1707 | Ga0495676_0018510 | |||
| 1708 | Ga0495676_0124706 | |||
| 1709 | Ga0495680_0004905 | |||
| 1710 | Ga0495680_0417871 | |||
| 1711 | Ga0495683_0054075 | |||
| 1712 | Ga0495675_0018271 | |||
| 1713 | Ga0495679_007235 | |||
| 1714 | Ga0495684_0000364 | |||
| 1715 | Ga0495684_0022288 | |||
| 1716 | Ga0495684_0026426 | |||
| 1717 | Ga0495684_0074058 | |||
| 1718 | Ga0495684_0308365 | |||
| 1719 | Ga0495686_0050683 | |||
| 1720 | Ga0495686_0111680 | |||
| 1721 | Ga0495686_0218786 | |||
| 1722 | Ga0495593_0029368 | |||
| 1723 | Ga0495602_0005811 | |||
| 1724 | Ga0495602_0049129 | |||
| 1725 | Ga0495602_0060836 | |||
| 1726 | Ga0495602_0064361 | |||
| 1727 | Ga0496102_0005344 | |||
| 1728 | Ga0496102_0747258 | |||
| 1729 | Ga0496104_0006263 | |||
| 1730 | Ga0496104_0021646 | |||
| 1731 | Ga0496105_0018216 | |||
| 1732 | Ga0496105_0075831 | |||
| 1733 | Ga0496106_0431044 | |||
| 1734 | Ga0496108_0345187 | |||
| 1735 | Ga0496109_0514494 | |||
| 1736 | Ga0496109_0710264 | |||
| 1737 | Ga0496114_0232128 | |||
| 1738 | Ga0496115_0002166 | |||
| 1739 | Ga0496115_0011264 | |||
| 1740 | Ga0496116_0005936 | |||
| 1741 | Ga0496117_0022494 | |||
| 1742 | Ga0496118_0009619 | |||
| 1743 | Ga0496118_0028759 | |||
| 1744 | Ga0496119_0014813 | |||
| 1745 | Ga0496119_0133575 | |||
| 1746 | Ga0496120_0014944 | |||
| 1747 | Ga0496120_0020206 | |||
| 1748 | Ga0496121_0013413 | |||
| 1749 | Ga0496121_0019990 | |||
| 1750 | Ga0496121_0021352 | |||
| 1751 | Ga0496122_0072136 | |||
| 1752 | Ga0496124_0001004 | |||
| 1753 | Ga0496124_0204807 | |||
| 1754 | Ga0496124_0247149 | |||
| 1755 | Ga0496125_0000092 | |||
| 1756 | Ga0496125_0002341 | |||
| 1757 | Ga0496125_0006440 | |||
| 1758 | Ga0496125_0163445 | |||
| 1759 | Ga0496126_0036454 | |||
| 1760 | Ga0496126_0038039 | |||
| 1761 | Ga0501031_0001375 | |||
| 1762 | Ga0501032_0006786 | |||
| 1763 | Ga0501033_0003741 | |||
| 1764 | Ga0501034_0000831 | |||
| 1765 | Ga0501034_0005434 | |||
| 1766 | Ga0501034_0044153 | |||
| 1767 | Ga0501034_0263329 | |||
| 1768 | Ga0501036_0012120 | |||
| 1769 | Ga0501037_0004091 | |||
| 1770 | Ga0501037_0009808 | |||
| 1771 | Ga0501038_0000073 | |||
| 1772 | Ga0501038_0060624 | |||
| 1773 | Ga0501039_0004136 | |||
| 1774 | Ga0501039_0105628 | |||
| 1775 | Ga0501040_0483300 | |||
| 1776 | Ga0501042_0062937 | |||
| 1777 | Ga0501043_0000609 | |||
| 1778 | Ga0501043_0035977 | |||
| 1779 | Ga0501043_0123461 | |||
| 1780 | Ga0501046_0000020 | |||
| 1781 | Ga0501046_0000911 | |||
| 1782 | Ga0501046_0008367 | |||
| 1783 | Ga0501047_0009250 | |||
| 1784 | Ga0501047_0037175 | |||
| 1785 | Ga0501047_0058858 | |||
| 1786 | Ga0501047_0113673 | |||
| 1787 | Ga0501048_0000276 | |||
| 1788 | Ga0501048_0022094 | |||
| 1789 | Ga0501067_0002927 | |||
| 1790 | Ga0501069_0002719 | |||
| 1791 | Ga0501069_0012510 | |||
| 1792 | Ga0501070_0003152 | |||
| 1793 | Ga0501070_0027889 | |||
| 1794 | Ga0501070_0326634 | |||
| 1795 | Ga0501071_0163128 | |||
| 1796 | Ga0501072_0014591 | |||
| 1797 | Ga0501072_0089696 | |||
| 1798 | Ga0501073_0009784 | |||
| 1799 | Ga0501073_0017715 | |||
| 1800 | Ga0501074_0003592 | |||
| 1801 | Ga0501074_0159383 | |||
| 1802 | Ga0501079_0003469 | |||
| 1803 | Ga0501080_0091317 | |||
| 1804 | Ga0501080_0100647 | |||
| 1805 | Ga0501080_0388270 | |||
| 1806 | Ga0501083_0000005 | |||
| 1807 | Ga0501083_0011237 | |||
| 1808 | Ga0501083_0125575 | |||
| 1809 | Ga0501035_0058520 | |||
| 1810 | Ga0501035_0172775 | |||
| 1811 | Ga0501035_0465833 | |||
| 1812 | Ga0501044_0031001 | |||
| 1813 | Ga0501044_0058302 | |||
| 1814 | Ga0501044_0206932 | |||
| 1815 | nmdc:mga00v17_9282_c1 | |||
| 1816 | nmdc:mga0yw44_13180_c1 | |||
| 1817 | nmdc:mga0yw44_5651_c1 | |||
| 1818 | nmdc:mga05p37_36371_c1 | |||
| 1819 | nmdc:mga05p37_502743_c1 | |||
| 1820 | nmdc:mga05p37_573042_c1 | |||
| 1821 | nmdc:mga05p37_81121_c1 | |||
| 1822 | nmdc:mga05p37_8360_c2 | |||
| 1823 | nmdc:mga09592_18178_c1 | |||
| 1824 | nmdc:mga0qj67_99338_c1 | |||
| 1825 | nmdc:mga06r32_125328_c1 | |||
| 1826 | nmdc:mga06r32_148299_c1 | |||
| 1827 | nmdc:mga06r32_33075_c1 | |||
| 1828 | nmdc:mga06r32_432487_c1 | |||
| 1829 | nmdc:mga06r32_8053_c1 | |||
| 1830 | nmdc:mga08y16_359779_c1 | |||
| 1831 | nmdc:mga08y16_3745_c1 | |||
| 1832 | nmdc:mga0n895_102632_c1 | |||
| 1833 | nmdc:mga0n895_175808_c1 | |||
| 1834 | nmdc:mga0n895_537280_c1 | |||
| 1835 | nmdc:mga0n895_62033_c1 | |||
| 1836 | nmdc:mga0n895_66565_c1 | |||
| 1837 | nmdc:mga0rr50_185187_c1 | |||
| 1838 | nmdc:mga0rr50_279104_c1 | |||
| 1839 | nmdc:mga0rr50_52726_c1 | |||
| 1840 | nmdc:mga0rr50_769448_c1 | |||
| 1841 | nmdc:mga0rr50_89940_c1 | |||
| 1842 | nmdc:mga0a205_114036_c1 | |||
| 1843 | nmdc:mga0a205_11548_c1 | |||
| 1844 | nmdc:mga0a205_37316_c1 | |||
| 1845 | nmdc:mga0a205_56692_c1 | |||
| 1846 | nmdc:mga0a205_94617_c1 | |||
| 1847 | nmdc:mga0sz30_1962_c1 | |||
| 1848 | Ga0500635_0021659 | |||
| 1849 | Ga0500578_0037339 | |||
| 1850 | Ga0500643_000048 | |||
| 1851 | Ga0500643_022191 | |||
| 1852 | Ga0500644_0005789 | |||
| 1853 | Ga0500581_032426 | |||
| 1854 | Ga0500646_0072437 | |||
| 1855 | Ga0500651_0046502 | |||
| 1856 | Ga0500566_0000466 | |||
| 1857 | Ga0500566_0014261 | |||
| 1858 | Ga0500640_114588 | |||
| 1859 | Ga0500648_171458 | |||
| 1860 | Ga0500650_0254473 | |||
| 1861 | Ga0500555_003969 | |||
| 1862 | Ga0500556_0000024 | |||
| 1863 | Ga0500556_0007119 | |||
| 1864 | Ga0500557_000355 | |||
| 1865 | Ga0500562_006937 | |||
| 1866 | Ga0500569_076333 | |||
| 1867 | Ga0500572_007323 | |||
| 1868 | Ga0500593_026264 | |||
| 1869 | Ga0500595_027716 | |||
| 1870 | Ga0500607_012481 | |||
| 1871 | Ga0500608_014653 | |||
| 1872 | Ga0500618_003931 | |||
| 1873 | Ga0500642_0000035 | |||
| 1874 | Ga0500642_0012927 | |||
| 1875 | Ga0500652_000134 | |||
| 1876 | Ga0500658_0049494 | |||
| 1877 | Ga0500658_0158252 | |||
| 1878 | Ga0500559_0002381 | |||
| 1879 | Ga0500559_0019519 | |||
| 1880 | Ga0500559_0179752 | |||
| 1881 | Ga0500564_070132 | |||
| 1882 | Ga0500577_0001590 | |||
| 1883 | Ga0500590_111728 | |||
| 1884 | Ga0500616_0000122 | |||
| 1885 | Ga0500616_0147834 | |||
| 1886 | Ga0500622_0001726 | |||
| 1887 | Ga0500622_0002746 | |||
| 1888 | Ga0500633_0017745 | |||
| 1889 | Ga0500636_0000080 | |||
| 1890 | Ga0500636_0005624 | |||
| 1891 | Ga0500625_027612 | |||
| 1892 | Ga0500645_033387 | |||
| 1893 | Ga0500596_009867 | |||
| 1894 | Ga0500599_000096 | |||
| 1895 | Ga0500601_000167 | |||
| 1896 | Ga0501084_0023284 | |||
| 1897 | Ga0500661_001708 | |||
| 1898 | 2508540056 | |||
| 1899 | 2511123935 | |||
| 1900 | 2513649830 | |||
| 1901 | 2515631695 | |||
| 1902 | 2528851387 | |||
| 1903 | 2603861087 | |||
| 1904 | 2671118159 | |||
| 1905 | 2818240830 | |||
| 1906 | 2819539123 | |||
| 1907 | 2819647998 | |||
| 1908 | 2824605566 | |||
| 1909 | 2824610864 | |||
| 1910 | 2824653915 | |||
| 1911 | 2824663680 | |||
| 1912 | 2842401190 | |||
| 1913 | 2844321525 | |||
| 1914 | 2857528785 | |||
| 1915 | 2874596399 | |||
| 1916 | 2874650386 | |||
| 1917 | 2876776864 | |||
| 1918 | 2876824654 | |||
| 1919 | 2879081001 | |||
| 1920 | 2879106561 | |||
| 1921 | 2879128231 | |||
| 1922 | 2879143526 | |||
| 1923 | 2888387779 | |||
| 1924 | 2888389999 | |||
| 1925 | 2889420898 | |||
| 1926 | 2893068980 | |||
| 1927 | 2903727896 | |||
| 1928 | 2906602620 | |||
| 1929 | 2906631936 | |||
| 1930 | 2922377545 | |||
| 1931 | 2929622329 | |||
| 1932 | 2929630025 | |||
| 1933 | 2932788042 | |||
| 1934 | 2932799473 | |||
| 1935 | 2932805221 | |||
| 1936 | 2932813417 | |||
| 1937 | 2932820114 | |||
| 1938 | 2932832822 | |||
| 1939 | 2933584057 | |||
| 1940 | 2935620307 | |||
| 1941 | 2935640632 | |||
| 1942 | 2935649320 | |||
| 1943 | 2935657908 | |||
| 1944 | 2935668824 | |||
| 1945 | 2935681450 | |||
| 1946 | 2935687132 | |||
| 1947 | 2935696897 | |||
| 1948 | 2935709011 | |||
| 1949 | 2935716820 | |||
| 1950 | 2935723055 | |||
| 1951 | 2935734612 | |||
| 1952 | 2935744597 | |||
| 1953 | 2935753098 | |||
| 1954 | 2935767502 | |||
| 1955 | 2935770147 | |||
| 1956 | 2935777823 | |||
| 1957 | 2935786799 | |||
| 1958 | 2935794853 | |||
| 1959 | 2935804741 | |||
| 1960 | 2935815891 | |||
| 1961 | 2935832138 | |||
| 1962 | 2935841032 | |||
| 1963 | 2935859193 | |||
| 1964 | 2935864377 | |||
| 1965 | 2935875271 | |||
| 1966 | 2935887690 | |||
| 1967 | 2935978280 | |||
| 1968 | 2935985596 | |||
| 1969 | 2935995754 | |||
| 1970 | 2936005665 | |||
| 1971 | 2936012127 | |||
| 1972 | 2936020792 | |||
| 1973 | 2936029420 | |||
| 1974 | 2936041794 | |||
| 1975 | 2936048256 | |||
| 1976 | 2940559011 | |||
| 1977 | 2941541706 | |||
| 1978 | 8005697202 | |||
| 1979 | 8006933416 | |||
| 1980 | 8016517394 | |||
| 1981 | 8016526896 | |||
| 1982 | 8016531983 | |||
| 1983 | 8016545187 | |||
| 1984 | 8016556892 | |||
| 1985 | 8016565245 | |||
| 1986 | 8016570270 | |||
| 1987 | 8016582821 | |||
| 1988 | 8016602887 | |||
| 1989 | 8016605760 | |||
| 1990 | 8016617667 | |||
| 1991 | 8016623903 | |||
| 1992 | 8017059215 | |||
| 1993 | 8019531800 | |||
| 1994 | 8019539725 | |||
| 1995 | 8019550922 | |||
| 1996 | 8019576418 | |||
| 1997 | 8019607272 | |||
| 1998 | 8019611245 | |||
| 1999 | 8019639328 | |||
| 2000 | 8019668100 | |||
| 2001 | 8019677566 | |||
| 2002 | 8019687383 | |||
| 2003 | 8055743421 | |||
| 2004 | 8056975399 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7v0h-assembly1.cif.gz_B | crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with nadp and a potential reaction product | 0.9766 | 2 | 217 |
| 7v0h-assembly1.cif.gz_B | crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with nadp and a potential reaction product | 0.9678 | 2 | 217 |
| 4bms-assembly1.cif.gz_F | short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph | 0.9559 | 1 | 216 |
| 4bms-assembly2.cif.gz_E-2 | short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph | 0.9547 | 3 | 216 |
| 4bms-assembly1.cif.gz_B | short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph | 0.9544 | 1 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54QN6_1_250_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9524 | 5 | 216 | 3.40.50.720 |
| 4mowD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9514 | 2 | 217 | 3.40.50.720 |
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9485 | 3 | 150 | 3.40.50.720 |
| 3nugC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9449 | 1 | 217 | 3.40.50.720 |
| af_I1LJY0_35_302_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9429 | 2 | 216 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W7GTV1-F1-model_v4 | deleted | 0.9936 | 1 | 217 |
|
| AF-A0A6P2XBE5-F1-model_v4 | deleted | 0.9911 | 1 | 217 |
|
| AF-A0A2W7GTV1-F1-model_v4 | deleted | 0.9891 | 1 | 217 |
|
| AF-A0A511EWG1-F1-model_v4 | deleted | 0.9877 | 1 | 217 |
|
| AF-A0A6P2XBE5-F1-model_v4 | deleted | 0.9866 | 1 | 217 |
|