F487940

General Info

Members Datasets Scaffolds Average Seq Length
1003 274 2006 141

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0034144|Ga0395900_0034144_573_1049
Length 158
Sequence LGSRLRGNDGIFDFRSNMTRIDFHTNIPDKLSYACRLARKAYAAHAKLVLLADSQAQADALNEALWTLSGTDFIPHVMAGDPLAPETPVIVTADEQVELPHRDMLVNLTRRTPAGFERFARVFEIISTDEEDAAAGRARYVAYKKQSYPLTHFVAGQS

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
98 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
99 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
100 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
101 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
102 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
115 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
116 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
117 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
118 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
119 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
223 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
261 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
262 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
263 2643221556 Massilia sp. Root1485 Isolate Unclassified
264 2643221684 Massilia sp. Root133 Isolate Unclassified
265 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
266 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
267 2857553236 Duganella sp. R-74557 Isolate Unclassified
268 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
269 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
270 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
271 2919476304 Duganella sp. 3397 Isolate Unclassified
272 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
273 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
274 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 0.7
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0.7
Rhizoplane 6.58
Rhizosphere 83.45
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0034144 3300037418 Bacteria 5236
2 JGI24735J21928_10000315 3300002067 Bacteria 16821
3 JGI25151J46595_10003169 3300003187 Bacteria 9242
4 JGI25151J46595_10015580 3300003187 Bacteria 3345
5 JGI25151J46595_10076164 3300003187 Bacteria 992
6 rootL2_10090814 3300003322 Bacteria 1993
7 Ga0055539_1026174 3300003752 Bacteria 677
8 Ga0055525_1000009 3300003759 Bacteria 596899
9 Ga0055542_1014183 3300003762 Bacteria 1317
10 Ga0055526_1002809 3300003771 Bacteria 11531
11 Ga0055526_1002900 3300003771 Bacteria 11295
12 Ga0055526_1009169 3300003771 Bacteria 4809
13 Ga0055537_1001304 3300003773 Bacteria 10241
14 Ga0055524_1000644 3300003775 Bacteria 24800
15 Ga0055524_1012209 3300003775 Bacteria 3311
16 Ga0055536_1000123 3300003781 Bacteria 66351
17 Ga0055534_1000683 3300003784 Bacteria 16806
18 Ga0055534_1005042 3300003784 Bacteria 3645
19 Ga0055534_1050114 3300003784 Bacteria 595
20 Ga0065165_1002937 3300005262 Bacteria 12990
21 Ga0065714_10229500 3300005288 Bacteria 815
22 Ga0070658_10195032 3300005327 Bacteria 1708
23 Ga0070658_10550350 3300005327 Bacteria 998
24 Ga0070658_10823616 3300005327 Bacteria 806
25 Ga0070658_10967173 3300005327 Bacteria 740
26 Ga0070658_11885013 3300005327 Bacteria 516
27 Ga0070670_101020053 3300005331 Bacteria 753
28 Ga0070660_100013393 3300005339 Bacteria 5883
29 Ga0070660_100085697 3300005339 Bacteria 2478
30 Ga0070660_100175571 3300005339 Bacteria 1732
31 Ga0070660_101097301 3300005339 Bacteria 673
32 Ga0070661_100211592 3300005344 Bacteria 1484
33 Ga0070661_100739517 3300005344 Bacteria 804
34 Ga0070675_101109308 3300005354 Bacteria 728
35 Ga0070671_101332938 3300005355 Bacteria 633
36 Ga0070659_100149993 3300005366 Bacteria 1901
37 Ga0070663_100506654 3300005455 Bacteria 1003
38 Ga0070678_100268723 3300005456 Bacteria 1437
39 Ga0070662_100180947 3300005457 Bacteria 1661
40 Ga0070662_100197664 3300005457 Bacteria 1594
41 Ga0070662_100574189 3300005457 Bacteria 947
42 Ga0068867_100933014 3300005459 Bacteria 783
43 Ga0068855_100206849 3300005563 Bacteria 2207
44 Ga0068855_100427654 3300005563 Bacteria 1448
45 Ga0070664_100075292 3300005564 Bacteria 2898
46 Ga0070664_100279474 3300005564 Bacteria 1505
47 Ga0070664_100942039 3300005564 Bacteria 810
48 Ga0070664_101131972 3300005564 Bacteria 738
49 Ga0068854_100985292 3300005578 Bacteria 745
50 Ga0068856_100208336 3300005614 Bacteria 1970
51 Ga0068852_100248999 3300005616 Bacteria 1701
52 Ga0068871_100273939 3300006358 Bacteria 1475
53 Ga0068865_101853379 3300006881 Bacteria 546
54 Ga0099823_1126582 3300006944 Bacteria 632
55 Ga0099826_10000016 3300006948 Bacteria 210934
56 Ga0105251_10000415 3300009011 Bacteria 41488
57 Ga0105251_10069980 3300009011 Bacteria 1635
58 Ga0105244_10074650 3300009036 Bacteria 1686
59 Ga0105244_10276046 3300009036 Bacteria 780
60 Ga0105240_10184873 3300009093 Bacteria 2456
61 Ga0105245_11069641 3300009098 Bacteria 852
62 Ga0105243_10042909 3300009148 Bacteria 3544
63 Ga0105241_10017143 3300009174 Bacteria 5320
64 Ga0105241_11180634 3300009174 Bacteria 724
65 Ga0105238_10091926 3300009551 Bacteria 3022
66 Ga0105238_10111405 3300009551 Bacteria 2717
67 Ga0105239_10680763 3300010375 Bacteria 1175
68 Ga0105246_10368129 3300011119 Bacteria 1183
69 Ga0157371_10000001 3300013102 Bacteria 1162285
70 Ga0157371_11053836 3300013102 Bacteria 622
71 Ga0157370_11245553 3300013104 Bacteria 671
72 Ga0157369_10118972 3300013105 Bacteria 2804
73 Ga0157369_10495354 3300013105 Bacteria 1264
74 Ga0157378_10487090 3300013297 Bacteria 1230
75 Ga0163162_10033912 3300013306 Bacteria 5076
76 Ga0157372_10746710 3300013307 Bacteria 1138
77 Ga0157372_12396790 3300013307 Bacteria 606
78 Ga0182008_10005149 3300014497 Bacteria 7501
79 Ga0182008_10027101 3300014497 Bacteria 2905
80 Ga0182006_1000268 3300015261 Bacteria 47147
81 Ga0182006_1079214 3300015261 Bacteria 1201
82 Ga0182007_10009746 3300015262 Bacteria 3846
83 Ga0182007_10054035 3300015262 Bacteria 1321
84 Ga0182005_1000014 3300015265 Bacteria 389763
85 Ga0182005_1000018 3300015265 Bacteria 324307
86 Ga0163161_10014907 3300017792 Bacteria 5414
87 Ga0163161_10164069 3300017792 Bacteria 1696
88 Ga0209563_100015 3300025230 Bacteria 879901
89 Ga0207425_1026655 3300025245 Bacteria 1184
90 Ga0209677_112273 3300025253 Bacteria 1282
91 Ga0209148_1000930 3300025254 Bacteria 19265
92 Ga0209565_1000093 3300025263 Bacteria 138690
93 Ga0209565_1002895 3300025263 Bacteria 5867
94 Ga0209673_1029808 3300025273 Bacteria 1730
95 Ga0209130_1018698 3300025284 Bacteria 1621
96 Ga0209675_1000203 3300025291 Bacteria 62939
97 Ga0209675_1000602 3300025291 Bacteria 25808
98 Ga0209675_1018934 3300025291 Bacteria 1911
99 Ga0209676_1000012 3300025292 Bacteria 841431
100 Ga0209025_1000124 3300025294 Bacteria 201973
101 Ga0209025_1001162 3300025294 Bacteria 37273
102 Ga0209025_1001443 3300025294 Bacteria 31259
103 Ga0209025_1003964 3300025294 Bacteria 13284
104 Ga0209564_1000305 3300025295 Bacteria 96990
105 Ga0209564_1000701 3300025295 Bacteria 49090
106 Ga0209564_1001579 3300025295 Bacteria 22276
107 Ga0209758_1058277 3300025297 Bacteria 1293
108 Ga0209050_1085854 3300025298 Bacteria 657
109 Ga0209256_1000388 3300025299 Bacteria 69926
110 Ga0209256_1000409 3300025299 Bacteria 67842
111 Ga0207426_1002357 3300025302 Bacteria 12298
112 Ga0209051_1006398 3300025303 Bacteria 6645
113 Ga0207655_1105279 3300025728 Bacteria 963
114 Ga0207713_1010886 3300025735 Bacteria 4996
115 Ga0207713_1053124 3300025735 Bacteria 1598
116 Ga0207705_10063363 3300025909 Bacteria 2671
117 Ga0207705_10135033 3300025909 Bacteria 1838
118 Ga0207705_10431302 3300025909 Bacteria 1021
119 Ga0207654_10027453 3300025911 Bacteria 3094
120 Ga0207654_10895188 3300025911 Bacteria 643
121 Ga0207671_10337892 3300025914 Bacteria 1193
122 Ga0207660_10451381 3300025917 Bacteria 1040
123 Ga0207657_10027156 3300025919 Bacteria 5247
124 Ga0207657_10137307 3300025919 Bacteria 2000
125 Ga0207657_10137534 3300025919 Bacteria 1998
126 Ga0207694_10029691 3300025924 Bacteria 4173
127 Ga0207694_11058590 3300025924 Bacteria 686
128 Ga0207659_10756157 3300025926 Bacteria 834
129 Ga0207687_10715231 3300025927 Bacteria 851
130 Ga0207644_10147849 3300025931 Bacteria 1816
131 Ga0207690_10070747 3300025932 Bacteria 2404
132 Ga0207706_10163947 3300025933 Bacteria 1953
133 Ga0207706_10256436 3300025933 Bacteria 1527
134 Ga0207686_10096973 3300025934 Bacteria 1960
135 Ga0207686_10263092 3300025934 Bacteria 1265
136 Ga0207709_10125201 3300025935 Bacteria 1742
137 Ga0207704_10759638 3300025938 Bacteria 807
138 Ga0207689_10451683 3300025942 Bacteria 1074
139 Ga0207679_10461000 3300025945 Bacteria 1129
140 Ga0207679_10546288 3300025945 Bacteria 1039
141 Ga0207667_10023046 3300025949 Bacteria 6862
142 Ga0207667_10258877 3300025949 Bacteria 1779
143 Ga0207640_10041675 3300025981 Bacteria 2922
144 Ga0207639_10460079 3300026041 Bacteria 1156
145 Ga0207678_10080552 3300026067 Bacteria 2788
146 Ga0207678_10321486 3300026067 Bacteria 1331
147 Ga0207648_10599689 3300026089 Bacteria 1015
148 Ga0207674_10151402 3300026116 Bacteria 2277
149 Ga0207683_10343816 3300026121 Bacteria 1368
150 Ga0207698_10443628 3300026142 Bacteria 1251
151 Ga0209281_1002048 3300027111 Bacteria 9100
152 Ga0209282_1000080 3300027666 Bacteria 73508
153 Ga0316178_1071755 3300030735 Bacteria 3131
154 Ga0316180_1024582 3300030736 Bacteria 2151
155 Ga0316181_1020261 3300030744 Bacteria 1648
156 Ga0316182_1281142 3300030745 Bacteria 2214
157 Ga0307513_10372073 3300031456 Bacteria 1171
158 Ga0307408_100002121 3300031548 Bacteria 14242
159 Ga0395899_0000330 3300037312 Bacteria 60063
160 Ga0395899_0001893 3300037312 Bacteria 17273
161 Ga0395899_0015861 3300037312 Bacteria 5745
162 Ga0395899_0046032 3300037312 Bacteria 3249
163 Ga0395899_0061526 3300037312 Bacteria 2765
164 Ga0395899_0316431 3300037312 Bacteria 1052
165 Ga0395899_0531663 3300037312 Bacteria 758
166 Ga0395900_0002680 3300037418 Bacteria 19461
167 Ga0395900_0017086 3300037418 Bacteria 7406
168 Ga0395900_0056106 3300037418 Bacteria 4055
169 Ga0395900_0070916 3300037418 Bacteria 3581
170 Ga0395900_0079724 3300037418 Bacteria 3364
171 Ga0395900_0302766 3300037418 Bacteria 1584
172 Ga0395900_0475579 3300037418 Bacteria 1202
173 Ga0395900_0619123 3300037418 Bacteria 1021
174 Ga0395900_1051951 3300037418 Bacteria 732
175 Ga0395898_0025598 3300037466 Bacteria 5943
176 Ga0395898_0129947 3300037466 Bacteria 2413
177 Ga0395898_0405058 3300037466 Bacteria 1300
178 Ga0395898_0499033 3300037466 Bacteria 1157
179 Ga0395905_0005473 3300037471 Bacteria 12951
180 Ga0395905_0063746 3300037471 Bacteria 3448
181 Ga0395905_0222007 3300037471 Bacteria 1768
182 Ga0395905_0238560 3300037471 Bacteria 1699
183 Ga0395905_0652219 3300037471 Bacteria 954
184 Ga0395905_1267169 3300037471 Bacteria 641
185 Ga0395901_0000229 3300038443 Bacteria 70261
186 Ga0395901_0022887 3300038443 Bacteria 6406
187 Ga0395901_0102231 3300038443 Bacteria 3007
188 Ga0395901_0275942 3300038443 Bacteria 1747
189 Ga0395901_0466110 3300038443 Bacteria 1290
190 Ga0439436_0253896 3300041404 Bacteria 510
191 Ga0439465_0018766 3300041413 Bacteria 2161
192 Ga0439433_0018259 3300041999 Bacteria 1561
193 Ga0439448_0001129 3300042005 Bacteria 6734
194 Ga0439448_0009122 3300042005 Bacteria 2920
195 Ga0439448_0085656 3300042005 Bacteria 1061
196 Ga0439449_0223813 3300042007 Bacteria 705
197 Ga0439452_039490 3300042010 Bacteria 1117
198 Ga0439454_023406 3300042011 Bacteria 927
199 Ga0439455_0001103 3300042012 Bacteria 4315
200 Ga0439455_0095170 3300042012 Bacteria 819
201 Ga0450897_002704 3300042128 Bacteria 1360
202 Ga0450896_034662 3300042133 Bacteria 773
203 Ga0450904_000265 3300042139 Bacteria 11278
204 Ga0439458_0110135 3300042157 Bacteria 719
205 Ga0466969_0132304 3300044656 Bacteria 1156
206 Ga0466969_0136552 3300044656 Bacteria 1135
207 Ga0466969_0256465 3300044656 Bacteria 792
208 Ga0466972_0003253 3300044658 Bacteria 8051
209 Ga0466972_0201043 3300044658 Bacteria 933
210 Ga0466972_0427416 3300044658 Bacteria 621
211 Ga0466972_0438469 3300044658 Bacteria 613
212 Ga0466965_0002351 3300044683 Bacteria 8001
213 Ga0466965_0043891 3300044683 Bacteria 2208
214 Ga0466965_0048928 3300044683 Bacteria 2095
215 Ga0466965_0071744 3300044683 Bacteria 1742
216 Ga0466965_0117874 3300044683 Bacteria 1369
217 Ga0466965_0284952 3300044683 Bacteria 893
218 Ga0466965_0544974 3300044683 Bacteria 654
219 Ga0466965_0747661 3300044683 Bacteria 563
220 Ga0466966_0023547 3300044684 Bacteria 4029
221 Ga0466966_0025434 3300044684 Bacteria 3866
222 Ga0466966_0090562 3300044684 Bacteria 1899
223 Ga0466966_0103298 3300044684 Bacteria 1761
224 Ga0466966_0154108 3300044684 Bacteria 1400
225 Ga0466966_0182003 3300044684 Bacteria 1275
226 Ga0466966_0352428 3300044684 Bacteria 884
227 Ga0466966_0534523 3300044684 Bacteria 705
228 Ga0466961_0127426 3300044693 Bacteria 1596
229 Ga0466961_0200239 3300044693 Bacteria 1235
230 Ga0466961_0271661 3300044693 Bacteria 1038
231 Ga0466963_0250305 3300044694 Bacteria 1243
232 Ga0466963_0348577 3300044694 Bacteria 1043
233 Ga0466964_0000266 3300044706 Bacteria 15085
234 Ga0466964_0010720 3300044706 Bacteria 3460
235 Ga0466971_0141423 3300044719 Bacteria 1120
236 Ga0466971_0421425 3300044719 Bacteria 652
237 Ga0466970_0041957 3300044765 Bacteria 2433
238 Ga0466970_0194627 3300044765 Bacteria 1127
239 Ga0466970_0776712 3300044765 Bacteria 560
240 Ga0466957_0002503 3300044842 Bacteria 9883
241 Ga0466957_0007273 3300044842 Bacteria 6256
242 Ga0466957_0097447 3300044842 Bacteria 1849
243 Ga0466957_0199252 3300044842 Bacteria 1314
244 Ga0466960_0527823 3300044901 Bacteria 694
245 Ga0466959_0073815 3300045049 Bacteria 2467
246 Ga0466959_0109015 3300045049 Bacteria 1977
247 Ga0466959_0123429 3300045049 Bacteria 1839
248 Ga0466959_1021240 3300045049 Bacteria 550
249 Ga0466958_0259796 3300045836 Bacteria 1111
250 Ga0466967_0009076 3300045976 Bacteria 7353
251 Ga0466967_0316823 3300045976 Bacteria 1503
252 Ga0466967_1453551 3300045976 Bacteria 683
253 Ga0495617_000002 3300046452 Bacteria 710121
254 Ga0495617_001334 3300046452 Bacteria 10970
255 Ga0495617_004889 3300046452 Bacteria 4818
256 Ga0495617_030414 3300046452 Bacteria 1815
257 Ga0495617_274933 3300046452 Bacteria 516
258 Ga0495627_001759 3300046453 Bacteria 11666
259 Ga0495627_017831 3300046453 Bacteria 2404
260 Ga0495627_018539 3300046453 Bacteria 2344
261 Ga0495627_089696 3300046453 Bacteria 884
262 Ga0495603_0088345 3300046455 Bacteria 1813
263 Ga0495603_0090886 3300046455 Bacteria 1785
264 Ga0495603_0108944 3300046455 Bacteria 1616
265 Ga0495603_0440304 3300046455 Bacteria 746
266 Ga0495590_0000025 3300046457 Bacteria 165221
267 Ga0495590_0000959 3300046457 Bacteria 12723
268 Ga0495590_0012485 3300046457 Bacteria 3151
269 Ga0495590_0030361 3300046457 Bacteria 1893
270 Ga0495590_0038338 3300046457 Bacteria 1671
271 Ga0495590_0109218 3300046457 Bacteria 986
272 Ga0495590_0179115 3300046457 Bacteria 774
273 Ga0495591_002012 3300046458 Bacteria 11829
274 Ga0495591_045435 3300046458 Bacteria 1224
275 Ga0495629_0010071 3300046459 Bacteria 6897
276 Ga0495629_0150374 3300046459 Bacteria 1618
277 Ga0495629_0242011 3300046459 Bacteria 1242
278 Ga0495629_0367075 3300046459 Bacteria 980
279 Ga0495638_0036194 3300046460 Bacteria 3145
280 Ga0495638_0037102 3300046460 Bacteria 3102
281 Ga0495638_0051443 3300046460 Bacteria 2569
282 Ga0495638_0094239 3300046460 Bacteria 1800
283 Ga0495638_0099914 3300046460 Bacteria 1736
284 Ga0495638_0366570 3300046460 Bacteria 756
285 Ga0495653_0024794 3300046463 Bacteria 4827
286 Ga0495653_0027939 3300046463 Bacteria 4515
287 Ga0495653_0045074 3300046463 Bacteria 3420
288 Ga0495653_0219616 3300046463 Bacteria 1278
289 Ga0495650_0000015 3300046471 Bacteria 557595
290 Ga0495650_0000124 3300046471 Bacteria 180310
291 Ga0495650_0034770 3300046471 Bacteria 2226
292 Ga0495650_0043762 3300046471 Bacteria 1897
293 Ga0495650_0107043 3300046471 Bacteria 1043
294 Ga0495650_0143247 3300046471 Bacteria 863
295 Ga0495580_0026098 3300046472 Bacteria 4262
296 Ga0495580_0147170 3300046472 Bacteria 1632
297 Ga0495580_0193111 3300046472 Bacteria 1404
298 Ga0495582_0027177 3300046473 Bacteria 3135
299 Ga0495582_0188089 3300046473 Bacteria 1177
300 Ga0495605_0000293 3300046474 Bacteria 55067
301 Ga0495605_0000717 3300046474 Bacteria 24406
302 Ga0495605_0008261 3300046474 Bacteria 5889
303 Ga0495605_0010067 3300046474 Bacteria 5297
304 Ga0495605_0010421 3300046474 Bacteria 5200
305 Ga0495605_0014020 3300046474 Bacteria 4397
306 Ga0495605_0032020 3300046474 Bacteria 2681
307 Ga0495605_0051425 3300046474 Bacteria 2006
308 Ga0495605_0065215 3300046474 Bacteria 1732
309 Ga0495605_0077476 3300046474 Bacteria 1559
310 Ga0495605_0079005 3300046474 Bacteria 1541
311 Ga0495605_0161703 3300046474 Bacteria 994
312 Ga0495605_0186098 3300046474 Bacteria 911
313 Ga0495605_0436537 3300046474 Bacteria 541
314 Ga0495664_0039896 3300046477 Bacteria 2774
315 Ga0495664_0118369 3300046477 Bacteria 1602
316 Ga0495664_0301979 3300046477 Bacteria 966
317 Ga0495584_0000017 3300046491 Bacteria 149686
318 Ga0495584_0002122 3300046491 Bacteria 11352
319 Ga0495584_0003169 3300046491 Bacteria 9137
320 Ga0495584_0003659 3300046491 Bacteria 8380
321 Ga0495584_0004378 3300046491 Bacteria 7606
322 Ga0495584_0006023 3300046491 Bacteria 6388
323 Ga0495584_0011969 3300046491 Bacteria 4435
324 Ga0495584_0017021 3300046491 Bacteria 3705
325 Ga0495584_0076394 3300046491 Bacteria 1684
326 Ga0495584_0103015 3300046491 Bacteria 1443
327 Ga0495584_0114280 3300046491 Bacteria 1366
328 Ga0495584_0162721 3300046491 Bacteria 1134
329 Ga0495584_0173893 3300046491 Bacteria 1095
330 Ga0495584_0197309 3300046491 Bacteria 1023
331 Ga0495585_0000006 3300046492 Bacteria 320556
332 Ga0495585_0000425 3300046492 Bacteria 40655
333 Ga0495585_0001636 3300046492 Bacteria 17134
334 Ga0495585_0001963 3300046492 Bacteria 15324
335 Ga0495585_0003227 3300046492 Bacteria 11124
336 Ga0495585_0004277 3300046492 Bacteria 9297
337 Ga0495585_0005707 3300046492 Bacteria 7809
338 Ga0495585_0009361 3300046492 Bacteria 5878
339 Ga0495585_0013937 3300046492 Bacteria 4695
340 Ga0495585_0026731 3300046492 Bacteria 3295
341 Ga0495585_0027004 3300046492 Bacteria 3277
342 Ga0495585_0045407 3300046492 Bacteria 2452
343 Ga0495585_0046387 3300046492 Bacteria 2423
344 Ga0495585_0119739 3300046492 Bacteria 1393
345 Ga0495585_0160338 3300046492 Bacteria 1167
346 Ga0495585_0192515 3300046492 Bacteria 1042
347 Ga0495585_0317471 3300046492 Bacteria 762
348 Ga0495585_0372835 3300046492 Bacteria 690
349 Ga0495594_0007537 3300046499 Bacteria 5601
350 Ga0495594_0029822 3300046499 Bacteria 2949
351 Ga0495594_0032797 3300046499 Bacteria 2820
352 Ga0495594_0069541 3300046499 Bacteria 1955
353 Ga0495594_0295131 3300046499 Bacteria 923
354 Ga0495594_0358403 3300046499 Bacteria 830
355 Ga0495596_0001127 3300046500 Bacteria 15769
356 Ga0495596_0001627 3300046500 Bacteria 12752
357 Ga0495596_0002615 3300046500 Bacteria 9550
358 Ga0495596_0002998 3300046500 Bacteria 8747
359 Ga0495596_0003128 3300046500 Bacteria 8543
360 Ga0495596_0005139 3300046500 Bacteria 6231
361 Ga0495596_0006410 3300046500 Bacteria 5414
362 Ga0495596_0006835 3300046500 Bacteria 5203
363 Ga0495596_0011790 3300046500 Bacteria 3753
364 Ga0495596_0013870 3300046500 Bacteria 3405
365 Ga0495596_0014743 3300046500 Bacteria 3289
366 Ga0495596_0020505 3300046500 Bacteria 2705
367 Ga0495596_0078049 3300046500 Bacteria 1285
368 Ga0495596_0082877 3300046500 Bacteria 1245
369 Ga0495596_0104613 3300046500 Bacteria 1099
370 Ga0495596_0339620 3300046500 Bacteria 584
371 Ga0495607_0004530 3300046501 Bacteria 10201
372 Ga0495607_0005031 3300046501 Bacteria 9585
373 Ga0495607_0006792 3300046501 Bacteria 7993
374 Ga0495607_0008578 3300046501 Bacteria 6979
375 Ga0495607_0027084 3300046501 Bacteria 3550
376 Ga0495607_0038101 3300046501 Bacteria 2882
377 Ga0495607_0051640 3300046501 Bacteria 2386
378 Ga0495607_0054785 3300046501 Bacteria 2297
379 Ga0495607_0070137 3300046501 Bacteria 1959
380 Ga0495607_0143478 3300046501 Bacteria 1229
381 Ga0495607_0207924 3300046501 Bacteria 964
382 Ga0495583_0000195 3300046506 Bacteria 101598
383 Ga0495583_0001466 3300046506 Bacteria 23712
384 Ga0495583_0002716 3300046506 Bacteria 14661
385 Ga0495583_0003773 3300046506 Bacteria 11258
386 Ga0495583_0007016 3300046506 Bacteria 7207
387 Ga0495583_0007306 3300046506 Bacteria 6979
388 Ga0495583_0012979 3300046506 Bacteria 4678
389 Ga0495583_0016767 3300046506 Bacteria 3920
390 Ga0495583_0026924 3300046506 Bacteria 2843
391 Ga0495583_0030630 3300046506 Bacteria 2617
392 Ga0495583_0041291 3300046506 Bacteria 2162
393 Ga0495583_0042485 3300046506 Bacteria 2122
394 Ga0495583_0081389 3300046506 Bacteria 1406
395 Ga0495583_0125237 3300046506 Bacteria 1078
396 Ga0495583_0137890 3300046506 Bacteria 1017
397 Ga0495583_0154802 3300046506 Bacteria 948
398 Ga0495606_0011093 3300046507 Bacteria 7389
399 Ga0495606_0019132 3300046507 Bacteria 5106
400 Ga0495606_0025281 3300046507 Bacteria 4256
401 Ga0495606_0053907 3300046507 Bacteria 2607
402 Ga0495606_0105736 3300046507 Bacteria 1705
403 Ga0495606_0108723 3300046507 Bacteria 1675
404 Ga0495606_0209939 3300046507 Bacteria 1103
405 Ga0495606_0414276 3300046507 Bacteria 698
406 Ga0495610_0005810 3300046512 Bacteria 8675
407 Ga0495610_0009822 3300046512 Bacteria 5997
408 Ga0495610_0234611 3300046512 Bacteria 734
409 Ga0495616_0001644 3300046513 Bacteria 15317
410 Ga0495616_0002635 3300046513 Bacteria 11797
411 Ga0495616_0002826 3300046513 Bacteria 11330
412 Ga0495616_0003400 3300046513 Bacteria 10203
413 Ga0495616_0003450 3300046513 Bacteria 10116
414 Ga0495616_0004626 3300046513 Bacteria 8637
415 Ga0495616_0011397 3300046513 Bacteria 5096
416 Ga0495616_0017902 3300046513 Bacteria 3903
417 Ga0495616_0020264 3300046513 Bacteria 3620
418 Ga0495616_0025185 3300046513 Bacteria 3182
419 Ga0495616_0026001 3300046513 Bacteria 3120
420 Ga0495616_0035261 3300046513 Bacteria 2590
421 Ga0495616_0049200 3300046513 Bacteria 2114
422 Ga0495616_0058067 3300046513 Bacteria 1906
423 Ga0495616_0072260 3300046513 Bacteria 1666
424 Ga0495616_0131521 3300046513 Bacteria 1146
425 Ga0495616_0144307 3300046513 Bacteria 1081
426 Ga0495616_0226760 3300046513 Bacteria 811
427 Ga0495620_0031794 3300046515 Bacteria 2413
428 Ga0495620_0057745 3300046515 Bacteria 1627
429 Ga0495620_0115939 3300046515 Bacteria 1059
430 Ga0495620_0239770 3300046515 Bacteria 692
431 Ga0495628_0100611 3300046516 Bacteria 2231
432 Ga0495630_0042268 3300046517 Bacteria 3404
433 Ga0495630_0044241 3300046517 Bacteria 3327
434 Ga0495631_0000378 3300046518 Bacteria 30608
435 Ga0495631_0004326 3300046518 Bacteria 7574
436 Ga0495631_0004421 3300046518 Bacteria 7486
437 Ga0495631_0011371 3300046518 Bacteria 4378
438 Ga0495631_0014497 3300046518 Bacteria 3804
439 Ga0495631_0023973 3300046518 Bacteria 2822
440 Ga0495631_0025855 3300046518 Bacteria 2699
441 Ga0495631_0038597 3300046518 Bacteria 2122
442 Ga0495631_0049539 3300046518 Bacteria 1838
443 Ga0495631_0082014 3300046518 Bacteria 1390
444 Ga0495631_0088996 3300046518 Bacteria 1329
445 Ga0495632_0002064 3300046519 Bacteria 15767
446 Ga0495632_0003086 3300046519 Bacteria 12087
447 Ga0495632_0003136 3300046519 Bacteria 11952
448 Ga0495632_0004557 3300046519 Bacteria 9393
449 Ga0495632_0010943 3300046519 Bacteria 5323
450 Ga0495632_0066601 3300046519 Bacteria 1738
451 Ga0495632_0097436 3300046519 Bacteria 1388
452 Ga0495632_0123556 3300046519 Bacteria 1208
453 Ga0495637_0000019 3300046520 Bacteria 185953
454 Ga0495637_0003900 3300046520 Bacteria 7824
455 Ga0495637_0249320 3300046520 Bacteria 639
456 Ga0495637_0268032 3300046520 Bacteria 611
457 Ga0495643_0002040 3300046522 Bacteria 16783
458 Ga0495643_0004574 3300046522 Bacteria 9630
459 Ga0495643_0004743 3300046522 Bacteria 9405
460 Ga0495643_0010057 3300046522 Bacteria 5836
461 Ga0495643_0015762 3300046522 Bacteria 4458
462 Ga0495643_0035817 3300046522 Bacteria 2730
463 Ga0495643_0060649 3300046522 Bacteria 2007
464 Ga0495643_0154069 3300046522 Bacteria 1136
465 Ga0495644_0003348 3300046523 Bacteria 6337
466 Ga0495644_0005381 3300046523 Bacteria 5000
467 Ga0495644_0008956 3300046523 Bacteria 3849
468 Ga0495644_0010090 3300046523 Bacteria 3639
469 Ga0495644_0016971 3300046523 Bacteria 2786
470 Ga0495644_0020194 3300046523 Bacteria 2541
471 Ga0495644_0023245 3300046523 Bacteria 2360
472 Ga0495644_0045447 3300046523 Bacteria 1651
473 Ga0495644_0064151 3300046523 Bacteria 1380
474 Ga0495648_0000007 3300046524 Bacteria 347305
475 Ga0495648_0003804 3300046524 Bacteria 13113
476 Ga0495648_0006194 3300046524 Bacteria 9801
477 Ga0495648_0006859 3300046524 Bacteria 9197
478 Ga0495648_0018822 3300046524 Bacteria 4874
479 Ga0495648_0025767 3300046524 Bacteria 3973
480 Ga0495648_0055092 3300046524 Bacteria 2398
481 Ga0495648_0088287 3300046524 Bacteria 1743
482 Ga0495648_0179495 3300046524 Bacteria 1077
483 Ga0495648_0427061 3300046524 Bacteria 585
484 Ga0495663_0003993 3300046525 Bacteria 4189
485 Ga0495663_0173990 3300046525 Bacteria 743
486 Ga0495666_0001537 3300046526 Bacteria 11323
487 Ga0495666_0046279 3300046526 Bacteria 2097
488 Ga0495666_0062976 3300046526 Bacteria 1770
489 Ga0495666_0075641 3300046526 Bacteria 1596
490 Ga0495666_0099593 3300046526 Bacteria 1370
491 Ga0495642_0001065 3300046528 Bacteria 12701
492 Ga0495642_0001266 3300046528 Bacteria 11467
493 Ga0495642_0001585 3300046528 Bacteria 9960
494 Ga0495642_0006219 3300046528 Bacteria 4583
495 Ga0495642_0022878 3300046528 Bacteria 2464
496 Ga0495642_0025093 3300046528 Bacteria 2361
497 Ga0495642_0032983 3300046528 Bacteria 2081
498 Ga0495642_0067061 3300046528 Bacteria 1496
499 Ga0495642_0141057 3300046528 Bacteria 1040
500 Ga0495642_0171182 3300046528 Bacteria 944
501 Ga0495642_0190928 3300046528 Bacteria 892
502 Ga0495642_0262402 3300046528 Bacteria 755
503 Ga0495642_0282560 3300046528 Bacteria 726
504 Ga0495642_0308005 3300046528 Unclassified 694
505 Ga0495642_0378999 3300046528 Unclassified 623
506 Ga0495642_0379944 3300046528 Bacteria 622
507 Ga0495652_0021270 3300046529 Bacteria 5768
508 Ga0495652_0113029 3300046529 Bacteria 2180
509 Ga0495654_0013470 3300046530 Bacteria 4375
510 Ga0495654_0031944 3300046530 Bacteria 2671
511 Ga0495654_0052725 3300046530 Bacteria 1979
512 Ga0495654_0089043 3300046530 Bacteria 1435
513 Ga0495654_0110026 3300046530 Bacteria 1258
514 Ga0495654_0160229 3300046530 Bacteria 988
515 Ga0495654_0187567 3300046530 Bacteria 892
516 Ga0495654_0258178 3300046530 Bacteria 723
517 Ga0495665_0005637 3300046531 Bacteria 6752
518 Ga0495665_0009705 3300046531 Bacteria 5210
519 Ga0495665_0017307 3300046531 Bacteria 3877
520 Ga0495665_0035594 3300046531 Bacteria 2659
521 Ga0495665_0239174 3300046531 Bacteria 936
522 Ga0495665_0442632 3300046531 Bacteria 657
523 Ga0495640_0022008 3300046533 Bacteria 4668
524 Ga0495586_0013652 3300046535 Bacteria 4309
525 Ga0495586_0040634 3300046535 Bacteria 2503
526 Ga0495586_0076423 3300046535 Bacteria 1835
527 Ga0495587_0183565 3300046536 Bacteria 1185
528 Ga0495598_0042112 3300046537 Unclassified 1339
529 Ga0495609_0000002 3300046538 Bacteria 739816
530 Ga0495609_0003408 3300046538 Bacteria 9119
531 Ga0495609_0003793 3300046538 Bacteria 8509
532 Ga0495609_0008116 3300046538 Bacteria 5169
533 Ga0495609_0008528 3300046538 Bacteria 5016
534 Ga0495609_0014176 3300046538 Bacteria 3752
535 Ga0495609_0026294 3300046538 Bacteria 2665
536 Ga0495609_0029073 3300046538 Bacteria 2519
537 Ga0495609_0032914 3300046538 Bacteria 2353
538 Ga0495609_0044907 3300046538 Bacteria 1981
539 Ga0495609_0064449 3300046538 Bacteria 1616
540 Ga0495609_0129051 3300046538 Bacteria 1083
541 Ga0495609_0223872 3300046538 Bacteria 780
542 Ga0495621_0001811 3300046539 Bacteria 5623
543 Ga0495597_0001284 3300046542 Bacteria 18462
544 Ga0495597_0002344 3300046542 Bacteria 12238
545 Ga0495597_0002387 3300046542 Bacteria 11978
546 Ga0495597_0002599 3300046542 Bacteria 11264
547 Ga0495597_0009014 3300046542 Bacteria 4962
548 Ga0495597_0013849 3300046542 Bacteria 3854
549 Ga0495597_0039644 3300046542 Bacteria 2108
550 Ga0495597_0086401 3300046542 Bacteria 1335
551 Ga0495597_0096196 3300046542 Bacteria 1252
552 Ga0495597_0129230 3300046542 Bacteria 1048
553 Ga0495597_0158397 3300046542 Bacteria 925
554 Ga0495597_0185583 3300046542 Bacteria 838
555 Ga0495597_0279306 3300046542 Bacteria 651
556 Ga0495645_0029119 3300046543 Bacteria 4014
557 Ga0495622_0049733 3300046557 Bacteria 1946
558 Ga0495622_0053475 3300046557 Bacteria 1873
559 Ga0495622_0073480 3300046557 Bacteria 1577
560 Ga0495622_0081648 3300046557 Bacteria 1487
561 Ga0495633_0001186 3300046558 Bacteria 20926
562 Ga0495633_0001954 3300046558 Bacteria 14964
563 Ga0495633_0004314 3300046558 Bacteria 9084
564 Ga0495633_0009485 3300046558 Bacteria 5371
565 Ga0495633_0014116 3300046558 Bacteria 4187
566 Ga0495633_0023245 3300046558 Bacteria 3072
567 Ga0495633_0034745 3300046558 Bacteria 2423
568 Ga0495633_0052614 3300046558 Bacteria 1917
569 Ga0495633_0073264 3300046558 Bacteria 1596
570 Ga0495633_0092378 3300046558 Bacteria 1406
571 Ga0495633_0180952 3300046558 Bacteria 970
572 Ga0495633_0280185 3300046558 Bacteria 758
573 Ga0495656_0009683 3300046615 Bacteria 3475
574 Ga0495656_0019063 3300046615 Bacteria 2643
575 Ga0495656_0144590 3300046615 Bacteria 1143
576 Ga0495656_0198688 3300046615 Bacteria 994
577 Ga0495656_0239371 3300046615 Bacteria 913
578 Ga0495656_0239904 3300046615 Bacteria 912
579 Ga0495668_0000998 3300046616 Bacteria 30582
580 Ga0495668_0003576 3300046616 Bacteria 11537
581 Ga0495668_0006241 3300046616 Bacteria 7867
582 Ga0495668_0007008 3300046616 Bacteria 7278
583 Ga0495668_0037244 3300046616 Bacteria 2722
584 Ga0495668_0038237 3300046616 Bacteria 2682
585 Ga0495668_0042397 3300046616 Bacteria 2533
586 Ga0495668_0049468 3300046616 Bacteria 2331
587 Ga0495668_0051608 3300046616 Bacteria 2276
588 Ga0495668_0061752 3300046616 Bacteria 2066
589 Ga0495668_0090527 3300046616 Bacteria 1676
590 Ga0495668_0093202 3300046616 Bacteria 1649
591 Ga0495668_0101079 3300046616 Bacteria 1577
592 Ga0495668_0238881 3300046616 Bacteria 995
593 Ga0495668_0603875 3300046616 Bacteria 606
594 Ga0495668_0702576 3300046616 Bacteria 559
595 Ga0495634_0005004 3300046642 Bacteria 10238
596 Ga0495611_0001415 3300046648 Bacteria 11968
597 Ga0495611_0002181 3300046648 Bacteria 9128
598 Ga0495611_0009834 3300046648 Bacteria 4045
599 Ga0495611_0013960 3300046648 Bacteria 3427
600 Ga0495611_0055227 3300046648 Bacteria 1796
601 Ga0495611_0070768 3300046648 Bacteria 1594
602 Ga0495611_0150325 3300046648 Bacteria 1087
603 Ga0495611_0274078 3300046648 Bacteria 780
604 Ga0495625_0001394 3300046660 Bacteria 29641
605 Ga0495625_0228814 3300046660 Bacteria 1215
606 Ga0495625_0326586 3300046660 Bacteria 975
607 Ga0495625_0347417 3300046660 Bacteria 938
608 Ga0495625_0371592 3300046660 Bacteria 899
609 Ga0495625_0698359 3300046660 Bacteria 599
610 Ga0495625_0753544 3300046660 Bacteria 570
611 Ga0495625_0886808 3300046660 Bacteria 512
612 Ga0495635_0072002 3300046663 Bacteria 2369
613 Ga0495635_0327690 3300046663 Bacteria 1024
614 Ga0495635_0545277 3300046663 Bacteria 760
615 Ga0495659_0074592 3300046664 Bacteria 1276
616 Ga0495659_0087101 3300046664 Bacteria 1194
617 Ga0495661_0002730 3300046665 Bacteria 13435
618 Ga0495661_0002951 3300046665 Bacteria 12848
619 Ga0495661_0003461 3300046665 Bacteria 11653
620 Ga0495661_0004001 3300046665 Bacteria 10745
621 Ga0495661_0016564 3300046665 Bacteria 4881
622 Ga0495661_0017594 3300046665 Bacteria 4718
623 Ga0495661_0029472 3300046665 Bacteria 3502
624 Ga0495661_0035117 3300046665 Bacteria 3149
625 Ga0495661_0052712 3300046665 Bacteria 2449
626 Ga0495661_0062501 3300046665 Bacteria 2205
627 Ga0495661_0063894 3300046665 Bacteria 2174
628 Ga0495661_0073056 3300046665 Bacteria 1999
629 Ga0495661_0092205 3300046665 Bacteria 1721
630 Ga0495661_0098384 3300046665 Bacteria 1651
631 Ga0495661_0158016 3300046665 Bacteria 1219
632 Ga0495661_0158612 3300046665 Bacteria 1216
633 Ga0495661_0204926 3300046665 Bacteria 1030
634 Ga0495661_0222358 3300046665 Bacteria 978
635 Ga0495588_0000127 3300046674 Bacteria 125854
636 Ga0495588_0003809 3300046674 Bacteria 6606
637 Ga0495588_0006102 3300046674 Bacteria 5410
638 Ga0495588_0099777 3300046674 Bacteria 1525
639 Ga0495588_0165739 3300046674 Bacteria 1168
640 Ga0495588_0176098 3300046674 Bacteria 1130
641 Ga0495657_0351842 3300046675 Bacteria 872
642 Ga0495599_0076805 3300046678 Bacteria 2086
643 Ga0495623_0005951 3300046679 Bacteria 7951
644 Ga0495623_0035386 3300046679 Bacteria 3201
645 Ga0495623_0059819 3300046679 Bacteria 2391
646 Ga0495623_0109108 3300046679 Bacteria 1679
647 Ga0495623_0635594 3300046679 Bacteria 551
648 Ga0495646_0194441 3300046680 Bacteria 1107
649 Ga0495646_0308269 3300046680 Bacteria 836
650 Ga0495669_0001026 3300046684 Bacteria 11641
651 Ga0495669_0008679 3300046684 Bacteria 4277
652 Ga0495669_0009004 3300046684 Bacteria 4205
653 Ga0495669_0019937 3300046684 Bacteria 2896
654 Ga0495669_0042110 3300046684 Bacteria 2029
655 Ga0495669_0084276 3300046684 Bacteria 1461
656 Ga0495669_0102182 3300046684 Bacteria 1332
657 Ga0495669_0108240 3300046684 Bacteria 1296
658 Ga0495669_0122365 3300046684 Bacteria 1220
659 Ga0495669_0133017 3300046684 Bacteria 1171
660 Ga0495669_0272705 3300046684 Bacteria 813
661 Ga0495613_0027077 3300046689 Bacteria 4266
662 Ga0495613_0245395 3300046689 Bacteria 1251
663 Ga0495670_0000883 3300046691 Bacteria 14534
664 Ga0495670_0006114 3300046691 Bacteria 5907
665 Ga0495670_0020383 3300046691 Bacteria 3269
666 Ga0495670_0049566 3300046691 Bacteria 2101
667 Ga0495670_0057620 3300046691 Bacteria 1950
668 Ga0495670_0059800 3300046691 Bacteria 1913
669 Ga0495670_0081035 3300046691 Bacteria 1653
670 Ga0495670_0082183 3300046691 Bacteria 1642
671 Ga0495670_0093454 3300046691 Bacteria 1541
672 Ga0495670_0104793 3300046691 Bacteria 1459
673 Ga0495670_0109313 3300046691 Bacteria 1429
674 Ga0495670_0121522 3300046691 Bacteria 1357
675 Ga0495670_0371893 3300046691 Bacteria 770
676 Ga0495671_0002227 3300046692 Bacteria 12333
677 Ga0495671_0002525 3300046692 Bacteria 11502
678 Ga0495671_0004716 3300046692 Bacteria 8057
679 Ga0495671_0043376 3300046692 Bacteria 2257
680 Ga0495671_0061613 3300046692 Bacteria 1850
681 Ga0495671_0064360 3300046692 Bacteria 1805
682 Ga0495671_0256710 3300046692 Bacteria 843
683 Ga0495649_0002138 3300046694 Bacteria 14132
684 Ga0495649_0002201 3300046694 Bacteria 13922
685 Ga0495649_0034612 3300046694 Bacteria 2779
686 Ga0495649_0044534 3300046694 Bacteria 2422
687 Ga0495649_0048387 3300046694 Bacteria 2310
688 Ga0495649_0069740 3300046694 Bacteria 1885
689 Ga0495649_0091237 3300046694 Bacteria 1624
690 Ga0495649_0094762 3300046694 Bacteria 1589
691 Ga0495649_0097199 3300046694 Bacteria 1567
692 Ga0495589_0000083 3300046794 Bacteria 87058
693 Ga0495589_0000357 3300046794 Bacteria 35496
694 Ga0495589_0001877 3300046794 Bacteria 11902
695 Ga0495589_0004129 3300046794 Bacteria 7770
696 Ga0495589_0006723 3300046794 Bacteria 6054
697 Ga0495589_0022129 3300046794 Bacteria 3246
698 Ga0495589_0037683 3300046794 Bacteria 2421
699 Ga0495589_0051190 3300046794 Bacteria 2042
700 Ga0495589_0059663 3300046794 Bacteria 1874
701 Ga0495589_0104489 3300046794 Bacteria 1369
702 Ga0495589_0107289 3300046794 Bacteria 1349
703 Ga0495589_0120065 3300046794 Bacteria 1266
704 Ga0495589_0126736 3300046794 Bacteria 1227
705 Ga0495600_0015331 3300046809 Bacteria 4844
706 Ga0495600_0081580 3300046809 Bacteria 2111
707 Ga0495600_0668486 3300046809 Bacteria 627
708 Ga0495660_0001996 3300046810 Bacteria 13266
709 Ga0495660_0005132 3300046810 Bacteria 7871
710 Ga0495660_0011218 3300046810 Bacteria 5202
711 Ga0495660_0019351 3300046810 Bacteria 3908
712 Ga0495660_0021793 3300046810 Bacteria 3665
713 Ga0495660_0028149 3300046810 Bacteria 3176
714 Ga0495660_0037780 3300046810 Bacteria 2688
715 Ga0495660_0165881 3300046810 Bacteria 1079
716 Ga0495660_0422628 3300046810 Bacteria 580
717 Ga0495581_0074203 3300047315 Bacteria 1968
718 Ga0495581_0084578 3300047315 Bacteria 1838
719 Ga0495581_0142962 3300047315 Bacteria 1396
720 Ga0495581_0325912 3300047315 Bacteria 897
721 Ga0495604_0017845 3300047317 Bacteria 5676
722 Ga0495604_0022620 3300047317 Bacteria 5019
723 Ga0495604_0133746 3300047317 Bacteria 1779
724 Ga0495636_0015364 3300047318 Bacteria 3051
725 Ga0495636_0050761 3300047318 Bacteria 1737
726 Ga0495636_0133924 3300047318 Bacteria 1103
727 Ga0495674_0007700 3300047319 Bacteria 10290
728 Ga0495674_0047023 3300047319 Bacteria 3828
729 Ga0495672_0000041 3300047320 Bacteria 267545
730 Ga0495672_0000050 3300047320 Bacteria 240336
731 Ga0495672_0001417 3300047320 Bacteria 23561
732 Ga0495672_0002883 3300047320 Bacteria 15219
733 Ga0495672_0003045 3300047320 Bacteria 14705
734 Ga0495672_0004834 3300047320 Bacteria 10857
735 Ga0495672_0008621 3300047320 Bacteria 7502
736 Ga0495672_0008661 3300047320 Bacteria 7477
737 Ga0495672_0057686 3300047320 Bacteria 2254
738 Ga0495672_0073192 3300047320 Bacteria 1933
739 Ga0495672_0097969 3300047320 Bacteria 1595
740 Ga0495672_0108211 3300047320 Bacteria 1496
741 Ga0495672_0134569 3300047320 Bacteria 1297
742 Ga0495676_0005037 3300047321 Bacteria 12118
743 Ga0495676_0013916 3300047321 Bacteria 7212
744 Ga0495676_0022904 3300047321 Bacteria 5428
745 Ga0495676_0070851 3300047321 Bacteria 2682
746 Ga0495676_0359315 3300047321 Bacteria 972
747 Ga0495680_0005811 3300047322 Bacteria 11549
748 Ga0495680_0077544 3300047322 Bacteria 2517
749 Ga0495680_0174571 3300047322 Bacteria 1554
750 Ga0495683_0000543 3300047323 Bacteria 28655
751 Ga0495683_0004058 3300047323 Bacteria 8394
752 Ga0495683_0004786 3300047323 Bacteria 7604
753 Ga0495683_0010347 3300047323 Bacteria 4933
754 Ga0495683_0013132 3300047323 Bacteria 4336
755 Ga0495683_0029884 3300047323 Bacteria 2783
756 Ga0495683_0029979 3300047323 Bacteria 2778
757 Ga0495683_0034543 3300047323 Bacteria 2571
758 Ga0495683_0064668 3300047323 Bacteria 1806
759 Ga0495683_0065120 3300047323 Bacteria 1798
760 Ga0495683_0075655 3300047323 Bacteria 1649
761 Ga0495683_0076471 3300047323 Bacteria 1637
762 Ga0495683_0105149 3300047323 Bacteria 1353
763 Ga0495683_0177010 3300047323 Bacteria 977
764 Ga0495683_0202542 3300047323 Bacteria 894
765 Ga0495683_0483456 3300047323 Bacteria 504
766 Ga0495687_000075 3300047443 Bacteria 152218
767 Ga0495687_000197 3300047443 Bacteria 86694
768 Ga0495687_001196 3300047443 Bacteria 24836
769 Ga0495687_002881 3300047443 Bacteria 13140
770 Ga0495687_002919 3300047443 Bacteria 13003
771 Ga0495687_003090 3300047443 Bacteria 12468
772 Ga0495687_008299 3300047443 Bacteria 5968
773 Ga0495687_098015 3300047443 Bacteria 1107
774 Ga0495687_100418 3300047443 Bacteria 1087
775 Ga0495687_154976 3300047443 Bacteria 778
776 Ga0495675_0005488 3300047444 Bacteria 7737
777 Ga0495675_0074877 3300047444 Bacteria 2133
778 Ga0495675_0230419 3300047444 Bacteria 1118
779 Ga0495677_0000030 3300047445 Bacteria 87817
780 Ga0495677_0001988 3300047445 Bacteria 8158
781 Ga0495677_0002188 3300047445 Bacteria 7746
782 Ga0495677_0005224 3300047445 Bacteria 4938
783 Ga0495677_0005722 3300047445 Bacteria 4711
784 Ga0495677_0007276 3300047445 Bacteria 4140
785 Ga0495677_0008361 3300047445 Bacteria 3847
786 Ga0495677_0014323 3300047445 Bacteria 2888
787 Ga0495677_0073883 3300047445 Bacteria 1272
788 Ga0495677_0082173 3300047445 Bacteria 1208
789 Ga0495677_0086025 3300047445 Bacteria 1181
790 Ga0495677_0157608 3300047445 Bacteria 875
791 Ga0495677_0307771 3300047445 Bacteria 623
792 Ga0495679_011539 3300047446 Bacteria 3403
793 Ga0495679_013009 3300047446 Bacteria 3142
794 Ga0495685_000013 3300047447 Bacteria 79924
795 Ga0495685_015198 3300047447 Bacteria 2624
796 Ga0495685_023425 3300047447 Bacteria 2126
797 Ga0495685_041201 3300047447 Bacteria 1578
798 Ga0495685_280303 3300047447 Bacteria 525
799 Ga0495673_0005818 3300047469 Bacteria 7376
800 Ga0495673_0025704 3300047469 Bacteria 2823
801 Ga0495673_0134920 3300047469 Bacteria 967
802 Ga0495681_0002458 3300047470 Bacteria 13219
803 Ga0495681_0003565 3300047470 Bacteria 10831
804 Ga0495681_0003787 3300047470 Bacteria 10479
805 Ga0495681_0007373 3300047470 Bacteria 7035
806 Ga0495681_0012953 3300047470 Bacteria 4872
807 Ga0495681_0016166 3300047470 Bacteria 4198
808 Ga0495681_0016437 3300047470 Bacteria 4148
809 Ga0495681_0017758 3300047470 Bacteria 3940
810 Ga0495681_0020127 3300047470 Bacteria 3626
811 Ga0495681_0133945 3300047470 Bacteria 1052
812 Ga0495681_0336746 3300047470 Eukaryota 576
813 Ga0495686_0000002 3300047472 Bacteria 1050777
814 Ga0495686_0003258 3300047472 Bacteria 14238
815 Ga0495686_0003588 3300047472 Bacteria 13323
816 Ga0495686_0046693 3300047472 Bacteria 2736
817 Ga0495686_0093194 3300047472 Bacteria 1826
818 Ga0495686_0120986 3300047472 Bacteria 1560
819 Ga0495686_0266848 3300047472 Bacteria 956
820 Ga0495593_0014942 3300047673 Bacteria 4409
821 Ga0495593_0044347 3300047673 Bacteria 2379
822 Ga0495593_0381920 3300047673 Bacteria 704
823 Ga0495593_0656534 3300047673 Bacteria 526
824 Ga0495602_0007930 3300048088 Bacteria 11097
825 Ga0495602_0034938 3300048088 Bacteria 4694
826 Ga0495602_0142585 3300048088 Bacteria 1895
827 Ga0495602_0513908 3300048088 Bacteria 835
828 Ga0495614_0007947 3300048089 Bacteria 4714
829 Ga0495614_0010310 3300048089 Bacteria 4120
830 Ga0495614_0078946 3300048089 Bacteria 1425
831 Ga0495614_0106661 3300048089 Bacteria 1228
832 Ga0495615_0014542 3300048090 Bacteria 1666
833 Ga0495615_0040987 3300048090 Bacteria 1155
834 Ga0495615_0162286 3300048090 Bacteria 672
835 Ga0495626_0000102 3300048091 Bacteria 110315
836 Ga0495626_0000390 3300048091 Bacteria 45358
837 Ga0495626_0002136 3300048091 Bacteria 14309
838 Ga0495626_0004669 3300048091 Bacteria 8313
839 Ga0495626_0005577 3300048091 Bacteria 7304
840 Ga0495626_0007292 3300048091 Bacteria 6167
841 Ga0495626_0010354 3300048091 Bacteria 4979
842 Ga0495626_0019978 3300048091 Bacteria 3342
843 Ga0495626_0021186 3300048091 Bacteria 3228
844 Ga0495626_0021911 3300048091 Bacteria 3162
845 Ga0495626_0023249 3300048091 Bacteria 3054
846 Ga0495626_0048567 3300048091 Bacteria 1968
847 Ga0495626_0050296 3300048091 Bacteria 1926
848 Ga0495626_0057753 3300048091 Bacteria 1775
849 Ga0495626_0058416 3300048091 Bacteria 1762
850 Ga0495626_0075103 3300048091 Bacteria 1511
851 Ga0495626_0077771 3300048091 Bacteria 1478
852 Ga0495626_0107245 3300048091 Bacteria 1212
853 Ga0495626_0163786 3300048091 Bacteria 931
854 Ga0495626_0183362 3300048091 Bacteria 866
855 Ga0495626_0203618 3300048091 Bacteria 810
856 Ga0496100_0053874 3300048903 Bacteria 2621
857 Ga0496100_0066977 3300048903 Bacteria 2383
858 Ga0496100_1174135 3300048903 Bacteria 605
859 Ga0496101_0050138 3300048904 Bacteria 3003
860 Ga0496101_0113837 3300048904 Bacteria 2039
861 Ga0496101_0125524 3300048904 Bacteria 1944
862 Ga0496101_0129448 3300048904 Bacteria 1915
863 Ga0496102_0000088 3300048905 Bacteria 129762
864 Ga0496102_0003622 3300048905 Bacteria 13072
865 Ga0496102_0005159 3300048905 Bacteria 11083
866 Ga0496102_0008059 3300048905 Bacteria 9012
867 Ga0496102_0023395 3300048905 Bacteria 5487
868 Ga0496102_0049434 3300048905 Bacteria 3826
869 Ga0496102_0306811 3300048905 Bacteria 1496
870 Ga0496102_0319962 3300048905 Bacteria 1461
871 Ga0496102_0666429 3300048905 Bacteria 963
872 Ga0496103_0002332 3300048906 Bacteria 11998
873 Ga0496103_0024167 3300048906 Bacteria 3665
874 Ga0496103_0033059 3300048906 Bacteria 3159
875 Ga0496103_0062417 3300048906 Bacteria 2319
876 Ga0496103_0085781 3300048906 Bacteria 1984
877 Ga0496103_0372976 3300048906 Bacteria 917
878 Ga0496104_0119739 3300048907 Bacteria 2527
879 Ga0496104_0170692 3300048907 Bacteria 2086
880 Ga0496104_0740203 3300048907 Unclassified 890
881 Ga0496105_0200391 3300048908 Bacteria 1629
882 Ga0496105_0372773 3300048908 Bacteria 1137
883 Ga0496106_0023569 3300048909 Bacteria 4572
884 Ga0496106_0452444 3300048909 Bacteria 1031
885 Ga0496106_1378780 3300048909 Bacteria 545
886 Ga0496107_0092052 3300048910 Bacteria 2216
887 Ga0496107_0163229 3300048910 Bacteria 1652
888 Ga0496107_0279299 3300048910 Bacteria 1243
889 Ga0496107_0491499 3300048910 Bacteria 910
890 Ga0496107_0741971 3300048910 Bacteria 721
891 Ga0496109_0009803 3300048912 Bacteria 8178
892 Ga0496109_0160473 3300048912 Bacteria 2106
893 Ga0496109_0693064 3300048912 Bacteria 956
894 Ga0496109_0727822 3300048912 Bacteria 930
895 Ga0496109_1122322 3300048912 Bacteria 723
896 Ga0496110_0003394 3300048913 Bacteria 12175
897 Ga0496110_0015836 3300048913 Bacteria 6287
898 Ga0496110_0018878 3300048913 Bacteria 5793
899 Ga0496110_0048290 3300048913 Bacteria 3731
900 Ga0496110_0974580 3300048913 Bacteria 755
901 Ga0496110_1101448 3300048913 Bacteria 702
902 Ga0496111_0028117 3300048914 Bacteria 3983
903 Ga0496111_0037365 3300048914 Bacteria 3475
904 Ga0496111_0085352 3300048914 Bacteria 2308
905 Ga0496111_0133037 3300048914 Bacteria 1841
906 Ga0496111_0198165 3300048914 Bacteria 1493
907 Ga0496111_0362945 3300048914 Bacteria 1072
908 Ga0496111_1017000 3300048914 Bacteria 593
909 Ga0496112_0060493 3300048915 Bacteria 3733
910 Ga0496112_0386576 3300048915 Bacteria 1340
911 Ga0496112_0648961 3300048915 Bacteria 985
912 Ga0496113_0003066 3300048916 Bacteria 9912
913 Ga0496113_0085751 3300048916 Bacteria 2419
914 Ga0496113_0199641 3300048916 Bacteria 1590
915 Ga0496113_0496554 3300048916 Bacteria 980
916 Ga0496113_0585461 3300048916 Unclassified 894
917 Ga0496114_0154632 3300048917 Bacteria 1991
918 Ga0496114_0416894 3300048917 Bacteria 1189
919 Ga0496115_0020211 3300048918 Bacteria 5134
920 Ga0496115_0057770 3300048918 Bacteria 3121
921 Ga0496115_0775736 3300048918 Bacteria 748
922 Ga0496116_0025786 3300048919 Bacteria 4313
923 Ga0496116_0063932 3300048919 Bacteria 2367
924 Ga0496116_0078342 3300048919 Bacteria 2061
925 Ga0496116_0433716 3300048919 Bacteria 569
926 Ga0496119_0132869 3300048922 Bacteria 1354
927 Ga0496121_0014242 3300048924 Bacteria 8458
928 Ga0496121_0029187 3300048924 Bacteria 5110
929 Ga0496121_0049327 3300048924 Bacteria 3570
930 Ga0496121_0094966 3300048924 Bacteria 2318
931 Ga0496121_0172717 3300048924 Bacteria 1568
932 Ga0496121_0243920 3300048924 Bacteria 1250
933 Ga0496122_0000988 3300048925 Bacteria 50798
934 Ga0496122_0012290 3300048925 Bacteria 8551
935 Ga0496122_0012860 3300048925 Bacteria 8273
936 Ga0496122_0026761 3300048925 Bacteria 4958
937 Ga0496122_0043220 3300048925 Bacteria 3533
938 Ga0496122_0044264 3300048925 Bacteria 3476
939 Ga0496122_0238929 3300048925 Bacteria 1026
940 Ga0496123_0005693 3300048926 Bacteria 12424
941 Ga0496123_0007548 3300048926 Bacteria 10194
942 Ga0496123_0010155 3300048926 Bacteria 8359
943 Ga0496123_0030810 3300048926 Bacteria 3918
944 Ga0496123_0035901 3300048926 Bacteria 3525
945 Ga0496123_0099689 3300048926 Bacteria 1695
946 Ga0496123_0135595 3300048926 Bacteria 1355
947 Ga0496124_0026291 3300048927 Bacteria 5251
948 Ga0496124_0032047 3300048927 Bacteria 4648
949 Ga0496124_0075195 3300048927 Bacteria 2791
950 Ga0496124_0087965 3300048927 Bacteria 2540
951 Ga0496124_0090308 3300048927 Bacteria 2499
952 Ga0496124_0100806 3300048927 Bacteria 2340
953 Ga0496124_0102064 3300048927 Bacteria 2322
954 Ga0496124_0410365 3300048927 Bacteria 937
955 Ga0496124_0552829 3300048927 Bacteria 759
956 Ga0496125_0006646 3300048928 Bacteria 12445
957 Ga0496125_0007838 3300048928 Bacteria 11285
958 Ga0496125_0169902 3300048928 Bacteria 1467
959 Ga0496125_0230120 3300048928 Bacteria 1186
960 Ga0496125_0321294 3300048928 Bacteria 938
961 Ga0496126_0671380 3300048929 Bacteria 808
962 Ga0496126_0949469 3300048929 Bacteria 649
963 Ga0496126_1368324 3300048929 Bacteria 512
964 Ga0495678_000042 3300049459 Bacteria 174125
965 Ga0495678_000070 3300049459 Bacteria 131437
966 Ga0495678_002288 3300049459 Bacteria 13288
967 Ga0495678_002833 3300049459 Bacteria 11234
968 Ga0495678_002880 3300049459 Bacteria 11100
969 Ga0495678_003410 3300049459 Bacteria 9864
970 Ga0495678_012871 3300049459 Bacteria 3947
971 Ga0495678_049875 3300049459 Bacteria 1625
972 Ga0495678_148758 3300049459 Bacteria 758
973 Ga0495682_0001441 3300049460 Bacteria 12849
974 Ga0495682_0002337 3300049460 Bacteria 9018
975 Ga0495682_0005940 3300049460 Bacteria 5004
976 Ga0495682_0117508 3300049460 Bacteria 952
977 Ga0501316_038677 3300049532 Unclassified 659
978 Ga0501034_0000336 3300049571 Bacteria 81926
979 Ga0501207_056442 3300049654 Unclassified 711
980 Ga0501035_0005767 3300049822 Bacteria 11675
981 Ga0501044_0388230 3300049823 Bacteria 1310
982 Ga0587077_060491 3300059493 Bacteria 819
983 Ga0587083_0027423 3300059505 Bacteria 1107
984 Ga0587062_044804 3300059639 Bacteria 730
985 Ga0587068_001268 3300059641 Bacteria 2769
986 Ga0587076_034224 3300059645 Bacteria 917
987 Ga0587079_094424 3300059647 Bacteria 705
988 Ga0466962_0370575 3300061719 Bacteria 714
989 Ga0466962_0378868 3300061719 Bacteria 706
990 2513954471 2513237150 Bacteria 6553639
991 2514041069 2513237165 Bacteria 6771773
992 2643798051 2643221556 Bacteria 7251154
993 2644473229 2643221684 Bacteria 7145183
994 2809144533 2808606418 Bacteria 6724496
995 2834641247 2834641062 Bacteria 5559922
996 2857553897 2857553236 Bacteria 6166726
997 2858693395 2858688981 Bacteria 8184122
998 2885086248 2885080285 Bacteria 6355622
999 2901303515 2901300506 Bacteria 8463898
1000 2919480511 2919476304 Bacteria 5888696
1001 644748780 644736347 Bacteria 6476522
1002 8003401071 8003400568 Bacteria 5535898
1003 8047678059 8047673197 Bacteria 7395230
1004 Ga0395900_0034144
1005 JGI24735J21928_10000315
1006 JGI25151J46595_10003169
1007 JGI25151J46595_10015580
1008 JGI25151J46595_10076164
1009 rootL2_10090814
1010 Ga0055539_1026174
1011 Ga0055525_1000009
1012 Ga0055542_1014183
1013 Ga0055526_1002809
1014 Ga0055526_1002900
1015 Ga0055526_1009169
1016 Ga0055537_1001304
1017 Ga0055524_1000644
1018 Ga0055524_1012209
1019 Ga0055536_1000123
1020 Ga0055534_1000683
1021 Ga0055534_1005042
1022 Ga0055534_1050114
1023 Ga0065165_1002937
1024 Ga0065714_10229500
1025 Ga0070658_10195032
1026 Ga0070658_10550350
1027 Ga0070658_10823616
1028 Ga0070658_10967173
1029 Ga0070658_11885013
1030 Ga0070670_101020053
1031 Ga0070660_100013393
1032 Ga0070660_100085697
1033 Ga0070660_100175571
1034 Ga0070660_101097301
1035 Ga0070661_100211592
1036 Ga0070661_100739517
1037 Ga0070675_101109308
1038 Ga0070671_101332938
1039 Ga0070659_100149993
1040 Ga0070663_100506654
1041 Ga0070678_100268723
1042 Ga0070662_100180947
1043 Ga0070662_100197664
1044 Ga0070662_100574189
1045 Ga0068867_100933014
1046 Ga0068855_100206849
1047 Ga0068855_100427654
1048 Ga0070664_100075292
1049 Ga0070664_100279474
1050 Ga0070664_100942039
1051 Ga0070664_101131972
1052 Ga0068854_100985292
1053 Ga0068856_100208336
1054 Ga0068852_100248999
1055 Ga0068871_100273939
1056 Ga0068865_101853379
1057 Ga0099823_1126582
1058 Ga0099826_10000016
1059 Ga0105251_10000415
1060 Ga0105251_10069980
1061 Ga0105244_10074650
1062 Ga0105244_10276046
1063 Ga0105240_10184873
1064 Ga0105245_11069641
1065 Ga0105243_10042909
1066 Ga0105241_10017143
1067 Ga0105241_11180634
1068 Ga0105238_10091926
1069 Ga0105238_10111405
1070 Ga0105239_10680763
1071 Ga0105246_10368129
1072 Ga0157371_10000001
1073 Ga0157371_11053836
1074 Ga0157370_11245553
1075 Ga0157369_10118972
1076 Ga0157369_10495354
1077 Ga0157378_10487090
1078 Ga0163162_10033912
1079 Ga0157372_10746710
1080 Ga0157372_12396790
1081 Ga0182008_10005149
1082 Ga0182008_10027101
1083 Ga0182006_1000268
1084 Ga0182006_1079214
1085 Ga0182007_10009746
1086 Ga0182007_10054035
1087 Ga0182005_1000014
1088 Ga0182005_1000018
1089 Ga0163161_10014907
1090 Ga0163161_10164069
1091 Ga0209563_100015
1092 Ga0207425_1026655
1093 Ga0209677_112273
1094 Ga0209148_1000930
1095 Ga0209565_1000093
1096 Ga0209565_1002895
1097 Ga0209673_1029808
1098 Ga0209130_1018698
1099 Ga0209675_1000203
1100 Ga0209675_1000602
1101 Ga0209675_1018934
1102 Ga0209676_1000012
1103 Ga0209025_1000124
1104 Ga0209025_1001162
1105 Ga0209025_1001443
1106 Ga0209025_1003964
1107 Ga0209564_1000305
1108 Ga0209564_1000701
1109 Ga0209564_1001579
1110 Ga0209758_1058277
1111 Ga0209050_1085854
1112 Ga0209256_1000388
1113 Ga0209256_1000409
1114 Ga0207426_1002357
1115 Ga0209051_1006398
1116 Ga0207655_1105279
1117 Ga0207713_1010886
1118 Ga0207713_1053124
1119 Ga0207705_10063363
1120 Ga0207705_10135033
1121 Ga0207705_10431302
1122 Ga0207654_10027453
1123 Ga0207654_10895188
1124 Ga0207671_10337892
1125 Ga0207660_10451381
1126 Ga0207657_10027156
1127 Ga0207657_10137307
1128 Ga0207657_10137534
1129 Ga0207694_10029691
1130 Ga0207694_11058590
1131 Ga0207659_10756157
1132 Ga0207687_10715231
1133 Ga0207644_10147849
1134 Ga0207690_10070747
1135 Ga0207706_10163947
1136 Ga0207706_10256436
1137 Ga0207686_10096973
1138 Ga0207686_10263092
1139 Ga0207709_10125201
1140 Ga0207704_10759638
1141 Ga0207689_10451683
1142 Ga0207679_10461000
1143 Ga0207679_10546288
1144 Ga0207667_10023046
1145 Ga0207667_10258877
1146 Ga0207640_10041675
1147 Ga0207639_10460079
1148 Ga0207678_10080552
1149 Ga0207678_10321486
1150 Ga0207648_10599689
1151 Ga0207674_10151402
1152 Ga0207683_10343816
1153 Ga0207698_10443628
1154 Ga0209281_1002048
1155 Ga0209282_1000080
1156 Ga0316178_1071755
1157 Ga0316180_1024582
1158 Ga0316181_1020261
1159 Ga0316182_1281142
1160 Ga0307513_10372073
1161 Ga0307408_100002121
1162 Ga0395899_0000330
1163 Ga0395899_0001893
1164 Ga0395899_0015861
1165 Ga0395899_0046032
1166 Ga0395899_0061526
1167 Ga0395899_0316431
1168 Ga0395899_0531663
1169 Ga0395900_0002680
1170 Ga0395900_0017086
1171 Ga0395900_0056106
1172 Ga0395900_0070916
1173 Ga0395900_0079724
1174 Ga0395900_0302766
1175 Ga0395900_0475579
1176 Ga0395900_0619123
1177 Ga0395900_1051951
1178 Ga0395898_0025598
1179 Ga0395898_0129947
1180 Ga0395898_0405058
1181 Ga0395898_0499033
1182 Ga0395905_0005473
1183 Ga0395905_0063746
1184 Ga0395905_0222007
1185 Ga0395905_0238560
1186 Ga0395905_0652219
1187 Ga0395905_1267169
1188 Ga0395901_0000229
1189 Ga0395901_0022887
1190 Ga0395901_0102231
1191 Ga0395901_0275942
1192 Ga0395901_0466110
1193 Ga0439436_0253896
1194 Ga0439465_0018766
1195 Ga0439433_0018259
1196 Ga0439448_0001129
1197 Ga0439448_0009122
1198 Ga0439448_0085656
1199 Ga0439449_0223813
1200 Ga0439452_039490
1201 Ga0439454_023406
1202 Ga0439455_0001103
1203 Ga0439455_0095170
1204 Ga0450897_002704
1205 Ga0450896_034662
1206 Ga0450904_000265
1207 Ga0439458_0110135
1208 Ga0466969_0132304
1209 Ga0466969_0136552
1210 Ga0466969_0256465
1211 Ga0466972_0003253
1212 Ga0466972_0201043
1213 Ga0466972_0427416
1214 Ga0466972_0438469
1215 Ga0466965_0002351
1216 Ga0466965_0043891
1217 Ga0466965_0048928
1218 Ga0466965_0071744
1219 Ga0466965_0117874
1220 Ga0466965_0284952
1221 Ga0466965_0544974
1222 Ga0466965_0747661
1223 Ga0466966_0023547
1224 Ga0466966_0025434
1225 Ga0466966_0090562
1226 Ga0466966_0103298
1227 Ga0466966_0154108
1228 Ga0466966_0182003
1229 Ga0466966_0352428
1230 Ga0466966_0534523
1231 Ga0466961_0127426
1232 Ga0466961_0200239
1233 Ga0466961_0271661
1234 Ga0466963_0250305
1235 Ga0466963_0348577
1236 Ga0466964_0000266
1237 Ga0466964_0010720
1238 Ga0466971_0141423
1239 Ga0466971_0421425
1240 Ga0466970_0041957
1241 Ga0466970_0194627
1242 Ga0466970_0776712
1243 Ga0466957_0002503
1244 Ga0466957_0007273
1245 Ga0466957_0097447
1246 Ga0466957_0199252
1247 Ga0466960_0527823
1248 Ga0466959_0073815
1249 Ga0466959_0109015
1250 Ga0466959_0123429
1251 Ga0466959_1021240
1252 Ga0466958_0259796
1253 Ga0466967_0009076
1254 Ga0466967_0316823
1255 Ga0466967_1453551
1256 Ga0495617_000002
1257 Ga0495617_001334
1258 Ga0495617_004889
1259 Ga0495617_030414
1260 Ga0495617_274933
1261 Ga0495627_001759
1262 Ga0495627_017831
1263 Ga0495627_018539
1264 Ga0495627_089696
1265 Ga0495603_0088345
1266 Ga0495603_0090886
1267 Ga0495603_0108944
1268 Ga0495603_0440304
1269 Ga0495590_0000025
1270 Ga0495590_0000959
1271 Ga0495590_0012485
1272 Ga0495590_0030361
1273 Ga0495590_0038338
1274 Ga0495590_0109218
1275 Ga0495590_0179115
1276 Ga0495591_002012
1277 Ga0495591_045435
1278 Ga0495629_0010071
1279 Ga0495629_0150374
1280 Ga0495629_0242011
1281 Ga0495629_0367075
1282 Ga0495638_0036194
1283 Ga0495638_0037102
1284 Ga0495638_0051443
1285 Ga0495638_0094239
1286 Ga0495638_0099914
1287 Ga0495638_0366570
1288 Ga0495653_0024794
1289 Ga0495653_0027939
1290 Ga0495653_0045074
1291 Ga0495653_0219616
1292 Ga0495650_0000015
1293 Ga0495650_0000124
1294 Ga0495650_0034770
1295 Ga0495650_0043762
1296 Ga0495650_0107043
1297 Ga0495650_0143247
1298 Ga0495580_0026098
1299 Ga0495580_0147170
1300 Ga0495580_0193111
1301 Ga0495582_0027177
1302 Ga0495582_0188089
1303 Ga0495605_0000293
1304 Ga0495605_0000717
1305 Ga0495605_0008261
1306 Ga0495605_0010067
1307 Ga0495605_0010421
1308 Ga0495605_0014020
1309 Ga0495605_0032020
1310 Ga0495605_0051425
1311 Ga0495605_0065215
1312 Ga0495605_0077476
1313 Ga0495605_0079005
1314 Ga0495605_0161703
1315 Ga0495605_0186098
1316 Ga0495605_0436537
1317 Ga0495664_0039896
1318 Ga0495664_0118369
1319 Ga0495664_0301979
1320 Ga0495584_0000017
1321 Ga0495584_0002122
1322 Ga0495584_0003169
1323 Ga0495584_0003659
1324 Ga0495584_0004378
1325 Ga0495584_0006023
1326 Ga0495584_0011969
1327 Ga0495584_0017021
1328 Ga0495584_0076394
1329 Ga0495584_0103015
1330 Ga0495584_0114280
1331 Ga0495584_0162721
1332 Ga0495584_0173893
1333 Ga0495584_0197309
1334 Ga0495585_0000006
1335 Ga0495585_0000425
1336 Ga0495585_0001636
1337 Ga0495585_0001963
1338 Ga0495585_0003227
1339 Ga0495585_0004277
1340 Ga0495585_0005707
1341 Ga0495585_0009361
1342 Ga0495585_0013937
1343 Ga0495585_0026731
1344 Ga0495585_0027004
1345 Ga0495585_0045407
1346 Ga0495585_0046387
1347 Ga0495585_0119739
1348 Ga0495585_0160338
1349 Ga0495585_0192515
1350 Ga0495585_0317471
1351 Ga0495585_0372835
1352 Ga0495594_0007537
1353 Ga0495594_0029822
1354 Ga0495594_0032797
1355 Ga0495594_0069541
1356 Ga0495594_0295131
1357 Ga0495594_0358403
1358 Ga0495596_0001127
1359 Ga0495596_0001627
1360 Ga0495596_0002615
1361 Ga0495596_0002998
1362 Ga0495596_0003128
1363 Ga0495596_0005139
1364 Ga0495596_0006410
1365 Ga0495596_0006835
1366 Ga0495596_0011790
1367 Ga0495596_0013870
1368 Ga0495596_0014743
1369 Ga0495596_0020505
1370 Ga0495596_0078049
1371 Ga0495596_0082877
1372 Ga0495596_0104613
1373 Ga0495596_0339620
1374 Ga0495607_0004530
1375 Ga0495607_0005031
1376 Ga0495607_0006792
1377 Ga0495607_0008578
1378 Ga0495607_0027084
1379 Ga0495607_0038101
1380 Ga0495607_0051640
1381 Ga0495607_0054785
1382 Ga0495607_0070137
1383 Ga0495607_0143478
1384 Ga0495607_0207924
1385 Ga0495583_0000195
1386 Ga0495583_0001466
1387 Ga0495583_0002716
1388 Ga0495583_0003773
1389 Ga0495583_0007016
1390 Ga0495583_0007306
1391 Ga0495583_0012979
1392 Ga0495583_0016767
1393 Ga0495583_0026924
1394 Ga0495583_0030630
1395 Ga0495583_0041291
1396 Ga0495583_0042485
1397 Ga0495583_0081389
1398 Ga0495583_0125237
1399 Ga0495583_0137890
1400 Ga0495583_0154802
1401 Ga0495606_0011093
1402 Ga0495606_0019132
1403 Ga0495606_0025281
1404 Ga0495606_0053907
1405 Ga0495606_0105736
1406 Ga0495606_0108723
1407 Ga0495606_0209939
1408 Ga0495606_0414276
1409 Ga0495610_0005810
1410 Ga0495610_0009822
1411 Ga0495610_0234611
1412 Ga0495616_0001644
1413 Ga0495616_0002635
1414 Ga0495616_0002826
1415 Ga0495616_0003400
1416 Ga0495616_0003450
1417 Ga0495616_0004626
1418 Ga0495616_0011397
1419 Ga0495616_0017902
1420 Ga0495616_0020264
1421 Ga0495616_0025185
1422 Ga0495616_0026001
1423 Ga0495616_0035261
1424 Ga0495616_0049200
1425 Ga0495616_0058067
1426 Ga0495616_0072260
1427 Ga0495616_0131521
1428 Ga0495616_0144307
1429 Ga0495616_0226760
1430 Ga0495620_0031794
1431 Ga0495620_0057745
1432 Ga0495620_0115939
1433 Ga0495620_0239770
1434 Ga0495628_0100611
1435 Ga0495630_0042268
1436 Ga0495630_0044241
1437 Ga0495631_0000378
1438 Ga0495631_0004326
1439 Ga0495631_0004421
1440 Ga0495631_0011371
1441 Ga0495631_0014497
1442 Ga0495631_0023973
1443 Ga0495631_0025855
1444 Ga0495631_0038597
1445 Ga0495631_0049539
1446 Ga0495631_0082014
1447 Ga0495631_0088996
1448 Ga0495632_0002064
1449 Ga0495632_0003086
1450 Ga0495632_0003136
1451 Ga0495632_0004557
1452 Ga0495632_0010943
1453 Ga0495632_0066601
1454 Ga0495632_0097436
1455 Ga0495632_0123556
1456 Ga0495637_0000019
1457 Ga0495637_0003900
1458 Ga0495637_0249320
1459 Ga0495637_0268032
1460 Ga0495643_0002040
1461 Ga0495643_0004574
1462 Ga0495643_0004743
1463 Ga0495643_0010057
1464 Ga0495643_0015762
1465 Ga0495643_0035817
1466 Ga0495643_0060649
1467 Ga0495643_0154069
1468 Ga0495644_0003348
1469 Ga0495644_0005381
1470 Ga0495644_0008956
1471 Ga0495644_0010090
1472 Ga0495644_0016971
1473 Ga0495644_0020194
1474 Ga0495644_0023245
1475 Ga0495644_0045447
1476 Ga0495644_0064151
1477 Ga0495648_0000007
1478 Ga0495648_0003804
1479 Ga0495648_0006194
1480 Ga0495648_0006859
1481 Ga0495648_0018822
1482 Ga0495648_0025767
1483 Ga0495648_0055092
1484 Ga0495648_0088287
1485 Ga0495648_0179495
1486 Ga0495648_0427061
1487 Ga0495663_0003993
1488 Ga0495663_0173990
1489 Ga0495666_0001537
1490 Ga0495666_0046279
1491 Ga0495666_0062976
1492 Ga0495666_0075641
1493 Ga0495666_0099593
1494 Ga0495642_0001065
1495 Ga0495642_0001266
1496 Ga0495642_0001585
1497 Ga0495642_0006219
1498 Ga0495642_0022878
1499 Ga0495642_0025093
1500 Ga0495642_0032983
1501 Ga0495642_0067061
1502 Ga0495642_0141057
1503 Ga0495642_0171182
1504 Ga0495642_0190928
1505 Ga0495642_0262402
1506 Ga0495642_0282560
1507 Ga0495642_0308005
1508 Ga0495642_0378999
1509 Ga0495642_0379944
1510 Ga0495652_0021270
1511 Ga0495652_0113029
1512 Ga0495654_0013470
1513 Ga0495654_0031944
1514 Ga0495654_0052725
1515 Ga0495654_0089043
1516 Ga0495654_0110026
1517 Ga0495654_0160229
1518 Ga0495654_0187567
1519 Ga0495654_0258178
1520 Ga0495665_0005637
1521 Ga0495665_0009705
1522 Ga0495665_0017307
1523 Ga0495665_0035594
1524 Ga0495665_0239174
1525 Ga0495665_0442632
1526 Ga0495640_0022008
1527 Ga0495586_0013652
1528 Ga0495586_0040634
1529 Ga0495586_0076423
1530 Ga0495587_0183565
1531 Ga0495598_0042112
1532 Ga0495609_0000002
1533 Ga0495609_0003408
1534 Ga0495609_0003793
1535 Ga0495609_0008116
1536 Ga0495609_0008528
1537 Ga0495609_0014176
1538 Ga0495609_0026294
1539 Ga0495609_0029073
1540 Ga0495609_0032914
1541 Ga0495609_0044907
1542 Ga0495609_0064449
1543 Ga0495609_0129051
1544 Ga0495609_0223872
1545 Ga0495621_0001811
1546 Ga0495597_0001284
1547 Ga0495597_0002344
1548 Ga0495597_0002387
1549 Ga0495597_0002599
1550 Ga0495597_0009014
1551 Ga0495597_0013849
1552 Ga0495597_0039644
1553 Ga0495597_0086401
1554 Ga0495597_0096196
1555 Ga0495597_0129230
1556 Ga0495597_0158397
1557 Ga0495597_0185583
1558 Ga0495597_0279306
1559 Ga0495645_0029119
1560 Ga0495622_0049733
1561 Ga0495622_0053475
1562 Ga0495622_0073480
1563 Ga0495622_0081648
1564 Ga0495633_0001186
1565 Ga0495633_0001954
1566 Ga0495633_0004314
1567 Ga0495633_0009485
1568 Ga0495633_0014116
1569 Ga0495633_0023245
1570 Ga0495633_0034745
1571 Ga0495633_0052614
1572 Ga0495633_0073264
1573 Ga0495633_0092378
1574 Ga0495633_0180952
1575 Ga0495633_0280185
1576 Ga0495656_0009683
1577 Ga0495656_0019063
1578 Ga0495656_0144590
1579 Ga0495656_0198688
1580 Ga0495656_0239371
1581 Ga0495656_0239904
1582 Ga0495668_0000998
1583 Ga0495668_0003576
1584 Ga0495668_0006241
1585 Ga0495668_0007008
1586 Ga0495668_0037244
1587 Ga0495668_0038237
1588 Ga0495668_0042397
1589 Ga0495668_0049468
1590 Ga0495668_0051608
1591 Ga0495668_0061752
1592 Ga0495668_0090527
1593 Ga0495668_0093202
1594 Ga0495668_0101079
1595 Ga0495668_0238881
1596 Ga0495668_0603875
1597 Ga0495668_0702576
1598 Ga0495634_0005004
1599 Ga0495611_0001415
1600 Ga0495611_0002181
1601 Ga0495611_0009834
1602 Ga0495611_0013960
1603 Ga0495611_0055227
1604 Ga0495611_0070768
1605 Ga0495611_0150325
1606 Ga0495611_0274078
1607 Ga0495625_0001394
1608 Ga0495625_0228814
1609 Ga0495625_0326586
1610 Ga0495625_0347417
1611 Ga0495625_0371592
1612 Ga0495625_0698359
1613 Ga0495625_0753544
1614 Ga0495625_0886808
1615 Ga0495635_0072002
1616 Ga0495635_0327690
1617 Ga0495635_0545277
1618 Ga0495659_0074592
1619 Ga0495659_0087101
1620 Ga0495661_0002730
1621 Ga0495661_0002951
1622 Ga0495661_0003461
1623 Ga0495661_0004001
1624 Ga0495661_0016564
1625 Ga0495661_0017594
1626 Ga0495661_0029472
1627 Ga0495661_0035117
1628 Ga0495661_0052712
1629 Ga0495661_0062501
1630 Ga0495661_0063894
1631 Ga0495661_0073056
1632 Ga0495661_0092205
1633 Ga0495661_0098384
1634 Ga0495661_0158016
1635 Ga0495661_0158612
1636 Ga0495661_0204926
1637 Ga0495661_0222358
1638 Ga0495588_0000127
1639 Ga0495588_0003809
1640 Ga0495588_0006102
1641 Ga0495588_0099777
1642 Ga0495588_0165739
1643 Ga0495588_0176098
1644 Ga0495657_0351842
1645 Ga0495599_0076805
1646 Ga0495623_0005951
1647 Ga0495623_0035386
1648 Ga0495623_0059819
1649 Ga0495623_0109108
1650 Ga0495623_0635594
1651 Ga0495646_0194441
1652 Ga0495646_0308269
1653 Ga0495669_0001026
1654 Ga0495669_0008679
1655 Ga0495669_0009004
1656 Ga0495669_0019937
1657 Ga0495669_0042110
1658 Ga0495669_0084276
1659 Ga0495669_0102182
1660 Ga0495669_0108240
1661 Ga0495669_0122365
1662 Ga0495669_0133017
1663 Ga0495669_0272705
1664 Ga0495613_0027077
1665 Ga0495613_0245395
1666 Ga0495670_0000883
1667 Ga0495670_0006114
1668 Ga0495670_0020383
1669 Ga0495670_0049566
1670 Ga0495670_0057620
1671 Ga0495670_0059800
1672 Ga0495670_0081035
1673 Ga0495670_0082183
1674 Ga0495670_0093454
1675 Ga0495670_0104793
1676 Ga0495670_0109313
1677 Ga0495670_0121522
1678 Ga0495670_0371893
1679 Ga0495671_0002227
1680 Ga0495671_0002525
1681 Ga0495671_0004716
1682 Ga0495671_0043376
1683 Ga0495671_0061613
1684 Ga0495671_0064360
1685 Ga0495671_0256710
1686 Ga0495649_0002138
1687 Ga0495649_0002201
1688 Ga0495649_0034612
1689 Ga0495649_0044534
1690 Ga0495649_0048387
1691 Ga0495649_0069740
1692 Ga0495649_0091237
1693 Ga0495649_0094762
1694 Ga0495649_0097199
1695 Ga0495589_0000083
1696 Ga0495589_0000357
1697 Ga0495589_0001877
1698 Ga0495589_0004129
1699 Ga0495589_0006723
1700 Ga0495589_0022129
1701 Ga0495589_0037683
1702 Ga0495589_0051190
1703 Ga0495589_0059663
1704 Ga0495589_0104489
1705 Ga0495589_0107289
1706 Ga0495589_0120065
1707 Ga0495589_0126736
1708 Ga0495600_0015331
1709 Ga0495600_0081580
1710 Ga0495600_0668486
1711 Ga0495660_0001996
1712 Ga0495660_0005132
1713 Ga0495660_0011218
1714 Ga0495660_0019351
1715 Ga0495660_0021793
1716 Ga0495660_0028149
1717 Ga0495660_0037780
1718 Ga0495660_0165881
1719 Ga0495660_0422628
1720 Ga0495581_0074203
1721 Ga0495581_0084578
1722 Ga0495581_0142962
1723 Ga0495581_0325912
1724 Ga0495604_0017845
1725 Ga0495604_0022620
1726 Ga0495604_0133746
1727 Ga0495636_0015364
1728 Ga0495636_0050761
1729 Ga0495636_0133924
1730 Ga0495674_0007700
1731 Ga0495674_0047023
1732 Ga0495672_0000041
1733 Ga0495672_0000050
1734 Ga0495672_0001417
1735 Ga0495672_0002883
1736 Ga0495672_0003045
1737 Ga0495672_0004834
1738 Ga0495672_0008621
1739 Ga0495672_0008661
1740 Ga0495672_0057686
1741 Ga0495672_0073192
1742 Ga0495672_0097969
1743 Ga0495672_0108211
1744 Ga0495672_0134569
1745 Ga0495676_0005037
1746 Ga0495676_0013916
1747 Ga0495676_0022904
1748 Ga0495676_0070851
1749 Ga0495676_0359315
1750 Ga0495680_0005811
1751 Ga0495680_0077544
1752 Ga0495680_0174571
1753 Ga0495683_0000543
1754 Ga0495683_0004058
1755 Ga0495683_0004786
1756 Ga0495683_0010347
1757 Ga0495683_0013132
1758 Ga0495683_0029884
1759 Ga0495683_0029979
1760 Ga0495683_0034543
1761 Ga0495683_0064668
1762 Ga0495683_0065120
1763 Ga0495683_0075655
1764 Ga0495683_0076471
1765 Ga0495683_0105149
1766 Ga0495683_0177010
1767 Ga0495683_0202542
1768 Ga0495683_0483456
1769 Ga0495687_000075
1770 Ga0495687_000197
1771 Ga0495687_001196
1772 Ga0495687_002881
1773 Ga0495687_002919
1774 Ga0495687_003090
1775 Ga0495687_008299
1776 Ga0495687_098015
1777 Ga0495687_100418
1778 Ga0495687_154976
1779 Ga0495675_0005488
1780 Ga0495675_0074877
1781 Ga0495675_0230419
1782 Ga0495677_0000030
1783 Ga0495677_0001988
1784 Ga0495677_0002188
1785 Ga0495677_0005224
1786 Ga0495677_0005722
1787 Ga0495677_0007276
1788 Ga0495677_0008361
1789 Ga0495677_0014323
1790 Ga0495677_0073883
1791 Ga0495677_0082173
1792 Ga0495677_0086025
1793 Ga0495677_0157608
1794 Ga0495677_0307771
1795 Ga0495679_011539
1796 Ga0495679_013009
1797 Ga0495685_000013
1798 Ga0495685_015198
1799 Ga0495685_023425
1800 Ga0495685_041201
1801 Ga0495685_280303
1802 Ga0495673_0005818
1803 Ga0495673_0025704
1804 Ga0495673_0134920
1805 Ga0495681_0002458
1806 Ga0495681_0003565
1807 Ga0495681_0003787
1808 Ga0495681_0007373
1809 Ga0495681_0012953
1810 Ga0495681_0016166
1811 Ga0495681_0016437
1812 Ga0495681_0017758
1813 Ga0495681_0020127
1814 Ga0495681_0133945
1815 Ga0495681_0336746
1816 Ga0495686_0000002
1817 Ga0495686_0003258
1818 Ga0495686_0003588
1819 Ga0495686_0046693
1820 Ga0495686_0093194
1821 Ga0495686_0120986
1822 Ga0495686_0266848
1823 Ga0495593_0014942
1824 Ga0495593_0044347
1825 Ga0495593_0381920
1826 Ga0495593_0656534
1827 Ga0495602_0007930
1828 Ga0495602_0034938
1829 Ga0495602_0142585
1830 Ga0495602_0513908
1831 Ga0495614_0007947
1832 Ga0495614_0010310
1833 Ga0495614_0078946
1834 Ga0495614_0106661
1835 Ga0495615_0014542
1836 Ga0495615_0040987
1837 Ga0495615_0162286
1838 Ga0495626_0000102
1839 Ga0495626_0000390
1840 Ga0495626_0002136
1841 Ga0495626_0004669
1842 Ga0495626_0005577
1843 Ga0495626_0007292
1844 Ga0495626_0010354
1845 Ga0495626_0019978
1846 Ga0495626_0021186
1847 Ga0495626_0021911
1848 Ga0495626_0023249
1849 Ga0495626_0048567
1850 Ga0495626_0050296
1851 Ga0495626_0057753
1852 Ga0495626_0058416
1853 Ga0495626_0075103
1854 Ga0495626_0077771
1855 Ga0495626_0107245
1856 Ga0495626_0163786
1857 Ga0495626_0183362
1858 Ga0495626_0203618
1859 Ga0496100_0053874
1860 Ga0496100_0066977
1861 Ga0496100_1174135
1862 Ga0496101_0050138
1863 Ga0496101_0113837
1864 Ga0496101_0125524
1865 Ga0496101_0129448
1866 Ga0496102_0000088
1867 Ga0496102_0003622
1868 Ga0496102_0005159
1869 Ga0496102_0008059
1870 Ga0496102_0023395
1871 Ga0496102_0049434
1872 Ga0496102_0306811
1873 Ga0496102_0319962
1874 Ga0496102_0666429
1875 Ga0496103_0002332
1876 Ga0496103_0024167
1877 Ga0496103_0033059
1878 Ga0496103_0062417
1879 Ga0496103_0085781
1880 Ga0496103_0372976
1881 Ga0496104_0119739
1882 Ga0496104_0170692
1883 Ga0496104_0740203
1884 Ga0496105_0200391
1885 Ga0496105_0372773
1886 Ga0496106_0023569
1887 Ga0496106_0452444
1888 Ga0496106_1378780
1889 Ga0496107_0092052
1890 Ga0496107_0163229
1891 Ga0496107_0279299
1892 Ga0496107_0491499
1893 Ga0496107_0741971
1894 Ga0496109_0009803
1895 Ga0496109_0160473
1896 Ga0496109_0693064
1897 Ga0496109_0727822
1898 Ga0496109_1122322
1899 Ga0496110_0003394
1900 Ga0496110_0015836
1901 Ga0496110_0018878
1902 Ga0496110_0048290
1903 Ga0496110_0974580
1904 Ga0496110_1101448
1905 Ga0496111_0028117
1906 Ga0496111_0037365
1907 Ga0496111_0085352
1908 Ga0496111_0133037
1909 Ga0496111_0198165
1910 Ga0496111_0362945
1911 Ga0496111_1017000
1912 Ga0496112_0060493
1913 Ga0496112_0386576
1914 Ga0496112_0648961
1915 Ga0496113_0003066
1916 Ga0496113_0085751
1917 Ga0496113_0199641
1918 Ga0496113_0496554
1919 Ga0496113_0585461
1920 Ga0496114_0154632
1921 Ga0496114_0416894
1922 Ga0496115_0020211
1923 Ga0496115_0057770
1924 Ga0496115_0775736
1925 Ga0496116_0025786
1926 Ga0496116_0063932
1927 Ga0496116_0078342
1928 Ga0496116_0433716
1929 Ga0496119_0132869
1930 Ga0496121_0014242
1931 Ga0496121_0029187
1932 Ga0496121_0049327
1933 Ga0496121_0094966
1934 Ga0496121_0172717
1935 Ga0496121_0243920
1936 Ga0496122_0000988
1937 Ga0496122_0012290
1938 Ga0496122_0012860
1939 Ga0496122_0026761
1940 Ga0496122_0043220
1941 Ga0496122_0044264
1942 Ga0496122_0238929
1943 Ga0496123_0005693
1944 Ga0496123_0007548
1945 Ga0496123_0010155
1946 Ga0496123_0030810
1947 Ga0496123_0035901
1948 Ga0496123_0099689
1949 Ga0496123_0135595
1950 Ga0496124_0026291
1951 Ga0496124_0032047
1952 Ga0496124_0075195
1953 Ga0496124_0087965
1954 Ga0496124_0090308
1955 Ga0496124_0100806
1956 Ga0496124_0102064
1957 Ga0496124_0410365
1958 Ga0496124_0552829
1959 Ga0496125_0006646
1960 Ga0496125_0007838
1961 Ga0496125_0169902
1962 Ga0496125_0230120
1963 Ga0496125_0321294
1964 Ga0496126_0671380
1965 Ga0496126_0949469
1966 Ga0496126_1368324
1967 Ga0495678_000042
1968 Ga0495678_000070
1969 Ga0495678_002288
1970 Ga0495678_002833
1971 Ga0495678_002880
1972 Ga0495678_003410
1973 Ga0495678_012871
1974 Ga0495678_049875
1975 Ga0495678_148758
1976 Ga0495682_0001441
1977 Ga0495682_0002337
1978 Ga0495682_0005940
1979 Ga0495682_0117508
1980 Ga0501316_038677
1981 Ga0501034_0000336
1982 Ga0501207_056442
1983 Ga0501035_0005767
1984 Ga0501044_0388230
1985 Ga0587077_060491
1986 Ga0587083_0027423
1987 Ga0587062_044804
1988 Ga0587068_001268
1989 Ga0587076_034224
1990 Ga0587079_094424
1991 Ga0466962_0370575
1992 Ga0466962_0378868
1993 2513954471
1994 2514041069
1995 2643798051
1996 2644473229
1997 2809144533
1998 2834641247
1999 2857553897
2000 2858693395
2001 2885086248
2002 2901303515
2003 2919480511
2004 644748780
2005 8003401071
2006 8047678059

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04364

DNA_pol3_chi

DNA polymerase III chi subunit, HolC

18

151

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sxu-assembly1.cif.gz_A structure of the e. coli ssb-dna polymerase iii interface 0.8364 1 135
3sxu-assembly1.cif.gz_A structure of the e. coli ssb-dna polymerase iii interface 0.8151 1 135
8byq-assembly1.cif.gz_0 rna polymerase ii pre-initiation complex with the proximal +1 nucleosome (pic-nuc10w) 0.7212 2 136
7ad8-assembly1.cif.gz_A core tfiih-xpa-dna complex with modelled p62 subunit 0.7167 1 138
7ad8-assembly1.cif.gz_A core tfiih-xpa-dna complex with modelled p62 subunit 0.7137 1 138
ID Description Score Start End Superfamily
1em8C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi 0.8809 1 133 3.40.50.10110
1em8C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi 0.8457 1 133 3.40.50.10110
af_A0A0P0VNY0_1_181_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7078 14 88 3.40.50.300
af_O97290_481_658_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7043 2 132 3.40.50.300
af_Q8I416_933_1112_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6987 3 127 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A103DVL9-F1-model_v4 DNA polymerase III chi subunit (EC 2.7.7.7) (DNA polymerase III subunit chi) 0.9929 1 138 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A0F5K6J0-F1-model_v4 DNA polymerase III subunit chi 0.9899 1 137 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A0Q4XRG3-F1-model_v4 DNA polymerase III subunit chi 0.9895 1 135 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A375HA84-F1-model_v4 DNA polymerase III subunit chi (EC 2.7.7.7) 0.9887 1 138 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A0F5K6J0-F1-model_v4 DNA polymerase III subunit chi 0.9828 1 137 GO:0003677
GO:0003887
GO:0006260
GO:0032298

Map