F487944
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1003 | 750 | 2006 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0186950|Ga0495686_0186950_131_826 |
| Length | 231 |
| Sequence | MSSLRKRVVVFISGGGSNMLALVKAAKAADHPAKIVGVISDRPDAGGLAKAAAEGIPTFAFARKDFASKDAHEAAIFSCLDELQPDILCLAGYMRLLTGEFIRRYEGRIINIHPSLLPLFPGLHTHQRAIDAGMRIAGCTVHFVTEGMDEGPVIGQASVPVLSDDTAETLAARVLGIEHQLYPLVLRLMADGKVKMEDGRTVTAVDTGTTLVPPALRQLVLQLVEGQTSQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 40 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 41 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 44 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 62 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 63 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 64 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 65 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 66 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 67 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 102 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 108 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 112 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 115 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 116 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 117 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 122 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 123 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 124 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 126 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 127 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 128 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 129 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 130 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 131 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 132 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 133 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 134 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 135 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 136 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 137 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 138 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 139 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 140 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 141 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 142 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 143 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 144 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 145 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 146 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 207 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 208 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 209 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 210 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 213 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 214 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 215 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 216 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 217 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 232 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 233 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 234 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 235 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 236 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 237 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 238 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 239 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 241 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 243 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 244 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 245 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 246 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 247 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 248 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 250 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 251 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 252 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 253 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 254 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 255 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 256 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 258 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 259 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 260 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 261 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 262 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 263 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 264 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 265 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 266 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 267 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 268 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 269 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 270 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 271 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 272 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 273 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 274 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 275 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 276 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 277 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 278 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 279 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 280 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 281 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 282 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 283 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 284 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 285 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 286 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 287 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 288 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 289 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 290 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 291 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 292 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 293 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 294 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 295 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 296 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 297 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 298 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 299 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 300 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 301 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 302 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 303 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 304 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 305 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 306 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 307 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 308 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 309 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 310 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 311 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 312 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 313 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 314 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 315 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 316 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 317 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 318 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 319 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 320 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 321 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 322 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 323 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 324 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 325 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 326 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 327 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 328 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 329 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 330 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 331 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 332 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 333 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 334 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 335 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 336 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 337 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 338 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 339 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 340 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 341 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 342 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 343 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 344 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 345 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 346 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 347 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 348 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 349 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 350 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 351 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 352 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 353 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 354 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 355 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 356 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 357 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 358 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 359 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 360 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 361 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 362 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 363 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 364 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 365 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 366 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 367 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 368 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 369 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 370 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 371 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 372 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 373 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 374 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 375 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 376 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 377 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 378 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 379 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 380 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 381 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 382 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 383 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 384 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 385 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 386 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 387 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 388 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 389 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 390 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 391 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 392 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 393 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 394 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 395 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 396 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 397 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 398 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 399 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 400 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 401 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 402 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 403 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 404 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 405 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 406 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 407 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 408 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 409 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 410 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 411 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 412 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 413 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 414 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 415 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 416 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 417 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 418 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 419 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 420 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 421 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 422 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 423 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 424 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 425 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 426 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 427 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 428 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 429 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 430 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 431 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 432 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 433 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 434 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 435 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 436 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 437 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 438 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 439 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 440 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 441 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 442 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 443 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 444 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 445 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 446 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 447 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 448 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 449 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 450 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 451 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 452 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 453 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 454 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 455 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 456 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 457 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 458 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 459 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 460 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 461 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 462 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 463 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 464 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 465 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 466 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 467 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 468 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 469 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 470 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 471 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 472 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 473 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 474 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 475 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 476 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 477 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 478 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 479 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 480 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 481 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 482 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 483 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 484 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 485 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 486 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 487 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 488 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 489 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 490 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 491 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 492 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 493 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 494 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 495 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 496 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 497 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 498 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 499 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 500 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 501 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 502 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 503 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 504 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 505 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 506 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 507 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 508 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 509 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 510 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 511 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 512 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 513 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 514 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 515 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 516 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 517 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 518 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 519 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 520 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 521 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 522 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 523 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 524 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 525 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 526 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 527 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 528 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 529 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 530 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 531 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 532 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 533 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 534 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 535 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 536 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 537 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 538 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 539 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 540 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 541 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 542 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 543 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 544 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 545 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 546 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 547 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 548 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 549 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 550 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 551 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 552 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 553 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 554 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 555 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 556 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 557 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 558 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 559 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 560 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 561 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 562 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 563 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 564 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 565 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 566 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 567 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 568 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 569 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 570 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 571 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 572 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 573 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 574 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 575 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 576 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 577 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 578 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 579 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 580 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 581 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 582 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 583 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 584 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 585 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 586 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 587 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 588 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 589 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 590 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 591 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 592 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 593 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 594 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 595 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 596 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 597 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 598 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 599 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 600 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 601 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 602 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 603 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 604 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 605 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 606 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 607 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 608 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 609 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 610 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 611 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 612 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 613 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 614 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 615 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 616 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 617 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 618 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 619 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 620 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 621 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 622 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 623 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 624 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 625 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 626 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 627 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 628 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 629 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 630 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 631 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 632 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 633 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 634 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 635 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 636 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 637 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 638 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 639 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 640 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 641 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 642 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 643 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 644 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 645 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 646 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 647 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 648 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 649 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 650 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 651 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 652 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 653 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 654 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 655 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 656 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 657 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 658 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 659 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 660 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 661 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 662 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 663 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 664 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 665 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 666 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 667 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 668 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 669 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 670 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 671 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 672 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 673 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 674 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 675 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 676 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 677 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 678 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 679 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 680 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 681 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 682 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 683 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 684 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 685 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 686 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 687 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 688 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 689 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 690 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 691 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 692 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 693 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 694 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 695 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 696 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 697 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 698 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 699 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 700 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 701 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 702 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 703 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 704 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 705 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 706 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 707 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 708 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 709 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 710 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 711 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 712 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 713 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 714 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 715 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 716 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 717 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 718 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 719 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 720 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 721 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 722 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 723 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 724 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 725 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 726 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 727 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 728 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 729 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 730 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 731 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 732 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 733 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 734 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 735 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 736 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 737 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 738 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 739 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 740 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 741 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 742 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 743 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 744 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 745 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 746 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 747 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 748 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 749 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 750 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 50.45 |
| Metatranscriptomes | 0.4 |
| Isolates | 49.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 18.44 |
| Nodule | 38.48 |
| Rhizoplane | 1.6 |
| Rhizosphere | 22.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495686_0186950 | 3300047472 | Bacteria | 1196 |
| 2 | JGI25156J39149_1000129 | 3300002705 | Bacteria | 54812 |
| 3 | JGI25162J39368_1000663 | 3300002737 | Bacteria | 24312 |
| 4 | JGI25162J39368_1000771 | 3300002737 | Bacteria | 21641 |
| 5 | JGI25154J39366_1000393 | 3300002738 | Bacteria | 23858 |
| 6 | JGI25154J39366_1010856 | 3300002738 | Bacteria | 1064 |
| 7 | JGI25157J39369_1000061 | 3300002741 | Bacteria | 105511 |
| 8 | JGI25163J39215_1005407 | 3300002771 | Bacteria | 815 |
| 9 | JGI25152J39213_1000780 | 3300002773 | Bacteria | 16053 |
| 10 | JGI25152J39213_1003870 | 3300002773 | Bacteria | 4923 |
| 11 | JGI25152J39213_1005651 | 3300002773 | Bacteria | 3586 |
| 12 | JGI25150J39212_1000033 | 3300002774 | Bacteria | 96269 |
| 13 | JGI25159J45721_1000136 | 3300002987 | Bacteria | 34768 |
| 14 | JGI25159J45721_1000539 | 3300002987 | Bacteria | 17199 |
| 15 | JGI25151J46595_10000108 | 3300003187 | Bacteria | 112874 |
| 16 | JGI25151J46595_10001664 | 3300003187 | Bacteria | 14579 |
| 17 | JGI25151J46595_10004059 | 3300003187 | Bacteria | 7850 |
| 18 | JGI25151J46595_10029420 | 3300003187 | Bacteria | 2175 |
| 19 | JGI25165J46597_1000887 | 3300003214 | Bacteria | 21063 |
| 20 | JGI25165J46597_1001344 | 3300003214 | Bacteria | 13749 |
| 21 | JGI25165J46597_1003152 | 3300003214 | Bacteria | 4380 |
| 22 | JGI25153J46596_10000780 | 3300003215 | Bacteria | 19521 |
| 23 | JGI25153J46596_10005162 | 3300003215 | Bacteria | 6878 |
| 24 | JGI25153J46596_10008442 | 3300003215 | Bacteria | 4922 |
| 25 | JGI25153J46596_10026362 | 3300003215 | Bacteria | 2057 |
| 26 | rootH1_10029408 | 3300003316 | Bacteria | 1135 |
| 27 | rootL2_10224148 | 3300003322 | Bacteria | 1214 |
| 28 | rootH1_10199986 | 3300003323 | Bacteria | 1878 |
| 29 | rootH1_10199992 | 3300003323 | Bacteria | 4130 |
| 30 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 31 | JGI25160J50197_1000015 | 3300003354 | Bacteria | 250902 |
| 32 | JGI25160J50197_1000191 | 3300003354 | Bacteria | 51959 |
| 33 | JGI25160J50197_1013276 | 3300003354 | Bacteria | 2817 |
| 34 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 35 | JGI25161J50226_1000051 | 3300003374 | Bacteria | 110051 |
| 36 | JGI25161J50226_1000645 | 3300003374 | Bacteria | 14023 |
| 37 | Ga0055526_1004586 | 3300003771 | Bacteria | 8241 |
| 38 | Ga0055526_1006805 | 3300003771 | Bacteria | 6103 |
| 39 | Ga0055526_1011614 | 3300003771 | Bacteria | 3946 |
| 40 | Ga0055526_1025227 | 3300003771 | Bacteria | 1913 |
| 41 | Ga0055526_1050721 | 3300003771 | Bacteria | 949 |
| 42 | Ga0055524_1001028 | 3300003775 | Bacteria | 17224 |
| 43 | Ga0055524_1001385 | 3300003775 | Bacteria | 13993 |
| 44 | Ga0055524_1002986 | 3300003775 | Bacteria | 8403 |
| 45 | Ga0055524_1008559 | 3300003775 | Bacteria | 4242 |
| 46 | Ga0055524_1043002 | 3300003775 | Bacteria | 1116 |
| 47 | Ga0055536_1005530 | 3300003781 | Bacteria | 6146 |
| 48 | Ga0055528_1000201 | 3300003790 | Bacteria | 50283 |
| 49 | Ga0055528_1001755 | 3300003790 | Bacteria | 12505 |
| 50 | Ga0055528_1003372 | 3300003790 | Bacteria | 8058 |
| 51 | Ga0055528_1005168 | 3300003790 | Bacteria | 6135 |
| 52 | Ga0055528_1016328 | 3300003790 | Bacteria | 2631 |
| 53 | Ga0055530_10021277 | 3300003791 | Bacteria | 1915 |
| 54 | Ga0055540_1000220 | 3300003792 | Bacteria | 53660 |
| 55 | Ga0055540_1003015 | 3300003792 | Bacteria | 8420 |
| 56 | Ga0055540_1022079 | 3300003792 | Bacteria | 1635 |
| 57 | Ga0055531_10002199 | 3300003794 | Bacteria | 13276 |
| 58 | Ga0055531_10011531 | 3300003794 | Bacteria | 4248 |
| 59 | Ga0055531_10021064 | 3300003794 | Bacteria | 2546 |
| 60 | Ga0055543_1000012 | 3300004625 | Bacteria | 186581 |
| 61 | Ga0055543_1000040 | 3300004625 | Bacteria | 122485 |
| 62 | Ga0055543_1000258 | 3300004625 | Bacteria | 39859 |
| 63 | Ga0055543_1001853 | 3300004625 | Bacteria | 7713 |
| 64 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 65 | Ga0065165_1000125 | 3300005262 | Bacteria | 130283 |
| 66 | Ga0065165_1007971 | 3300005262 | Bacteria | 5070 |
| 67 | Ga0065165_1008405 | 3300005262 | Bacteria | 4836 |
| 68 | Ga0065165_1024782 | 3300005262 | Bacteria | 2008 |
| 69 | Ga0065165_1095829 | 3300005262 | Bacteria | 749 |
| 70 | Ga0065704_10123258 | 3300005289 | Bacteria | 1736 |
| 71 | Ga0070658_10655175 | 3300005327 | Bacteria | 911 |
| 72 | Ga0070709_10347892 | 3300005434 | Bacteria | 1094 |
| 73 | Ga0070713_100183244 | 3300005436 | Bacteria | 1883 |
| 74 | Ga0070665_100020587 | 3300005548 | Bacteria | 6628 |
| 75 | Ga0068855_100134254 | 3300005563 | Bacteria | 2824 |
| 76 | Ga0068856_100317635 | 3300005614 | Bacteria | 1575 |
| 77 | Ga0068863_100251041 | 3300005841 | Bacteria | 1709 |
| 78 | Ga0068862_100689433 | 3300005844 | Bacteria | 989 |
| 79 | Ga0075365_10000858 | 3300006038 | Bacteria | 12642 |
| 80 | Ga0075365_10001303 | 3300006038 | Bacteria | 11124 |
| 81 | Ga0075365_10002765 | 3300006038 | Bacteria | 8765 |
| 82 | Ga0075364_10287326 | 3300006051 | Bacteria | 1119 |
| 83 | Ga0070716_100002842 | 3300006173 | Bacteria | 8063 |
| 84 | Ga0075362_10001499 | 3300006177 | Bacteria | 7503 |
| 85 | Ga0075367_10002234 | 3300006178 | Bacteria | 8746 |
| 86 | Ga0075367_10072548 | 3300006178 | Bacteria | 2073 |
| 87 | Ga0075367_10130236 | 3300006178 | Bacteria | 1555 |
| 88 | Ga0075369_10000760 | 3300006186 | Bacteria | 10508 |
| 89 | Ga0075369_10012547 | 3300006186 | Bacteria | 3348 |
| 90 | Ga0075369_10117755 | 3300006186 | Bacteria | 1201 |
| 91 | Ga0075366_10005574 | 3300006195 | Bacteria | 6825 |
| 92 | Ga0075370_10060792 | 3300006353 | Bacteria | 2152 |
| 93 | Ga0075370_10256504 | 3300006353 | Bacteria | 1037 |
| 94 | Ga0079104_1001622 | 3300006946 | Bacteria | 14656 |
| 95 | Ga0079104_1007055 | 3300006946 | Bacteria | 4135 |
| 96 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 97 | Ga0105243_10225965 | 3300009148 | Bacteria | 1658 |
| 98 | Ga0105248_10518140 | 3300009177 | Bacteria | 1344 |
| 99 | Ga0105237_10002365 | 3300009545 | Bacteria | 23399 |
| 100 | Ga0105238_10491988 | 3300009551 | Bacteria | 1227 |
| 101 | Ga0105249_10051807 | 3300009553 | Bacteria | 3746 |
| 102 | Ga0123342_1018873 | 3300009766 | Bacteria | 5383 |
| 103 | Ga0123342_1031383 | 3300009766 | Bacteria | 2576 |
| 104 | Ga0105239_10012679 | 3300010375 | Bacteria | 9377 |
| 105 | Ga0157373_10034649 | 3300013100 | Bacteria | 3626 |
| 106 | Ga0157373_10092973 | 3300013100 | Bacteria | 2124 |
| 107 | Ga0157373_10421988 | 3300013100 | Bacteria | 958 |
| 108 | Ga0157370_10006055 | 3300013104 | Bacteria | 13428 |
| 109 | Ga0157369_10065345 | 3300013105 | Bacteria | 3915 |
| 110 | Ga0157369_10072048 | 3300013105 | Bacteria | 3708 |
| 111 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 112 | Ga0157378_10067397 | 3300013297 | Bacteria | 3207 |
| 113 | Ga0182008_10008143 | 3300014497 | Bacteria | 5737 |
| 114 | Ga0182007_10000460 | 3300015262 | Bacteria | 24598 |
| 115 | Ga0182005_1001195 | 3300015265 | Bacteria | 10741 |
| 116 | Ga0183363_1174 | 3300015690 | Bacteria | 14284 |
| 117 | Ga0214544_1000017 | 3300021320 | Bacteria | 193638 |
| 118 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 119 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 120 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 121 | Ga0228711_1000001 | 3300022739 | Bacteria | 357377 |
| 122 | Ga0228710_1000001 | 3300022740 | Bacteria | 314328 |
| 123 | Ga0209435_100042 | 3300025206 | Bacteria | 105563 |
| 124 | Ga0209760_103229 | 3300025207 | Bacteria | 1459 |
| 125 | Ga0209436_100971 | 3300025208 | Bacteria | 11156 |
| 126 | Ga0209436_102619 | 3300025208 | Bacteria | 5272 |
| 127 | Ga0209672_103729 | 3300025228 | Bacteria | 3039 |
| 128 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 129 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 130 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 131 | Ga0207425_1005673 | 3300025245 | Bacteria | 3523 |
| 132 | Ga0207425_1010232 | 3300025245 | Bacteria | 2293 |
| 133 | Ga0207425_1010928 | 3300025245 | Bacteria | 2190 |
| 134 | Ga0209646_1000145 | 3300025246 | Bacteria | 105563 |
| 135 | Ga0209026_1000160 | 3300025250 | Bacteria | 105563 |
| 136 | Ga0209677_101318 | 3300025253 | Bacteria | 10964 |
| 137 | Ga0209759_1000177 | 3300025256 | Bacteria | 105563 |
| 138 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 139 | Ga0209129_1000137 | 3300025258 | Bacteria | 123213 |
| 140 | Ga0209129_1001658 | 3300025258 | Bacteria | 12046 |
| 141 | Ga0209129_1004647 | 3300025258 | Bacteria | 5254 |
| 142 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 143 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 144 | Ga0209233_1000209 | 3300025261 | Bacteria | 115124 |
| 145 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 146 | Ga0209673_1000319 | 3300025273 | Bacteria | 88129 |
| 147 | Ga0209673_1000603 | 3300025273 | Bacteria | 55646 |
| 148 | Ga0209673_1001904 | 3300025273 | Bacteria | 16728 |
| 149 | Ga0209673_1002052 | 3300025273 | Bacteria | 15245 |
| 150 | Ga0209673_1005246 | 3300025273 | Bacteria | 6593 |
| 151 | Ga0209673_1006607 | 3300025273 | Bacteria | 5552 |
| 152 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 153 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 154 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 155 | Ga0209130_1026324 | 3300025284 | Bacteria | 1249 |
| 156 | Ga0209130_1041110 | 3300025284 | Bacteria | 891 |
| 157 | Ga0209676_1000694 | 3300025292 | Bacteria | 47316 |
| 158 | Ga0209676_1003604 | 3300025292 | Bacteria | 9324 |
| 159 | Ga0209676_1008047 | 3300025292 | Bacteria | 4794 |
| 160 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 161 | Ga0209025_1000199 | 3300025294 | Bacteria | 146058 |
| 162 | Ga0209025_1000580 | 3300025294 | Bacteria | 66332 |
| 163 | Ga0209025_1001502 | 3300025294 | Bacteria | 30072 |
| 164 | Ga0209025_1001754 | 3300025294 | Bacteria | 26007 |
| 165 | Ga0209025_1007635 | 3300025294 | Bacteria | 8001 |
| 166 | Ga0209025_1009735 | 3300025294 | Bacteria | 6641 |
| 167 | Ga0209025_1014633 | 3300025294 | Bacteria | 4803 |
| 168 | Ga0209025_1027130 | 3300025294 | Bacteria | 2851 |
| 169 | Ga0209025_1066977 | 3300025294 | Bacteria | 1300 |
| 170 | Ga0209564_1000330 | 3300025295 | Bacteria | 92033 |
| 171 | Ga0209564_1000425 | 3300025295 | Bacteria | 74279 |
| 172 | Ga0209564_1000431 | 3300025295 | Bacteria | 72866 |
| 173 | Ga0209564_1001106 | 3300025295 | Bacteria | 31905 |
| 174 | Ga0209564_1004048 | 3300025295 | Bacteria | 9246 |
| 175 | Ga0209564_1042266 | 3300025295 | Bacteria | 1212 |
| 176 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 177 | Ga0209758_1000333 | 3300025297 | Bacteria | 88318 |
| 178 | Ga0209758_1000890 | 3300025297 | Bacteria | 40935 |
| 179 | Ga0209758_1002000 | 3300025297 | Bacteria | 21958 |
| 180 | Ga0209758_1002059 | 3300025297 | Bacteria | 21481 |
| 181 | Ga0209758_1002927 | 3300025297 | Bacteria | 16450 |
| 182 | Ga0209758_1005916 | 3300025297 | Bacteria | 9096 |
| 183 | Ga0209758_1031983 | 3300025297 | Bacteria | 2146 |
| 184 | Ga0209050_1007450 | 3300025298 | Bacteria | 6130 |
| 185 | Ga0209050_1013684 | 3300025298 | Bacteria | 3577 |
| 186 | Ga0209256_1000877 | 3300025299 | Bacteria | 37183 |
| 187 | Ga0209256_1001695 | 3300025299 | Bacteria | 21274 |
| 188 | Ga0209256_1001781 | 3300025299 | Bacteria | 20391 |
| 189 | Ga0209256_1002866 | 3300025299 | Bacteria | 13104 |
| 190 | Ga0209256_1003093 | 3300025299 | Bacteria | 12194 |
| 191 | Ga0209256_1005385 | 3300025299 | Bacteria | 7409 |
| 192 | Ga0209256_1008203 | 3300025299 | Bacteria | 4905 |
| 193 | Ga0209256_1043748 | 3300025299 | Bacteria | 1122 |
| 194 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 195 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 196 | Ga0207426_1000106 | 3300025302 | Bacteria | 244368 |
| 197 | Ga0207426_1000119 | 3300025302 | Bacteria | 221800 |
| 198 | Ga0209051_1000198 | 3300025303 | Bacteria | 106688 |
| 199 | Ga0209051_1001443 | 3300025303 | Bacteria | 20239 |
| 200 | Ga0209051_1001611 | 3300025303 | Bacteria | 18403 |
| 201 | Ga0209051_1002094 | 3300025303 | Bacteria | 15026 |
| 202 | Ga0209051_1002200 | 3300025303 | Bacteria | 14404 |
| 203 | Ga0209051_1065244 | 3300025303 | Bacteria | 1124 |
| 204 | Ga0209257_1001713 | 3300025304 | Bacteria | 24577 |
| 205 | Ga0209257_1002246 | 3300025304 | Bacteria | 19809 |
| 206 | Ga0209257_1004254 | 3300025304 | Bacteria | 11304 |
| 207 | Ga0209257_1040331 | 3300025304 | Bacteria | 1394 |
| 208 | Ga0209257_1043170 | 3300025304 | Bacteria | 1324 |
| 209 | Ga0207697_10105119 | 3300025315 | Bacteria | 1206 |
| 210 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 211 | Ga0207671_10000718 | 3300025914 | Bacteria | 42274 |
| 212 | Ga0207650_10008527 | 3300025925 | Bacteria | 6998 |
| 213 | Ga0207700_10073190 | 3300025928 | Bacteria | 2645 |
| 214 | Ga0207665_10000133 | 3300025939 | Bacteria | 49199 |
| 215 | Ga0207667_10107346 | 3300025949 | Bacteria | 2880 |
| 216 | Ga0207712_10084772 | 3300025961 | Bacteria | 2316 |
| 217 | Ga0207641_10229578 | 3300026088 | Bacteria | 1724 |
| 218 | Ga0207676_10546880 | 3300026095 | Bacteria | 1106 |
| 219 | Ga0207698_10284304 | 3300026142 | Bacteria | 1532 |
| 220 | Ga0209281_1000053 | 3300027111 | Bacteria | 309587 |
| 221 | Ga0209281_1000236 | 3300027111 | Bacteria | 113362 |
| 222 | Ga0209281_1000266 | 3300027111 | Bacteria | 100574 |
| 223 | Ga0209282_1000007 | 3300027666 | Bacteria | 254917 |
| 224 | Ga0268266_10034684 | 3300028379 | Bacteria | 4292 |
| 225 | Ga0268266_10154536 | 3300028379 | Bacteria | 2071 |
| 226 | Ga0268264_10633587 | 3300028381 | Unclassified | 1057 |
| 227 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 228 | Ga0307515_10009357 | 3300028794 | Bacteria | 18953 |
| 229 | Ga0307515_10009393 | 3300028794 | Bacteria | 18922 |
| 230 | Ga0307515_10010607 | 3300028794 | Bacteria | 17629 |
| 231 | Ga0307515_10266528 | 3300028794 | Bacteria | 1441 |
| 232 | Ga0307515_10361103 | 3300028794 | Bacteria | 1093 |
| 233 | Ga0307513_10017679 | 3300031456 | Bacteria | 8541 |
| 234 | Ga0307513_10064384 | 3300031456 | Bacteria | 3864 |
| 235 | Ga0307408_100084949 | 3300031548 | Bacteria | 2375 |
| 236 | Ga0307405_10001075 | 3300031731 | Bacteria | 11115 |
| 237 | Ga0307406_10010681 | 3300031901 | Bacteria | 5185 |
| 238 | Ga0307412_10003169 | 3300031911 | Bacteria | 9142 |
| 239 | Ga0307412_10457103 | 3300031911 | Bacteria | 1053 |
| 240 | Ga0315914_1000006 | 3300031967 | Bacteria | 239817 |
| 241 | Ga0307409_100072804 | 3300031995 | Bacteria | 2738 |
| 242 | Ga0307414_10126819 | 3300032004 | Bacteria | 1973 |
| 243 | Ga0307510_10352406 | 3300033180 | Bacteria | 922 |
| 244 | Ga0315913_1000002 | 3300033430 | Bacteria | 241452 |
| 245 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 246 | Ga0395900_0111279 | 3300037418 | Bacteria | 2813 |
| 247 | Ga0395905_0016934 | 3300037471 | Bacteria | 6922 |
| 248 | Ga0395905_0047077 | 3300037471 | Bacteria | 4043 |
| 249 | Ga0395901_0000508 | 3300038443 | Bacteria | 45081 |
| 250 | Ga0436365_0215315 | 3300039437 | Bacteria | 1041 |
| 251 | Ga0436365_0573424 | 3300039437 | Bacteria | 751 |
| 252 | Ga0439436_0018152 | 3300041404 | Bacteria | 2103 |
| 253 | Ga0439438_023347 | 3300041405 | Bacteria | 1706 |
| 254 | Ga0439465_0026630 | 3300041413 | Bacteria | 1829 |
| 255 | Ga0439465_0093300 | 3300041413 | Bacteria | 1032 |
| 256 | Ga0451793_1931244 | 3300041452 | Bacteria | 1214 |
| 257 | Ga0451837_0331042 | 3300041494 | Bacteria | 1341 |
| 258 | Ga0451839_0799242 | 3300041496 | Bacteria | 1251 |
| 259 | Ga0451841_0302975 | 3300041498 | Bacteria | 1489 |
| 260 | Ga0451841_0659426 | 3300041498 | Bacteria | 5282 |
| 261 | Ga0451845_0068571 | 3300041501 | Bacteria | 1944 |
| 262 | Ga0451846_49560 | 3300041502 | Bacteria | 1403 |
| 263 | Ga0451847_0047250 | 3300041503 | Bacteria | 5077 |
| 264 | Ga0451847_0824177 | 3300041503 | Bacteria | 749 |
| 265 | Ga0451849_0746664 | 3300041505 | Bacteria | 1077 |
| 266 | Ga0451849_1275464 | 3300041505 | Bacteria | 1036 |
| 267 | Ga0451849_1509101 | 3300041505 | Bacteria | 1572 |
| 268 | Ga0451851_0316867 | 3300041507 | Bacteria | 5269 |
| 269 | Ga0451851_0644451 | 3300041507 | Bacteria | 1358 |
| 270 | Ga0451855_1139024 | 3300041511 | Bacteria | 3291 |
| 271 | Ga0451853_0907327 | 3300041512 | Bacteria | 2165 |
| 272 | Ga0439445_0035464 | 3300042004 | Bacteria | 1310 |
| 273 | Ga0439449_0010290 | 3300042007 | Bacteria | 3532 |
| 274 | Ga0439449_0102273 | 3300042007 | Bacteria | 1059 |
| 275 | Ga0439462_0009016 | 3300042015 | Bacteria | 2524 |
| 276 | Ga0450906_008763 | 3300042145 | Bacteria | 1946 |
| 277 | Ga0439434_0051995 | 3300042435 | Bacteria | 1271 |
| 278 | Ga0466965_0064857 | 3300044683 | Bacteria | 1829 |
| 279 | Ga0466966_0528769 | 3300044684 | Bacteria | 709 |
| 280 | Ga0466963_0402478 | 3300044694 | Bacteria | 965 |
| 281 | Ga0466968_0017525 | 3300044735 | Bacteria | 2864 |
| 282 | Ga0466970_0012880 | 3300044765 | Bacteria | 4282 |
| 283 | Ga0466970_0032477 | 3300044765 | Bacteria | 2758 |
| 284 | Ga0466957_0081763 | 3300044842 | Bacteria | 2012 |
| 285 | Ga0466960_0151262 | 3300044901 | Bacteria | 1240 |
| 286 | Ga0466958_0150466 | 3300045836 | Bacteria | 1468 |
| 287 | Ga0495617_037385 | 3300046452 | Bacteria | 1626 |
| 288 | Ga0495592_0097073 | 3300046454 | Bacteria | 2105 |
| 289 | Ga0495603_0157881 | 3300046455 | Bacteria | 1316 |
| 290 | Ga0495590_0108203 | 3300046457 | Bacteria | 991 |
| 291 | Ga0495638_0003817 | 3300046460 | Bacteria | 11698 |
| 292 | Ga0495638_0037074 | 3300046460 | Bacteria | 3103 |
| 293 | Ga0495651_0251438 | 3300046462 | Bacteria | 1207 |
| 294 | Ga0495605_0011138 | 3300046474 | Bacteria | 5025 |
| 295 | Ga0495605_0181496 | 3300046474 | Bacteria | 925 |
| 296 | Ga0495662_0010800 | 3300046476 | Bacteria | 4465 |
| 297 | Ga0495664_0066671 | 3300046477 | Bacteria | 2147 |
| 298 | Ga0495585_0011550 | 3300046492 | Bacteria | 5226 |
| 299 | Ga0495585_0038977 | 3300046492 | Bacteria | 2673 |
| 300 | Ga0495585_0061354 | 3300046492 | Bacteria | 2068 |
| 301 | Ga0495585_0123347 | 3300046492 | Bacteria | 1369 |
| 302 | Ga0495596_0108794 | 3300046500 | Bacteria | 1076 |
| 303 | Ga0495607_0068939 | 3300046501 | Bacteria | 1982 |
| 304 | Ga0495607_0210805 | 3300046501 | Bacteria | 956 |
| 305 | Ga0495583_0004596 | 3300046506 | Bacteria | 9785 |
| 306 | Ga0495583_0013729 | 3300046506 | Bacteria | 4498 |
| 307 | Ga0495606_0007105 | 3300046507 | Bacteria | 10123 |
| 308 | Ga0495606_0035483 | 3300046507 | Bacteria | 3407 |
| 309 | Ga0495606_0036357 | 3300046507 | Bacteria | 3355 |
| 310 | Ga0495606_0049390 | 3300046507 | Bacteria | 2760 |
| 311 | Ga0495610_0006488 | 3300046512 | Bacteria | 8037 |
| 312 | Ga0495610_0033071 | 3300046512 | Bacteria | 2677 |
| 313 | Ga0495616_0016301 | 3300046513 | Bacteria | 4116 |
| 314 | Ga0495616_0049112 | 3300046513 | Bacteria | 2117 |
| 315 | Ga0495620_0008876 | 3300046515 | Bacteria | 5374 |
| 316 | Ga0495620_0035575 | 3300046515 | Bacteria | 2237 |
| 317 | Ga0495628_0108952 | 3300046516 | Bacteria | 2132 |
| 318 | Ga0495631_0003953 | 3300046518 | Bacteria | 8006 |
| 319 | Ga0495632_0021429 | 3300046519 | Bacteria | 3482 |
| 320 | Ga0495632_0029637 | 3300046519 | Bacteria | 2847 |
| 321 | Ga0495632_0084482 | 3300046519 | Bacteria | 1510 |
| 322 | Ga0495643_0023538 | 3300046522 | Bacteria | 3501 |
| 323 | Ga0495643_0024536 | 3300046522 | Bacteria | 3419 |
| 324 | Ga0495643_0123974 | 3300046522 | Bacteria | 1303 |
| 325 | Ga0495648_0016629 | 3300046524 | Bacteria | 5295 |
| 326 | Ga0495648_0222101 | 3300046524 | Bacteria | 931 |
| 327 | Ga0495652_0176860 | 3300046529 | Bacteria | 1642 |
| 328 | Ga0495654_0000092 | 3300046530 | Bacteria | 101504 |
| 329 | Ga0495654_0072443 | 3300046530 | Bacteria | 1631 |
| 330 | Ga0495640_0199047 | 3300046533 | Bacteria | 1270 |
| 331 | Ga0495587_0067533 | 3300046536 | Bacteria | 2084 |
| 332 | Ga0495609_0034871 | 3300046538 | Bacteria | 2279 |
| 333 | Ga0495609_0121838 | 3300046538 | Bacteria | 1121 |
| 334 | Ga0495621_0139715 | 3300046539 | Bacteria | 947 |
| 335 | Ga0495622_0008227 | 3300046557 | Bacteria | 4832 |
| 336 | Ga0495633_0112623 | 3300046558 | Bacteria | 1261 |
| 337 | Ga0495633_0116324 | 3300046558 | Bacteria | 1239 |
| 338 | Ga0495668_0004226 | 3300046616 | Bacteria | 10340 |
| 339 | Ga0495611_0005820 | 3300046648 | Bacteria | 5263 |
| 340 | Ga0495625_0000883 | 3300046660 | Bacteria | 40600 |
| 341 | Ga0495625_0011676 | 3300046660 | Bacteria | 7145 |
| 342 | Ga0495625_0021680 | 3300046660 | Bacteria | 4941 |
| 343 | Ga0495625_0244679 | 3300046660 | Bacteria | 1166 |
| 344 | Ga0495625_0378203 | 3300046660 | Bacteria | 889 |
| 345 | Ga0495659_0000169 | 3300046664 | Bacteria | 29041 |
| 346 | Ga0495661_0099044 | 3300046665 | Bacteria | 1644 |
| 347 | Ga0495588_0017354 | 3300046674 | Bacteria | 3493 |
| 348 | Ga0495588_0034968 | 3300046674 | Bacteria | 2544 |
| 349 | Ga0495657_0034711 | 3300046675 | Bacteria | 3501 |
| 350 | Ga0495646_0217716 | 3300046680 | Bacteria | 1034 |
| 351 | Ga0495658_0078054 | 3300046683 | Bacteria | 1937 |
| 352 | Ga0495670_0089722 | 3300046691 | Bacteria | 1572 |
| 353 | Ga0495670_0362318 | 3300046691 | Bacteria | 781 |
| 354 | Ga0495671_0005586 | 3300046692 | Bacteria | 7340 |
| 355 | Ga0495671_0111024 | 3300046692 | Bacteria | 1339 |
| 356 | Ga0495649_0015455 | 3300046694 | Bacteria | 4345 |
| 357 | Ga0495600_0014412 | 3300046809 | Bacteria | 4982 |
| 358 | Ga0495660_0027278 | 3300046810 | Bacteria | 3232 |
| 359 | Ga0495660_0029535 | 3300046810 | Bacteria | 3092 |
| 360 | Ga0495660_0181624 | 3300046810 | Bacteria | 1017 |
| 361 | Ga0495604_0041180 | 3300047317 | Bacteria | 3623 |
| 362 | Ga0495636_0035876 | 3300047318 | Bacteria | 2043 |
| 363 | Ga0495636_0094526 | 3300047318 | Bacteria | 1301 |
| 364 | Ga0495672_0000045 | 3300047320 | Bacteria | 255145 |
| 365 | Ga0495672_0009853 | 3300047320 | Bacteria | 6874 |
| 366 | Ga0495687_016382 | 3300047443 | Bacteria | 3729 |
| 367 | Ga0495681_0103466 | 3300047470 | Bacteria | 1242 |
| 368 | Ga0495686_0001036 | 3300047472 | Bacteria | 33364 |
| 369 | Ga0495686_0008424 | 3300047472 | Bacteria | 7565 |
| 370 | Ga0495686_0018580 | 3300047472 | Bacteria | 4661 |
| 371 | Ga0495686_0030342 | 3300047472 | Bacteria | 3512 |
| 372 | Ga0495626_0081029 | 3300048091 | Bacteria | 1442 |
| 373 | Ga0495626_0099234 | 3300048091 | Bacteria | 1271 |
| 374 | Ga0496100_0037143 | 3300048903 | Bacteria | 3077 |
| 375 | Ga0496100_0521848 | 3300048903 | Bacteria | 917 |
| 376 | Ga0496101_0288769 | 3300048904 | Bacteria | 1283 |
| 377 | Ga0496102_0066355 | 3300048905 | Bacteria | 3307 |
| 378 | Ga0496103_0008468 | 3300048906 | Bacteria | 6109 |
| 379 | Ga0496106_0015849 | 3300048909 | Bacteria | 5574 |
| 380 | Ga0496106_0365858 | 3300048909 | Bacteria | 1159 |
| 381 | Ga0496111_0002706 | 3300048914 | Bacteria | 10766 |
| 382 | Ga0496112_0079195 | 3300048915 | Bacteria | 3250 |
| 383 | Ga0496113_0228648 | 3300048916 | Bacteria | 1483 |
| 384 | Ga0496116_0000026 | 3300048919 | Bacteria | 450803 |
| 385 | Ga0496116_0005741 | 3300048919 | Bacteria | 11414 |
| 386 | Ga0496116_0009536 | 3300048919 | Bacteria | 8267 |
| 387 | Ga0496116_0010291 | 3300048919 | Bacteria | 7856 |
| 388 | Ga0496116_0039068 | 3300048919 | Bacteria | 3285 |
| 389 | Ga0496116_0056409 | 3300048919 | Bacteria | 2574 |
| 390 | Ga0496116_0096303 | 3300048919 | Bacteria | 1783 |
| 391 | Ga0496116_0289728 | 3300048919 | Bacteria | 787 |
| 392 | Ga0496117_0001867 | 3300048920 | Bacteria | 28420 |
| 393 | Ga0496117_0023329 | 3300048920 | Bacteria | 4934 |
| 394 | Ga0496117_0029504 | 3300048920 | Bacteria | 4227 |
| 395 | Ga0496117_0030478 | 3300048920 | Bacteria | 4139 |
| 396 | Ga0496117_0097743 | 3300048920 | Bacteria | 1869 |
| 397 | Ga0496117_0105548 | 3300048920 | Bacteria | 1770 |
| 398 | Ga0496118_0012870 | 3300048921 | Bacteria | 7974 |
| 399 | Ga0496118_0022747 | 3300048921 | Bacteria | 5466 |
| 400 | Ga0496118_0024577 | 3300048921 | Bacteria | 5195 |
| 401 | Ga0496118_0034308 | 3300048921 | Bacteria | 4143 |
| 402 | Ga0496118_0074792 | 3300048921 | Bacteria | 2419 |
| 403 | Ga0496118_0213674 | 3300048921 | Bacteria | 1130 |
| 404 | Ga0496119_0004467 | 3300048922 | Bacteria | 13916 |
| 405 | Ga0496119_0027539 | 3300048922 | Bacteria | 3903 |
| 406 | Ga0496119_0059809 | 3300048922 | Bacteria | 2285 |
| 407 | Ga0496119_0237284 | 3300048922 | Bacteria | 925 |
| 408 | Ga0496120_0036918 | 3300048923 | Bacteria | 2903 |
| 409 | Ga0496121_0008112 | 3300048924 | Bacteria | 12489 |
| 410 | Ga0496121_0012320 | 3300048924 | Bacteria | 9350 |
| 411 | Ga0496121_0012537 | 3300048924 | Bacteria | 9225 |
| 412 | Ga0496121_0035352 | 3300048924 | Bacteria | 4480 |
| 413 | Ga0496121_0037316 | 3300048924 | Bacteria | 4317 |
| 414 | Ga0496121_0132588 | 3300048924 | Bacteria | 1862 |
| 415 | Ga0496121_0198199 | 3300048924 | Bacteria | 1433 |
| 416 | Ga0496121_0212161 | 3300048924 | Bacteria | 1371 |
| 417 | Ga0496122_0000160 | 3300048925 | Bacteria | 159236 |
| 418 | Ga0496122_0000604 | 3300048925 | Bacteria | 73844 |
| 419 | Ga0496122_0005715 | 3300048925 | Bacteria | 14660 |
| 420 | Ga0496122_0011685 | 3300048925 | Bacteria | 8849 |
| 421 | Ga0496122_0012377 | 3300048925 | Bacteria | 8508 |
| 422 | Ga0496122_0031039 | 3300048925 | Bacteria | 4458 |
| 423 | Ga0496122_0037563 | 3300048925 | Bacteria | 3895 |
| 424 | Ga0496122_0043473 | 3300048925 | Bacteria | 3519 |
| 425 | Ga0496122_0188671 | 3300048925 | Bacteria | 1219 |
| 426 | Ga0496122_0248322 | 3300048925 | Bacteria | 997 |
| 427 | Ga0496122_0318563 | 3300048925 | Bacteria | 828 |
| 428 | Ga0496123_0000034 | 3300048926 | Bacteria | 274836 |
| 429 | Ga0496123_0000103 | 3300048926 | Bacteria | 168232 |
| 430 | Ga0496123_0003820 | 3300048926 | Bacteria | 16441 |
| 431 | Ga0496123_0008044 | 3300048926 | Bacteria | 9762 |
| 432 | Ga0496123_0009653 | 3300048926 | Bacteria | 8658 |
| 433 | Ga0496123_0045222 | 3300048926 | Bacteria | 3002 |
| 434 | Ga0496123_0057206 | 3300048926 | Bacteria | 2540 |
| 435 | Ga0496123_0149581 | 3300048926 | Bacteria | 1262 |
| 436 | Ga0496124_0001469 | 3300048927 | Bacteria | 34707 |
| 437 | Ga0496124_0005176 | 3300048927 | Bacteria | 14827 |
| 438 | Ga0496124_0008098 | 3300048927 | Bacteria | 11045 |
| 439 | Ga0496124_0012183 | 3300048927 | Bacteria | 8511 |
| 440 | Ga0496124_0054620 | 3300048927 | Bacteria | 3380 |
| 441 | Ga0496124_0076704 | 3300048927 | Bacteria | 2758 |
| 442 | Ga0496124_0107636 | 3300048927 | Bacteria | 2249 |
| 443 | Ga0496124_0109488 | 3300048927 | Bacteria | 2226 |
| 444 | Ga0496124_0192816 | 3300048927 | Bacteria | 1557 |
| 445 | Ga0496124_0246281 | 3300048927 | Bacteria | 1325 |
| 446 | Ga0496124_0268234 | 3300048927 | Bacteria | 1252 |
| 447 | Ga0496124_0569779 | 3300048927 | Bacteria | 743 |
| 448 | Ga0496125_0004365 | 3300048928 | Bacteria | 16385 |
| 449 | Ga0496125_0009397 | 3300048928 | Bacteria | 10056 |
| 450 | Ga0496125_0017778 | 3300048928 | Bacteria | 6767 |
| 451 | Ga0496125_0049367 | 3300048928 | Bacteria | 3497 |
| 452 | Ga0496125_0051911 | 3300048928 | Bacteria | 3377 |
| 453 | Ga0496125_0127217 | 3300048928 | Bacteria | 1802 |
| 454 | Ga0496125_0355894 | 3300048928 | Bacteria | 872 |
| 455 | Ga0496126_0000069 | 3300048929 | Bacteria | 246935 |
| 456 | Ga0496126_0001336 | 3300048929 | Bacteria | 39105 |
| 457 | Ga0496126_0006321 | 3300048929 | Bacteria | 13225 |
| 458 | Ga0496126_0041488 | 3300048929 | Bacteria | 4258 |
| 459 | Ga0496126_0068735 | 3300048929 | Bacteria | 3162 |
| 460 | Ga0496126_0103341 | 3300048929 | Bacteria | 2490 |
| 461 | Ga0496126_0214523 | 3300048929 | Bacteria | 1619 |
| 462 | Ga0501308_024281 | 3300049128 | Bacteria | 779 |
| 463 | Ga0495678_037486 | 3300049459 | Bacteria | 1969 |
| 464 | Ga0495682_0199677 | 3300049460 | Bacteria | 709 |
| 465 | Ga0501313_021698 | 3300049529 | Bacteria | 797 |
| 466 | Ga0501315_011186 | 3300049531 | Bacteria | 1091 |
| 467 | Ga0501034_0167911 | 3300049571 | Bacteria | 2162 |
| 468 | Ga0501034_0213083 | 3300049571 | Bacteria | 1886 |
| 469 | Ga0501036_0149380 | 3300049572 | Bacteria | 1971 |
| 470 | Ga0501043_0121628 | 3300049579 | Bacteria | 2047 |
| 471 | Ga0501048_0435449 | 3300049582 | Bacteria | 938 |
| 472 | Ga0501073_0376747 | 3300049589 | Bacteria | 980 |
| 473 | Ga0501080_0313249 | 3300049742 | Bacteria | 1422 |
| 474 | Ga0501280_003075 | 3300049776 | Bacteria | 2627 |
| 475 | Ga0501280_006911 | 3300049776 | Bacteria | 1593 |
| 476 | Ga0501035_0704233 | 3300049822 | Bacteria | 814 |
| 477 | Ga0501045_0502139 | 3300049824 | Bacteria | 901 |
| 478 | nmdc:mga03683_87540_c1 | 3300050489 | Bacteria | 1354 |
| 479 | nmdc:mga03n38_33570_c1 | 3300050490 | Bacteria | 2184 |
| 480 | nmdc:mga00v17_359109_c1 | 3300050491 | Bacteria | 947 |
| 481 | nmdc:mga0yw44_3000_c1 | 3300050492 | Bacteria | 7370 |
| 482 | nmdc:mga0k408_232359_c1 | 3300050493 | Bacteria | 1101 |
| 483 | nmdc:mga06z11_472136_c1 | 3300050494 | Bacteria | 759 |
| 484 | nmdc:mga07m45_140263_c1 | 3300050496 | Bacteria | 1400 |
| 485 | nmdc:mga0sz30_167045_c1 | 3300050516 | Bacteria | 975 |
| 486 | nmdc:mga0sz30_8860_c1 | 3300050516 | Bacteria | 3813 |
| 487 | Ga0495601_0078710 | 3300053077 | Bacteria | 2113 |
| 488 | Ga0500610_0112906 | 3300053079 | Bacteria | 1395 |
| 489 | Ga0495619_0022478 | 3300053085 | Bacteria | 4037 |
| 490 | Ga0500578_0064509 | 3300053086 | Bacteria | 2335 |
| 491 | Ga0500578_0073300 | 3300053086 | Bacteria | 2181 |
| 492 | Ga0500643_141821 | 3300053087 | Bacteria | 645 |
| 493 | Ga0500654_055175 | 3300053099 | Bacteria | 2096 |
| 494 | Ga0500569_007786 | 3300053109 | Bacteria | 2421 |
| 495 | Ga0500569_008089 | 3300053109 | Bacteria | 2392 |
| 496 | Ga0500594_0032146 | 3300053118 | Bacteria | 1388 |
| 497 | Ga0500614_009709 | 3300053123 | Bacteria | 2056 |
| 498 | Ga0500658_0006339 | 3300053134 | Bacteria | 4388 |
| 499 | Ga0500658_0084466 | 3300053134 | Bacteria | 1363 |
| 500 | Ga0500568_0002529 | 3300053139 | Bacteria | 10682 |
| 501 | Ga0500577_0039181 | 3300053142 | Bacteria | 1716 |
| 502 | Ga0500590_001191 | 3300053148 | Bacteria | 10331 |
| 503 | Ga0500604_0062650 | 3300053151 | Bacteria | 1171 |
| 504 | Ga0500616_0001190 | 3300053153 | Bacteria | 26447 |
| 505 | Ga0500616_0001711 | 3300053153 | Bacteria | 20169 |
| 506 | Ga0500616_0006652 | 3300053153 | Bacteria | 7517 |
| 507 | Ga0500622_0008805 | 3300053156 | Bacteria | 5618 |
| 508 | Ga0500627_0099460 | 3300053158 | Bacteria | 1305 |
| 509 | Ga0501082_0104676 | 3300060353 | Bacteria | 2448 |
| 510 | Ga0466962_0050301 | 3300061719 | Bacteria | 1992 |
| 511 | 2509108569 | 2508501122 | Bacteria | 6292184 |
| 512 | 2509374404 | 2509276019 | Bacteria | 6802256 |
| 513 | 2509443030 | 2509276033 | Bacteria | 7180565 |
| 514 | 2510132342 | 2510065019 | Bacteria | 6903379 |
| 515 | 2510839644 | 2510461069 | Bacteria | 5505000 |
| 516 | 2510898679 | 2510461076 | Bacteria | 8618824 |
| 517 | 2511137075 | 2510917022 | Bacteria | 6504556 |
| 518 | 2511171876 | 2510917026 | Bacteria | 7046020 |
| 519 | 2511186407 | 2510917028 | Bacteria | 6185411 |
| 520 | 2511197152 | 2510917030 | Bacteria | 7460662 |
| 521 | 2511501070 | 2511231052 | Bacteria | 6974333 |
| 522 | 2512972185 | 2512875026 | Bacteria | 6861065 |
| 523 | 2513569181 | 2513237084 | Bacteria | 7231967 |
| 524 | 2513578854 | 2513237085 | Bacteria | 7695351 |
| 525 | 2513582845 | 2513237086 | Bacteria | 7265287 |
| 526 | 2513596293 | 2513237088 | Bacteria | 6927906 |
| 527 | 2513603264 | 2513237089 | Bacteria | 6553624 |
| 528 | 2513616234 | 2513237091 | Bacteria | 6900273 |
| 529 | 2513632714 | 2513237093 | Bacteria | 7545552 |
| 530 | 2513709166 | 2513237103 | Bacteria | 7647401 |
| 531 | 2513871250 | 2513237138 | Bacteria | 7368160 |
| 532 | 2513881043 | 2513237140 | Bacteria | 7076289 |
| 533 | 2513902279 | 2513237143 | Bacteria | 6664116 |
| 534 | 2513908885 | 2513237144 | Bacteria | 7530820 |
| 535 | 2513925746 | 2513237146 | Bacteria | 7166346 |
| 536 | 2513983870 | 2513237156 | Bacteria | 6402557 |
| 537 | 2514001931 | 2513237159 | Bacteria | 6810126 |
| 538 | 2514004719 | 2513237160 | Bacteria | 6650282 |
| 539 | 2515111326 | 2515075009 | Bacteria | 7288508 |
| 540 | 2515638475 | 2515154113 | Bacteria | 7807172 |
| 541 | 2515644361 | 2515154114 | Bacteria | 7848616 |
| 542 | 2515659149 | 2515154116 | Bacteria | 7552979 |
| 543 | 2515740513 | 2515154134 | Bacteria | 7220242 |
| 544 | 2516892351 | 2516653046 | Bacteria | 6989037 |
| 545 | 2517039967 | 2516653077 | Bacteria | 7555578 |
| 546 | 2517075519 | 2516653085 | Bacteria | 7346596 |
| 547 | 2517094100 | 2517093000 | Bacteria | 7412387 |
| 548 | 2517405919 | 2517287029 | Bacteria | 6905599 |
| 549 | 2517569149 | 2517487022 | Bacteria | 7227575 |
| 550 | 2520377445 | 2519899620 | Bacteria | 6499161 |
| 551 | 2524451081 | 2524023207 | Bacteria | 6813453 |
| 552 | 2524460601 | 2524023209 | Bacteria | 6679728 |
| 553 | 2530643844 | 2529292951 | Bacteria | 6916614 |
| 554 | 2535484456 | 2534681786 | Bacteria | 3308809 |
| 555 | 2535515763 | 2534681796 | Bacteria | 7146037 |
| 556 | 2551680465 | 2551306084 | Bacteria | 8942552 |
| 557 | 2551683852 | 2551306085 | Bacteria | 7347181 |
| 558 | 2551695754 | 2551306086 | Bacteria | 6843938 |
| 559 | 2551698137 | 2551306087 | Bacteria | 7351905 |
| 560 | 2551713132 | 2551306089 | Bacteria | 7162724 |
| 561 | 2551721354 | 2551306090 | Bacteria | 7953713 |
| 562 | 2551727278 | 2551306091 | Bacteria | 7086830 |
| 563 | 2551739170 | 2551306092 | Bacteria | 6992595 |
| 564 | 2551745195 | 2551306093 | Bacteria | 7064773 |
| 565 | 2558863431 | 2558860100 | Bacteria | 8458965 |
| 566 | 2561466096 | 2558860983 | Bacteria | 4133860 |
| 567 | 2585165614 | 2582581283 | Bacteria | 6030556 |
| 568 | 2585203126 | 2582581294 | Bacteria | 6626667 |
| 569 | 2585221038 | 2582581298 | Bacteria | 7315509 |
| 570 | 2585231447 | 2582581299 | Bacteria | 6518058 |
| 571 | 2585256566 | 2582581304 | Bacteria | 5831370 |
| 572 | 2585266112 | 2582581306 | Bacteria | 6450535 |
| 573 | 2585273215 | 2582581307 | Bacteria | 6597605 |
| 574 | 2585278952 | 2582581308 | Bacteria | 7413247 |
| 575 | 2585325433 | 2582581315 | Bacteria | 7318924 |
| 576 | 2585329595 | 2582581316 | Bacteria | 7774528 |
| 577 | 2585387113 | 2582581865 | Bacteria | 6644329 |
| 578 | 2585392767 | 2582581866 | Bacteria | 6859583 |
| 579 | 2585400077 | 2582581867 | Bacteria | 7184437 |
| 580 | 2585528016 | 2585427526 | Bacteria | 7258840 |
| 581 | 2585530748 | 2585427527 | Bacteria | 7273426 |
| 582 | 2585541382 | 2585427528 | Bacteria | 6842387 |
| 583 | 2585549240 | 2585427529 | Bacteria | 7395659 |
| 584 | 2585554929 | 2585427530 | Bacteria | 7383882 |
| 585 | 2585559485 | 2585427531 | Bacteria | 6992870 |
| 586 | 2585822636 | 2585427590 | Bacteria | 6824633 |
| 587 | 2585839486 | 2585427593 | Bacteria | 7141551 |
| 588 | 2585847167 | 2585427594 | Bacteria | 6180594 |
| 589 | 2585902156 | 2585427608 | Bacteria | 6544331 |
| 590 | 2585905139 | 2585427609 | Bacteria | 6667127 |
| 591 | 2585995164 | 2585427633 | Bacteria | 6413184 |
| 592 | 2585999711 | 2585427634 | Bacteria | 6455027 |
| 593 | 2587979746 | 2585428125 | Bacteria | 6662905 |
| 594 | 2599418550 | 2599185170 | Bacteria | 7295545 |
| 595 | 2599722060 | 2599185236 | Bacteria | 6875203 |
| 596 | 2600191988 | 2599185352 | Bacteria | 7228948 |
| 597 | 2600375315 | 2600254933 | Bacteria | 4750527 |
| 598 | 2616296171 | 2615840624 | Bacteria | 6557588 |
| 599 | 2616305775 | 2615840626 | Bacteria | 7921970 |
| 600 | 2616553985 | 2615840698 | Bacteria | 7319877 |
| 601 | 2617384175 | 2617270742 | Bacteria | 6808054 |
| 602 | 2643788362 | 2643221554 | Bacteria | 6603920 |
| 603 | 2643807146 | 2643221557 | Bacteria | 7184309 |
| 604 | 2643809960 | 2643221558 | Bacteria | 5460675 |
| 605 | 2644007970 | 2643221599 | Bacteria | 6292121 |
| 606 | 2644046509 | 2643221607 | Bacteria | 6314006 |
| 607 | 2644069588 | 2643221610 | Bacteria | 7480339 |
| 608 | 2644108937 | 2643221618 | Bacteria | 7717186 |
| 609 | 2644151459 | 2643221626 | Bacteria | 8069654 |
| 610 | 2644196559 | 2643221634 | Bacteria | 6705461 |
| 611 | 2644200862 | 2643221636 | Bacteria | 6583769 |
| 612 | 2644206147 | 2643221637 | Bacteria | 5345260 |
| 613 | 2644213710 | 2643221638 | Bacteria | 6579467 |
| 614 | 2644239056 | 2643221643 | Bacteria | 5749658 |
| 615 | 2644311593 | 2643221655 | Bacteria | 7722067 |
| 616 | 2644329851 | 2643221659 | Bacteria | 7890716 |
| 617 | 2644356613 | 2643221664 | Bacteria | 7272945 |
| 618 | 2644380528 | 2643221668 | Bacteria | 7306521 |
| 619 | 2644420742 | 2643221675 | Bacteria | 7473456 |
| 620 | 2644454267 | 2643221680 | Bacteria | 7473610 |
| 621 | 2644479299 | 2643221686 | Bacteria | 6310811 |
| 622 | 2644493349 | 2643221688 | Bacteria | 5260751 |
| 623 | 2644502346 | 2643221689 | Bacteria | 6042950 |
| 624 | 2644546525 | 2643221698 | Bacteria | 7756764 |
| 625 | 2644617392 | 2643221712 | Bacteria | 7729434 |
| 626 | 2644649794 | 2643221718 | Bacteria | 5345506 |
| 627 | 2644675594 | 2643221723 | Bacteria | 7095460 |
| 628 | 2644689604 | 2643221726 | Bacteria | 7455827 |
| 629 | 2657683213 | 2657244999 | Bacteria | 5946535 |
| 630 | 2671115261 | 2667528174 | Bacteria | 6435400 |
| 631 | 2719180334 | 2718217882 | Bacteria | 6556348 |
| 632 | 2719384911 | 2718217927 | Bacteria | 6972593 |
| 633 | 2719664656 | 2718217997 | Bacteria | 6740740 |
| 634 | 2719731083 | 2718218009 | Bacteria | 6478651 |
| 635 | 2720491076 | 2718218199 | Bacteria | 6740745 |
| 636 | 2720612445 | 2718218232 | Bacteria | 6720332 |
| 637 | 2720619284 | 2718218233 | Bacteria | 6662049 |
| 638 | 2721146428 | 2718218363 | Bacteria | 6524337 |
| 639 | 2721157949 | 2718218365 | Bacteria | 6274507 |
| 640 | 2721163307 | 2718218366 | Bacteria | 6425255 |
| 641 | 2721398631 | 2718218423 | Bacteria | 6438183 |
| 642 | 2722839477 | 2721755514 | Bacteria | 6424414 |
| 643 | 2723026105 | 2721755556 | Bacteria | 6745503 |
| 644 | 2723559649 | 2721755684 | Bacteria | 6859907 |
| 645 | 2724037444 | 2721755809 | Bacteria | 6438790 |
| 646 | 2724043839 | 2721755810 | Bacteria | 6479005 |
| 647 | 2724109369 | 2721755823 | Bacteria | 6752556 |
| 648 | 2725946774 | 2724679232 | Bacteria | 7646494 |
| 649 | 2730107041 | 2728369352 | Bacteria | 6745171 |
| 650 | 2730163571 | 2728369365 | Bacteria | 6555560 |
| 651 | 2730297581 | 2728369397 | Bacteria | 6274511 |
| 652 | 2738738765 | 2738541280 | Bacteria | 6630198 |
| 653 | 2738802209 | 2738541293 | Bacteria | 7065685 |
| 654 | 2738844646 | 2738541300 | Bacteria | 6675882 |
| 655 | 2739035946 | 2738541333 | Bacteria | 7106503 |
| 656 | 2739276170 | 2738543018 | Bacteria | 6718814 |
| 657 | 2739345306 | 2738543030 | Bacteria | 6719714 |
| 658 | 2753359022 | 2751185800 | Bacteria | 5467370 |
| 659 | 2758641259 | 2758568016 | Bacteria | 5645291 |
| 660 | 2766067561 | 2765235942 | Bacteria | 7445910 |
| 661 | 2776912872 | 2775507049 | Bacteria | 6284736 |
| 662 | 2778177531 | 2775507266 | Bacteria | 7392367 |
| 663 | 2792584214 | 2791355082 | Bacteria | 5973319 |
| 664 | 2793296241 | 2791355256 | Bacteria | 6798008 |
| 665 | 2793317567 | 2791355259 | Bacteria | 7254731 |
| 666 | 2793321057 | 2791355260 | Bacteria | 6598818 |
| 667 | 2793327089 | 2791355261 | Bacteria | 6661293 |
| 668 | 2793333658 | 2791355262 | Bacteria | 6774204 |
| 669 | 2793339748 | 2791355263 | Bacteria | 6872478 |
| 670 | 2793347975 | 2791355264 | Bacteria | 6429314 |
| 671 | 2793357410 | 2791355265 | Bacteria | 6539969 |
| 672 | 2793358961 | 2791355266 | Bacteria | 7116587 |
| 673 | 2793367891 | 2791355267 | Bacteria | 7222458 |
| 674 | 2802717793 | 2802428858 | Bacteria | 6636079 |
| 675 | 2802723278 | 2802428859 | Bacteria | 6667919 |
| 676 | 2802733141 | 2802428860 | Bacteria | 6525526 |
| 677 | 2802736277 | 2802428861 | Bacteria | 6534206 |
| 678 | 2802743513 | 2802428862 | Bacteria | 6633353 |
| 679 | 2802750774 | 2802428863 | Bacteria | 6410669 |
| 680 | 2804751399 | 2802429268 | Bacteria | 6094027 |
| 681 | 2805926538 | 2802429605 | Bacteria | 6875453 |
| 682 | 2805933337 | 2802429606 | Bacteria | 6346811 |
| 683 | 2806046875 | 2802429633 | Bacteria | 7341974 |
| 684 | 2806052458 | 2802429634 | Bacteria | 7083200 |
| 685 | 2806058771 | 2802429635 | Bacteria | 7650140 |
| 686 | 2806067461 | 2802429636 | Bacteria | 7597525 |
| 687 | 2806074034 | 2802429637 | Bacteria | 7067217 |
| 688 | 2819242493 | 2818991272 | Bacteria | 4622173 |
| 689 | 2819611551 | 2818991448 | Bacteria | 6772224 |
| 690 | 2819639204 | 2818991453 | Bacteria | 7181617 |
| 691 | 2838017328 | 2838016132 | Bacteria | 6577831 |
| 692 | 2838023103 | 2838022645 | Bacteria | 6494267 |
| 693 | 2838037754 | 2838035591 | Bacteria | 7166484 |
| 694 | 2838048868 | 2838042994 | Bacteria | 6046894 |
| 695 | 2838049190 | 2838048938 | Bacteria | 6044578 |
| 696 | 2838063364 | 2838061910 | Bacteria | 6794874 |
| 697 | 2838076494 | 2838074704 | Bacteria | 6785777 |
| 698 | 2838662767 | 2838661181 | Bacteria | 7385261 |
| 699 | 2838670887 | 2838668709 | Bacteria | 6671819 |
| 700 | 2838681383 | 2838680041 | Bacteria | 6545511 |
| 701 | 2838688566 | 2838686498 | Bacteria | 7807632 |
| 702 | 2838694582 | 2838694306 | Bacteria | 6853137 |
| 703 | 2838703258 | 2838701080 | Bacteria | 6669771 |
| 704 | 2838707960 | 2838707686 | Bacteria | 6619912 |
| 705 | 2838730861 | 2838729681 | Bacteria | 7400765 |
| 706 | 2838741176 | 2838736955 | Bacteria | 5760694 |
| 707 | 2838744245 | 2838742623 | Bacteria | 7396178 |
| 708 | 2841844927 | 2841840854 | Bacteria | 5761912 |
| 709 | 2841856926 | 2841851746 | Bacteria | 7532261 |
| 710 | 2842080809 | 2842077413 | Bacteria | 6508645 |
| 711 | 2842115018 | 2842110456 | Bacteria | 7656360 |
| 712 | 2842121428 | 2842118031 | Bacteria | 7033875 |
| 713 | 2842144649 | 2842140634 | Bacteria | 5759631 |
| 714 | 2842147518 | 2842146304 | Bacteria | 5957337 |
| 715 | 2842160096 | 2842156927 | Bacteria | 6894975 |
| 716 | 2842168339 | 2842163707 | Bacteria | 6916235 |
| 717 | 2842183287 | 2842180545 | Bacteria | 6888678 |
| 718 | 2842197989 | 2842192696 | Bacteria | 6147454 |
| 719 | 2842199531 | 2842198810 | Bacteria | 6608673 |
| 720 | 2842207657 | 2842205361 | Bacteria | 6340321 |
| 721 | 2842221243 | 2842217011 | Bacteria | 7497767 |
| 722 | 2842235112 | 2842229732 | Bacteria | 7475766 |
| 723 | 2842237371 | 2842237096 | Bacteria | 6620661 |
| 724 | 2842245709 | 2842243621 | Bacteria | 7421798 |
| 725 | 2842252584 | 2842250916 | Bacteria | 6579627 |
| 726 | 2842259641 | 2842257432 | Bacteria | 7401195 |
| 727 | 2842266882 | 2842264693 | Bacteria | 6472963 |
| 728 | 2842274480 | 2842271015 | Bacteria | 7807131 |
| 729 | 2842281548 | 2842278818 | Bacteria | 6340002 |
| 730 | 2842294465 | 2842291075 | Bacteria | 7076806 |
| 731 | 2842302405 | 2842298080 | Bacteria | 6123127 |
| 732 | 2842306723 | 2842304105 | Bacteria | 7023636 |
| 733 | 2842318612 | 2842317721 | Bacteria | 6793725 |
| 734 | 2842360862 | 2842357229 | Bacteria | 6485165 |
| 735 | 2842365291 | 2842363717 | Bacteria | 6844742 |
| 736 | 2842371846 | 2842370503 | Bacteria | 7038661 |
| 737 | 2842380863 | 2842377471 | Bacteria | 7140707 |
| 738 | 2842387934 | 2842384541 | Bacteria | 7057858 |
| 739 | 2842398215 | 2842395702 | Bacteria | 6780583 |
| 740 | 2842404346 | 2842402390 | Bacteria | 6681310 |
| 741 | 2842410969 | 2842409023 | Bacteria | 6687331 |
| 742 | 2842417575 | 2842415677 | Bacteria | 6596907 |
| 743 | 2842431013 | 2842428310 | Bacteria | 6767288 |
| 744 | 2842436989 | 2842434925 | Bacteria | 6502746 |
| 745 | 2842443067 | 2842441272 | Bacteria | 6769273 |
| 746 | 2842453289 | 2842447887 | Bacteria | 6754142 |
| 747 | 2842465078 | 2842462802 | Bacteria | 6588055 |
| 748 | 2842471696 | 2842469257 | Bacteria | 6752936 |
| 749 | 2842482894 | 2842482326 | Bacteria | 7212537 |
| 750 | 2842493797 | 2842489311 | Bacteria | 6620893 |
| 751 | 2842497247 | 2842495871 | Bacteria | 6820686 |
| 752 | 2842509770 | 2842509118 | Bacteria | 6850950 |
| 753 | 2842526296 | 2842521101 | Bacteria | 6569494 |
| 754 | 2844168460 | 2844163670 | Bacteria | 7266046 |
| 755 | 2844455082 | 2844454524 | Bacteria | 7952546 |
| 756 | 2850080530 | 2850079185 | Bacteria | 6848280 |
| 757 | 2852389124 | 2852387548 | Bacteria | 8025568 |
| 758 | 2854914543 | 2854911287 | Bacteria | 5582813 |
| 759 | 2855831423 | 2855825444 | Bacteria | 6785811 |
| 760 | 2855840547 | 2855839649 | Bacteria | 7135830 |
| 761 | 2857520250 | 2857516855 | Bacteria | 7787325 |
| 762 | 2858801075 | 2858800743 | Bacteria | 6603254 |
| 763 | 2891376454 | 2891373044 | Bacteria | 5202277 |
| 764 | 2896386694 | 2896384573 | Bacteria | 7700774 |
| 765 | 2913297394 | 2913295892 | Bacteria | 6333755 |
| 766 | 2915651528 | 2915650412 | Bacteria | 4288180 |
| 767 | 2915986273 | 2915980308 | Bacteria | 6624279 |
| 768 | 2915988308 | 2915986958 | Bacteria | 6739310 |
| 769 | 2915996160 | 2915993759 | Bacteria | 7016183 |
| 770 | 2916001175 | 2916000859 | Bacteria | 6865702 |
| 771 | 2916014006 | 2916007675 | Bacteria | 6898660 |
| 772 | 2916020243 | 2916014648 | Bacteria | 6946486 |
| 773 | 2916025152 | 2916021584 | Bacteria | 6854472 |
| 774 | 2916032637 | 2916028427 | Bacteria | 6748433 |
| 775 | 2916040277 | 2916035215 | Bacteria | 6755766 |
| 776 | 2916042695 | 2916041962 | Bacteria | 6820487 |
| 777 | 2916049615 | 2916048683 | Bacteria | 6543552 |
| 778 | 2916055259 | 2916055098 | Bacteria | 6758838 |
| 779 | 2916062701 | 2916061851 | Bacteria | 6737736 |
| 780 | 2916076777 | 2916076590 | Bacteria | 6596108 |
| 781 | 2919103872 | 2919100787 | Bacteria | 7710546 |
| 782 | 2919168432 | 2919166419 | Bacteria | 4952238 |
| 783 | 2919171371 | 2919171160 | Bacteria | 6499771 |
| 784 | 2919409356 | 2919408235 | Bacteria | 6149349 |
| 785 | 2920762822 | 2920760137 | Bacteria | 7427611 |
| 786 | 2920823898 | 2920822456 | Bacteria | 6897201 |
| 787 | 2921204366 | 2921201388 | Bacteria | 6926299 |
| 788 | 2921210050 | 2921208531 | Bacteria | 6745326 |
| 789 | 2921240045 | 2921237296 | Bacteria | 6876710 |
| 790 | 2921246195 | 2921244191 | Bacteria | 6568419 |
| 791 | 2921251054 | 2921250672 | Bacteria | 6677771 |
| 792 | 2921257885 | 2921257292 | Bacteria | 6808382 |
| 793 | 2921264136 | 2921263974 | Bacteria | 6864552 |
| 794 | 2921286248 | 2921282425 | Bacteria | 6826397 |
| 795 | 2921294831 | 2921289301 | Bacteria | 7316391 |
| 796 | 2921299626 | 2921296804 | Bacteria | 7176999 |
| 797 | 2923557524 | 2923556063 | Bacteria | 6793593 |
| 798 | 2924146586 | 2924144063 | Bacteria | 6883928 |
| 799 | 2924151197 | 2924150972 | Bacteria | 7169444 |
| 800 | 2924160674 | 2924158325 | Bacteria | 7188855 |
| 801 | 2924171712 | 2924165586 | Bacteria | 7260590 |
| 802 | 2924177525 | 2924172951 | Bacteria | 6749356 |
| 803 | 2924185891 | 2924179722 | Bacteria | 6843264 |
| 804 | 2924188719 | 2924186466 | Bacteria | 6876637 |
| 805 | 2924198163 | 2924193448 | Bacteria | 6955718 |
| 806 | 2924203021 | 2924200457 | Bacteria | 6757188 |
| 807 | 2924212633 | 2924207177 | Bacteria | 6917007 |
| 808 | 2924218051 | 2924214083 | Bacteria | 7080103 |
| 809 | 2924226761 | 2924221636 | Bacteria | 7113495 |
| 810 | 2924230290 | 2924228884 | Bacteria | 6633132 |
| 811 | 2933019564 | 2933016740 | Bacteria | 6355406 |
| 812 | 2933573163 | 2933570622 | Bacteria | 7023390 |
| 813 | 2933591417 | 2933586486 | Bacteria | 7667493 |
| 814 | 2935895104 | 2935894831 | Bacteria | 6620579 |
| 815 | 2935904088 | 2935901341 | Bacteria | 7341747 |
| 816 | 2936368080 | 2936367885 | Bacteria | 7324495 |
| 817 | 2936381526 | 2936375103 | Bacteria | 6652732 |
| 818 | 2936384903 | 2936381700 | Bacteria | 7006523 |
| 819 | 2937004316 | 2937002841 | Bacteria | 6934057 |
| 820 | 2937011069 | 2937009748 | Bacteria | 6746052 |
| 821 | 2937019401 | 2937016420 | Bacteria | 6782579 |
| 822 | 2937028501 | 2937023124 | Bacteria | 6815156 |
| 823 | 2937029766 | 2937029754 | Bacteria | 6424026 |
| 824 | 2937036792 | 2937036028 | Bacteria | 6846469 |
| 825 | 2937048318 | 2937042894 | Bacteria | 6741576 |
| 826 | 2937056089 | 2937049772 | Bacteria | 6757901 |
| 827 | 2937059172 | 2937056579 | Bacteria | 7107896 |
| 828 | 2937067840 | 2937063883 | Bacteria | 7199456 |
| 829 | 2937073943 | 2937071275 | Bacteria | 6984483 |
| 830 | 2937082872 | 2937078374 | Bacteria | 6610289 |
| 831 | 2937090524 | 2937084907 | Bacteria | 6618516 |
| 832 | 2937095690 | 2937091812 | Bacteria | 6979387 |
| 833 | 2937104117 | 2937098957 | Bacteria | 7249374 |
| 834 | 2937110734 | 2937106411 | Bacteria | 6947143 |
| 835 | 2937113967 | 2937113482 | Bacteria | 6505872 |
| 836 | 2937125464 | 2937119839 | Bacteria | 6597547 |
| 837 | 2937129032 | 2937126314 | Bacteria | 6771275 |
| 838 | 2939670219 | 2939669807 | Bacteria | 5028511 |
| 839 | 2941500160 | 2941499720 | Bacteria | 7599444 |
| 840 | 2957379925 | 2957375807 | Bacteria | 6425588 |
| 841 | 2957385828 | 2957382221 | Bacteria | 6737050 |
| 842 | 2957389031 | 2957388812 | Bacteria | 6778072 |
| 843 | 2957398335 | 2957395598 | Bacteria | 6822399 |
| 844 | 2957407534 | 2957402308 | Bacteria | 6741770 |
| 845 | 2957411614 | 2957408893 | Bacteria | 6558585 |
| 846 | 2957418883 | 2957415311 | Bacteria | 6991633 |
| 847 | 2957429866 | 2957422303 | Bacteria | 7172205 |
| 848 | 2957432539 | 2957430029 | Bacteria | 7022557 |
| 849 | 2957438993 | 2957437181 | Bacteria | 6568994 |
| 850 | 2957446521 | 2957443900 | Bacteria | 6869977 |
| 851 | 2957456587 | 2957450854 | Bacteria | 6765715 |
| 852 | 2957463339 | 2957457609 | Bacteria | 6967680 |
| 853 | 2957466631 | 2957464669 | Bacteria | 6568877 |
| 854 | 2957473173 | 2957471148 | Bacteria | 6797643 |
| 855 | 2957479919 | 2957478035 | Bacteria | 6756658 |
| 856 | 2957485722 | 2957484790 | Bacteria | 6703082 |
| 857 | 2957496255 | 2957491536 | Bacteria | 6695180 |
| 858 | 2957503554 | 2957498199 | Bacteria | 7126688 |
| 859 | 2957509254 | 2957505466 | Bacteria | 7253085 |
| 860 | 2960588733 | 2960584000 | Bacteria | 6864594 |
| 861 | 2960595673 | 2960591022 | Bacteria | 6622873 |
| 862 | 2960601606 | 2960597568 | Bacteria | 6550735 |
| 863 | 2960608562 | 2960603979 | Bacteria | 6898737 |
| 864 | 2960611909 | 2960610863 | Bacteria | 6691244 |
| 865 | 2960617802 | 2960617483 | Bacteria | 6727748 |
| 866 | 2960630670 | 2960624210 | Bacteria | 6875384 |
| 867 | 2960633125 | 2960631154 | Bacteria | 6732508 |
| 868 | 2960643190 | 2960637947 | Bacteria | 7296468 |
| 869 | 2960645792 | 2960645483 | Bacteria | 7211087 |
| 870 | 2960658010 | 2960652885 | Bacteria | 7083688 |
| 871 | 2960666505 | 2960660292 | Bacteria | 7041660 |
| 872 | 2960668692 | 2960667422 | Bacteria | 6763020 |
| 873 | 2960675885 | 2960674078 | Bacteria | 6609048 |
| 874 | 2960684262 | 2960680706 | Bacteria | 6624464 |
| 875 | 2960689069 | 2960687367 | Bacteria | 6535474 |
| 876 | 2960696790 | 2960693952 | Bacteria | 6749742 |
| 877 | 2964609486 | 2964607997 | Bacteria | 7101408 |
| 878 | 2964616027 | 2964615318 | Bacteria | 6809089 |
| 879 | 2964625079 | 2964621998 | Bacteria | 6834995 |
| 880 | 2964635383 | 2964628898 | Bacteria | 7083044 |
| 881 | 2964642539 | 2964636051 | Bacteria | 7091832 |
| 882 | 2964646925 | 2964643177 | Bacteria | 6820887 |
| 883 | 2964656336 | 2964649959 | Bacteria | 6675118 |
| 884 | 2964659728 | 2964656573 | Bacteria | 7100150 |
| 885 | 2964665576 | 2964663802 | Bacteria | 7019362 |
| 886 | 2964672022 | 2964670856 | Bacteria | 6851364 |
| 887 | 2964679411 | 2964678106 | Bacteria | 6792020 |
| 888 | 2964688255 | 2964685014 | Bacteria | 6839111 |
| 889 | 2964692139 | 2964691889 | Bacteria | 6802758 |
| 890 | 2964703518 | 2964698721 | Bacteria | 6765331 |
| 891 | 2964708590 | 2964705432 | Bacteria | 7114648 |
| 892 | 2964718656 | 2964712639 | Bacteria | 6695970 |
| 893 | 2964722300 | 2964719344 | Bacteria | 7286602 |
| 894 | 2967668679 | 2967664464 | Bacteria | 6948836 |
| 895 | 2967677139 | 2967671571 | Bacteria | 7021409 |
| 896 | 2967681628 | 2967678726 | Bacteria | 7264382 |
| 897 | 2967687134 | 2967686174 | Bacteria | 6678622 |
| 898 | 2967693346 | 2967693043 | Bacteria | 6804451 |
| 899 | 2967707818 | 2967706974 | Bacteria | 7186053 |
| 900 | 2967716428 | 2967714385 | Bacteria | 7000047 |
| 901 | 2967723328 | 2967721400 | Bacteria | 7073753 |
| 902 | 2967734634 | 2967728569 | Bacteria | 6641507 |
| 903 | 2967735544 | 2967735183 | Bacteria | 6827012 |
| 904 | 2967745106 | 2967742019 | Bacteria | 6794534 |
| 905 | 2967754505 | 2967748971 | Bacteria | 6733771 |
| 906 | 2967756995 | 2967755722 | Bacteria | 6814706 |
| 907 | 2967763897 | 2967762386 | Bacteria | 6923502 |
| 908 | 2967771679 | 2967769361 | Bacteria | 6587838 |
| 909 | 2967776701 | 2967775926 | Bacteria | 6738189 |
| 910 | 2970020539 | 2970019648 | Bacteria | 7072033 |
| 911 | 2970032655 | 2970026789 | Bacteria | 6785236 |
| 912 | 2970035732 | 2970033650 | Bacteria | 7118744 |
| 913 | 2970045421 | 2970040964 | Bacteria | 6731123 |
| 914 | 2970050481 | 2970047711 | Bacteria | 7088379 |
| 915 | 2970057920 | 2970054988 | Bacteria | 6611507 |
| 916 | 2970067786 | 2970061556 | Bacteria | 7099761 |
| 917 | 2970072000 | 2970068827 | Bacteria | 7123112 |
| 918 | 2970081395 | 2970076120 | Bacteria | 6697332 |
| 919 | 2970088304 | 2970082768 | Bacteria | 6183754 |
| 920 | 2970091613 | 2970088815 | Bacteria | 6933825 |
| 921 | 2970100955 | 2970095765 | Bacteria | 6936963 |
| 922 | 2970105075 | 2970102677 | Bacteria | 6812532 |
| 923 | 2970114587 | 2970109326 | Bacteria | 6863976 |
| 924 | 2970117820 | 2970116247 | Bacteria | 6501857 |
| 925 | 2970124358 | 2970122695 | Bacteria | 6625855 |
| 926 | 2970129618 | 2970129317 | Bacteria | 6806560 |
| 927 | 2970136506 | 2970136068 | Bacteria | 7207982 |
| 928 | 2970144473 | 2970143518 | Bacteria | 6446480 |
| 929 | 2970155827 | 2970149975 | Bacteria | 6779706 |
| 930 | 2970162894 | 2970156795 | Bacteria | 7168044 |
| 931 | 2970166849 | 2970164137 | Bacteria | 6861252 |
| 932 | 2970176026 | 2970170962 | Bacteria | 6876229 |
| 933 | 2970178480 | 2970177841 | Bacteria | 6768001 |
| 934 | 2970187386 | 2970184632 | Bacteria | 7054431 |
| 935 | 2970194280 | 2970191845 | Bacteria | 7032787 |
| 936 | 2977517875 | 2977516862 | Bacteria | 6940108 |
| 937 | 2977529804 | 2977523885 | Bacteria | 6960446 |
| 938 | 2977536953 | 2977530762 | Bacteria | 6951399 |
| 939 | 2977538088 | 2977537788 | Bacteria | 6929320 |
| 940 | 2977545993 | 2977544691 | Bacteria | 6875412 |
| 941 | 2977552088 | 2977551784 | Bacteria | 7125765 |
| 942 | 2977562810 | 2977558990 | Bacteria | 6863948 |
| 943 | 2977566313 | 2977565890 | Bacteria | 6901543 |
| 944 | 2977576533 | 2977572785 | Bacteria | 6763888 |
| 945 | 2977581193 | 2977579622 | Bacteria | 6772100 |
| 946 | 2978971101 | 2978969890 | Bacteria | 5400756 |
| 947 | 2984588263 | 2984587000 | Bacteria | 5263363 |
| 948 | 2989778234 | 2989776772 | Bacteria | 4843317 |
| 949 | 2996888730 | 2996887358 | Bacteria | 5795980 |
| 950 | 2996895127 | 2996893221 | Bacteria | 5823108 |
| 951 | 3003932725 | 3003930520 | Bacteria | 5667563 |
| 952 | 3005412489 | 3005409236 | Bacteria | 7188837 |
| 953 | 3005417185 | 3005416602 | Bacteria | 7064308 |
| 954 | 3005446799 | 3005445848 | Bacteria | 6906074 |
| 955 | 3005453494 | 3005452660 | Bacteria | 5889319 |
| 956 | 639647472 | 639633055 | Bacteria | 7751309 |
| 957 | 648736465 | 648276728 | Bacteria | 6968865 |
| 958 | 8003993047 | 8003992118 | Bacteria | 7266902 |
| 959 | 8004000283 | 8003999396 | Bacteria | 7063185 |
| 960 | 8005251267 | 8005246636 | Bacteria | 4933972 |
| 961 | 8005260002 | 8005258706 | Bacteria | 6184835 |
| 962 | 8005279631 | 8005275841 | Bacteria | 6929066 |
| 963 | 8005292832 | 8005289223 | Bacteria | 6634003 |
| 964 | 8005304638 | 8005301065 | Bacteria | 6614431 |
| 965 | 8005311136 | 8005307578 | Bacteria | 7395396 |
| 966 | 8005315246 | 8005314921 | Bacteria | 7072929 |
| 967 | 8005323257 | 8005321885 | Bacteria | 5795980 |
| 968 | 8005376567 | 8005376324 | Bacteria | 6590079 |
| 969 | 8005385956 | 8005382845 | Bacteria | 6732062 |
| 970 | 8005400261 | 8005395548 | Bacteria | 6806915 |
| 971 | 8005437121 | 8005430974 | Bacteria | 6689030 |
| 972 | 8005461970 | 8005460587 | Bacteria | 7157962 |
| 973 | 8005485583 | 8005484373 | Bacteria | 6297373 |
| 974 | 8005499378 | 8005497431 | Bacteria | 6477605 |
| 975 | 8005544397 | 8005542996 | Bacteria | 7077758 |
| 976 | 8005558887 | 8005556819 | Bacteria | 6908598 |
| 977 | 8005570476 | 8005563573 | Bacteria | 7153261 |
| 978 | 8005572733 | 8005570704 | Bacteria | 6957481 |
| 979 | 8005620568 | 8005619151 | Bacteria | 7030230 |
| 980 | 8005627469 | 8005626139 | Bacteria | 6534237 |
| 981 | 8005649893 | 8005645114 | Bacteria | 6950293 |
| 982 | 8005659930 | 8005658619 | Bacteria | 4500593 |
| 983 | 8005670794 | 8005668836 | Bacteria | 6953162 |
| 984 | 8005684522 | 8005682033 | Bacteria | 6726518 |
| 985 | 8005691063 | 8005688590 | Bacteria | 6610080 |
| 986 | 8005698738 | 8005695170 | Bacteria | 6912330 |
| 987 | 8018131374 | 8018127388 | Bacteria | 7351159 |
| 988 | 8018152505 | 8018150411 | Bacteria | 5549903 |
| 989 | 8018169469 | 8018163183 | Bacteria | 7277977 |
| 990 | 8018182550 | 8018176218 | Bacteria | 6896178 |
| 991 | 8023686907 | 8023680758 | Bacteria | 7729763 |
| 992 | 8024481146 | 8024479707 | Bacteria | 6954785 |
| 993 | 8024489714 | 8024486573 | Bacteria | 6540512 |
| 994 | 8024503212 | 8024501048 | Bacteria | 6427847 |
| 995 | 8046767722 | 8046767195 | Bacteria | 7547379 |
| 996 | 8049293972 | 8049293176 | Bacteria | 6128433 |
| 997 | 8054461947 | 8054460903 | Bacteria | 4872905 |
| 998 | 8055434237 | 8055431914 | Bacteria | 4551896 |
| 999 | 8056380771 | 8056375014 | Bacteria | 7006639 |
| 1000 | 8056384706 | 8056382006 | Bacteria | 6408074 |
| 1001 | 8056876538 | 8056875544 | Bacteria | 4355797 |
| 1002 | 8057582152 | 8057575449 | Bacteria | 7367519 |
| 1003 | 8057879915 | 8057874678 | Bacteria | 7494653 |
| 1004 | Ga0495686_0186950 | |||
| 1005 | JGI25156J39149_1000129 | |||
| 1006 | JGI25162J39368_1000663 | |||
| 1007 | JGI25162J39368_1000771 | |||
| 1008 | JGI25154J39366_1000393 | |||
| 1009 | JGI25154J39366_1010856 | |||
| 1010 | JGI25157J39369_1000061 | |||
| 1011 | JGI25163J39215_1005407 | |||
| 1012 | JGI25152J39213_1000780 | |||
| 1013 | JGI25152J39213_1003870 | |||
| 1014 | JGI25152J39213_1005651 | |||
| 1015 | JGI25150J39212_1000033 | |||
| 1016 | JGI25159J45721_1000136 | |||
| 1017 | JGI25159J45721_1000539 | |||
| 1018 | JGI25151J46595_10000108 | |||
| 1019 | JGI25151J46595_10001664 | |||
| 1020 | JGI25151J46595_10004059 | |||
| 1021 | JGI25151J46595_10029420 | |||
| 1022 | JGI25165J46597_1000887 | |||
| 1023 | JGI25165J46597_1001344 | |||
| 1024 | JGI25165J46597_1003152 | |||
| 1025 | JGI25153J46596_10000780 | |||
| 1026 | JGI25153J46596_10005162 | |||
| 1027 | JGI25153J46596_10008442 | |||
| 1028 | JGI25153J46596_10026362 | |||
| 1029 | rootH1_10029408 | |||
| 1030 | rootL2_10224148 | |||
| 1031 | rootH1_10199986 | |||
| 1032 | rootH1_10199992 | |||
| 1033 | JGI25160J50197_1000008 | |||
| 1034 | JGI25160J50197_1000015 | |||
| 1035 | JGI25160J50197_1000191 | |||
| 1036 | JGI25160J50197_1013276 | |||
| 1037 | JGI25161J50226_1000005 | |||
| 1038 | JGI25161J50226_1000051 | |||
| 1039 | JGI25161J50226_1000645 | |||
| 1040 | Ga0055526_1004586 | |||
| 1041 | Ga0055526_1006805 | |||
| 1042 | Ga0055526_1011614 | |||
| 1043 | Ga0055526_1025227 | |||
| 1044 | Ga0055526_1050721 | |||
| 1045 | Ga0055524_1001028 | |||
| 1046 | Ga0055524_1001385 | |||
| 1047 | Ga0055524_1002986 | |||
| 1048 | Ga0055524_1008559 | |||
| 1049 | Ga0055524_1043002 | |||
| 1050 | Ga0055536_1005530 | |||
| 1051 | Ga0055528_1000201 | |||
| 1052 | Ga0055528_1001755 | |||
| 1053 | Ga0055528_1003372 | |||
| 1054 | Ga0055528_1005168 | |||
| 1055 | Ga0055528_1016328 | |||
| 1056 | Ga0055530_10021277 | |||
| 1057 | Ga0055540_1000220 | |||
| 1058 | Ga0055540_1003015 | |||
| 1059 | Ga0055540_1022079 | |||
| 1060 | Ga0055531_10002199 | |||
| 1061 | Ga0055531_10011531 | |||
| 1062 | Ga0055531_10021064 | |||
| 1063 | Ga0055543_1000012 | |||
| 1064 | Ga0055543_1000040 | |||
| 1065 | Ga0055543_1000258 | |||
| 1066 | Ga0055543_1001853 | |||
| 1067 | Ga0065165_1000015 | |||
| 1068 | Ga0065165_1000125 | |||
| 1069 | Ga0065165_1007971 | |||
| 1070 | Ga0065165_1008405 | |||
| 1071 | Ga0065165_1024782 | |||
| 1072 | Ga0065165_1095829 | |||
| 1073 | Ga0065704_10123258 | |||
| 1074 | Ga0070658_10655175 | |||
| 1075 | Ga0070709_10347892 | |||
| 1076 | Ga0070713_100183244 | |||
| 1077 | Ga0070665_100020587 | |||
| 1078 | Ga0068855_100134254 | |||
| 1079 | Ga0068856_100317635 | |||
| 1080 | Ga0068863_100251041 | |||
| 1081 | Ga0068862_100689433 | |||
| 1082 | Ga0075365_10000858 | |||
| 1083 | Ga0075365_10001303 | |||
| 1084 | Ga0075365_10002765 | |||
| 1085 | Ga0075364_10287326 | |||
| 1086 | Ga0070716_100002842 | |||
| 1087 | Ga0075362_10001499 | |||
| 1088 | Ga0075367_10002234 | |||
| 1089 | Ga0075367_10072548 | |||
| 1090 | Ga0075367_10130236 | |||
| 1091 | Ga0075369_10000760 | |||
| 1092 | Ga0075369_10012547 | |||
| 1093 | Ga0075369_10117755 | |||
| 1094 | Ga0075366_10005574 | |||
| 1095 | Ga0075370_10060792 | |||
| 1096 | Ga0075370_10256504 | |||
| 1097 | Ga0079104_1001622 | |||
| 1098 | Ga0079104_1007055 | |||
| 1099 | Ga0105240_10000032 | |||
| 1100 | Ga0105243_10225965 | |||
| 1101 | Ga0105248_10518140 | |||
| 1102 | Ga0105237_10002365 | |||
| 1103 | Ga0105238_10491988 | |||
| 1104 | Ga0105249_10051807 | |||
| 1105 | Ga0123342_1018873 | |||
| 1106 | Ga0123342_1031383 | |||
| 1107 | Ga0105239_10012679 | |||
| 1108 | Ga0157373_10034649 | |||
| 1109 | Ga0157373_10092973 | |||
| 1110 | Ga0157373_10421988 | |||
| 1111 | Ga0157370_10006055 | |||
| 1112 | Ga0157369_10065345 | |||
| 1113 | Ga0157369_10072048 | |||
| 1114 | Ga0171463_1001 | |||
| 1115 | Ga0157378_10067397 | |||
| 1116 | Ga0182008_10008143 | |||
| 1117 | Ga0182007_10000460 | |||
| 1118 | Ga0182005_1001195 | |||
| 1119 | Ga0183363_1174 | |||
| 1120 | Ga0214544_1000017 | |||
| 1121 | Ga0214542_1000006 | |||
| 1122 | Ga0214543_1000003 | |||
| 1123 | Ga0214543_1000014 | |||
| 1124 | Ga0228711_1000001 | |||
| 1125 | Ga0228710_1000001 | |||
| 1126 | Ga0209435_100042 | |||
| 1127 | Ga0209760_103229 | |||
| 1128 | Ga0209436_100971 | |||
| 1129 | Ga0209436_102619 | |||
| 1130 | Ga0209672_103729 | |||
| 1131 | Ga0209437_100033 | |||
| 1132 | Ga0209437_100075 | |||
| 1133 | Ga0207425_1000031 | |||
| 1134 | Ga0207425_1005673 | |||
| 1135 | Ga0207425_1010232 | |||
| 1136 | Ga0207425_1010928 | |||
| 1137 | Ga0209646_1000145 | |||
| 1138 | Ga0209026_1000160 | |||
| 1139 | Ga0209677_101318 | |||
| 1140 | Ga0209759_1000177 | |||
| 1141 | Ga0209129_1000053 | |||
| 1142 | Ga0209129_1000137 | |||
| 1143 | Ga0209129_1001658 | |||
| 1144 | Ga0209129_1004647 | |||
| 1145 | Ga0209233_1000056 | |||
| 1146 | Ga0209233_1000064 | |||
| 1147 | Ga0209233_1000209 | |||
| 1148 | Ga0209673_1000041 | |||
| 1149 | Ga0209673_1000319 | |||
| 1150 | Ga0209673_1000603 | |||
| 1151 | Ga0209673_1001904 | |||
| 1152 | Ga0209673_1002052 | |||
| 1153 | Ga0209673_1005246 | |||
| 1154 | Ga0209673_1006607 | |||
| 1155 | Ga0209130_1000006 | |||
| 1156 | Ga0209130_1000007 | |||
| 1157 | Ga0209130_1000018 | |||
| 1158 | Ga0209130_1026324 | |||
| 1159 | Ga0209130_1041110 | |||
| 1160 | Ga0209676_1000694 | |||
| 1161 | Ga0209676_1003604 | |||
| 1162 | Ga0209676_1008047 | |||
| 1163 | Ga0209025_1000087 | |||
| 1164 | Ga0209025_1000199 | |||
| 1165 | Ga0209025_1000580 | |||
| 1166 | Ga0209025_1001502 | |||
| 1167 | Ga0209025_1001754 | |||
| 1168 | Ga0209025_1007635 | |||
| 1169 | Ga0209025_1009735 | |||
| 1170 | Ga0209025_1014633 | |||
| 1171 | Ga0209025_1027130 | |||
| 1172 | Ga0209025_1066977 | |||
| 1173 | Ga0209564_1000330 | |||
| 1174 | Ga0209564_1000425 | |||
| 1175 | Ga0209564_1000431 | |||
| 1176 | Ga0209564_1001106 | |||
| 1177 | Ga0209564_1004048 | |||
| 1178 | Ga0209564_1042266 | |||
| 1179 | Ga0209758_1000081 | |||
| 1180 | Ga0209758_1000333 | |||
| 1181 | Ga0209758_1000890 | |||
| 1182 | Ga0209758_1002000 | |||
| 1183 | Ga0209758_1002059 | |||
| 1184 | Ga0209758_1002927 | |||
| 1185 | Ga0209758_1005916 | |||
| 1186 | Ga0209758_1031983 | |||
| 1187 | Ga0209050_1007450 | |||
| 1188 | Ga0209050_1013684 | |||
| 1189 | Ga0209256_1000877 | |||
| 1190 | Ga0209256_1001695 | |||
| 1191 | Ga0209256_1001781 | |||
| 1192 | Ga0209256_1002866 | |||
| 1193 | Ga0209256_1003093 | |||
| 1194 | Ga0209256_1005385 | |||
| 1195 | Ga0209256_1008203 | |||
| 1196 | Ga0209256_1043748 | |||
| 1197 | Ga0207426_1000044 | |||
| 1198 | Ga0207426_1000064 | |||
| 1199 | Ga0207426_1000106 | |||
| 1200 | Ga0207426_1000119 | |||
| 1201 | Ga0209051_1000198 | |||
| 1202 | Ga0209051_1001443 | |||
| 1203 | Ga0209051_1001611 | |||
| 1204 | Ga0209051_1002094 | |||
| 1205 | Ga0209051_1002200 | |||
| 1206 | Ga0209051_1065244 | |||
| 1207 | Ga0209257_1001713 | |||
| 1208 | Ga0209257_1002246 | |||
| 1209 | Ga0209257_1004254 | |||
| 1210 | Ga0209257_1040331 | |||
| 1211 | Ga0209257_1043170 | |||
| 1212 | Ga0207697_10105119 | |||
| 1213 | Ga0207695_10000024 | |||
| 1214 | Ga0207671_10000718 | |||
| 1215 | Ga0207650_10008527 | |||
| 1216 | Ga0207700_10073190 | |||
| 1217 | Ga0207665_10000133 | |||
| 1218 | Ga0207667_10107346 | |||
| 1219 | Ga0207712_10084772 | |||
| 1220 | Ga0207641_10229578 | |||
| 1221 | Ga0207676_10546880 | |||
| 1222 | Ga0207698_10284304 | |||
| 1223 | Ga0209281_1000053 | |||
| 1224 | Ga0209281_1000236 | |||
| 1225 | Ga0209281_1000266 | |||
| 1226 | Ga0209282_1000007 | |||
| 1227 | Ga0268266_10034684 | |||
| 1228 | Ga0268266_10154536 | |||
| 1229 | Ga0268264_10633587 | |||
| 1230 | Ga0307515_10000070 | |||
| 1231 | Ga0307515_10009357 | |||
| 1232 | Ga0307515_10009393 | |||
| 1233 | Ga0307515_10010607 | |||
| 1234 | Ga0307515_10266528 | |||
| 1235 | Ga0307515_10361103 | |||
| 1236 | Ga0307513_10017679 | |||
| 1237 | Ga0307513_10064384 | |||
| 1238 | Ga0307408_100084949 | |||
| 1239 | Ga0307405_10001075 | |||
| 1240 | Ga0307406_10010681 | |||
| 1241 | Ga0307412_10003169 | |||
| 1242 | Ga0307412_10457103 | |||
| 1243 | Ga0315914_1000006 | |||
| 1244 | Ga0307409_100072804 | |||
| 1245 | Ga0307414_10126819 | |||
| 1246 | Ga0307510_10352406 | |||
| 1247 | Ga0315913_1000002 | |||
| 1248 | Ga0315915_1000001 | |||
| 1249 | Ga0395900_0111279 | |||
| 1250 | Ga0395905_0016934 | |||
| 1251 | Ga0395905_0047077 | |||
| 1252 | Ga0395901_0000508 | |||
| 1253 | Ga0436365_0215315 | |||
| 1254 | Ga0436365_0573424 | |||
| 1255 | Ga0439436_0018152 | |||
| 1256 | Ga0439438_023347 | |||
| 1257 | Ga0439465_0026630 | |||
| 1258 | Ga0439465_0093300 | |||
| 1259 | Ga0451793_1931244 | |||
| 1260 | Ga0451837_0331042 | |||
| 1261 | Ga0451839_0799242 | |||
| 1262 | Ga0451841_0302975 | |||
| 1263 | Ga0451841_0659426 | |||
| 1264 | Ga0451845_0068571 | |||
| 1265 | Ga0451846_49560 | |||
| 1266 | Ga0451847_0047250 | |||
| 1267 | Ga0451847_0824177 | |||
| 1268 | Ga0451849_0746664 | |||
| 1269 | Ga0451849_1275464 | |||
| 1270 | Ga0451849_1509101 | |||
| 1271 | Ga0451851_0316867 | |||
| 1272 | Ga0451851_0644451 | |||
| 1273 | Ga0451855_1139024 | |||
| 1274 | Ga0451853_0907327 | |||
| 1275 | Ga0439445_0035464 | |||
| 1276 | Ga0439449_0010290 | |||
| 1277 | Ga0439449_0102273 | |||
| 1278 | Ga0439462_0009016 | |||
| 1279 | Ga0450906_008763 | |||
| 1280 | Ga0439434_0051995 | |||
| 1281 | Ga0466965_0064857 | |||
| 1282 | Ga0466966_0528769 | |||
| 1283 | Ga0466963_0402478 | |||
| 1284 | Ga0466968_0017525 | |||
| 1285 | Ga0466970_0012880 | |||
| 1286 | Ga0466970_0032477 | |||
| 1287 | Ga0466957_0081763 | |||
| 1288 | Ga0466960_0151262 | |||
| 1289 | Ga0466958_0150466 | |||
| 1290 | Ga0495617_037385 | |||
| 1291 | Ga0495592_0097073 | |||
| 1292 | Ga0495603_0157881 | |||
| 1293 | Ga0495590_0108203 | |||
| 1294 | Ga0495638_0003817 | |||
| 1295 | Ga0495638_0037074 | |||
| 1296 | Ga0495651_0251438 | |||
| 1297 | Ga0495605_0011138 | |||
| 1298 | Ga0495605_0181496 | |||
| 1299 | Ga0495662_0010800 | |||
| 1300 | Ga0495664_0066671 | |||
| 1301 | Ga0495585_0011550 | |||
| 1302 | Ga0495585_0038977 | |||
| 1303 | Ga0495585_0061354 | |||
| 1304 | Ga0495585_0123347 | |||
| 1305 | Ga0495596_0108794 | |||
| 1306 | Ga0495607_0068939 | |||
| 1307 | Ga0495607_0210805 | |||
| 1308 | Ga0495583_0004596 | |||
| 1309 | Ga0495583_0013729 | |||
| 1310 | Ga0495606_0007105 | |||
| 1311 | Ga0495606_0035483 | |||
| 1312 | Ga0495606_0036357 | |||
| 1313 | Ga0495606_0049390 | |||
| 1314 | Ga0495610_0006488 | |||
| 1315 | Ga0495610_0033071 | |||
| 1316 | Ga0495616_0016301 | |||
| 1317 | Ga0495616_0049112 | |||
| 1318 | Ga0495620_0008876 | |||
| 1319 | Ga0495620_0035575 | |||
| 1320 | Ga0495628_0108952 | |||
| 1321 | Ga0495631_0003953 | |||
| 1322 | Ga0495632_0021429 | |||
| 1323 | Ga0495632_0029637 | |||
| 1324 | Ga0495632_0084482 | |||
| 1325 | Ga0495643_0023538 | |||
| 1326 | Ga0495643_0024536 | |||
| 1327 | Ga0495643_0123974 | |||
| 1328 | Ga0495648_0016629 | |||
| 1329 | Ga0495648_0222101 | |||
| 1330 | Ga0495652_0176860 | |||
| 1331 | Ga0495654_0000092 | |||
| 1332 | Ga0495654_0072443 | |||
| 1333 | Ga0495640_0199047 | |||
| 1334 | Ga0495587_0067533 | |||
| 1335 | Ga0495609_0034871 | |||
| 1336 | Ga0495609_0121838 | |||
| 1337 | Ga0495621_0139715 | |||
| 1338 | Ga0495622_0008227 | |||
| 1339 | Ga0495633_0112623 | |||
| 1340 | Ga0495633_0116324 | |||
| 1341 | Ga0495668_0004226 | |||
| 1342 | Ga0495611_0005820 | |||
| 1343 | Ga0495625_0000883 | |||
| 1344 | Ga0495625_0011676 | |||
| 1345 | Ga0495625_0021680 | |||
| 1346 | Ga0495625_0244679 | |||
| 1347 | Ga0495625_0378203 | |||
| 1348 | Ga0495659_0000169 | |||
| 1349 | Ga0495661_0099044 | |||
| 1350 | Ga0495588_0017354 | |||
| 1351 | Ga0495588_0034968 | |||
| 1352 | Ga0495657_0034711 | |||
| 1353 | Ga0495646_0217716 | |||
| 1354 | Ga0495658_0078054 | |||
| 1355 | Ga0495670_0089722 | |||
| 1356 | Ga0495670_0362318 | |||
| 1357 | Ga0495671_0005586 | |||
| 1358 | Ga0495671_0111024 | |||
| 1359 | Ga0495649_0015455 | |||
| 1360 | Ga0495600_0014412 | |||
| 1361 | Ga0495660_0027278 | |||
| 1362 | Ga0495660_0029535 | |||
| 1363 | Ga0495660_0181624 | |||
| 1364 | Ga0495604_0041180 | |||
| 1365 | Ga0495636_0035876 | |||
| 1366 | Ga0495636_0094526 | |||
| 1367 | Ga0495672_0000045 | |||
| 1368 | Ga0495672_0009853 | |||
| 1369 | Ga0495687_016382 | |||
| 1370 | Ga0495681_0103466 | |||
| 1371 | Ga0495686_0001036 | |||
| 1372 | Ga0495686_0008424 | |||
| 1373 | Ga0495686_0018580 | |||
| 1374 | Ga0495686_0030342 | |||
| 1375 | Ga0495626_0081029 | |||
| 1376 | Ga0495626_0099234 | |||
| 1377 | Ga0496100_0037143 | |||
| 1378 | Ga0496100_0521848 | |||
| 1379 | Ga0496101_0288769 | |||
| 1380 | Ga0496102_0066355 | |||
| 1381 | Ga0496103_0008468 | |||
| 1382 | Ga0496106_0015849 | |||
| 1383 | Ga0496106_0365858 | |||
| 1384 | Ga0496111_0002706 | |||
| 1385 | Ga0496112_0079195 | |||
| 1386 | Ga0496113_0228648 | |||
| 1387 | Ga0496116_0000026 | |||
| 1388 | Ga0496116_0005741 | |||
| 1389 | Ga0496116_0009536 | |||
| 1390 | Ga0496116_0010291 | |||
| 1391 | Ga0496116_0039068 | |||
| 1392 | Ga0496116_0056409 | |||
| 1393 | Ga0496116_0096303 | |||
| 1394 | Ga0496116_0289728 | |||
| 1395 | Ga0496117_0001867 | |||
| 1396 | Ga0496117_0023329 | |||
| 1397 | Ga0496117_0029504 | |||
| 1398 | Ga0496117_0030478 | |||
| 1399 | Ga0496117_0097743 | |||
| 1400 | Ga0496117_0105548 | |||
| 1401 | Ga0496118_0012870 | |||
| 1402 | Ga0496118_0022747 | |||
| 1403 | Ga0496118_0024577 | |||
| 1404 | Ga0496118_0034308 | |||
| 1405 | Ga0496118_0074792 | |||
| 1406 | Ga0496118_0213674 | |||
| 1407 | Ga0496119_0004467 | |||
| 1408 | Ga0496119_0027539 | |||
| 1409 | Ga0496119_0059809 | |||
| 1410 | Ga0496119_0237284 | |||
| 1411 | Ga0496120_0036918 | |||
| 1412 | Ga0496121_0008112 | |||
| 1413 | Ga0496121_0012320 | |||
| 1414 | Ga0496121_0012537 | |||
| 1415 | Ga0496121_0035352 | |||
| 1416 | Ga0496121_0037316 | |||
| 1417 | Ga0496121_0132588 | |||
| 1418 | Ga0496121_0198199 | |||
| 1419 | Ga0496121_0212161 | |||
| 1420 | Ga0496122_0000160 | |||
| 1421 | Ga0496122_0000604 | |||
| 1422 | Ga0496122_0005715 | |||
| 1423 | Ga0496122_0011685 | |||
| 1424 | Ga0496122_0012377 | |||
| 1425 | Ga0496122_0031039 | |||
| 1426 | Ga0496122_0037563 | |||
| 1427 | Ga0496122_0043473 | |||
| 1428 | Ga0496122_0188671 | |||
| 1429 | Ga0496122_0248322 | |||
| 1430 | Ga0496122_0318563 | |||
| 1431 | Ga0496123_0000034 | |||
| 1432 | Ga0496123_0000103 | |||
| 1433 | Ga0496123_0003820 | |||
| 1434 | Ga0496123_0008044 | |||
| 1435 | Ga0496123_0009653 | |||
| 1436 | Ga0496123_0045222 | |||
| 1437 | Ga0496123_0057206 | |||
| 1438 | Ga0496123_0149581 | |||
| 1439 | Ga0496124_0001469 | |||
| 1440 | Ga0496124_0005176 | |||
| 1441 | Ga0496124_0008098 | |||
| 1442 | Ga0496124_0012183 | |||
| 1443 | Ga0496124_0054620 | |||
| 1444 | Ga0496124_0076704 | |||
| 1445 | Ga0496124_0107636 | |||
| 1446 | Ga0496124_0109488 | |||
| 1447 | Ga0496124_0192816 | |||
| 1448 | Ga0496124_0246281 | |||
| 1449 | Ga0496124_0268234 | |||
| 1450 | Ga0496124_0569779 | |||
| 1451 | Ga0496125_0004365 | |||
| 1452 | Ga0496125_0009397 | |||
| 1453 | Ga0496125_0017778 | |||
| 1454 | Ga0496125_0049367 | |||
| 1455 | Ga0496125_0051911 | |||
| 1456 | Ga0496125_0127217 | |||
| 1457 | Ga0496125_0355894 | |||
| 1458 | Ga0496126_0000069 | |||
| 1459 | Ga0496126_0001336 | |||
| 1460 | Ga0496126_0006321 | |||
| 1461 | Ga0496126_0041488 | |||
| 1462 | Ga0496126_0068735 | |||
| 1463 | Ga0496126_0103341 | |||
| 1464 | Ga0496126_0214523 | |||
| 1465 | Ga0501308_024281 | |||
| 1466 | Ga0495678_037486 | |||
| 1467 | Ga0495682_0199677 | |||
| 1468 | Ga0501313_021698 | |||
| 1469 | Ga0501315_011186 | |||
| 1470 | Ga0501034_0167911 | |||
| 1471 | Ga0501034_0213083 | |||
| 1472 | Ga0501036_0149380 | |||
| 1473 | Ga0501043_0121628 | |||
| 1474 | Ga0501048_0435449 | |||
| 1475 | Ga0501073_0376747 | |||
| 1476 | Ga0501080_0313249 | |||
| 1477 | Ga0501280_003075 | |||
| 1478 | Ga0501280_006911 | |||
| 1479 | Ga0501035_0704233 | |||
| 1480 | Ga0501045_0502139 | |||
| 1481 | nmdc:mga03683_87540_c1 | |||
| 1482 | nmdc:mga03n38_33570_c1 | |||
| 1483 | nmdc:mga00v17_359109_c1 | |||
| 1484 | nmdc:mga0yw44_3000_c1 | |||
| 1485 | nmdc:mga0k408_232359_c1 | |||
| 1486 | nmdc:mga06z11_472136_c1 | |||
| 1487 | nmdc:mga07m45_140263_c1 | |||
| 1488 | nmdc:mga0sz30_167045_c1 | |||
| 1489 | nmdc:mga0sz30_8860_c1 | |||
| 1490 | Ga0495601_0078710 | |||
| 1491 | Ga0500610_0112906 | |||
| 1492 | Ga0495619_0022478 | |||
| 1493 | Ga0500578_0064509 | |||
| 1494 | Ga0500578_0073300 | |||
| 1495 | Ga0500643_141821 | |||
| 1496 | Ga0500654_055175 | |||
| 1497 | Ga0500569_007786 | |||
| 1498 | Ga0500569_008089 | |||
| 1499 | Ga0500594_0032146 | |||
| 1500 | Ga0500614_009709 | |||
| 1501 | Ga0500658_0006339 | |||
| 1502 | Ga0500658_0084466 | |||
| 1503 | Ga0500568_0002529 | |||
| 1504 | Ga0500577_0039181 | |||
| 1505 | Ga0500590_001191 | |||
| 1506 | Ga0500604_0062650 | |||
| 1507 | Ga0500616_0001190 | |||
| 1508 | Ga0500616_0001711 | |||
| 1509 | Ga0500616_0006652 | |||
| 1510 | Ga0500622_0008805 | |||
| 1511 | Ga0500627_0099460 | |||
| 1512 | Ga0501082_0104676 | |||
| 1513 | Ga0466962_0050301 | |||
| 1514 | 2509108569 | |||
| 1515 | 2509374404 | |||
| 1516 | 2509443030 | |||
| 1517 | 2510132342 | |||
| 1518 | 2510839644 | |||
| 1519 | 2510898679 | |||
| 1520 | 2511137075 | |||
| 1521 | 2511171876 | |||
| 1522 | 2511186407 | |||
| 1523 | 2511197152 | |||
| 1524 | 2511501070 | |||
| 1525 | 2512972185 | |||
| 1526 | 2513569181 | |||
| 1527 | 2513578854 | |||
| 1528 | 2513582845 | |||
| 1529 | 2513596293 | |||
| 1530 | 2513603264 | |||
| 1531 | 2513616234 | |||
| 1532 | 2513632714 | |||
| 1533 | 2513709166 | |||
| 1534 | 2513871250 | |||
| 1535 | 2513881043 | |||
| 1536 | 2513902279 | |||
| 1537 | 2513908885 | |||
| 1538 | 2513925746 | |||
| 1539 | 2513983870 | |||
| 1540 | 2514001931 | |||
| 1541 | 2514004719 | |||
| 1542 | 2515111326 | |||
| 1543 | 2515638475 | |||
| 1544 | 2515644361 | |||
| 1545 | 2515659149 | |||
| 1546 | 2515740513 | |||
| 1547 | 2516892351 | |||
| 1548 | 2517039967 | |||
| 1549 | 2517075519 | |||
| 1550 | 2517094100 | |||
| 1551 | 2517405919 | |||
| 1552 | 2517569149 | |||
| 1553 | 2520377445 | |||
| 1554 | 2524451081 | |||
| 1555 | 2524460601 | |||
| 1556 | 2530643844 | |||
| 1557 | 2535484456 | |||
| 1558 | 2535515763 | |||
| 1559 | 2551680465 | |||
| 1560 | 2551683852 | |||
| 1561 | 2551695754 | |||
| 1562 | 2551698137 | |||
| 1563 | 2551713132 | |||
| 1564 | 2551721354 | |||
| 1565 | 2551727278 | |||
| 1566 | 2551739170 | |||
| 1567 | 2551745195 | |||
| 1568 | 2558863431 | |||
| 1569 | 2561466096 | |||
| 1570 | 2585165614 | |||
| 1571 | 2585203126 | |||
| 1572 | 2585221038 | |||
| 1573 | 2585231447 | |||
| 1574 | 2585256566 | |||
| 1575 | 2585266112 | |||
| 1576 | 2585273215 | |||
| 1577 | 2585278952 | |||
| 1578 | 2585325433 | |||
| 1579 | 2585329595 | |||
| 1580 | 2585387113 | |||
| 1581 | 2585392767 | |||
| 1582 | 2585400077 | |||
| 1583 | 2585528016 | |||
| 1584 | 2585530748 | |||
| 1585 | 2585541382 | |||
| 1586 | 2585549240 | |||
| 1587 | 2585554929 | |||
| 1588 | 2585559485 | |||
| 1589 | 2585822636 | |||
| 1590 | 2585839486 | |||
| 1591 | 2585847167 | |||
| 1592 | 2585902156 | |||
| 1593 | 2585905139 | |||
| 1594 | 2585995164 | |||
| 1595 | 2585999711 | |||
| 1596 | 2587979746 | |||
| 1597 | 2599418550 | |||
| 1598 | 2599722060 | |||
| 1599 | 2600191988 | |||
| 1600 | 2600375315 | |||
| 1601 | 2616296171 | |||
| 1602 | 2616305775 | |||
| 1603 | 2616553985 | |||
| 1604 | 2617384175 | |||
| 1605 | 2643788362 | |||
| 1606 | 2643807146 | |||
| 1607 | 2643809960 | |||
| 1608 | 2644007970 | |||
| 1609 | 2644046509 | |||
| 1610 | 2644069588 | |||
| 1611 | 2644108937 | |||
| 1612 | 2644151459 | |||
| 1613 | 2644196559 | |||
| 1614 | 2644200862 | |||
| 1615 | 2644206147 | |||
| 1616 | 2644213710 | |||
| 1617 | 2644239056 | |||
| 1618 | 2644311593 | |||
| 1619 | 2644329851 | |||
| 1620 | 2644356613 | |||
| 1621 | 2644380528 | |||
| 1622 | 2644420742 | |||
| 1623 | 2644454267 | |||
| 1624 | 2644479299 | |||
| 1625 | 2644493349 | |||
| 1626 | 2644502346 | |||
| 1627 | 2644546525 | |||
| 1628 | 2644617392 | |||
| 1629 | 2644649794 | |||
| 1630 | 2644675594 | |||
| 1631 | 2644689604 | |||
| 1632 | 2657683213 | |||
| 1633 | 2671115261 | |||
| 1634 | 2719180334 | |||
| 1635 | 2719384911 | |||
| 1636 | 2719664656 | |||
| 1637 | 2719731083 | |||
| 1638 | 2720491076 | |||
| 1639 | 2720612445 | |||
| 1640 | 2720619284 | |||
| 1641 | 2721146428 | |||
| 1642 | 2721157949 | |||
| 1643 | 2721163307 | |||
| 1644 | 2721398631 | |||
| 1645 | 2722839477 | |||
| 1646 | 2723026105 | |||
| 1647 | 2723559649 | |||
| 1648 | 2724037444 | |||
| 1649 | 2724043839 | |||
| 1650 | 2724109369 | |||
| 1651 | 2725946774 | |||
| 1652 | 2730107041 | |||
| 1653 | 2730163571 | |||
| 1654 | 2730297581 | |||
| 1655 | 2738738765 | |||
| 1656 | 2738802209 | |||
| 1657 | 2738844646 | |||
| 1658 | 2739035946 | |||
| 1659 | 2739276170 | |||
| 1660 | 2739345306 | |||
| 1661 | 2753359022 | |||
| 1662 | 2758641259 | |||
| 1663 | 2766067561 | |||
| 1664 | 2776912872 | |||
| 1665 | 2778177531 | |||
| 1666 | 2792584214 | |||
| 1667 | 2793296241 | |||
| 1668 | 2793317567 | |||
| 1669 | 2793321057 | |||
| 1670 | 2793327089 | |||
| 1671 | 2793333658 | |||
| 1672 | 2793339748 | |||
| 1673 | 2793347975 | |||
| 1674 | 2793357410 | |||
| 1675 | 2793358961 | |||
| 1676 | 2793367891 | |||
| 1677 | 2802717793 | |||
| 1678 | 2802723278 | |||
| 1679 | 2802733141 | |||
| 1680 | 2802736277 | |||
| 1681 | 2802743513 | |||
| 1682 | 2802750774 | |||
| 1683 | 2804751399 | |||
| 1684 | 2805926538 | |||
| 1685 | 2805933337 | |||
| 1686 | 2806046875 | |||
| 1687 | 2806052458 | |||
| 1688 | 2806058771 | |||
| 1689 | 2806067461 | |||
| 1690 | 2806074034 | |||
| 1691 | 2819242493 | |||
| 1692 | 2819611551 | |||
| 1693 | 2819639204 | |||
| 1694 | 2838017328 | |||
| 1695 | 2838023103 | |||
| 1696 | 2838037754 | |||
| 1697 | 2838048868 | |||
| 1698 | 2838049190 | |||
| 1699 | 2838063364 | |||
| 1700 | 2838076494 | |||
| 1701 | 2838662767 | |||
| 1702 | 2838670887 | |||
| 1703 | 2838681383 | |||
| 1704 | 2838688566 | |||
| 1705 | 2838694582 | |||
| 1706 | 2838703258 | |||
| 1707 | 2838707960 | |||
| 1708 | 2838730861 | |||
| 1709 | 2838741176 | |||
| 1710 | 2838744245 | |||
| 1711 | 2841844927 | |||
| 1712 | 2841856926 | |||
| 1713 | 2842080809 | |||
| 1714 | 2842115018 | |||
| 1715 | 2842121428 | |||
| 1716 | 2842144649 | |||
| 1717 | 2842147518 | |||
| 1718 | 2842160096 | |||
| 1719 | 2842168339 | |||
| 1720 | 2842183287 | |||
| 1721 | 2842197989 | |||
| 1722 | 2842199531 | |||
| 1723 | 2842207657 | |||
| 1724 | 2842221243 | |||
| 1725 | 2842235112 | |||
| 1726 | 2842237371 | |||
| 1727 | 2842245709 | |||
| 1728 | 2842252584 | |||
| 1729 | 2842259641 | |||
| 1730 | 2842266882 | |||
| 1731 | 2842274480 | |||
| 1732 | 2842281548 | |||
| 1733 | 2842294465 | |||
| 1734 | 2842302405 | |||
| 1735 | 2842306723 | |||
| 1736 | 2842318612 | |||
| 1737 | 2842360862 | |||
| 1738 | 2842365291 | |||
| 1739 | 2842371846 | |||
| 1740 | 2842380863 | |||
| 1741 | 2842387934 | |||
| 1742 | 2842398215 | |||
| 1743 | 2842404346 | |||
| 1744 | 2842410969 | |||
| 1745 | 2842417575 | |||
| 1746 | 2842431013 | |||
| 1747 | 2842436989 | |||
| 1748 | 2842443067 | |||
| 1749 | 2842453289 | |||
| 1750 | 2842465078 | |||
| 1751 | 2842471696 | |||
| 1752 | 2842482894 | |||
| 1753 | 2842493797 | |||
| 1754 | 2842497247 | |||
| 1755 | 2842509770 | |||
| 1756 | 2842526296 | |||
| 1757 | 2844168460 | |||
| 1758 | 2844455082 | |||
| 1759 | 2850080530 | |||
| 1760 | 2852389124 | |||
| 1761 | 2854914543 | |||
| 1762 | 2855831423 | |||
| 1763 | 2855840547 | |||
| 1764 | 2857520250 | |||
| 1765 | 2858801075 | |||
| 1766 | 2891376454 | |||
| 1767 | 2896386694 | |||
| 1768 | 2913297394 | |||
| 1769 | 2915651528 | |||
| 1770 | 2915986273 | |||
| 1771 | 2915988308 | |||
| 1772 | 2915996160 | |||
| 1773 | 2916001175 | |||
| 1774 | 2916014006 | |||
| 1775 | 2916020243 | |||
| 1776 | 2916025152 | |||
| 1777 | 2916032637 | |||
| 1778 | 2916040277 | |||
| 1779 | 2916042695 | |||
| 1780 | 2916049615 | |||
| 1781 | 2916055259 | |||
| 1782 | 2916062701 | |||
| 1783 | 2916076777 | |||
| 1784 | 2919103872 | |||
| 1785 | 2919168432 | |||
| 1786 | 2919171371 | |||
| 1787 | 2919409356 | |||
| 1788 | 2920762822 | |||
| 1789 | 2920823898 | |||
| 1790 | 2921204366 | |||
| 1791 | 2921210050 | |||
| 1792 | 2921240045 | |||
| 1793 | 2921246195 | |||
| 1794 | 2921251054 | |||
| 1795 | 2921257885 | |||
| 1796 | 2921264136 | |||
| 1797 | 2921286248 | |||
| 1798 | 2921294831 | |||
| 1799 | 2921299626 | |||
| 1800 | 2923557524 | |||
| 1801 | 2924146586 | |||
| 1802 | 2924151197 | |||
| 1803 | 2924160674 | |||
| 1804 | 2924171712 | |||
| 1805 | 2924177525 | |||
| 1806 | 2924185891 | |||
| 1807 | 2924188719 | |||
| 1808 | 2924198163 | |||
| 1809 | 2924203021 | |||
| 1810 | 2924212633 | |||
| 1811 | 2924218051 | |||
| 1812 | 2924226761 | |||
| 1813 | 2924230290 | |||
| 1814 | 2933019564 | |||
| 1815 | 2933573163 | |||
| 1816 | 2933591417 | |||
| 1817 | 2935895104 | |||
| 1818 | 2935904088 | |||
| 1819 | 2936368080 | |||
| 1820 | 2936381526 | |||
| 1821 | 2936384903 | |||
| 1822 | 2937004316 | |||
| 1823 | 2937011069 | |||
| 1824 | 2937019401 | |||
| 1825 | 2937028501 | |||
| 1826 | 2937029766 | |||
| 1827 | 2937036792 | |||
| 1828 | 2937048318 | |||
| 1829 | 2937056089 | |||
| 1830 | 2937059172 | |||
| 1831 | 2937067840 | |||
| 1832 | 2937073943 | |||
| 1833 | 2937082872 | |||
| 1834 | 2937090524 | |||
| 1835 | 2937095690 | |||
| 1836 | 2937104117 | |||
| 1837 | 2937110734 | |||
| 1838 | 2937113967 | |||
| 1839 | 2937125464 | |||
| 1840 | 2937129032 | |||
| 1841 | 2939670219 | |||
| 1842 | 2941500160 | |||
| 1843 | 2957379925 | |||
| 1844 | 2957385828 | |||
| 1845 | 2957389031 | |||
| 1846 | 2957398335 | |||
| 1847 | 2957407534 | |||
| 1848 | 2957411614 | |||
| 1849 | 2957418883 | |||
| 1850 | 2957429866 | |||
| 1851 | 2957432539 | |||
| 1852 | 2957438993 | |||
| 1853 | 2957446521 | |||
| 1854 | 2957456587 | |||
| 1855 | 2957463339 | |||
| 1856 | 2957466631 | |||
| 1857 | 2957473173 | |||
| 1858 | 2957479919 | |||
| 1859 | 2957485722 | |||
| 1860 | 2957496255 | |||
| 1861 | 2957503554 | |||
| 1862 | 2957509254 | |||
| 1863 | 2960588733 | |||
| 1864 | 2960595673 | |||
| 1865 | 2960601606 | |||
| 1866 | 2960608562 | |||
| 1867 | 2960611909 | |||
| 1868 | 2960617802 | |||
| 1869 | 2960630670 | |||
| 1870 | 2960633125 | |||
| 1871 | 2960643190 | |||
| 1872 | 2960645792 | |||
| 1873 | 2960658010 | |||
| 1874 | 2960666505 | |||
| 1875 | 2960668692 | |||
| 1876 | 2960675885 | |||
| 1877 | 2960684262 | |||
| 1878 | 2960689069 | |||
| 1879 | 2960696790 | |||
| 1880 | 2964609486 | |||
| 1881 | 2964616027 | |||
| 1882 | 2964625079 | |||
| 1883 | 2964635383 | |||
| 1884 | 2964642539 | |||
| 1885 | 2964646925 | |||
| 1886 | 2964656336 | |||
| 1887 | 2964659728 | |||
| 1888 | 2964665576 | |||
| 1889 | 2964672022 | |||
| 1890 | 2964679411 | |||
| 1891 | 2964688255 | |||
| 1892 | 2964692139 | |||
| 1893 | 2964703518 | |||
| 1894 | 2964708590 | |||
| 1895 | 2964718656 | |||
| 1896 | 2964722300 | |||
| 1897 | 2967668679 | |||
| 1898 | 2967677139 | |||
| 1899 | 2967681628 | |||
| 1900 | 2967687134 | |||
| 1901 | 2967693346 | |||
| 1902 | 2967707818 | |||
| 1903 | 2967716428 | |||
| 1904 | 2967723328 | |||
| 1905 | 2967734634 | |||
| 1906 | 2967735544 | |||
| 1907 | 2967745106 | |||
| 1908 | 2967754505 | |||
| 1909 | 2967756995 | |||
| 1910 | 2967763897 | |||
| 1911 | 2967771679 | |||
| 1912 | 2967776701 | |||
| 1913 | 2970020539 | |||
| 1914 | 2970032655 | |||
| 1915 | 2970035732 | |||
| 1916 | 2970045421 | |||
| 1917 | 2970050481 | |||
| 1918 | 2970057920 | |||
| 1919 | 2970067786 | |||
| 1920 | 2970072000 | |||
| 1921 | 2970081395 | |||
| 1922 | 2970088304 | |||
| 1923 | 2970091613 | |||
| 1924 | 2970100955 | |||
| 1925 | 2970105075 | |||
| 1926 | 2970114587 | |||
| 1927 | 2970117820 | |||
| 1928 | 2970124358 | |||
| 1929 | 2970129618 | |||
| 1930 | 2970136506 | |||
| 1931 | 2970144473 | |||
| 1932 | 2970155827 | |||
| 1933 | 2970162894 | |||
| 1934 | 2970166849 | |||
| 1935 | 2970176026 | |||
| 1936 | 2970178480 | |||
| 1937 | 2970187386 | |||
| 1938 | 2970194280 | |||
| 1939 | 2977517875 | |||
| 1940 | 2977529804 | |||
| 1941 | 2977536953 | |||
| 1942 | 2977538088 | |||
| 1943 | 2977545993 | |||
| 1944 | 2977552088 | |||
| 1945 | 2977562810 | |||
| 1946 | 2977566313 | |||
| 1947 | 2977576533 | |||
| 1948 | 2977581193 | |||
| 1949 | 2978971101 | |||
| 1950 | 2984588263 | |||
| 1951 | 2989778234 | |||
| 1952 | 2996888730 | |||
| 1953 | 2996895127 | |||
| 1954 | 3003932725 | |||
| 1955 | 3005412489 | |||
| 1956 | 3005417185 | |||
| 1957 | 3005446799 | |||
| 1958 | 3005453494 | |||
| 1959 | 639647472 | |||
| 1960 | 648736465 | |||
| 1961 | 8003993047 | |||
| 1962 | 8004000283 | |||
| 1963 | 8005251267 | |||
| 1964 | 8005260002 | |||
| 1965 | 8005279631 | |||
| 1966 | 8005292832 | |||
| 1967 | 8005304638 | |||
| 1968 | 8005311136 | |||
| 1969 | 8005315246 | |||
| 1970 | 8005323257 | |||
| 1971 | 8005376567 | |||
| 1972 | 8005385956 | |||
| 1973 | 8005400261 | |||
| 1974 | 8005437121 | |||
| 1975 | 8005461970 | |||
| 1976 | 8005485583 | |||
| 1977 | 8005499378 | |||
| 1978 | 8005544397 | |||
| 1979 | 8005558887 | |||
| 1980 | 8005570476 | |||
| 1981 | 8005572733 | |||
| 1982 | 8005620568 | |||
| 1983 | 8005627469 | |||
| 1984 | 8005649893 | |||
| 1985 | 8005659930 | |||
| 1986 | 8005670794 | |||
| 1987 | 8005684522 | |||
| 1988 | 8005691063 | |||
| 1989 | 8005698738 | |||
| 1990 | 8018131374 | |||
| 1991 | 8018152505 | |||
| 1992 | 8018169469 | |||
| 1993 | 8018182550 | |||
| 1994 | 8023686907 | |||
| 1995 | 8024481146 | |||
| 1996 | 8024489714 | |||
| 1997 | 8024503212 | |||
| 1998 | 8046767722 | |||
| 1999 | 8049293972 | |||
| 2000 | 8054461947 | |||
| 2001 | 8055434237 | |||
| 2002 | 8056380771 | |||
| 2003 | 8056384706 | |||
| 2004 | 8056876538 | |||
| 2005 | 8057582152 | |||
| 2006 | 8057879915 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ds3-assembly1.cif.gz_A-2 | crystal structure of phosphoribosylglycinamide formyltransferase from brucella melitensis | 0.9899 | 5 | 190 |
| 1c2t-assembly1.cif.gz_A | new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. | 0.9805 | 7 | 203 |
| 3tqr-assembly1.cif.gz_A | structure of the phosphoribosylglycinamide formyltransferase (purn) in complex with ches from coxiella burnetii | 0.9734 | 5 | 203 |
| 1grc-assembly1.cif.gz_A | crystal structure of glycinamide ribonucleotide transformylase from escherichia coli at 3.0 angstroms resolution: a target enzyme for chemotherapy | 0.9725 | 7 | 203 |
| 3gar-assembly1.cif.gz_A-2 | a ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase | 0.968 | 7 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ds3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9899 | 5 | 190 | 3.40.50.170 |
| af_Q20143_783_975_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.977 | 5 | 192 | 3.40.50.170 |
| 1njsA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9676 | 7 | 204 | 3.40.50.170 |
| af_Q2FZI7_1_188_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9655 | 6 | 187 | 3.40.50.170 |
| 2ywrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9635 | 7 | 204 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q9AT05-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.992 | 1 | 197 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A656Z2T7-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) | 0.9865 | 24 | 174 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A849EET8-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9844 | 4 | 206 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A2A5GCI3-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9833 | 6 | 203 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A381TCJ8-F1-model_v4 | phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) | 0.9828 | 19 | 161 |
GO:0004644
GO:0005829 GO:0006189 |