F487950

General Info

Members Datasets Scaffolds Average Seq Length
1003 423 2006 161

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0280939|Ga0501079_0280939_43_657
Length 204
Sequence MSRKRRSYEAGHKPKFLVVVDDTQECDRAVYYASRRVARIGGGVVMLNVIETADRNQQWLGVADIMRAEAHEHANALLDRYSARANGVAAITPERVIREGDKVQEILTLIDEDEDIAALILAAGTGKEGPGPLVSSLGKTAGTFPIPVAIVPGHLNDEELDAMSSQPKSSSLGTTLVGACKGRAKRPHPPLRGDRLELQQRVAT

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
138 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
139 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
241 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
252 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
255 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
256 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
257 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
258 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
259 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
295 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
298 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
316 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
317 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
328 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
368 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
373 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
374 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
383 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
398 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
404 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
408 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
411 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
412 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
413 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
414 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
415 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
416 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
417 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
418 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
419 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
420 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
423 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.77
Nodule 0
Rhizoplane 8.08
Rhizosphere 81.85
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_0280939 3300049741 Bacteria 1302
2 JGI24737J22298_10158726 3300001990 Bacteria 667
3 JGI24743J22301_10000417 3300001991 Bacteria 4810
4 JGI24744J21845_10001216 3300002077 Bacteria 5049
5 JGI24742J22300_10003634 3300002244 Bacteria 2503
6 JGI24751J29686_10004423 3300002459 Bacteria 2853
7 JGI24751J29686_10086913 3300002459 Bacteria 649
8 JGI25153J46596_10002223 3300003215 Bacteria 11324
9 Ga0070658_10041525 3300005327 Bacteria 3712
10 Ga0070658_10887946 3300005327 Bacteria 775
11 Ga0070676_10010063 3300005328 Bacteria 5123
12 Ga0070676_10301903 3300005328 Bacteria 1086
13 Ga0070690_100002546 3300005330 Bacteria 9809
14 Ga0070690_100048741 3300005330 Bacteria 2698
15 Ga0070690_100095746 3300005330 Bacteria 1961
16 Ga0070690_100429011 3300005330 Bacteria 976
17 Ga0070670_100004975 3300005331 Bacteria 11179
18 Ga0070670_100286180 3300005331 Bacteria 1440
19 Ga0070677_10016774 3300005333 Bacteria 2612
20 Ga0068869_100025057 3300005334 Bacteria 4138
21 Ga0070666_10028232 3300005335 Bacteria 3681
22 Ga0070666_10533416 3300005335 Bacteria 853
23 Ga0070680_100043520 3300005336 Bacteria 3648
24 Ga0070680_100530767 3300005336 Bacteria 1008
25 Ga0070682_100591705 3300005337 Bacteria 874
26 Ga0068868_100003086 3300005338 Bacteria 11592
27 Ga0068868_101535438 3300005338 Bacteria 624
28 Ga0070660_100010850 3300005339 Bacteria 6450
29 Ga0070660_100062555 3300005339 Bacteria 2892
30 Ga0070660_100153948 3300005339 Bacteria 1850
31 Ga0070689_100017980 3300005340 Bacteria 5199
32 Ga0070689_100025050 3300005340 Bacteria 4480
33 Ga0070689_100029124 3300005340 Bacteria 4176
34 Ga0070691_10020269 3300005341 Bacteria 3072
35 Ga0070687_100005434 3300005343 Bacteria 5158
36 Ga0070687_100490944 3300005343 Bacteria 825
37 Ga0070692_10008804 3300005345 Bacteria 4517
38 Ga0070668_100044390 3300005347 Bacteria 3410
39 Ga0070668_100201514 3300005347 Bacteria 1634
40 Ga0070669_100145584 3300005353 Bacteria 1830
41 Ga0070669_101511449 3300005353 Bacteria 584
42 Ga0070675_100044786 3300005354 Bacteria 3618
43 Ga0070675_100213416 3300005354 Bacteria 1678
44 Ga0070675_100340935 3300005354 Bacteria 1327
45 Ga0070671_100003232 3300005355 Bacteria 12704
46 Ga0070671_100883638 3300005355 Bacteria 780
47 Ga0070674_100036927 3300005356 Bacteria 3283
48 Ga0070673_100117694 3300005364 Bacteria 2212
49 Ga0070673_100171641 3300005364 Bacteria 1851
50 Ga0070673_100333176 3300005364 Bacteria 1343
51 Ga0070688_100005196 3300005365 Bacteria 6837
52 Ga0070688_100064889 3300005365 Bacteria 2318
53 Ga0070688_100333915 3300005365 Bacteria 1105
54 Ga0070688_100728871 3300005365 Bacteria 770
55 Ga0070659_100202499 3300005366 Bacteria 1634
56 Ga0070667_100142278 3300005367 Bacteria 2102
57 Ga0070667_100245201 3300005367 Bacteria 1601
58 Ga0070667_100411872 3300005367 Bacteria 1231
59 Ga0070709_10458429 3300005434 Bacteria 961
60 Ga0070714_100217426 3300005435 Bacteria 1754
61 Ga0070714_100476595 3300005435 Bacteria 1188
62 Ga0070713_100021777 3300005436 Bacteria 4940
63 Ga0070713_100086865 3300005436 Bacteria 2682
64 Ga0070713_100164527 3300005436 Bacteria 1983
65 Ga0070713_100175022 3300005436 Bacteria 1925
66 Ga0070713_100225145 3300005436 Bacteria 1703
67 Ga0070713_100833955 3300005436 Bacteria 885
68 Ga0070701_10001300 3300005438 Bacteria 9184
69 Ga0070701_10078155 3300005438 Bacteria 1785
70 Ga0070711_100096146 3300005439 Bacteria 2145
71 Ga0070711_100321311 3300005439 Bacteria 1237
72 Ga0070705_100082024 3300005440 Bacteria 1983
73 Ga0070700_100011750 3300005441 Bacteria 4860
74 Ga0070700_100068378 3300005441 Bacteria 2259
75 Ga0070700_100247041 3300005441 Bacteria 1278
76 Ga0070694_100367263 3300005444 Bacteria 1119
77 Ga0070663_100770534 3300005455 Bacteria 823
78 Ga0070678_100050943 3300005456 Bacteria 2998
79 Ga0070678_100105398 3300005456 Bacteria 2194
80 Ga0070678_100262730 3300005456 Bacteria 1452
81 Ga0070678_100333328 3300005456 Bacteria 1299
82 Ga0070662_100030074 3300005457 Bacteria 3796
83 Ga0070662_100295883 3300005457 Bacteria 1314
84 Ga0070681_10016513 3300005458 Bacteria 7372
85 Ga0070681_10388395 3300005458 Bacteria 1307
86 Ga0070681_11470690 3300005458 Bacteria 606
87 Ga0070685_10011992 3300005466 Bacteria 4544
88 Ga0070685_10576048 3300005466 Bacteria 807
89 Ga0070707_100063303 3300005468 Bacteria 3550
90 Ga0070707_100811078 3300005468 Bacteria 900
91 Ga0070699_100011767 3300005518 Bacteria 7551
92 Ga0070679_100148471 3300005530 Bacteria 2322
93 Ga0070679_100170032 3300005530 Bacteria 2152
94 Ga0070679_101402831 3300005530 Bacteria 645
95 Ga0070684_100031381 3300005535 Bacteria 4523
96 Ga0070684_100092940 3300005535 Bacteria 2685
97 Ga0070697_100246002 3300005536 Bacteria 1528
98 Ga0068853_100025675 3300005539 Bacteria 4944
99 Ga0070672_100035169 3300005543 Bacteria 3807
100 Ga0070672_100338666 3300005543 Bacteria 1281
101 Ga0070686_100009403 3300005544 Bacteria 5495
102 Ga0070686_100373744 3300005544 Bacteria 1077
103 Ga0070686_100477995 3300005544 Bacteria 963
104 Ga0070686_100540931 3300005544 Bacteria 910
105 Ga0070686_100781356 3300005544 Bacteria 768
106 Ga0070696_100607154 3300005546 Bacteria 883
107 Ga0070693_100172074 3300005547 Bacteria 1388
108 Ga0070693_100527913 3300005547 Bacteria 841
109 Ga0070665_100112704 3300005548 Bacteria 2722
110 Ga0070665_100436350 3300005548 Bacteria 1319
111 Ga0070665_100521538 3300005548 Bacteria 1200
112 Ga0070704_100451580 3300005549 Bacteria 1107
113 Ga0068855_100619969 3300005563 Bacteria 1165
114 Ga0070664_100063082 3300005564 Bacteria 3159
115 Ga0070664_100362897 3300005564 Bacteria 1319
116 Ga0068857_100049760 3300005577 Bacteria 3718
117 Ga0068854_100015505 3300005578 Bacteria 5051
118 Ga0068856_100286386 3300005614 Bacteria 1664
119 Ga0070702_100002073 3300005615 Bacteria 8492
120 Ga0070702_100772536 3300005615 Bacteria 740
121 Ga0068852_100235492 3300005616 Bacteria 1747
122 Ga0068859_100063160 3300005617 Bacteria 3734
123 Ga0068859_100630003 3300005617 Bacteria 1165
124 Ga0068864_100005707 3300005618 Bacteria 10206
125 Ga0068864_100021676 3300005618 Bacteria 5381
126 Ga0068864_100246833 3300005618 Bacteria 1656
127 Ga0068866_10695613 3300005718 Bacteria 697
128 Ga0068861_100149247 3300005719 Bacteria 1916
129 Ga0068851_10135977 3300005834 Bacteria 1333
130 Ga0068870_10002924 3300005840 Bacteria 7197
131 Ga0068863_100030974 3300005841 Bacteria 5108
132 Ga0068863_100654917 3300005841 Bacteria 1042
133 Ga0068863_100722113 3300005841 Bacteria 991
134 Ga0068858_100014295 3300005842 Bacteria 7485
135 Ga0068858_100058072 3300005842 Bacteria 3577
136 Ga0068860_100085431 3300005843 Bacteria 3003
137 Ga0068862_100003247 3300005844 Bacteria 14065
138 Ga0068862_100407546 3300005844 Bacteria 1273
139 Ga0081455_10010887 3300005937 Bacteria 9179
140 Ga0081455_10031833 3300005937 Bacteria 4764
141 Ga0081455_10104767 3300005937 Bacteria 2262
142 Ga0081538_10011359 3300005981 Bacteria 7220
143 Ga0081538_10043962 3300005981 Bacteria 2795
144 Ga0081540_1002510 3300005983 Bacteria 14916
145 Ga0081540_1021893 3300005983 Bacteria 3788
146 Ga0081539_10022294 3300005985 Bacteria 4195
147 Ga0081539_10313820 3300005985 Bacteria 669
148 Ga0070717_10191672 3300006028 Bacteria 1786
149 Ga0070717_10298121 3300006028 Bacteria 1433
150 Ga0070717_11327511 3300006028 Bacteria 654
151 Ga0075365_10014447 3300006038 Bacteria 4752
152 Ga0075365_10105083 3300006038 Bacteria 1937
153 Ga0075365_10333696 3300006038 Bacteria 1068
154 Ga0075365_10695944 3300006038 Bacteria 718
155 Ga0075365_10939561 3300006038 Bacteria 609
156 Ga0075368_10092000 3300006042 Bacteria 1241
157 Ga0075368_10133979 3300006042 Bacteria 1030
158 Ga0075368_10313328 3300006042 Unclassified 679
159 Ga0075363_100048048 3300006048 Bacteria 2268
160 Ga0075363_100191866 3300006048 Bacteria 1165
161 Ga0075363_100336741 3300006048 Bacteria 879
162 Ga0075364_10132393 3300006051 Bacteria 1674
163 Ga0075364_10677683 3300006051 Unclassified 704
164 Ga0070715_10452708 3300006163 Bacteria 725
165 Ga0070716_100109237 3300006173 Bacteria 1711
166 Ga0070716_100441247 3300006173 Bacteria 946
167 Ga0070712_100137664 3300006175 Bacteria 1859
168 Ga0070712_100225175 3300006175 Bacteria 1486
169 Ga0070712_100252511 3300006175 Bacteria 1410
170 Ga0075362_10077539 3300006177 Bacteria 1527
171 Ga0075362_10085724 3300006177 Bacteria 1456
172 Ga0075362_10170248 3300006177 Bacteria 1052
173 Ga0075362_10275375 3300006177 Bacteria 831
174 Ga0075367_10109184 3300006178 Bacteria 1697
175 Ga0075367_10454275 3300006178 Bacteria 812
176 Ga0075369_10191348 3300006186 Bacteria 943
177 Ga0075369_10225136 3300006186 Bacteria 868
178 Ga0075366_10032270 3300006195 Bacteria 3083
179 Ga0075366_10132087 3300006195 Bacteria 1507
180 Ga0075366_10262849 3300006195 Bacteria 1053
181 Ga0097621_100191902 3300006237 Bacteria 1769
182 Ga0097621_100345596 3300006237 Bacteria 1322
183 Ga0097621_101323108 3300006237 Bacteria 681
184 Ga0075370_10181822 3300006353 Bacteria 1238
185 Ga0075370_10264226 3300006353 Bacteria 1021
186 Ga0075370_10384936 3300006353 Bacteria 840
187 Ga0068871_100074783 3300006358 Bacteria 2795
188 Ga0075428_100003706 3300006844 Bacteria 16735
189 Ga0075428_100016490 3300006844 Bacteria 8158
190 Ga0075428_100030184 3300006844 Bacteria 5997
191 Ga0075428_100319009 3300006844 Bacteria 1670
192 Ga0075430_100030234 3300006846 Bacteria 4599
193 Ga0075430_100202621 3300006846 Bacteria 1647
194 Ga0075430_100264296 3300006846 Bacteria 1425
195 Ga0075430_100364552 3300006846 Bacteria 1193
196 Ga0075430_100409291 3300006846 Bacteria 1119
197 Ga0075430_100551506 3300006846 Bacteria 951
198 Ga0075431_100000880 3300006847 Bacteria 26403
199 Ga0075431_100040575 3300006847 Bacteria 4798
200 Ga0075431_100116984 3300006847 Bacteria 2751
201 Ga0075431_100276265 3300006847 Bacteria 1701
202 Ga0075431_100398327 3300006847 Bacteria 1378
203 Ga0075431_100559362 3300006847 Bacteria 1131
204 Ga0075431_100577297 3300006847 Bacteria 1110
205 Ga0075431_100668877 3300006847 Bacteria 1018
206 Ga0075433_10232299 3300006852 Bacteria 1638
207 Ga0075433_11079573 3300006852 Bacteria 698
208 Ga0075434_100016910 3300006871 Bacteria 7017
209 Ga0075434_100713678 3300006871 Bacteria 1020
210 Ga0075434_100829063 3300006871 Bacteria 941
211 Ga0075429_100116239 3300006880 Bacteria 2339
212 Ga0075429_100128594 3300006880 Bacteria 2216
213 Ga0075429_100359111 3300006880 Bacteria 1276
214 Ga0068865_100031609 3300006881 Bacteria 3530
215 Ga0068865_100154346 3300006881 Bacteria 1745
216 Ga0068865_100156178 3300006881 Bacteria 1735
217 Ga0075436_100244084 3300006914 Bacteria 1278
218 Ga0075436_100710873 3300006914 Bacteria 745
219 Ga0097620_100063160 3300006931 Bacteria 3734
220 Ga0097620_100629988 3300006931 Bacteria 1165
221 Ga0075435_100230099 3300007076 Bacteria 1575
222 Ga0099795_10000656 3300007788 Bacteria 6653
223 Ga0099795_10361556 3300007788 Bacteria 651
224 Ga0105244_10205206 3300009036 Bacteria 928
225 Ga0105250_10065232 3300009092 Bacteria 1468
226 Ga0105240_10849708 3300009093 Bacteria 985
227 Ga0111539_10000367 3300009094 Bacteria 55719
228 Ga0111539_10007379 3300009094 Bacteria 14082
229 Ga0111539_10139013 3300009094 Bacteria 2844
230 Ga0111539_10509995 3300009094 Bacteria 1401
231 Ga0105245_10002059 3300009098 Bacteria 18233
232 Ga0105245_10224250 3300009098 Bacteria 1815
233 Ga0105245_10231932 3300009098 Bacteria 1786
234 Ga0105247_10004828 3300009101 Bacteria 8579
235 Ga0114129_10000825 3300009147 Bacteria 40003
236 Ga0114129_10008610 3300009147 Bacteria 14548
237 Ga0114129_10021090 3300009147 Bacteria 9252
238 Ga0114129_10061242 3300009147 Bacteria 5259
239 Ga0114129_10083698 3300009147 Bacteria 4430
240 Ga0114129_10185755 3300009147 Bacteria 2825
241 Ga0114129_10271081 3300009147 Bacteria 2271
242 Ga0114129_10857975 3300009147 Bacteria 1154
243 Ga0114129_11145518 3300009147 Bacteria 971
244 Ga0114129_11513787 3300009147 Bacteria 824
245 Ga0105243_10679836 3300009148 Bacteria 1001
246 Ga0105243_12489312 3300009148 Bacteria 557
247 Ga0105241_10039426 3300009174 Bacteria 3563
248 Ga0105242_10028812 3300009176 Bacteria 4423
249 Ga0105242_11628768 3300009176 Bacteria 680
250 Ga0105248_10017775 3300009177 Bacteria 7845
251 Ga0105248_10037889 3300009177 Bacteria 5394
252 Ga0105248_10074990 3300009177 Bacteria 3802
253 Ga0105248_10716732 3300009177 Bacteria 1129
254 Ga0105237_10398568 3300009545 Bacteria 1381
255 Ga0105238_10065513 3300009551 Bacteria 3634
256 Ga0105238_10066156 3300009551 Bacteria 3616
257 Ga0105238_10193826 3300009551 Bacteria 2008
258 Ga0105238_10562709 3300009551 Bacteria 1145
259 Ga0105249_10032153 3300009553 Bacteria 4745
260 Ga0105249_10107990 3300009553 Bacteria 2627
261 Ga0105249_10186479 3300009553 Bacteria 2021
262 Ga0105249_11568170 3300009553 Bacteria 731
263 Ga0099796_10005397 3300010159 Bacteria 3188
264 Ga0105239_10094993 3300010375 Bacteria 3293
265 Ga0105239_10315158 3300010375 Bacteria 1763
266 Ga0105239_12040541 3300010375 Bacteria 666
267 Ga0105246_10033093 3300011119 Bacteria 3433
268 Ga0105246_10354619 3300011119 Bacteria 1203
269 Ga0105246_11729971 3300011119 Bacteria 595
270 Ga0157371_10531774 3300013102 Bacteria 870
271 Ga0157374_10065462 3300013296 Bacteria 3413
272 Ga0157378_10077163 3300013297 Bacteria 3003
273 Ga0157378_10147786 3300013297 Bacteria 2187
274 Ga0157378_11085480 3300013297 Bacteria 837
275 Ga0163162_10074894 3300013306 Bacteria 3445
276 Ga0157372_10621527 3300013307 Bacteria 1259
277 Ga0157375_10064838 3300013308 Bacteria 3638
278 Ga0157375_10453727 3300013308 Bacteria 1448
279 Ga0163163_10017614 3300014325 Bacteria 6668
280 Ga0163163_10048932 3300014325 Bacteria 4159
281 Ga0163163_10053547 3300014325 Bacteria 3984
282 Ga0163163_10063537 3300014325 Bacteria 3661
283 Ga0163163_11704688 3300014325 Bacteria 691
284 Ga0157380_10105231 3300014326 Bacteria 2359
285 Ga0157380_10730635 3300014326 Bacteria 999
286 Ga0157380_11221901 3300014326 Bacteria 796
287 Ga0182008_10072353 3300014497 Bacteria 1696
288 Ga0157377_10035738 3300014745 Bacteria 2728
289 Ga0157377_10227922 3300014745 Bacteria 1196
290 Ga0157377_10265788 3300014745 Bacteria 1118
291 Ga0157379_10010974 3300014968 Bacteria 7901
292 Ga0157379_10412211 3300014968 Bacteria 1243
293 Ga0157379_11046574 3300014968 Unclassified 780
294 Ga0157379_11559263 3300014968 Bacteria 644
295 Ga0157376_10365850 3300014969 Bacteria 1384
296 Ga0157376_10472315 3300014969 Bacteria 1227
297 Ga0157376_11620261 3300014969 Bacteria 682
298 Ga0163161_10173393 3300017792 Bacteria 1650
299 Ga0213874_10047685 3300021377 Bacteria 1304
300 Ga0213876_10275543 3300021384 Bacteria 894
301 Ga0213875_10475016 3300021388 Bacteria 600
302 Ga0224571_106607 3300022734 Bacteria 776
303 Ga0224572_1020991 3300024225 Bacteria 1254
304 Ga0228598_1000576 3300024227 Bacteria 7697
305 Ga0209758_1000308 3300025297 Bacteria 94851
306 Ga0209758_1031982 3300025297 Bacteria 2146
307 Ga0207682_10060179 3300025893 Bacteria 1588
308 Ga0207692_10467714 3300025898 Bacteria 796
309 Ga0207642_10079213 3300025899 Bacteria 1590
310 Ga0207710_10267681 3300025900 Bacteria 858
311 Ga0207688_10008282 3300025901 Bacteria 5652
312 Ga0207688_10522620 3300025901 Bacteria 744
313 Ga0207680_10009093 3300025903 Bacteria 4912
314 Ga0207680_10298237 3300025903 Bacteria 1123
315 Ga0207680_10376586 3300025903 Bacteria 1000
316 Ga0207685_10090563 3300025905 Bacteria 1287
317 Ga0207685_10364692 3300025905 Bacteria 732
318 Ga0207699_10457743 3300025906 Bacteria 916
319 Ga0207645_10002945 3300025907 Bacteria 13153
320 Ga0207645_10300674 3300025907 Bacteria 1068
321 Ga0207643_10002845 3300025908 Bacteria 9348
322 Ga0207643_10271980 3300025908 Bacteria 1049
323 Ga0207705_10504237 3300025909 Bacteria 940
324 Ga0207684_10002963 3300025910 Bacteria 16822
325 Ga0207654_10036215 3300025911 Bacteria 2755
326 Ga0207707_10214247 3300025912 Bacteria 1677
327 Ga0207707_10438956 3300025912 Bacteria 1118
328 Ga0207707_10601166 3300025912 Bacteria 931
329 Ga0207671_10648018 3300025914 Bacteria 841
330 Ga0207693_10021699 3300025915 Bacteria 5104
331 Ga0207693_11036393 3300025915 Bacteria 625
332 Ga0207663_10164291 3300025916 Bacteria 1571
333 Ga0207660_10380810 3300025917 Bacteria 1134
334 Ga0207662_10008927 3300025918 Bacteria 5499
335 Ga0207662_10563075 3300025918 Bacteria 790
336 Ga0207657_10108486 3300025919 Bacteria 2295
337 Ga0207657_10115686 3300025919 Bacteria 2210
338 Ga0207649_10043035 3300025920 Bacteria 2758
339 Ga0207652_10109880 3300025921 Bacteria 2445
340 Ga0207646_10233656 3300025922 Bacteria 1661
341 Ga0207681_10150182 3300025923 Bacteria 1745
342 Ga0207681_10448728 3300025923 Bacteria 1049
343 Ga0207694_10032544 3300025924 Bacteria 3992
344 Ga0207694_10145058 3300025924 Bacteria 1910
345 Ga0207694_10179217 3300025924 Bacteria 1718
346 Ga0207650_10002572 3300025925 Bacteria 12563
347 Ga0207650_10012030 3300025925 Bacteria 5965
348 Ga0207650_10055028 3300025925 Bacteria 2952
349 Ga0207659_10018147 3300025926 Bacteria 4608
350 Ga0207659_10354961 3300025926 Bacteria 1217
351 Ga0207687_10005621 3300025927 Bacteria 8288
352 Ga0207687_10008628 3300025927 Bacteria 6663
353 Ga0207687_10723669 3300025927 Bacteria 846
354 Ga0207700_10035453 3300025928 Bacteria 3594
355 Ga0207700_10115092 3300025928 Bacteria 2171
356 Ga0207700_10158346 3300025928 Bacteria 1878
357 Ga0207664_10385528 3300025929 Bacteria 1244
358 Ga0207644_10003006 3300025931 Bacteria 10851
359 Ga0207644_10047247 3300025931 Bacteria 3070
360 Ga0207644_10123106 3300025931 Bacteria 1977
361 Ga0207644_10126378 3300025931 Bacteria 1952
362 Ga0207644_10761215 3300025931 Bacteria 809
363 Ga0207690_10051466 3300025932 Bacteria 2754
364 Ga0207706_10001336 3300025933 Bacteria 24661
365 Ga0207706_10250192 3300025933 Bacteria 1548
366 Ga0207706_10269819 3300025933 Bacteria 1485
367 Ga0207706_10333697 3300025933 Bacteria 1319
368 Ga0207686_10044726 3300025934 Bacteria 2721
369 Ga0207709_10003540 3300025935 Bacteria 9237
370 Ga0207709_10382857 3300025935 Bacteria 1071
371 Ga0207670_10002631 3300025936 Bacteria 9445
372 Ga0207670_10019968 3300025936 Bacteria 4106
373 Ga0207670_10049561 3300025936 Bacteria 2810
374 Ga0207669_10009108 3300025937 Bacteria 4708
375 Ga0207669_10618120 3300025937 Bacteria 882
376 Ga0207704_10013068 3300025938 Bacteria 4142
377 Ga0207704_10023025 3300025938 Bacteria 3350
378 Ga0207665_10135860 3300025939 Bacteria 1750
379 Ga0207665_10140119 3300025939 Bacteria 1724
380 Ga0207665_10285161 3300025939 Bacteria 1230
381 Ga0207691_10000635 3300025940 Bacteria 34764
382 Ga0207691_10149819 3300025940 Bacteria 2052
383 Ga0207711_10022721 3300025941 Bacteria 5247
384 Ga0207711_10030678 3300025941 Bacteria 4535
385 Ga0207711_10177849 3300025941 Bacteria 1933
386 Ga0207711_10230703 3300025941 Bacteria 1695
387 Ga0207689_10003641 3300025942 Bacteria 14070
388 Ga0207661_10229290 3300025944 Bacteria 1644
389 Ga0207661_10577599 3300025944 Bacteria 1031
390 Ga0207661_10605038 3300025944 Bacteria 1006
391 Ga0207661_11375057 3300025944 Bacteria 648
392 Ga0207679_10014282 3300025945 Bacteria 5216
393 Ga0207679_10237362 3300025945 Bacteria 1543
394 Ga0207679_10887112 3300025945 Bacteria 815
395 Ga0207667_10611740 3300025949 Bacteria 1098
396 Ga0207651_10013440 3300025960 Bacteria 4686
397 Ga0207651_10053292 3300025960 Bacteria 2764
398 Ga0207651_10060988 3300025960 Bacteria 2621
399 Ga0207651_10108854 3300025960 Bacteria 2075
400 Ga0207712_10141719 3300025961 Bacteria 1846
401 Ga0207668_10648152 3300025972 Bacteria 924
402 Ga0207658_10165462 3300025986 Bacteria 1816
403 Ga0207658_10356950 3300025986 Bacteria 1274
404 Ga0207677_10004734 3300026023 Bacteria 7334
405 Ga0207677_10015703 3300026023 Bacteria 4463
406 Ga0207677_10086620 3300026023 Bacteria 2265
407 Ga0207677_11877159 3300026023 Unclassified 556
408 Ga0207703_10012768 3300026035 Bacteria 6549
409 Ga0207703_10454839 3300026035 Bacteria 1196
410 Ga0207703_10835261 3300026035 Bacteria 880
411 Ga0207639_10018222 3300026041 Bacteria 4986
412 Ga0207639_11471416 3300026041 Bacteria 639
413 Ga0207678_10004902 3300026067 Bacteria 12024
414 Ga0207678_10108704 3300026067 Bacteria 2366
415 Ga0207708_10019050 3300026075 Bacteria 5168
416 Ga0207708_10202556 3300026075 Bacteria 1584
417 Ga0207708_10273170 3300026075 Bacteria 1368
418 Ga0207708_11049694 3300026075 Unclassified 709
419 Ga0207702_10065787 3300026078 Bacteria 3105
420 Ga0207641_10054416 3300026088 Bacteria 3395
421 Ga0207641_10085433 3300026088 Bacteria 2750
422 Ga0207641_10785951 3300026088 Bacteria 941
423 Ga0207648_10003105 3300026089 Bacteria 17542
424 Ga0207676_10009354 3300026095 Bacteria 6975
425 Ga0207676_10024382 3300026095 Bacteria 4475
426 Ga0207676_10607238 3300026095 Bacteria 1051
427 Ga0207674_10074975 3300026116 Bacteria 3394
428 Ga0207675_100004255 3300026118 Bacteria 13848
429 Ga0207675_100674404 3300026118 Bacteria 1041
430 Ga0207683_10007077 3300026121 Bacteria 9617
431 Ga0207683_10059191 3300026121 Bacteria 3365
432 Ga0207683_10176015 3300026121 Bacteria 1939
433 Ga0207683_10561561 3300026121 Bacteria 1055
434 Ga0207683_11368115 3300026121 Bacteria 655
435 Ga0207698_10014590 3300026142 Bacteria 5230
436 Ga0207698_10798166 3300026142 Bacteria 946
437 Ga0209179_1004144 3300027512 Bacteria 2162
438 Ga0209813_10009912 3300027866 Bacteria 2451
439 Ga0209813_10064414 3300027866 Bacteria 1178
440 Ga0207428_10009855 3300027907 Bacteria 8556
441 Ga0207428_10587255 3300027907 Bacteria 803
442 Ga0268266_10026518 3300028379 Bacteria 4930
443 Ga0268266_10153292 3300028379 Bacteria 2079
444 Ga0268266_11142407 3300028379 Bacteria 753
445 Ga0268265_10140363 3300028380 Bacteria 2022
446 Ga0268264_10005325 3300028381 Bacteria 10898
447 Ga0268264_10032334 3300028381 Bacteria 4292
448 Ga0268264_10516604 3300028381 Bacteria 1167
449 Ga0265332_10325512 3300031238 Bacteria 634
450 Ga0265320_10403907 3300031240 Bacteria 603
451 Ga0265325_10007779 3300031241 Bacteria 6383
452 Ga0265325_10011842 3300031241 Bacteria 5001
453 Ga0265329_10053174 3300031242 Bacteria 1288
454 Ga0265340_10009600 3300031247 Bacteria 5187
455 Ga0265339_10014509 3300031249 Bacteria 4746
456 Ga0265339_10016225 3300031249 Bacteria 4446
457 Ga0265339_10111402 3300031249 Bacteria 1416
458 Ga0265339_10122750 3300031249 Bacteria 1334
459 Ga0265339_10178547 3300031249 Bacteria 1059
460 Ga0265339_10339687 3300031249 Bacteria 709
461 Ga0265331_10209222 3300031250 Bacteria 878
462 Ga0265316_10159447 3300031344 Bacteria 1687
463 Ga0265316_10239493 3300031344 Bacteria 1334
464 Ga0265316_10529698 3300031344 Bacteria 840
465 Ga0307513_10038016 3300031456 Bacteria 5350
466 Ga0307513_10315876 3300031456 Bacteria 1322
467 Ga0307408_100574805 3300031548 Bacteria 998
468 Ga0307408_101039505 3300031548 Bacteria 757
469 Ga0265313_10007621 3300031595 Bacteria 7347
470 Ga0265313_10039771 3300031595 Bacteria 2331
471 Ga0265314_10008306 3300031711 Bacteria 8906
472 Ga0265342_10000092 3300031712 Bacteria 99040
473 Ga0265342_10414205 3300031712 Bacteria 695
474 Ga0307416_101382757 3300032002 Bacteria 810
475 Ga0373930_0006396 3300034816 Bacteria 1991
476 Ga0373926_0039278 3300035083 Bacteria 1687
477 Ga0373928_0179138 3300035084 Bacteria 601
478 Ga0373934_0059834 3300035086 Bacteria 1517
479 Ga0373944_0112143 3300035089 Bacteria 932
480 Ga0373944_0112335 3300035089 Bacteria 931
481 Ga0373944_0197498 3300035089 Bacteria 727
482 Ga0373923_0053586 3300035111 Bacteria 1696
483 Ga0373923_0069276 3300035111 Bacteria 1512
484 Ga0373923_0329942 3300035111 Bacteria 726
485 Ga0373932_0076589 3300035112 Bacteria 1048
486 Ga0373932_0156949 3300035112 Bacteria 785
487 Ga0373936_0045742 3300035113 Bacteria 1763
488 Ga0373936_0135400 3300035113 Bacteria 1061
489 Ga0373936_0164644 3300035113 Bacteria 967
490 Ga0373939_0170423 3300035114 Bacteria 805
491 Ga0373945_0020610 3300035116 Bacteria 2259
492 Ga0373953_0061763 3300035117 Bacteria 1533
493 Ga0373953_0141942 3300035117 Bacteria 1027
494 Ga0373954_0243607 3300035118 Bacteria 885
495 Ga0373954_0313660 3300035118 Bacteria 774
496 Ga0373956_0017882 3300035119 Bacteria 2996
497 Ga0373956_0024511 3300035119 Bacteria 2600
498 Ga0373943_0318347 3300035170 Bacteria 886
499 Ga0373946_0044254 3300035171 Bacteria 1837
500 Ga0373946_0089031 3300035171 Bacteria 1365
501 Ga0373955_0000300 3300035172 Bacteria 20457
502 Ga0373955_0032661 3300035172 Bacteria 2734
503 Ga0373955_0371582 3300035172 Bacteria 867
504 Ga0373961_0007703 3300035241 Bacteria 2609
505 Ga0373962_0078871 3300035242 Bacteria 996
506 Ga0373962_0349808 3300035242 Bacteria 534
507 Ga0373924_0087099 3300035410 Bacteria 1333
508 Ga0373931_0081073 3300035691 Bacteria 1791
509 Ga0373931_0082698 3300035691 Bacteria 1775
510 Ga0373931_0640042 3300035691 Bacteria 698
511 Ga0373931_0783670 3300035691 Bacteria 635
512 Ga0373935_0053222 3300035692 Bacteria 2575
513 Ga0373935_0197384 3300035692 Bacteria 1389
514 Ga0373935_0286702 3300035692 Bacteria 1160
515 Ga0373935_0473906 3300035692 Bacteria 906
516 Ga0373927_0026122 3300035695 Bacteria 3816
517 Ga0373927_0180690 3300035695 Bacteria 1384
518 Ga0373927_0288724 3300035695 Bacteria 1079
519 Ga0373927_0317766 3300035695 Bacteria 1025
520 Ga0373933_0000325 3300035724 Bacteria 30685
521 Ga0373933_0017319 3300035724 Bacteria 4041
522 Ga0373933_0086926 3300035724 Bacteria 1925
523 Ga0373947_0089323 3300035725 Bacteria 1919
524 Ga0373947_0134577 3300035725 Bacteria 1580
525 Ga0373947_0670027 3300035725 Bacteria 707
526 Ga0373937_0001881 3300036401 Bacteria 17641
527 Ga0373937_0054455 3300036401 Bacteria 3671
528 Ga0373937_0057722 3300036401 Bacteria 3566
529 Ga0373937_0504504 3300036401 Bacteria 1149
530 Ga0373937_0732445 3300036401 Bacteria 936
531 Ga0373925_0036787 3300037068 Bacteria 3612
532 Ga0373925_0058697 3300037068 Bacteria 2885
533 Ga0373925_0086083 3300037068 Bacteria 2397
534 Ga0373925_0131811 3300037068 Bacteria 1949
535 Ga0373925_0286499 3300037068 Bacteria 1328
536 Ga0373925_0396537 3300037068 Bacteria 1125
537 Ga0373925_0414753 3300037068 Bacteria 1100
538 Ga0436364_0751447 3300037853 Bacteria 1140
539 Ga0436365_0818573 3300039437 Bacteria 994
540 Ga0436365_0900656 3300039437 Bacteria 687
541 Ga0436360_1141745 3300039438 Bacteria 574
542 Ga0436361_0047650 3300039447 Bacteria 914
543 Ga0436363_0593372 3300039450 Bacteria 1572
544 Ga0436363_1121521 3300039450 Bacteria 664
545 Ga0436363_1439209 3300039450 Bacteria 2684
546 Ga0436363_1498361 3300039450 Bacteria 1397
547 Ga0436362_0051847 3300039453 Unclassified 786
548 Ga0439453_0007271 3300041408 Bacteria 1752
549 Ga0451800_0142143 3300041459 Bacteria 1002
550 Ga0451804_0888528 3300041463 Bacteria 1109
551 Ga0439431_0079961 3300041997 Bacteria 880
552 Ga0439440_0045892 3300042993 Bacteria 1078
553 Ga0466957_0088693 3300044842 Bacteria 1935
554 Ga0466958_0274305 3300045836 Bacteria 1080
555 Ga0495592_0017278 3300046454 Bacteria 5479
556 Ga0495592_0046620 3300046454 Bacteria 3230
557 Ga0495592_0435564 3300046454 Bacteria 824
558 Ga0495603_0023187 3300046455 Bacteria 3757
559 Ga0495603_0312499 3300046455 Bacteria 902
560 Ga0495629_0000643 3300046459 Bacteria 28259
561 Ga0495629_0063848 3300046459 Bacteria 2571
562 Ga0495629_0238468 3300046459 Bacteria 1252
563 Ga0495629_0402245 3300046459 Bacteria 930
564 Ga0495638_0036901 3300046460 Bacteria 3110
565 Ga0495641_0055732 3300046461 Bacteria 1793
566 Ga0495641_0183205 3300046461 Bacteria 937
567 Ga0495641_0184453 3300046461 Bacteria 934
568 Ga0495651_0000136 3300046462 Bacteria 54665
569 Ga0495651_0380615 3300046462 Bacteria 925
570 Ga0495653_0002531 3300046463 Bacteria 14560
571 Ga0495653_0035187 3300046463 Bacteria 3954
572 Ga0495653_0135612 3300046463 Bacteria 1737
573 Ga0495580_0521856 3300046472 Bacteria 791
574 Ga0495582_0276995 3300046473 Bacteria 963
575 Ga0495639_0105580 3300046475 Bacteria 1333
576 Ga0495639_0197550 3300046475 Bacteria 984
577 Ga0495639_0300623 3300046475 Bacteria 800
578 Ga0495662_0028353 3300046476 Bacteria 2702
579 Ga0495662_0108650 3300046476 Bacteria 1359
580 Ga0495664_0021171 3300046477 Bacteria 3756
581 Ga0495664_0055718 3300046477 Bacteria 2352
582 Ga0495664_0154115 3300046477 Bacteria 1394
583 Ga0495584_0032797 3300046491 Bacteria 2628
584 Ga0495584_0047883 3300046491 Bacteria 2156
585 Ga0495584_0058958 3300046491 Bacteria 1931
586 Ga0495584_0136999 3300046491 Bacteria 1243
587 Ga0495585_0007417 3300046492 Bacteria 6716
588 Ga0495608_0083515 3300046511 Bacteria 2073
589 Ga0495608_0097103 3300046511 Bacteria 1902
590 Ga0495616_0120331 3300046513 Bacteria 1213
591 Ga0495618_0045111 3300046514 Bacteria 2780
592 Ga0495620_0079341 3300046515 Bacteria 1330
593 Ga0495628_0030738 3300046516 Bacteria 4347
594 Ga0495628_0032827 3300046516 Bacteria 4187
595 Ga0495628_0210085 3300046516 Bacteria 1464
596 Ga0495630_0166295 3300046517 Bacteria 1679
597 Ga0495630_0342874 3300046517 Bacteria 1143
598 Ga0495631_0058992 3300046518 Bacteria 1668
599 Ga0495631_0440309 3300046518 Unclassified 555
600 Ga0495632_0065377 3300046519 Bacteria 1757
601 Ga0495637_0054757 3300046520 Bacteria 1656
602 Ga0495643_0106717 3300046522 Bacteria 1429
603 Ga0495643_0128251 3300046522 Bacteria 1276
604 Ga0495644_0046726 3300046523 Bacteria 1627
605 Ga0495644_0125698 3300046523 Bacteria 976
606 Ga0495663_0042054 3300046525 Bacteria 1392
607 Ga0495666_0018752 3300046526 Bacteria 3437
608 Ga0495666_0253932 3300046526 Bacteria 801
609 Ga0495652_0063623 3300046529 Bacteria 3105
610 Ga0495652_0266112 3300046529 Bacteria 1262
611 Ga0495665_0122774 3300046531 Bacteria 1360
612 Ga0495640_0006160 3300046533 Bacteria 9508
613 Ga0495640_0112934 3300046533 Bacteria 1773
614 Ga0495640_0200388 3300046533 Bacteria 1265
615 Ga0495586_0162477 3300046535 Bacteria 1260
616 Ga0495587_0000850 3300046536 Bacteria 20174
617 Ga0495587_0176922 3300046536 Bacteria 1211
618 Ga0495587_0180648 3300046536 Bacteria 1196
619 Ga0495598_0018521 3300046537 Bacteria 1811
620 Ga0495621_0079578 3300046539 Bacteria 1220
621 Ga0495645_0113195 3300046543 Bacteria 1918
622 Ga0495645_0736421 3300046543 Bacteria 596
623 Ga0495667_0000980 3300046559 Bacteria 18470
624 Ga0495667_0028083 3300046559 Bacteria 3788
625 Ga0495667_0163007 3300046559 Bacteria 1434
626 Ga0495667_0222230 3300046559 Bacteria 1205
627 Ga0495656_0115908 3300046615 Bacteria 1259
628 Ga0495656_0524787 3300046615 Bacteria 630
629 Ga0495668_0399410 3300046616 Bacteria 755
630 Ga0495634_0022477 3300046642 Bacteria 4443
631 Ga0495634_0062181 3300046642 Bacteria 2480
632 Ga0495634_0072123 3300046642 Bacteria 2272
633 Ga0495634_0432023 3300046642 Bacteria 779
634 Ga0495611_0178722 3300046648 Bacteria 992
635 Ga0495635_0120289 3300046663 Bacteria 1791
636 Ga0495635_0190031 3300046663 Bacteria 1394
637 Ga0495635_0194334 3300046663 Bacteria 1377
638 Ga0495659_0003942 3300046664 Bacteria 4700
639 Ga0495661_0193863 3300046665 Bacteria 1068
640 Ga0495657_0283193 3300046675 Bacteria 991
641 Ga0495657_0336952 3300046675 Bacteria 894
642 Ga0495599_0041022 3300046678 Bacteria 2906
643 Ga0495599_0042653 3300046678 Bacteria 2847
644 Ga0495599_0116400 3300046678 Bacteria 1663
645 Ga0495623_0028193 3300046679 Bacteria 3613
646 Ga0495623_0041057 3300046679 Bacteria 2952
647 Ga0495646_0003265 3300046680 Bacteria 10091
648 Ga0495646_0054032 3300046680 Bacteria 2418
649 Ga0495647_0018922 3300046681 Bacteria 2458
650 Ga0495658_0034233 3300046683 Bacteria 2786
651 Ga0495658_0513991 3300046683 Bacteria 766
652 Ga0495669_0136752 3300046684 Bacteria 1155
653 Ga0495613_0018251 3300046689 Bacteria 5231
654 Ga0495613_0065362 3300046689 Bacteria 2658
655 Ga0495613_0327531 3300046689 Bacteria 1056
656 Ga0495613_0793592 3300046689 Bacteria 618
657 Ga0495624_0190028 3300046690 Bacteria 1249
658 Ga0495624_0379501 3300046690 Bacteria 849
659 Ga0495670_0063459 3300046691 Bacteria 1860
660 Ga0495649_0216953 3300046694 Bacteria 990
661 Ga0495589_0199021 3300046794 Bacteria 946
662 Ga0495600_0005378 3300046809 Bacteria 7724
663 Ga0495600_0240579 3300046809 Bacteria 1153
664 Ga0495581_0026047 3300047315 Bacteria 3392
665 Ga0495581_0186274 3300047315 Bacteria 1214
666 Ga0495604_0000168 3300047317 Bacteria 57429
667 Ga0495604_0105756 3300047317 Bacteria 2059
668 Ga0495636_0514178 3300047318 Bacteria 580
669 Ga0495674_0027100 3300047319 Bacteria 5240
670 Ga0495674_0182518 3300047319 Bacteria 1747
671 Ga0495674_0290272 3300047319 Bacteria 1338
672 Ga0495672_0108681 3300047320 Bacteria 1492
673 Ga0495676_0023218 3300047321 Bacteria 5386
674 Ga0495676_0107680 3300047321 Bacteria 2051
675 Ga0495680_0000415 3300047322 Bacteria 47694
676 Ga0495680_0018853 3300047322 Bacteria 5846
677 Ga0495680_0165664 3300047322 Bacteria 1603
678 Ga0495680_0241003 3300047322 Bacteria 1284
679 Ga0495683_0222748 3300047323 Bacteria 840
680 Ga0495675_0039516 3300047444 Bacteria 3004
681 Ga0495677_0091275 3300047445 Bacteria 1148
682 Ga0495679_119935 3300047446 Bacteria 719
683 Ga0495684_0075093 3300047471 Bacteria 2568
684 Ga0495684_0196140 3300047471 Bacteria 1490
685 Ga0495684_0415966 3300047471 Bacteria 941
686 Ga0495686_0126255 3300047472 Bacteria 1521
687 Ga0495686_0567174 3300047472 Bacteria 591
688 Ga0495593_0045209 3300047673 Bacteria 2351
689 Ga0495593_0054889 3300047673 Bacteria 2099
690 Ga0495602_0021291 3300048088 Bacteria 6387
691 Ga0495602_0023810 3300048088 Bacteria 5956
692 Ga0495602_0159806 3300048088 Bacteria 1761
693 Ga0495614_0096103 3300048089 Bacteria 1292
694 Ga0495614_0200736 3300048089 Bacteria 902
695 Ga0495615_0086586 3300048090 Bacteria 867
696 Ga0496100_0017287 3300048903 Bacteria 4254
697 Ga0496100_0026314 3300048903 Bacteria 3566
698 Ga0496100_0060463 3300048903 Bacteria 2493
699 Ga0496100_0098865 3300048903 Bacteria 2006
700 Ga0496101_0013685 3300048904 Bacteria 5441
701 Ga0496101_0042859 3300048904 Bacteria 3231
702 Ga0496101_0110190 3300048904 Bacteria 2071
703 Ga0496101_0197808 3300048904 Bacteria 1553
704 Ga0496102_0008860 3300048905 Bacteria 8634
705 Ga0496102_0045286 3300048905 Bacteria 3994
706 Ga0496102_0086452 3300048905 Bacteria 2896
707 Ga0496103_0003062 3300048906 Bacteria 10279
708 Ga0496103_0003997 3300048906 Bacteria 8957
709 Ga0496103_0233618 3300048906 Bacteria 1183
710 Ga0496104_0004143 3300048907 Bacteria 12587
711 Ga0496104_0004953 3300048907 Bacteria 11622
712 Ga0496104_0040626 3300048907 Bacteria 4361
713 Ga0496104_0048661 3300048907 Bacteria 3996
714 Ga0496104_0558836 3300048907 Bacteria 1055
715 Ga0496104_0790224 3300048907 Bacteria 855
716 Ga0496105_0003143 3300048908 Bacteria 12154
717 Ga0496105_0010944 3300048908 Bacteria 7147
718 Ga0496105_0013524 3300048908 Bacteria 6483
719 Ga0496105_0054468 3300048908 Bacteria 3302
720 Ga0496105_0068948 3300048908 Bacteria 2922
721 Ga0496106_0005844 3300048909 Bacteria 9101
722 Ga0496106_0006633 3300048909 Bacteria 8570
723 Ga0496106_0064520 3300048909 Bacteria 2786
724 Ga0496106_0237743 3300048909 Bacteria 1455
725 Ga0496107_0000436 3300048910 Bacteria 22636
726 Ga0496107_0053541 3300048910 Bacteria 2911
727 Ga0496107_0066812 3300048910 Bacteria 2607
728 Ga0496107_0127874 3300048910 Bacteria 1874
729 Ga0496107_0132447 3300048910 Bacteria 1841
730 Ga0496107_0238571 3300048910 Bacteria 1353
731 Ga0496108_0004006 3300048911 Bacteria 11815
732 Ga0496108_0009582 3300048911 Bacteria 7848
733 Ga0496108_0047212 3300048911 Bacteria 3600
734 Ga0496108_0102660 3300048911 Bacteria 2440
735 Ga0496108_0343575 3300048911 Bacteria 1302
736 Ga0496109_0000404 3300048912 Bacteria 38842
737 Ga0496109_0030041 3300048912 Bacteria 4870
738 Ga0496109_0043419 3300048912 Bacteria 4074
739 Ga0496109_0104872 3300048912 Bacteria 2625
740 Ga0496110_0001910 3300048913 Bacteria 15419
741 Ga0496110_0064635 3300048913 Bacteria 3234
742 Ga0496110_0124244 3300048913 Bacteria 2327
743 Ga0496110_0471600 3300048913 Bacteria 1143
744 Ga0496110_0519330 3300048913 Bacteria 1083
745 Ga0496111_0002312 3300048914 Bacteria 11466
746 Ga0496111_0042841 3300048914 Bacteria 3251
747 Ga0496111_0156817 3300048914 Bacteria 1689
748 Ga0496112_0002963 3300048915 Bacteria 13850
749 Ga0496112_0003601 3300048915 Bacteria 12888
750 Ga0496112_0011928 3300048915 Bacteria 7962
751 Ga0496112_0067614 3300048915 Bacteria 3527
752 Ga0496112_0074698 3300048915 Bacteria 3352
753 Ga0496112_0077416 3300048915 Bacteria 3289
754 Ga0496112_0080731 3300048915 Bacteria 3216
755 Ga0496112_0235641 3300048915 Bacteria 1784
756 Ga0496112_0577018 3300048915 Bacteria 1057
757 Ga0496113_0001396 3300048916 Bacteria 13436
758 Ga0496113_0001735 3300048916 Bacteria 12339
759 Ga0496113_0064177 3300048916 Bacteria 2776
760 Ga0496113_0138439 3300048916 Bacteria 1914
761 Ga0496113_0194213 3300048916 Bacteria 1612
762 Ga0496114_0003326 3300048917 Bacteria 12354
763 Ga0496114_0024271 3300048917 Bacteria 4947
764 Ga0496114_0138598 3300048917 Bacteria 2104
765 Ga0496114_0154264 3300048917 Bacteria 1993
766 Ga0496114_1367490 3300048917 Unclassified 595
767 Ga0496115_0007820 3300048918 Bacteria 7881
768 Ga0496115_0008495 3300048918 Bacteria 7594
769 Ga0496115_0015671 3300048918 Bacteria 5755
770 Ga0496115_0226230 3300048918 Bacteria 1543
771 Ga0496115_0253407 3300048918 Bacteria 1448
772 Ga0496115_0292833 3300048918 Bacteria 1335
773 Ga0496115_0300267 3300048918 Bacteria 1316
774 Ga0496115_0699441 3300048918 Bacteria 797
775 Ga0496123_0000602 3300048926 Bacteria 61127
776 Ga0501032_0039642 3300049569 Bacteria 3204
777 Ga0501032_0388169 3300049569 Bacteria 897
778 Ga0501033_0274886 3300049570 Bacteria 1190
779 Ga0501034_0111543 3300049571 Bacteria 2726
780 Ga0501034_0117639 3300049571 Bacteria 2645
781 Ga0501034_0374057 3300049571 Bacteria 1350
782 Ga0501034_0571125 3300049571 Bacteria 1039
783 Ga0501036_0131842 3300049572 Bacteria 2110
784 Ga0501036_0184008 3300049572 Bacteria 1758
785 Ga0501036_0918323 3300049572 Bacteria 718
786 Ga0501036_1204680 3300049572 Bacteria 617
787 Ga0501037_0012047 3300049573 Bacteria 6367
788 Ga0501037_0424688 3300049573 Bacteria 909
789 Ga0501037_0564050 3300049573 Bacteria 767
790 Ga0501038_0032871 3300049574 Bacteria 4572
791 Ga0501038_0069297 3300049574 Bacteria 2996
792 Ga0501038_0074477 3300049574 Bacteria 2872
793 Ga0501038_0249762 3300049574 Bacteria 1406
794 Ga0501038_0496119 3300049574 Bacteria 934
795 Ga0501039_0036634 3300049575 Bacteria 3786
796 Ga0501039_0146106 3300049575 Bacteria 1858
797 Ga0501039_0568675 3300049575 Bacteria 889
798 Ga0501040_0077799 3300049576 Bacteria 2295
799 Ga0501041_0090089 3300049577 Bacteria 1894
800 Ga0501042_0061954 3300049578 Bacteria 2672
801 Ga0501043_0030110 3300049579 Bacteria 4263
802 Ga0501043_0030669 3300049579 Bacteria 4227
803 Ga0501043_0133329 3300049579 Bacteria 1947
804 Ga0501043_0144701 3300049579 Bacteria 1861
805 Ga0501046_0331577 3300049580 Bacteria 1107
806 Ga0501046_0344313 3300049580 Unclassified 1083
807 Ga0501046_0390274 3300049580 Bacteria 1006
808 Ga0501046_0497818 3300049580 Bacteria 873
809 Ga0501047_0026716 3300049581 Bacteria 5556
810 Ga0501047_0066714 3300049581 Bacteria 3469
811 Ga0501047_0077629 3300049581 Bacteria 3194
812 Ga0501047_0165309 3300049581 Bacteria 2083
813 Ga0501047_0453921 3300049581 Bacteria 1111
814 Ga0501048_0017649 3300049582 Bacteria 5253
815 Ga0501048_0152298 3300049582 Bacteria 1636
816 Ga0501048_0215102 3300049582 Bacteria 1363
817 Ga0501048_1302422 3300049582 Bacteria 522
818 Ga0501067_0069177 3300049583 Bacteria 1955
819 Ga0501068_0111266 3300049584 Bacteria 1703
820 Ga0501068_0361346 3300049584 Bacteria 934
821 Ga0501068_0503331 3300049584 Bacteria 786
822 Ga0501069_0129933 3300049585 Bacteria 1442
823 Ga0501070_0019024 3300049586 Bacteria 5760
824 Ga0501070_0067586 3300049586 Bacteria 2960
825 Ga0501070_0378486 3300049586 Bacteria 1147
826 Ga0501070_0388765 3300049586 Bacteria 1129
827 Ga0501071_0175620 3300049587 Bacteria 1605
828 Ga0501071_0437046 3300049587 Bacteria 1001
829 Ga0501071_0652042 3300049587 Bacteria 810
830 Ga0501071_0661011 3300049587 Bacteria 804
831 Ga0501072_0022194 3300049588 Bacteria 4924
832 Ga0501072_0183171 3300049588 Bacteria 1671
833 Ga0501072_0706570 3300049588 Bacteria 792
834 Ga0501072_0796381 3300049588 Bacteria 740
835 Ga0501073_0032267 3300049589 Bacteria 3734
836 Ga0501073_0149049 3300049589 Bacteria 1621
837 Ga0501073_0336610 3300049589 Bacteria 1042
838 Ga0501073_0347621 3300049589 Unclassified 1024
839 Ga0501073_0411602 3300049589 Bacteria 934
840 Ga0501074_0145084 3300049590 Bacteria 1697
841 Ga0501075_0128645 3300049591 Bacteria 1929
842 Ga0501075_0300405 3300049591 Bacteria 1223
843 Ga0501076_0021225 3300049592 Bacteria 4980
844 Ga0501076_0222426 3300049592 Bacteria 1543
845 Ga0501076_0223872 3300049592 Bacteria 1537
846 Ga0501076_0318693 3300049592 Bacteria 1275
847 Ga0501076_0502574 3300049592 Bacteria 999
848 Ga0501076_0697991 3300049592 Bacteria 838
849 Ga0501076_0714320 3300049592 Bacteria 827
850 Ga0501077_0057010 3300049593 Bacteria 2481
851 Ga0501077_0260059 3300049593 Bacteria 1104
852 Ga0501079_0147529 3300049741 Bacteria 1834
853 Ga0501079_0330679 3300049741 Bacteria 1193
854 Ga0501079_0581030 3300049741 Bacteria 881
855 Ga0501079_0679945 3300049741 Bacteria 810
856 Ga0501080_0388031 3300049742 Bacteria 1257
857 Ga0501080_0425926 3300049742 Bacteria 1192
858 Ga0501080_0440137 3300049742 Bacteria 1169
859 Ga0501081_0551341 3300049743 Bacteria 861
860 Ga0501081_0796040 3300049743 Bacteria 711
861 Ga0501083_0006385 3300049744 Bacteria 8356
862 Ga0501083_0148601 3300049744 Bacteria 1534
863 Ga0501083_0429209 3300049744 Bacteria 860
864 Ga0501083_0492892 3300049744 Bacteria 797
865 Ga0501035_0288216 3300049822 Bacteria 1386
866 Ga0501035_0423499 3300049822 Bacteria 1105
867 Ga0501035_0467272 3300049822 Bacteria 1042
868 Ga0501035_0719035 3300049822 Bacteria 804
869 Ga0501035_0728555 3300049822 Bacteria 797
870 Ga0501044_0006144 3300049823 Bacteria 13263
871 Ga0501044_0065573 3300049823 Bacteria 3703
872 Ga0501044_0069168 3300049823 Bacteria 3595
873 Ga0501044_0138733 3300049823 Bacteria 2421
874 Ga0501044_0931449 3300049823 Bacteria 742
875 Ga0501044_1365407 3300049823 Bacteria 574
876 Ga0501045_0155707 3300049824 Bacteria 1700
877 Ga0501045_0325397 3300049824 Bacteria 1144
878 Ga0501045_0526623 3300049824 Bacteria 877
879 nmdc:mga03683_302134_c1 3300050489 Bacteria 751
880 nmdc:mga03683_88745_c1 3300050489 Bacteria 1345
881 nmdc:mga03n38_236513_c1 3300050490 Bacteria 960
882 nmdc:mga03n38_396203_c1 3300050490 Bacteria 759
883 nmdc:mga00v17_108438_c1 3300050491 Bacteria 1760
884 nmdc:mga00v17_776126_c1 3300050491 Unclassified 611
885 nmdc:mga0yw44_1005730_c1 3300050492 Bacteria 564
886 nmdc:mga0yw44_1188084_c1 3300050492 Bacteria 515
887 nmdc:mga0yw44_147812_c1 3300050492 Bacteria 1531
888 nmdc:mga0yw44_218301_c1 3300050492 Bacteria 1263
889 nmdc:mga0yw44_295547_c1 3300050492 Bacteria 1084
890 nmdc:mga0yw44_555323_c1 3300050492 Bacteria 780
891 nmdc:mga0yw44_740153_c1 3300050492 Bacteria 668
892 nmdc:mga0yw44_813230_c1 3300050492 Bacteria 635
893 nmdc:mga0yw44_82376_c1 3300050492 Bacteria 2019
894 nmdc:mga0yw44_9426_c1 3300050492 Bacteria 4936
895 nmdc:mga0k408_134803_c1 3300050493 Bacteria 1467
896 nmdc:mga0k408_195488_c1 3300050493 Bacteria 1207
897 nmdc:mga0k408_239747_c1 3300050493 Bacteria 1083
898 nmdc:mga0k408_597089_c1 3300050493 Bacteria 651
899 nmdc:mga0k408_81583_c1 3300050493 Bacteria 1894
900 nmdc:mga0k408_8198_c1 3300050493 Bacteria 5600
901 nmdc:mga06z11_222637_c1 3300050494 Bacteria 1103
902 nmdc:mga06z11_25302_c1 3300050494 Bacteria 2811
903 nmdc:mga06z11_34867_c1 3300050494 Bacteria 2473
904 nmdc:mga06z11_492873_c1 3300050494 Bacteria 742
905 nmdc:mga04h51_40890_c1 3300050495 Bacteria 1513
906 nmdc:mga04h51_44794_c1 3300050495 Bacteria 1461
907 nmdc:mga07m45_226685_c1 3300050496 Bacteria 1087
908 nmdc:mga07m45_39237_c1 3300050496 Bacteria 2646
909 nmdc:mga07m45_600710_c1 3300050496 Bacteria 635
910 nmdc:mga07m45_843056_c1 3300050496 Bacteria 525
911 nmdc:mga07m45_93868_c1 3300050496 Bacteria 1720
912 nmdc:mga05p37_1224670_c1 3300050507 Bacteria 773
913 nmdc:mga05p37_14184_c1 3300050507 Bacteria 9566
914 nmdc:mga05p37_14557_c1 3300050507 Bacteria 9445
915 nmdc:mga05p37_31120_c1 3300050507 Bacteria 6517
916 nmdc:mga05p37_540_c1 3300050507 Bacteria 41709
917 nmdc:mga05p37_8519_c1 3300050507 Bacteria 12120
918 nmdc:mga09592_218984_c1 3300050508 Bacteria 1649
919 nmdc:mga09592_321720_c1 3300050508 Bacteria 1340
920 nmdc:mga09592_660276_c1 3300050508 Bacteria 892
921 nmdc:mga0qj67_49229_c1 3300050509 Bacteria 3331
922 nmdc:mga0qj67_53833_c1 3300050509 Bacteria 3186
923 nmdc:mga0qj67_63072_c2 3300050509 Bacteria 2528
924 nmdc:mga0qj67_9371_c1 3300050509 Bacteria 7283
925 nmdc:mga06r32_100936_c1 3300050510 Bacteria 2831
926 nmdc:mga06r32_3089_c1 3300050510 Bacteria 14903
927 nmdc:mga06r32_355072_c1 3300050510 Bacteria 1450
928 nmdc:mga06r32_40585_c1 3300050510 Bacteria 4419
929 nmdc:mga06r32_86655_c1 3300050510 Bacteria 3054
930 nmdc:mga06r32_99217_c1 3300050510 Bacteria 2856
931 nmdc:mga08y16_3123_c1 3300050511 Bacteria 17148
932 nmdc:mga08y16_386604_c1 3300050511 Bacteria 1434
933 nmdc:mga08y16_518513_c1 3300050511 Bacteria 1209
934 nmdc:mga08y16_85413_c1 3300050511 Bacteria 3289
935 nmdc:mga0n895_1161654_c1 3300050512 Bacteria 747
936 nmdc:mga0n895_1223442_c1 3300050512 Bacteria 724
937 nmdc:mga0n895_1421242_c1 3300050512 Bacteria 662
938 nmdc:mga0n895_35380_c1 3300050512 Bacteria 4815
939 nmdc:mga0rr50_270967_c1 3300050513 Bacteria 1415
940 nmdc:mga0rr50_464120_c1 3300050513 Bacteria 1074
941 nmdc:mga08x19_1004614_c1 3300050514 Bacteria 592
942 nmdc:mga08x19_889705_c1 3300050514 Bacteria 632
943 nmdc:mga0a205_45421_c1 3300050515 Bacteria 4235
944 nmdc:mga0a205_524145_c1 3300050515 Bacteria 1041
945 nmdc:mga0sz30_108885_c1 3300050516 Bacteria 1213
946 nmdc:mga0sz30_137859_c1 3300050516 Bacteria 1077
947 nmdc:mga0sz30_178072_c1 3300050516 Bacteria 943
948 Ga0495601_0033259 3300053077 Bacteria 3212
949 Ga0495601_0295407 3300053077 Bacteria 1056
950 Ga0495601_0298600 3300053077 Bacteria 1049
951 Ga0495601_0594377 3300053077 Bacteria 710
952 Ga0495612_0038327 3300053078 Bacteria 1947
953 Ga0495612_0042574 3300053078 Bacteria 1854
954 Ga0500610_0251235 3300053079 Bacteria 815
955 Ga0495655_0040007 3300053083 Bacteria 1191
956 Ga0495655_0045064 3300053083 Bacteria 1144
957 Ga0495655_0196588 3300053083 Bacteria 657
958 Ga0495595_0000353 3300053084 Bacteria 17423
959 Ga0495595_0084256 3300053084 Bacteria 1518
960 Ga0495595_0121103 3300053084 Bacteria 1275
961 Ga0495595_0177974 3300053084 Bacteria 1054
962 Ga0495619_0000354 3300053085 Bacteria 32055
963 Ga0495619_0055466 3300053085 Bacteria 2624
964 Ga0495619_0076036 3300053085 Bacteria 2254
965 Ga0495619_0310631 3300053085 Bacteria 1092
966 Ga0495619_0502809 3300053085 Bacteria 833
967 Ga0495619_0576067 3300053085 Bacteria 771
968 Ga0495619_0631490 3300053085 Bacteria 731
969 Ga0495619_0664024 3300053085 Bacteria 710
970 Ga0500646_0041092 3300053090 Bacteria 1302
971 Ga0500566_0300999 3300053094 Bacteria 755
972 Ga0500641_0033230 3300053096 Bacteria 2046
973 Ga0500641_0176778 3300053096 Bacteria 917
974 Ga0500562_088560 3300053108 Bacteria 840
975 Ga0500562_122455 3300053108 Bacteria 709
976 Ga0500593_163370 3300053117 Bacteria 848
977 Ga0500595_067715 3300053119 Bacteria 1064
978 Ga0500658_0059527 3300053134 Bacteria 1585
979 Ga0500658_0071891 3300053134 Bacteria 1462
980 Ga0500568_0041166 3300053139 Bacteria 1858
981 Ga0500568_0143034 3300053139 Bacteria 886
982 Ga0500577_0068256 3300053142 Bacteria 1388
983 Ga0500577_0096823 3300053142 Bacteria 1201
984 Ga0500588_0019816 3300053146 Bacteria 1795
985 Ga0500604_0095176 3300053151 Bacteria 977
986 Ga0500616_0121218 3300053153 Bacteria 1249
987 Ga0500645_135410 3300053730 Unclassified 683
988 Ga0500609_043346 3300053731 Bacteria 623
989 Ga0501084_0077618 3300054114 Bacteria 2784
990 Ga0501084_0153148 3300054114 Bacteria 1944
991 Ga0501084_0404981 3300054114 Bacteria 1153
992 Ga0501084_0458161 3300054114 Bacteria 1078
993 Ga0501082_0000145 3300060353 Bacteria 58967
994 Ga0501082_0018450 3300060353 Bacteria 6010
995 Ga0501082_0050933 3300060353 Bacteria 3570
996 Ga0501082_0211622 3300060353 Bacteria 1687
997 Ga0501082_0297293 3300060353 Bacteria 1406
998 Ga0501082_0603482 3300060353 Bacteria 960
999 Ga0530510_0012433 3300061734 Bacteria 5981
1000 Ga0530510_0013033 3300061734 Bacteria 5848
1001 Ga0530510_0082797 3300061734 Bacteria 2336
1002 Ga0530510_0469686 3300061734 Bacteria 952
1003 Ga0530510_0479835 3300061734 Bacteria 942
1004 Ga0501079_0280939
1005 JGI24737J22298_10158726
1006 JGI24743J22301_10000417
1007 JGI24744J21845_10001216
1008 JGI24742J22300_10003634
1009 JGI24751J29686_10004423
1010 JGI24751J29686_10086913
1011 JGI25153J46596_10002223
1012 Ga0070658_10041525
1013 Ga0070658_10887946
1014 Ga0070676_10010063
1015 Ga0070676_10301903
1016 Ga0070690_100002546
1017 Ga0070690_100048741
1018 Ga0070690_100095746
1019 Ga0070690_100429011
1020 Ga0070670_100004975
1021 Ga0070670_100286180
1022 Ga0070677_10016774
1023 Ga0068869_100025057
1024 Ga0070666_10028232
1025 Ga0070666_10533416
1026 Ga0070680_100043520
1027 Ga0070680_100530767
1028 Ga0070682_100591705
1029 Ga0068868_100003086
1030 Ga0068868_101535438
1031 Ga0070660_100010850
1032 Ga0070660_100062555
1033 Ga0070660_100153948
1034 Ga0070689_100017980
1035 Ga0070689_100025050
1036 Ga0070689_100029124
1037 Ga0070691_10020269
1038 Ga0070687_100005434
1039 Ga0070687_100490944
1040 Ga0070692_10008804
1041 Ga0070668_100044390
1042 Ga0070668_100201514
1043 Ga0070669_100145584
1044 Ga0070669_101511449
1045 Ga0070675_100044786
1046 Ga0070675_100213416
1047 Ga0070675_100340935
1048 Ga0070671_100003232
1049 Ga0070671_100883638
1050 Ga0070674_100036927
1051 Ga0070673_100117694
1052 Ga0070673_100171641
1053 Ga0070673_100333176
1054 Ga0070688_100005196
1055 Ga0070688_100064889
1056 Ga0070688_100333915
1057 Ga0070688_100728871
1058 Ga0070659_100202499
1059 Ga0070667_100142278
1060 Ga0070667_100245201
1061 Ga0070667_100411872
1062 Ga0070709_10458429
1063 Ga0070714_100217426
1064 Ga0070714_100476595
1065 Ga0070713_100021777
1066 Ga0070713_100086865
1067 Ga0070713_100164527
1068 Ga0070713_100175022
1069 Ga0070713_100225145
1070 Ga0070713_100833955
1071 Ga0070701_10001300
1072 Ga0070701_10078155
1073 Ga0070711_100096146
1074 Ga0070711_100321311
1075 Ga0070705_100082024
1076 Ga0070700_100011750
1077 Ga0070700_100068378
1078 Ga0070700_100247041
1079 Ga0070694_100367263
1080 Ga0070663_100770534
1081 Ga0070678_100050943
1082 Ga0070678_100105398
1083 Ga0070678_100262730
1084 Ga0070678_100333328
1085 Ga0070662_100030074
1086 Ga0070662_100295883
1087 Ga0070681_10016513
1088 Ga0070681_10388395
1089 Ga0070681_11470690
1090 Ga0070685_10011992
1091 Ga0070685_10576048
1092 Ga0070707_100063303
1093 Ga0070707_100811078
1094 Ga0070699_100011767
1095 Ga0070679_100148471
1096 Ga0070679_100170032
1097 Ga0070679_101402831
1098 Ga0070684_100031381
1099 Ga0070684_100092940
1100 Ga0070697_100246002
1101 Ga0068853_100025675
1102 Ga0070672_100035169
1103 Ga0070672_100338666
1104 Ga0070686_100009403
1105 Ga0070686_100373744
1106 Ga0070686_100477995
1107 Ga0070686_100540931
1108 Ga0070686_100781356
1109 Ga0070696_100607154
1110 Ga0070693_100172074
1111 Ga0070693_100527913
1112 Ga0070665_100112704
1113 Ga0070665_100436350
1114 Ga0070665_100521538
1115 Ga0070704_100451580
1116 Ga0068855_100619969
1117 Ga0070664_100063082
1118 Ga0070664_100362897
1119 Ga0068857_100049760
1120 Ga0068854_100015505
1121 Ga0068856_100286386
1122 Ga0070702_100002073
1123 Ga0070702_100772536
1124 Ga0068852_100235492
1125 Ga0068859_100063160
1126 Ga0068859_100630003
1127 Ga0068864_100005707
1128 Ga0068864_100021676
1129 Ga0068864_100246833
1130 Ga0068866_10695613
1131 Ga0068861_100149247
1132 Ga0068851_10135977
1133 Ga0068870_10002924
1134 Ga0068863_100030974
1135 Ga0068863_100654917
1136 Ga0068863_100722113
1137 Ga0068858_100014295
1138 Ga0068858_100058072
1139 Ga0068860_100085431
1140 Ga0068862_100003247
1141 Ga0068862_100407546
1142 Ga0081455_10010887
1143 Ga0081455_10031833
1144 Ga0081455_10104767
1145 Ga0081538_10011359
1146 Ga0081538_10043962
1147 Ga0081540_1002510
1148 Ga0081540_1021893
1149 Ga0081539_10022294
1150 Ga0081539_10313820
1151 Ga0070717_10191672
1152 Ga0070717_10298121
1153 Ga0070717_11327511
1154 Ga0075365_10014447
1155 Ga0075365_10105083
1156 Ga0075365_10333696
1157 Ga0075365_10695944
1158 Ga0075365_10939561
1159 Ga0075368_10092000
1160 Ga0075368_10133979
1161 Ga0075368_10313328
1162 Ga0075363_100048048
1163 Ga0075363_100191866
1164 Ga0075363_100336741
1165 Ga0075364_10132393
1166 Ga0075364_10677683
1167 Ga0070715_10452708
1168 Ga0070716_100109237
1169 Ga0070716_100441247
1170 Ga0070712_100137664
1171 Ga0070712_100225175
1172 Ga0070712_100252511
1173 Ga0075362_10077539
1174 Ga0075362_10085724
1175 Ga0075362_10170248
1176 Ga0075362_10275375
1177 Ga0075367_10109184
1178 Ga0075367_10454275
1179 Ga0075369_10191348
1180 Ga0075369_10225136
1181 Ga0075366_10032270
1182 Ga0075366_10132087
1183 Ga0075366_10262849
1184 Ga0097621_100191902
1185 Ga0097621_100345596
1186 Ga0097621_101323108
1187 Ga0075370_10181822
1188 Ga0075370_10264226
1189 Ga0075370_10384936
1190 Ga0068871_100074783
1191 Ga0075428_100003706
1192 Ga0075428_100016490
1193 Ga0075428_100030184
1194 Ga0075428_100319009
1195 Ga0075430_100030234
1196 Ga0075430_100202621
1197 Ga0075430_100264296
1198 Ga0075430_100364552
1199 Ga0075430_100409291
1200 Ga0075430_100551506
1201 Ga0075431_100000880
1202 Ga0075431_100040575
1203 Ga0075431_100116984
1204 Ga0075431_100276265
1205 Ga0075431_100398327
1206 Ga0075431_100559362
1207 Ga0075431_100577297
1208 Ga0075431_100668877
1209 Ga0075433_10232299
1210 Ga0075433_11079573
1211 Ga0075434_100016910
1212 Ga0075434_100713678
1213 Ga0075434_100829063
1214 Ga0075429_100116239
1215 Ga0075429_100128594
1216 Ga0075429_100359111
1217 Ga0068865_100031609
1218 Ga0068865_100154346
1219 Ga0068865_100156178
1220 Ga0075436_100244084
1221 Ga0075436_100710873
1222 Ga0097620_100063160
1223 Ga0097620_100629988
1224 Ga0075435_100230099
1225 Ga0099795_10000656
1226 Ga0099795_10361556
1227 Ga0105244_10205206
1228 Ga0105250_10065232
1229 Ga0105240_10849708
1230 Ga0111539_10000367
1231 Ga0111539_10007379
1232 Ga0111539_10139013
1233 Ga0111539_10509995
1234 Ga0105245_10002059
1235 Ga0105245_10224250
1236 Ga0105245_10231932
1237 Ga0105247_10004828
1238 Ga0114129_10000825
1239 Ga0114129_10008610
1240 Ga0114129_10021090
1241 Ga0114129_10061242
1242 Ga0114129_10083698
1243 Ga0114129_10185755
1244 Ga0114129_10271081
1245 Ga0114129_10857975
1246 Ga0114129_11145518
1247 Ga0114129_11513787
1248 Ga0105243_10679836
1249 Ga0105243_12489312
1250 Ga0105241_10039426
1251 Ga0105242_10028812
1252 Ga0105242_11628768
1253 Ga0105248_10017775
1254 Ga0105248_10037889
1255 Ga0105248_10074990
1256 Ga0105248_10716732
1257 Ga0105237_10398568
1258 Ga0105238_10065513
1259 Ga0105238_10066156
1260 Ga0105238_10193826
1261 Ga0105238_10562709
1262 Ga0105249_10032153
1263 Ga0105249_10107990
1264 Ga0105249_10186479
1265 Ga0105249_11568170
1266 Ga0099796_10005397
1267 Ga0105239_10094993
1268 Ga0105239_10315158
1269 Ga0105239_12040541
1270 Ga0105246_10033093
1271 Ga0105246_10354619
1272 Ga0105246_11729971
1273 Ga0157371_10531774
1274 Ga0157374_10065462
1275 Ga0157378_10077163
1276 Ga0157378_10147786
1277 Ga0157378_11085480
1278 Ga0163162_10074894
1279 Ga0157372_10621527
1280 Ga0157375_10064838
1281 Ga0157375_10453727
1282 Ga0163163_10017614
1283 Ga0163163_10048932
1284 Ga0163163_10053547
1285 Ga0163163_10063537
1286 Ga0163163_11704688
1287 Ga0157380_10105231
1288 Ga0157380_10730635
1289 Ga0157380_11221901
1290 Ga0182008_10072353
1291 Ga0157377_10035738
1292 Ga0157377_10227922
1293 Ga0157377_10265788
1294 Ga0157379_10010974
1295 Ga0157379_10412211
1296 Ga0157379_11046574
1297 Ga0157379_11559263
1298 Ga0157376_10365850
1299 Ga0157376_10472315
1300 Ga0157376_11620261
1301 Ga0163161_10173393
1302 Ga0213874_10047685
1303 Ga0213876_10275543
1304 Ga0213875_10475016
1305 Ga0224571_106607
1306 Ga0224572_1020991
1307 Ga0228598_1000576
1308 Ga0209758_1000308
1309 Ga0209758_1031982
1310 Ga0207682_10060179
1311 Ga0207692_10467714
1312 Ga0207642_10079213
1313 Ga0207710_10267681
1314 Ga0207688_10008282
1315 Ga0207688_10522620
1316 Ga0207680_10009093
1317 Ga0207680_10298237
1318 Ga0207680_10376586
1319 Ga0207685_10090563
1320 Ga0207685_10364692
1321 Ga0207699_10457743
1322 Ga0207645_10002945
1323 Ga0207645_10300674
1324 Ga0207643_10002845
1325 Ga0207643_10271980
1326 Ga0207705_10504237
1327 Ga0207684_10002963
1328 Ga0207654_10036215
1329 Ga0207707_10214247
1330 Ga0207707_10438956
1331 Ga0207707_10601166
1332 Ga0207671_10648018
1333 Ga0207693_10021699
1334 Ga0207693_11036393
1335 Ga0207663_10164291
1336 Ga0207660_10380810
1337 Ga0207662_10008927
1338 Ga0207662_10563075
1339 Ga0207657_10108486
1340 Ga0207657_10115686
1341 Ga0207649_10043035
1342 Ga0207652_10109880
1343 Ga0207646_10233656
1344 Ga0207681_10150182
1345 Ga0207681_10448728
1346 Ga0207694_10032544
1347 Ga0207694_10145058
1348 Ga0207694_10179217
1349 Ga0207650_10002572
1350 Ga0207650_10012030
1351 Ga0207650_10055028
1352 Ga0207659_10018147
1353 Ga0207659_10354961
1354 Ga0207687_10005621
1355 Ga0207687_10008628
1356 Ga0207687_10723669
1357 Ga0207700_10035453
1358 Ga0207700_10115092
1359 Ga0207700_10158346
1360 Ga0207664_10385528
1361 Ga0207644_10003006
1362 Ga0207644_10047247
1363 Ga0207644_10123106
1364 Ga0207644_10126378
1365 Ga0207644_10761215
1366 Ga0207690_10051466
1367 Ga0207706_10001336
1368 Ga0207706_10250192
1369 Ga0207706_10269819
1370 Ga0207706_10333697
1371 Ga0207686_10044726
1372 Ga0207709_10003540
1373 Ga0207709_10382857
1374 Ga0207670_10002631
1375 Ga0207670_10019968
1376 Ga0207670_10049561
1377 Ga0207669_10009108
1378 Ga0207669_10618120
1379 Ga0207704_10013068
1380 Ga0207704_10023025
1381 Ga0207665_10135860
1382 Ga0207665_10140119
1383 Ga0207665_10285161
1384 Ga0207691_10000635
1385 Ga0207691_10149819
1386 Ga0207711_10022721
1387 Ga0207711_10030678
1388 Ga0207711_10177849
1389 Ga0207711_10230703
1390 Ga0207689_10003641
1391 Ga0207661_10229290
1392 Ga0207661_10577599
1393 Ga0207661_10605038
1394 Ga0207661_11375057
1395 Ga0207679_10014282
1396 Ga0207679_10237362
1397 Ga0207679_10887112
1398 Ga0207667_10611740
1399 Ga0207651_10013440
1400 Ga0207651_10053292
1401 Ga0207651_10060988
1402 Ga0207651_10108854
1403 Ga0207712_10141719
1404 Ga0207668_10648152
1405 Ga0207658_10165462
1406 Ga0207658_10356950
1407 Ga0207677_10004734
1408 Ga0207677_10015703
1409 Ga0207677_10086620
1410 Ga0207677_11877159
1411 Ga0207703_10012768
1412 Ga0207703_10454839
1413 Ga0207703_10835261
1414 Ga0207639_10018222
1415 Ga0207639_11471416
1416 Ga0207678_10004902
1417 Ga0207678_10108704
1418 Ga0207708_10019050
1419 Ga0207708_10202556
1420 Ga0207708_10273170
1421 Ga0207708_11049694
1422 Ga0207702_10065787
1423 Ga0207641_10054416
1424 Ga0207641_10085433
1425 Ga0207641_10785951
1426 Ga0207648_10003105
1427 Ga0207676_10009354
1428 Ga0207676_10024382
1429 Ga0207676_10607238
1430 Ga0207674_10074975
1431 Ga0207675_100004255
1432 Ga0207675_100674404
1433 Ga0207683_10007077
1434 Ga0207683_10059191
1435 Ga0207683_10176015
1436 Ga0207683_10561561
1437 Ga0207683_11368115
1438 Ga0207698_10014590
1439 Ga0207698_10798166
1440 Ga0209179_1004144
1441 Ga0209813_10009912
1442 Ga0209813_10064414
1443 Ga0207428_10009855
1444 Ga0207428_10587255
1445 Ga0268266_10026518
1446 Ga0268266_10153292
1447 Ga0268266_11142407
1448 Ga0268265_10140363
1449 Ga0268264_10005325
1450 Ga0268264_10032334
1451 Ga0268264_10516604
1452 Ga0265332_10325512
1453 Ga0265320_10403907
1454 Ga0265325_10007779
1455 Ga0265325_10011842
1456 Ga0265329_10053174
1457 Ga0265340_10009600
1458 Ga0265339_10014509
1459 Ga0265339_10016225
1460 Ga0265339_10111402
1461 Ga0265339_10122750
1462 Ga0265339_10178547
1463 Ga0265339_10339687
1464 Ga0265331_10209222
1465 Ga0265316_10159447
1466 Ga0265316_10239493
1467 Ga0265316_10529698
1468 Ga0307513_10038016
1469 Ga0307513_10315876
1470 Ga0307408_100574805
1471 Ga0307408_101039505
1472 Ga0265313_10007621
1473 Ga0265313_10039771
1474 Ga0265314_10008306
1475 Ga0265342_10000092
1476 Ga0265342_10414205
1477 Ga0307416_101382757
1478 Ga0373930_0006396
1479 Ga0373926_0039278
1480 Ga0373928_0179138
1481 Ga0373934_0059834
1482 Ga0373944_0112143
1483 Ga0373944_0112335
1484 Ga0373944_0197498
1485 Ga0373923_0053586
1486 Ga0373923_0069276
1487 Ga0373923_0329942
1488 Ga0373932_0076589
1489 Ga0373932_0156949
1490 Ga0373936_0045742
1491 Ga0373936_0135400
1492 Ga0373936_0164644
1493 Ga0373939_0170423
1494 Ga0373945_0020610
1495 Ga0373953_0061763
1496 Ga0373953_0141942
1497 Ga0373954_0243607
1498 Ga0373954_0313660
1499 Ga0373956_0017882
1500 Ga0373956_0024511
1501 Ga0373943_0318347
1502 Ga0373946_0044254
1503 Ga0373946_0089031
1504 Ga0373955_0000300
1505 Ga0373955_0032661
1506 Ga0373955_0371582
1507 Ga0373961_0007703
1508 Ga0373962_0078871
1509 Ga0373962_0349808
1510 Ga0373924_0087099
1511 Ga0373931_0081073
1512 Ga0373931_0082698
1513 Ga0373931_0640042
1514 Ga0373931_0783670
1515 Ga0373935_0053222
1516 Ga0373935_0197384
1517 Ga0373935_0286702
1518 Ga0373935_0473906
1519 Ga0373927_0026122
1520 Ga0373927_0180690
1521 Ga0373927_0288724
1522 Ga0373927_0317766
1523 Ga0373933_0000325
1524 Ga0373933_0017319
1525 Ga0373933_0086926
1526 Ga0373947_0089323
1527 Ga0373947_0134577
1528 Ga0373947_0670027
1529 Ga0373937_0001881
1530 Ga0373937_0054455
1531 Ga0373937_0057722
1532 Ga0373937_0504504
1533 Ga0373937_0732445
1534 Ga0373925_0036787
1535 Ga0373925_0058697
1536 Ga0373925_0086083
1537 Ga0373925_0131811
1538 Ga0373925_0286499
1539 Ga0373925_0396537
1540 Ga0373925_0414753
1541 Ga0436364_0751447
1542 Ga0436365_0818573
1543 Ga0436365_0900656
1544 Ga0436360_1141745
1545 Ga0436361_0047650
1546 Ga0436363_0593372
1547 Ga0436363_1121521
1548 Ga0436363_1439209
1549 Ga0436363_1498361
1550 Ga0436362_0051847
1551 Ga0439453_0007271
1552 Ga0451800_0142143
1553 Ga0451804_0888528
1554 Ga0439431_0079961
1555 Ga0439440_0045892
1556 Ga0466957_0088693
1557 Ga0466958_0274305
1558 Ga0495592_0017278
1559 Ga0495592_0046620
1560 Ga0495592_0435564
1561 Ga0495603_0023187
1562 Ga0495603_0312499
1563 Ga0495629_0000643
1564 Ga0495629_0063848
1565 Ga0495629_0238468
1566 Ga0495629_0402245
1567 Ga0495638_0036901
1568 Ga0495641_0055732
1569 Ga0495641_0183205
1570 Ga0495641_0184453
1571 Ga0495651_0000136
1572 Ga0495651_0380615
1573 Ga0495653_0002531
1574 Ga0495653_0035187
1575 Ga0495653_0135612
1576 Ga0495580_0521856
1577 Ga0495582_0276995
1578 Ga0495639_0105580
1579 Ga0495639_0197550
1580 Ga0495639_0300623
1581 Ga0495662_0028353
1582 Ga0495662_0108650
1583 Ga0495664_0021171
1584 Ga0495664_0055718
1585 Ga0495664_0154115
1586 Ga0495584_0032797
1587 Ga0495584_0047883
1588 Ga0495584_0058958
1589 Ga0495584_0136999
1590 Ga0495585_0007417
1591 Ga0495608_0083515
1592 Ga0495608_0097103
1593 Ga0495616_0120331
1594 Ga0495618_0045111
1595 Ga0495620_0079341
1596 Ga0495628_0030738
1597 Ga0495628_0032827
1598 Ga0495628_0210085
1599 Ga0495630_0166295
1600 Ga0495630_0342874
1601 Ga0495631_0058992
1602 Ga0495631_0440309
1603 Ga0495632_0065377
1604 Ga0495637_0054757
1605 Ga0495643_0106717
1606 Ga0495643_0128251
1607 Ga0495644_0046726
1608 Ga0495644_0125698
1609 Ga0495663_0042054
1610 Ga0495666_0018752
1611 Ga0495666_0253932
1612 Ga0495652_0063623
1613 Ga0495652_0266112
1614 Ga0495665_0122774
1615 Ga0495640_0006160
1616 Ga0495640_0112934
1617 Ga0495640_0200388
1618 Ga0495586_0162477
1619 Ga0495587_0000850
1620 Ga0495587_0176922
1621 Ga0495587_0180648
1622 Ga0495598_0018521
1623 Ga0495621_0079578
1624 Ga0495645_0113195
1625 Ga0495645_0736421
1626 Ga0495667_0000980
1627 Ga0495667_0028083
1628 Ga0495667_0163007
1629 Ga0495667_0222230
1630 Ga0495656_0115908
1631 Ga0495656_0524787
1632 Ga0495668_0399410
1633 Ga0495634_0022477
1634 Ga0495634_0062181
1635 Ga0495634_0072123
1636 Ga0495634_0432023
1637 Ga0495611_0178722
1638 Ga0495635_0120289
1639 Ga0495635_0190031
1640 Ga0495635_0194334
1641 Ga0495659_0003942
1642 Ga0495661_0193863
1643 Ga0495657_0283193
1644 Ga0495657_0336952
1645 Ga0495599_0041022
1646 Ga0495599_0042653
1647 Ga0495599_0116400
1648 Ga0495623_0028193
1649 Ga0495623_0041057
1650 Ga0495646_0003265
1651 Ga0495646_0054032
1652 Ga0495647_0018922
1653 Ga0495658_0034233
1654 Ga0495658_0513991
1655 Ga0495669_0136752
1656 Ga0495613_0018251
1657 Ga0495613_0065362
1658 Ga0495613_0327531
1659 Ga0495613_0793592
1660 Ga0495624_0190028
1661 Ga0495624_0379501
1662 Ga0495670_0063459
1663 Ga0495649_0216953
1664 Ga0495589_0199021
1665 Ga0495600_0005378
1666 Ga0495600_0240579
1667 Ga0495581_0026047
1668 Ga0495581_0186274
1669 Ga0495604_0000168
1670 Ga0495604_0105756
1671 Ga0495636_0514178
1672 Ga0495674_0027100
1673 Ga0495674_0182518
1674 Ga0495674_0290272
1675 Ga0495672_0108681
1676 Ga0495676_0023218
1677 Ga0495676_0107680
1678 Ga0495680_0000415
1679 Ga0495680_0018853
1680 Ga0495680_0165664
1681 Ga0495680_0241003
1682 Ga0495683_0222748
1683 Ga0495675_0039516
1684 Ga0495677_0091275
1685 Ga0495679_119935
1686 Ga0495684_0075093
1687 Ga0495684_0196140
1688 Ga0495684_0415966
1689 Ga0495686_0126255
1690 Ga0495686_0567174
1691 Ga0495593_0045209
1692 Ga0495593_0054889
1693 Ga0495602_0021291
1694 Ga0495602_0023810
1695 Ga0495602_0159806
1696 Ga0495614_0096103
1697 Ga0495614_0200736
1698 Ga0495615_0086586
1699 Ga0496100_0017287
1700 Ga0496100_0026314
1701 Ga0496100_0060463
1702 Ga0496100_0098865
1703 Ga0496101_0013685
1704 Ga0496101_0042859
1705 Ga0496101_0110190
1706 Ga0496101_0197808
1707 Ga0496102_0008860
1708 Ga0496102_0045286
1709 Ga0496102_0086452
1710 Ga0496103_0003062
1711 Ga0496103_0003997
1712 Ga0496103_0233618
1713 Ga0496104_0004143
1714 Ga0496104_0004953
1715 Ga0496104_0040626
1716 Ga0496104_0048661
1717 Ga0496104_0558836
1718 Ga0496104_0790224
1719 Ga0496105_0003143
1720 Ga0496105_0010944
1721 Ga0496105_0013524
1722 Ga0496105_0054468
1723 Ga0496105_0068948
1724 Ga0496106_0005844
1725 Ga0496106_0006633
1726 Ga0496106_0064520
1727 Ga0496106_0237743
1728 Ga0496107_0000436
1729 Ga0496107_0053541
1730 Ga0496107_0066812
1731 Ga0496107_0127874
1732 Ga0496107_0132447
1733 Ga0496107_0238571
1734 Ga0496108_0004006
1735 Ga0496108_0009582
1736 Ga0496108_0047212
1737 Ga0496108_0102660
1738 Ga0496108_0343575
1739 Ga0496109_0000404
1740 Ga0496109_0030041
1741 Ga0496109_0043419
1742 Ga0496109_0104872
1743 Ga0496110_0001910
1744 Ga0496110_0064635
1745 Ga0496110_0124244
1746 Ga0496110_0471600
1747 Ga0496110_0519330
1748 Ga0496111_0002312
1749 Ga0496111_0042841
1750 Ga0496111_0156817
1751 Ga0496112_0002963
1752 Ga0496112_0003601
1753 Ga0496112_0011928
1754 Ga0496112_0067614
1755 Ga0496112_0074698
1756 Ga0496112_0077416
1757 Ga0496112_0080731
1758 Ga0496112_0235641
1759 Ga0496112_0577018
1760 Ga0496113_0001396
1761 Ga0496113_0001735
1762 Ga0496113_0064177
1763 Ga0496113_0138439
1764 Ga0496113_0194213
1765 Ga0496114_0003326
1766 Ga0496114_0024271
1767 Ga0496114_0138598
1768 Ga0496114_0154264
1769 Ga0496114_1367490
1770 Ga0496115_0007820
1771 Ga0496115_0008495
1772 Ga0496115_0015671
1773 Ga0496115_0226230
1774 Ga0496115_0253407
1775 Ga0496115_0292833
1776 Ga0496115_0300267
1777 Ga0496115_0699441
1778 Ga0496123_0000602
1779 Ga0501032_0039642
1780 Ga0501032_0388169
1781 Ga0501033_0274886
1782 Ga0501034_0111543
1783 Ga0501034_0117639
1784 Ga0501034_0374057
1785 Ga0501034_0571125
1786 Ga0501036_0131842
1787 Ga0501036_0184008
1788 Ga0501036_0918323
1789 Ga0501036_1204680
1790 Ga0501037_0012047
1791 Ga0501037_0424688
1792 Ga0501037_0564050
1793 Ga0501038_0032871
1794 Ga0501038_0069297
1795 Ga0501038_0074477
1796 Ga0501038_0249762
1797 Ga0501038_0496119
1798 Ga0501039_0036634
1799 Ga0501039_0146106
1800 Ga0501039_0568675
1801 Ga0501040_0077799
1802 Ga0501041_0090089
1803 Ga0501042_0061954
1804 Ga0501043_0030110
1805 Ga0501043_0030669
1806 Ga0501043_0133329
1807 Ga0501043_0144701
1808 Ga0501046_0331577
1809 Ga0501046_0344313
1810 Ga0501046_0390274
1811 Ga0501046_0497818
1812 Ga0501047_0026716
1813 Ga0501047_0066714
1814 Ga0501047_0077629
1815 Ga0501047_0165309
1816 Ga0501047_0453921
1817 Ga0501048_0017649
1818 Ga0501048_0152298
1819 Ga0501048_0215102
1820 Ga0501048_1302422
1821 Ga0501067_0069177
1822 Ga0501068_0111266
1823 Ga0501068_0361346
1824 Ga0501068_0503331
1825 Ga0501069_0129933
1826 Ga0501070_0019024
1827 Ga0501070_0067586
1828 Ga0501070_0378486
1829 Ga0501070_0388765
1830 Ga0501071_0175620
1831 Ga0501071_0437046
1832 Ga0501071_0652042
1833 Ga0501071_0661011
1834 Ga0501072_0022194
1835 Ga0501072_0183171
1836 Ga0501072_0706570
1837 Ga0501072_0796381
1838 Ga0501073_0032267
1839 Ga0501073_0149049
1840 Ga0501073_0336610
1841 Ga0501073_0347621
1842 Ga0501073_0411602
1843 Ga0501074_0145084
1844 Ga0501075_0128645
1845 Ga0501075_0300405
1846 Ga0501076_0021225
1847 Ga0501076_0222426
1848 Ga0501076_0223872
1849 Ga0501076_0318693
1850 Ga0501076_0502574
1851 Ga0501076_0697991
1852 Ga0501076_0714320
1853 Ga0501077_0057010
1854 Ga0501077_0260059
1855 Ga0501079_0147529
1856 Ga0501079_0330679
1857 Ga0501079_0581030
1858 Ga0501079_0679945
1859 Ga0501080_0388031
1860 Ga0501080_0425926
1861 Ga0501080_0440137
1862 Ga0501081_0551341
1863 Ga0501081_0796040
1864 Ga0501083_0006385
1865 Ga0501083_0148601
1866 Ga0501083_0429209
1867 Ga0501083_0492892
1868 Ga0501035_0288216
1869 Ga0501035_0423499
1870 Ga0501035_0467272
1871 Ga0501035_0719035
1872 Ga0501035_0728555
1873 Ga0501044_0006144
1874 Ga0501044_0065573
1875 Ga0501044_0069168
1876 Ga0501044_0138733
1877 Ga0501044_0931449
1878 Ga0501044_1365407
1879 Ga0501045_0155707
1880 Ga0501045_0325397
1881 Ga0501045_0526623
1882 nmdc:mga03683_302134_c1
1883 nmdc:mga03683_88745_c1
1884 nmdc:mga03n38_236513_c1
1885 nmdc:mga03n38_396203_c1
1886 nmdc:mga00v17_108438_c1
1887 nmdc:mga00v17_776126_c1
1888 nmdc:mga0yw44_1005730_c1
1889 nmdc:mga0yw44_1188084_c1
1890 nmdc:mga0yw44_147812_c1
1891 nmdc:mga0yw44_218301_c1
1892 nmdc:mga0yw44_295547_c1
1893 nmdc:mga0yw44_555323_c1
1894 nmdc:mga0yw44_740153_c1
1895 nmdc:mga0yw44_813230_c1
1896 nmdc:mga0yw44_82376_c1
1897 nmdc:mga0yw44_9426_c1
1898 nmdc:mga0k408_134803_c1
1899 nmdc:mga0k408_195488_c1
1900 nmdc:mga0k408_239747_c1
1901 nmdc:mga0k408_597089_c1
1902 nmdc:mga0k408_81583_c1
1903 nmdc:mga0k408_8198_c1
1904 nmdc:mga06z11_222637_c1
1905 nmdc:mga06z11_25302_c1
1906 nmdc:mga06z11_34867_c1
1907 nmdc:mga06z11_492873_c1
1908 nmdc:mga04h51_40890_c1
1909 nmdc:mga04h51_44794_c1
1910 nmdc:mga07m45_226685_c1
1911 nmdc:mga07m45_39237_c1
1912 nmdc:mga07m45_600710_c1
1913 nmdc:mga07m45_843056_c1
1914 nmdc:mga07m45_93868_c1
1915 nmdc:mga05p37_1224670_c1
1916 nmdc:mga05p37_14184_c1
1917 nmdc:mga05p37_14557_c1
1918 nmdc:mga05p37_31120_c1
1919 nmdc:mga05p37_540_c1
1920 nmdc:mga05p37_8519_c1
1921 nmdc:mga09592_218984_c1
1922 nmdc:mga09592_321720_c1
1923 nmdc:mga09592_660276_c1
1924 nmdc:mga0qj67_49229_c1
1925 nmdc:mga0qj67_53833_c1
1926 nmdc:mga0qj67_63072_c2
1927 nmdc:mga0qj67_9371_c1
1928 nmdc:mga06r32_100936_c1
1929 nmdc:mga06r32_3089_c1
1930 nmdc:mga06r32_355072_c1
1931 nmdc:mga06r32_40585_c1
1932 nmdc:mga06r32_86655_c1
1933 nmdc:mga06r32_99217_c1
1934 nmdc:mga08y16_3123_c1
1935 nmdc:mga08y16_386604_c1
1936 nmdc:mga08y16_518513_c1
1937 nmdc:mga08y16_85413_c1
1938 nmdc:mga0n895_1161654_c1
1939 nmdc:mga0n895_1223442_c1
1940 nmdc:mga0n895_1421242_c1
1941 nmdc:mga0n895_35380_c1
1942 nmdc:mga0rr50_270967_c1
1943 nmdc:mga0rr50_464120_c1
1944 nmdc:mga08x19_1004614_c1
1945 nmdc:mga08x19_889705_c1
1946 nmdc:mga0a205_45421_c1
1947 nmdc:mga0a205_524145_c1
1948 nmdc:mga0sz30_108885_c1
1949 nmdc:mga0sz30_137859_c1
1950 nmdc:mga0sz30_178072_c1
1951 Ga0495601_0033259
1952 Ga0495601_0295407
1953 Ga0495601_0298600
1954 Ga0495601_0594377
1955 Ga0495612_0038327
1956 Ga0495612_0042574
1957 Ga0500610_0251235
1958 Ga0495655_0040007
1959 Ga0495655_0045064
1960 Ga0495655_0196588
1961 Ga0495595_0000353
1962 Ga0495595_0084256
1963 Ga0495595_0121103
1964 Ga0495595_0177974
1965 Ga0495619_0000354
1966 Ga0495619_0055466
1967 Ga0495619_0076036
1968 Ga0495619_0310631
1969 Ga0495619_0502809
1970 Ga0495619_0576067
1971 Ga0495619_0631490
1972 Ga0495619_0664024
1973 Ga0500646_0041092
1974 Ga0500566_0300999
1975 Ga0500641_0033230
1976 Ga0500641_0176778
1977 Ga0500562_088560
1978 Ga0500562_122455
1979 Ga0500593_163370
1980 Ga0500595_067715
1981 Ga0500658_0059527
1982 Ga0500658_0071891
1983 Ga0500568_0041166
1984 Ga0500568_0143034
1985 Ga0500577_0068256
1986 Ga0500577_0096823
1987 Ga0500588_0019816
1988 Ga0500604_0095176
1989 Ga0500616_0121218
1990 Ga0500645_135410
1991 Ga0500609_043346
1992 Ga0501084_0077618
1993 Ga0501084_0153148
1994 Ga0501084_0404981
1995 Ga0501084_0458161
1996 Ga0501082_0000145
1997 Ga0501082_0018450
1998 Ga0501082_0050933
1999 Ga0501082_0211622
2000 Ga0501082_0297293
2001 Ga0501082_0603482
2002 Ga0530510_0012433
2003 Ga0530510_0013033
2004 Ga0530510_0082797
2005 Ga0530510_0469686
2006 Ga0530510_0479835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

14

152

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8315 15 153
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.8043 9 152
3ab7-assembly3.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8008 15 153
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.7935 9 152
5ahw-assembly2.cif.gz_D crystal structure of universal stress protein msmeg_3811 in complex with camp 0.7895 12 153
ID Description Score Start End Superfamily
af_A0A1D6L4K8_21_186_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.827 10 152 3.40.50.620
af_Q336S5_6_169_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8216 13 152 3.40.50.620
af_A0A1D6J571_14_177_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8065 9 152 3.40.50.620
4wnyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8043 9 152 3.40.50.620
af_Q57951_25_170_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8033 13 152 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2T5HGP2-F1-model_v4 Nucleotide-binding universal stress UspA family protein 0.9726 14 164
AF-M9RGK0-F1-model_v4 Putative universal stress protein 0.9709 14 164
AF-M9RDL8-F1-model_v4 Putative universal stress protein 0.9694 14 164
AF-A0A1X7A007-F1-model_v4 Universal stress protein family protein 0.9688 14 164
AF-A0A7C9RE59-F1-model_v4 Universal stress protein 0.9684 31 164

Map