F487968
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1004 | 454 | 938 | 419 |
Family's Representative Sequence
| Representative Sequence | 3300031239|Ga0265328_10013792|Ga0265328_100137923 |
| Length | 492 |
| Sequence | VSPRRRNDGSGGDAARGRVPGARGRLFSGACGAGARRLRATAGTGSELRVVDAMAGTIERYFRLAEQGTTVRTEVLAGLTTFLTMAYIVVVNPVILGEAGMPVAAVAAATCLAAGFGSILMGLVSNYPLALAPGMGLNAYFTFTVVKGMGVPWPTALGCVFLSGAAFLLLTVVGVRQLIISAMPRALFAAVAGGVGLFIAFIGLGDAGVIVARPGTMVGLGSLTTPTAALSLLGLLLIAALQARRVRGAMLLGILATAAVGWGIGLVHVAPGAYHAGDLAAAAFKLDVPAALNLKGGIGLSLVEIVFVFLFVDLFDNVGTLVAVTRKAGLVAPDGSIPRLNRILVVDSIAMAAGALVGTSPVTSYIESAAGVAAGGRTGLTSVVVGALFLVTLLFAPLVQAIPAAATAPALILVGGMMMGALAEVDWTEPGESIPAFLTVIMIPLSYSIANGLAFGITSHAALKLVRGDVRRGDWLIYVLAALCVARFVYLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 3 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 4 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 5 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 6 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 7 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 8 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 9 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 10 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 11 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 12 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 13 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 14 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 15 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 16 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 17 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 18 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 19 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 20 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 21 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 22 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 23 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 24 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 25 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 26 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 27 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 28 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 29 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 30 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 31 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 32 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 33 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 34 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 35 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 36 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 37 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 38 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 39 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 40 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 41 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 42 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 43 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 44 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 45 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 46 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 47 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 48 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 49 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 50 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 51 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 52 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 53 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 54 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 55 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 56 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 57 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 58 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 59 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 60 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 61 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 62 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 63 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 64 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 65 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 66 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 67 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 68 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 69 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 70 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 71 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 72 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 73 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 74 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 75 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 79 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 85 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 88 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 113 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 117 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 118 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 119 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 120 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 121 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 122 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 123 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 124 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 125 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 126 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 127 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 128 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 129 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 130 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 132 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 133 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 137 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 138 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 140 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 141 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 142 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 143 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 144 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 145 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 146 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 148 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 176 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 177 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 179 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 248 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 249 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 251 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 252 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 253 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 255 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 256 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 258 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 259 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 260 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 261 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 276 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 277 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 278 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 279 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 280 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 281 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 282 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 283 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 286 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 287 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 288 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 289 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 290 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 291 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 378 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 379 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 380 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 381 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 382 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 383 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 384 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 401 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 402 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 407 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 409 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 418 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 419 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 420 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 422 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 423 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 425 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 426 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 427 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 429 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 430 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 431 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 432 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 434 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 435 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 437 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 439 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 440 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 442 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 443 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 444 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 445 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 446 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 447 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 448 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 449 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 450 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 451 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 452 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 453 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 454 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.33 |
| Metatranscriptomes | 0 |
| Isolates | 6.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.4 |
| Bulb | 0 |
| Endosphere | 12.35 |
| Nodule | 0 |
| Rhizoplane | 3.59 |
| Rhizosphere | 70.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2235436 | 2162886007 | Bacteria | 72815 |
| 2 | SwRhRL2b_contig_2526931 | 2162886007 | Bacteria | 3420 |
| 3 | JGI24739J22299_10004388 | 3300001989 | Bacteria | 5401 |
| 4 | JGI24749J21850_1000001 | 3300002076 | Bacteria | 67089 |
| 5 | JGI24744J21845_10015581 | 3300002077 | Bacteria | 1518 |
| 6 | JGI24751J29686_10000086 | 3300002459 | Bacteria | 52241 |
| 7 | JGI25159J45721_1008128 | 3300002987 | Bacteria | 2915 |
| 8 | JGI25165J46597_1000071 | 3300003214 | Bacteria | 193222 |
| 9 | JGI25153J46596_10000005 | 3300003215 | Bacteria | 492839 |
| 10 | rootH1_10006386 | 3300003316 | Bacteria | 2019 |
| 11 | rootH1_10006386 | 3300003323 | Bacteria | 30831 |
| 12 | rootL2_10015514 | 3300003322 | Bacteria | 4232 |
| 13 | rootL2_10015516 | 3300003322 | Bacteria | 6785 |
| 14 | rootH1_10092427 | 3300003323 | Bacteria | 2056 |
| 15 | Ga0055542_1005438 | 3300003762 | Bacteria | 2880 |
| 16 | Ga0055524_1023436 | 3300003775 | Bacteria | 1987 |
| 17 | Ga0055530_10000091 | 3300003791 | Bacteria | 78039 |
| 18 | Ga0055531_10001862 | 3300003794 | Bacteria | 14812 |
| 19 | Ga0055531_10022604 | 3300003794 | Bacteria | 2390 |
| 20 | Ga0065165_1000279 | 3300005262 | Bacteria | 87186 |
| 21 | Ga0065165_1000784 | 3300005262 | Bacteria | 42627 |
| 22 | Ga0065704_10070176 | 3300005289 | Bacteria | 138803 |
| 23 | Ga0065704_10083431 | 3300005289 | Bacteria | 3467 |
| 24 | Ga0065704_10094793 | 3300005289 | Bacteria | 2524 |
| 25 | Ga0065707_10084403 | 3300005295 | Bacteria | 7235 |
| 26 | Ga0065707_10127388 | 3300005295 | Bacteria | 1985 |
| 27 | Ga0070658_10002919 | 3300005327 | Bacteria | 14175 |
| 28 | Ga0070658_10005267 | 3300005327 | Bacteria | 10504 |
| 29 | Ga0070658_10123037 | 3300005327 | Bacteria | 2157 |
| 30 | Ga0070683_100000653 | 3300005329 | Bacteria | 25046 |
| 31 | Ga0070683_100003219 | 3300005329 | Bacteria | 13178 |
| 32 | Ga0070683_100051339 | 3300005329 | Bacteria | 3818 |
| 33 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 34 | Ga0070670_100197846 | 3300005331 | Bacteria | 1746 |
| 35 | Ga0068869_100026773 | 3300005334 | Bacteria | 4016 |
| 36 | Ga0070666_10039404 | 3300005335 | Bacteria | 3149 |
| 37 | Ga0070666_10050620 | 3300005335 | Bacteria | 2794 |
| 38 | Ga0070666_10092487 | 3300005335 | Bacteria | 2079 |
| 39 | Ga0070680_100078754 | 3300005336 | Bacteria | 2716 |
| 40 | Ga0070680_100080691 | 3300005336 | Bacteria | 2683 |
| 41 | Ga0070680_100102337 | 3300005336 | Bacteria | 2379 |
| 42 | Ga0068868_100008257 | 3300005338 | Bacteria | 7453 |
| 43 | Ga0070660_100013911 | 3300005339 | Bacteria | 5788 |
| 44 | Ga0070660_100033918 | 3300005339 | Bacteria | 3852 |
| 45 | Ga0070661_100001532 | 3300005344 | Bacteria | 16096 |
| 46 | Ga0070661_100029231 | 3300005344 | Bacteria | 3976 |
| 47 | Ga0070661_100140601 | 3300005344 | Bacteria | 1819 |
| 48 | Ga0070668_100000739 | 3300005347 | Bacteria | 22344 |
| 49 | Ga0070668_100001077 | 3300005347 | Bacteria | 19225 |
| 50 | Ga0070668_100006248 | 3300005347 | Bacteria | 8823 |
| 51 | Ga0070668_100007185 | 3300005347 | Bacteria | 8256 |
| 52 | Ga0070668_100008702 | 3300005347 | Bacteria | 7538 |
| 53 | Ga0070669_100000084 | 3300005353 | Bacteria | 91046 |
| 54 | Ga0070669_100000393 | 3300005353 | Bacteria | 33445 |
| 55 | Ga0070669_100036071 | 3300005353 | Bacteria | 3582 |
| 56 | Ga0070671_100004362 | 3300005355 | Bacteria | 11188 |
| 57 | Ga0070671_100004490 | 3300005355 | Bacteria | 11043 |
| 58 | Ga0070671_100006472 | 3300005355 | Bacteria | 9364 |
| 59 | Ga0070671_100019361 | 3300005355 | Bacteria | 5539 |
| 60 | Ga0070671_100070644 | 3300005355 | Bacteria | 2913 |
| 61 | Ga0070671_100081026 | 3300005355 | Bacteria | 2714 |
| 62 | Ga0070671_100114478 | 3300005355 | Bacteria | 2267 |
| 63 | Ga0070659_100003866 | 3300005366 | Bacteria | 10671 |
| 64 | Ga0070667_100000112 | 3300005367 | Bacteria | 104843 |
| 65 | Ga0070667_100000162 | 3300005367 | Bacteria | 83150 |
| 66 | Ga0070667_100000174 | 3300005367 | Bacteria | 79730 |
| 67 | Ga0070667_100000453 | 3300005367 | Bacteria | 42432 |
| 68 | Ga0070667_100009649 | 3300005367 | Bacteria | 8007 |
| 69 | Ga0070667_100028597 | 3300005367 | Bacteria | 4641 |
| 70 | Ga0070667_100048519 | 3300005367 | Bacteria | 3574 |
| 71 | Ga0070667_100079384 | 3300005367 | Bacteria | 2805 |
| 72 | Ga0070703_10000111 | 3300005406 | Bacteria | 42242 |
| 73 | Ga0070709_10000003 | 3300005434 | Bacteria | 295541 |
| 74 | Ga0070709_10024313 | 3300005434 | Bacteria | 3565 |
| 75 | Ga0070714_100028179 | 3300005435 | Bacteria | 4657 |
| 76 | Ga0070713_100012419 | 3300005436 | Bacteria | 6247 |
| 77 | Ga0070713_100012623 | 3300005436 | Bacteria | 6206 |
| 78 | Ga0070710_10021405 | 3300005437 | Bacteria | 3370 |
| 79 | Ga0070711_100000026 | 3300005439 | Bacteria | 109906 |
| 80 | Ga0070711_100027640 | 3300005439 | Bacteria | 3726 |
| 81 | Ga0070705_100000002 | 3300005440 | Bacteria | 137084 |
| 82 | Ga0070708_100256935 | 3300005445 | Unclassified | 1642 |
| 83 | Ga0070663_100082894 | 3300005455 | Bacteria | 2360 |
| 84 | Ga0070678_100014881 | 3300005456 | Bacteria | 4925 |
| 85 | Ga0070678_100026536 | 3300005456 | Bacteria | 3919 |
| 86 | Ga0070678_100160307 | 3300005456 | Bacteria | 1822 |
| 87 | Ga0070662_100020516 | 3300005457 | Bacteria | 4500 |
| 88 | Ga0070681_10064516 | 3300005458 | Bacteria | 3632 |
| 89 | Ga0070681_10244762 | 3300005458 | Unclassified | 1706 |
| 90 | Ga0070685_10006416 | 3300005466 | Bacteria | 5996 |
| 91 | Ga0070706_100000066 | 3300005467 | Bacteria | 120884 |
| 92 | Ga0070699_100000236 | 3300005518 | Bacteria | 53800 |
| 93 | Ga0070699_100229015 | 3300005518 | Bacteria | 1657 |
| 94 | Ga0070679_100011129 | 3300005530 | Bacteria | 8567 |
| 95 | Ga0070679_100051727 | 3300005530 | Bacteria | 4092 |
| 96 | Ga0070684_100022634 | 3300005535 | Bacteria | 5245 |
| 97 | Ga0068853_100000120 | 3300005539 | Bacteria | 52962 |
| 98 | Ga0068853_100002521 | 3300005539 | Bacteria | 13743 |
| 99 | Ga0068853_100024916 | 3300005539 | Bacteria | 5020 |
| 100 | Ga0070686_100059630 | 3300005544 | Bacteria | 2459 |
| 101 | Ga0070696_100000017 | 3300005546 | Bacteria | 74201 |
| 102 | Ga0070696_100089553 | 3300005546 | Bacteria | 2188 |
| 103 | Ga0070665_100000150 | 3300005548 | Bacteria | 127885 |
| 104 | Ga0070665_100004072 | 3300005548 | Bacteria | 15376 |
| 105 | Ga0070665_100005090 | 3300005548 | Bacteria | 13636 |
| 106 | Ga0070665_100006874 | 3300005548 | Bacteria | 11565 |
| 107 | Ga0070665_100012980 | 3300005548 | Bacteria | 8392 |
| 108 | Ga0070665_100080621 | 3300005548 | Bacteria | 3260 |
| 109 | Ga0068855_100000029 | 3300005563 | Bacteria | 171278 |
| 110 | Ga0068855_100000801 | 3300005563 | Bacteria | 38932 |
| 111 | Ga0068855_100003681 | 3300005563 | Bacteria | 18753 |
| 112 | Ga0068855_100015111 | 3300005563 | Bacteria | 9295 |
| 113 | Ga0068855_100151387 | 3300005563 | Bacteria | 2638 |
| 114 | Ga0068855_100223228 | 3300005563 | Bacteria | 2112 |
| 115 | Ga0068857_100219300 | 3300005577 | Unclassified | 1737 |
| 116 | Ga0068854_100020566 | 3300005578 | Unclassified | 4468 |
| 117 | Ga0068856_100005698 | 3300005614 | Bacteria | 12266 |
| 118 | Ga0068856_100017538 | 3300005614 | Bacteria | 6937 |
| 119 | Ga0068856_100065917 | 3300005614 | Bacteria | 3578 |
| 120 | Ga0068856_100102561 | 3300005614 | Bacteria | 2855 |
| 121 | Ga0068856_100227121 | 3300005614 | Bacteria | 1882 |
| 122 | Ga0068852_100000077 | 3300005616 | Bacteria | 69050 |
| 123 | Ga0068852_100005962 | 3300005616 | Bacteria | 8773 |
| 124 | Ga0068852_100266566 | 3300005616 | Bacteria | 1647 |
| 125 | Ga0068859_100000120 | 3300005617 | Bacteria | 74447 |
| 126 | Ga0068859_100002276 | 3300005617 | Bacteria | 19488 |
| 127 | Ga0068859_100070714 | 3300005617 | Bacteria | 3525 |
| 128 | Ga0068859_100116748 | 3300005617 | Bacteria | 2733 |
| 129 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 130 | Ga0068864_100000088 | 3300005618 | Bacteria | 98366 |
| 131 | Ga0068864_100005216 | 3300005618 | Bacteria | 10650 |
| 132 | Ga0068861_100026207 | 3300005719 | Bacteria | 4237 |
| 133 | Ga0068861_100249567 | 3300005719 | Bacteria | 1513 |
| 134 | Ga0068851_10006050 | 3300005834 | Bacteria | 5518 |
| 135 | Ga0068851_10022628 | 3300005834 | Bacteria | 3064 |
| 136 | Ga0068851_10034142 | 3300005834 | Bacteria | 2538 |
| 137 | Ga0068863_100000023 | 3300005841 | Bacteria | 186490 |
| 138 | Ga0068863_100000047 | 3300005841 | Bacteria | 140249 |
| 139 | Ga0068863_100001506 | 3300005841 | Bacteria | 23038 |
| 140 | Ga0068863_100007525 | 3300005841 | Bacteria | 10653 |
| 141 | Ga0068863_100008711 | 3300005841 | Bacteria | 9911 |
| 142 | Ga0068863_100114615 | 3300005841 | Bacteria | 2568 |
| 143 | Ga0068858_100000093 | 3300005842 | Bacteria | 93236 |
| 144 | Ga0068858_100000094 | 3300005842 | Bacteria | 93130 |
| 145 | Ga0068858_100000647 | 3300005842 | Bacteria | 36268 |
| 146 | Ga0068858_100002961 | 3300005842 | Bacteria | 17057 |
| 147 | Ga0068858_100005876 | 3300005842 | Bacteria | 11982 |
| 148 | Ga0068858_100047698 | 3300005842 | Bacteria | 3970 |
| 149 | Ga0068858_100095925 | 3300005842 | Bacteria | 2763 |
| 150 | Ga0068860_100000115 | 3300005843 | Bacteria | 128506 |
| 151 | Ga0068860_100000125 | 3300005843 | Bacteria | 123363 |
| 152 | Ga0068860_100007819 | 3300005843 | Bacteria | 10674 |
| 153 | Ga0068860_100008267 | 3300005843 | Bacteria | 10356 |
| 154 | Ga0068860_100023799 | 3300005843 | Bacteria | 5920 |
| 155 | Ga0068860_100058444 | 3300005843 | Bacteria | 3666 |
| 156 | Ga0068860_100087974 | 3300005843 | Bacteria | 2957 |
| 157 | Ga0068860_100360785 | 3300005843 | Bacteria | 1432 |
| 158 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 159 | Ga0068862_100001478 | 3300005844 | Bacteria | 21538 |
| 160 | Ga0068862_100007196 | 3300005844 | Bacteria | 9240 |
| 161 | Ga0068862_100015582 | 3300005844 | Bacteria | 6314 |
| 162 | Ga0081540_1006248 | 3300005983 | Bacteria | 8723 |
| 163 | Ga0070717_10051550 | 3300006028 | Bacteria | 3387 |
| 164 | Ga0075368_10000447 | 3300006042 | Bacteria | 12179 |
| 165 | Ga0075368_10000886 | 3300006042 | Bacteria | 9289 |
| 166 | Ga0075364_10000807 | 3300006051 | Bacteria | 16518 |
| 167 | Ga0070715_10001793 | 3300006163 | Bacteria | 6394 |
| 168 | Ga0070716_100001919 | 3300006173 | Bacteria | 9458 |
| 169 | Ga0070712_100015972 | 3300006175 | Bacteria | 4842 |
| 170 | Ga0075367_10000022 | 3300006178 | Bacteria | 33901 |
| 171 | Ga0075366_10047605 | 3300006195 | Bacteria | 2542 |
| 172 | Ga0097621_100027460 | 3300006237 | Bacteria | 4476 |
| 173 | Ga0097621_100061202 | 3300006237 | Bacteria | 3087 |
| 174 | Ga0075370_10066079 | 3300006353 | Bacteria | 2063 |
| 175 | Ga0068871_100018941 | 3300006358 | Bacteria | 5246 |
| 176 | Ga0068871_100061545 | 3300006358 | Bacteria | 3066 |
| 177 | Ga0068871_100187475 | 3300006358 | Bacteria | 1780 |
| 178 | Ga0075431_100004452 | 3300006847 | Bacteria | 13740 |
| 179 | Ga0075434_100312332 | 3300006871 | Bacteria | 1592 |
| 180 | Ga0075429_100100214 | 3300006880 | Bacteria | 2528 |
| 181 | Ga0068865_100052620 | 3300006881 | Bacteria | 2823 |
| 182 | Ga0075436_100001730 | 3300006914 | Bacteria | 14953 |
| 183 | Ga0075436_100099073 | 3300006914 | Bacteria | 2029 |
| 184 | Ga0097620_100000120 | 3300006931 | Bacteria | 74447 |
| 185 | Ga0097620_100002276 | 3300006931 | Bacteria | 19488 |
| 186 | Ga0097620_100070714 | 3300006931 | Bacteria | 3525 |
| 187 | Ga0097620_100116747 | 3300006931 | Bacteria | 2733 |
| 188 | Ga0075435_100033347 | 3300007076 | Bacteria | 4071 |
| 189 | Ga0105251_10000694 | 3300009011 | Bacteria | 31101 |
| 190 | Ga0105251_10009021 | 3300009011 | Bacteria | 5943 |
| 191 | Ga0105251_10022289 | 3300009011 | Bacteria | 3291 |
| 192 | Ga0105244_10004535 | 3300009036 | Bacteria | 9522 |
| 193 | Ga0105244_10030107 | 3300009036 | Bacteria | 2891 |
| 194 | Ga0105250_10023339 | 3300009092 | Bacteria | 2492 |
| 195 | Ga0105250_10032285 | 3300009092 | Bacteria | 2103 |
| 196 | Ga0105250_10038247 | 3300009092 | Bacteria | 1924 |
| 197 | Ga0105240_10001088 | 3300009093 | Bacteria | 47994 |
| 198 | Ga0105240_10001097 | 3300009093 | Bacteria | 47790 |
| 199 | Ga0105240_10006037 | 3300009093 | Bacteria | 17907 |
| 200 | Ga0105240_10007626 | 3300009093 | Bacteria | 15671 |
| 201 | Ga0105240_10007974 | 3300009093 | Bacteria | 15271 |
| 202 | Ga0105240_10008070 | 3300009093 | Bacteria | 15132 |
| 203 | Ga0105240_10009372 | 3300009093 | Bacteria | 13876 |
| 204 | Ga0105240_10028229 | 3300009093 | Bacteria | 7333 |
| 205 | Ga0105240_10029267 | 3300009093 | Bacteria | 7180 |
| 206 | Ga0105240_10030435 | 3300009093 | Bacteria | 7016 |
| 207 | Ga0105240_10054737 | 3300009093 | Bacteria | 4998 |
| 208 | Ga0105240_10105715 | 3300009093 | Bacteria | 3416 |
| 209 | Ga0105245_10001260 | 3300009098 | Bacteria | 22888 |
| 210 | Ga0105245_10030431 | 3300009098 | Bacteria | 4773 |
| 211 | Ga0105245_10100590 | 3300009098 | Bacteria | 2674 |
| 212 | Ga0105245_10153788 | 3300009098 | Bacteria | 2177 |
| 213 | Ga0105247_10000055 | 3300009101 | Bacteria | 134197 |
| 214 | Ga0114129_10010022 | 3300009147 | Bacteria | 13508 |
| 215 | Ga0114129_10215573 | 3300009147 | Bacteria | 2592 |
| 216 | Ga0114129_10275530 | 3300009147 | Bacteria | 2249 |
| 217 | Ga0105241_10000236 | 3300009174 | Bacteria | 41893 |
| 218 | Ga0105241_10022023 | 3300009174 | Bacteria | 4717 |
| 219 | Ga0105241_10022832 | 3300009174 | Bacteria | 4637 |
| 220 | Ga0105241_10197284 | 3300009174 | Bacteria | 1679 |
| 221 | Ga0105242_10091962 | 3300009176 | Bacteria | 2555 |
| 222 | Ga0105248_10000222 | 3300009177 | Bacteria | 65122 |
| 223 | Ga0105248_10000619 | 3300009177 | Bacteria | 40470 |
| 224 | Ga0105248_10001588 | 3300009177 | Bacteria | 25327 |
| 225 | Ga0105248_10012654 | 3300009177 | Bacteria | 9311 |
| 226 | Ga0105248_10019560 | 3300009177 | Bacteria | 7495 |
| 227 | Ga0105248_10041647 | 3300009177 | Bacteria | 5149 |
| 228 | Ga0105248_10045373 | 3300009177 | Bacteria | 4929 |
| 229 | Ga0105248_10097301 | 3300009177 | Bacteria | 3316 |
| 230 | Ga0105248_10109781 | 3300009177 | Bacteria | 3110 |
| 231 | Ga0105248_10162397 | 3300009177 | Bacteria | 2519 |
| 232 | Ga0105248_10248992 | 3300009177 | Unclassified | 2000 |
| 233 | Ga0105237_10000607 | 3300009545 | Bacteria | 49998 |
| 234 | Ga0105237_10098447 | 3300009545 | Bacteria | 2916 |
| 235 | Ga0105237_10224682 | 3300009545 | Bacteria | 1878 |
| 236 | Ga0105238_10000332 | 3300009551 | Bacteria | 51604 |
| 237 | Ga0105238_10006830 | 3300009551 | Bacteria | 11394 |
| 238 | Ga0105238_10020209 | 3300009551 | Bacteria | 6778 |
| 239 | Ga0105238_10035909 | 3300009551 | Bacteria | 5039 |
| 240 | Ga0105238_10038338 | 3300009551 | Bacteria | 4867 |
| 241 | Ga0105238_10054217 | 3300009551 | Bacteria | 4028 |
| 242 | Ga0105238_10126233 | 3300009551 | Bacteria | 2537 |
| 243 | Ga0105249_10017204 | 3300009553 | Bacteria | 6418 |
| 244 | Ga0105249_10057440 | 3300009553 | Bacteria | 3565 |
| 245 | Ga0105249_10267670 | 3300009553 | Bacteria | 1701 |
| 246 | Ga0105239_10001070 | 3300010375 | Bacteria | 38047 |
| 247 | Ga0105239_10002886 | 3300010375 | Bacteria | 21477 |
| 248 | Ga0105239_10018071 | 3300010375 | Bacteria | 7800 |
| 249 | Ga0105239_10086325 | 3300010375 | Bacteria | 3459 |
| 250 | Ga0105239_10142023 | 3300010375 | Bacteria | 2676 |
| 251 | Ga0105239_10255785 | 3300010375 | Bacteria | 1967 |
| 252 | Ga0105239_10281882 | 3300010375 | Bacteria | 1871 |
| 253 | Ga0105246_10002204 | 3300011119 | Bacteria | 11750 |
| 254 | Ga0105246_10006176 | 3300011119 | Bacteria | 7312 |
| 255 | Ga0105246_10046101 | 3300011119 | Bacteria | 2972 |
| 256 | Ga0157370_10158449 | 3300013104 | Bacteria | 2106 |
| 257 | Ga0157369_10002432 | 3300013105 | Bacteria | 22368 |
| 258 | Ga0157369_10005268 | 3300013105 | Bacteria | 15078 |
| 259 | Ga0157369_10016374 | 3300013105 | Bacteria | 8341 |
| 260 | Ga0157369_10051635 | 3300013105 | Unclassified | 4449 |
| 261 | Ga0157369_10056791 | 3300013105 | Bacteria | 4224 |
| 262 | Ga0157369_10097974 | 3300013105 | Bacteria | 3128 |
| 263 | Ga0157369_10127959 | 3300013105 | Bacteria | 2692 |
| 264 | Ga0157369_10168113 | 3300013105 | Bacteria | 2311 |
| 265 | Ga0157369_10406047 | 3300013105 | Bacteria | 1413 |
| 266 | Ga0157374_10017350 | 3300013296 | Bacteria | 6337 |
| 267 | Ga0157374_10019466 | 3300013296 | Bacteria | 6008 |
| 268 | Ga0157374_10116314 | 3300013296 | Bacteria | 2576 |
| 269 | Ga0157374_10194710 | 3300013296 | Bacteria | 1983 |
| 270 | Ga0157374_10200222 | 3300013296 | Bacteria | 1955 |
| 271 | Ga0157374_10235609 | 3300013296 | Unclassified | 1799 |
| 272 | Ga0157378_10060639 | 3300013297 | Bacteria | 3375 |
| 273 | Ga0157378_10263189 | 3300013297 | Bacteria | 1656 |
| 274 | Ga0163162_10001307 | 3300013306 | Bacteria | 23298 |
| 275 | Ga0163162_10013600 | 3300013306 | Bacteria | 7951 |
| 276 | Ga0163162_10069456 | 3300013306 | Bacteria | 3575 |
| 277 | Ga0163162_10267967 | 3300013306 | Bacteria | 1839 |
| 278 | Ga0163162_10287298 | 3300013306 | Bacteria | 1777 |
| 279 | Ga0157372_10012597 | 3300013307 | Bacteria | 9005 |
| 280 | Ga0157372_10016888 | 3300013307 | Bacteria | 7835 |
| 281 | Ga0157372_10189762 | 3300013307 | Bacteria | 2380 |
| 282 | Ga0157375_10294207 | 3300013308 | Bacteria | 1787 |
| 283 | Ga0163163_10001191 | 3300014325 | Bacteria | 22056 |
| 284 | Ga0163163_10017374 | 3300014325 | Bacteria | 6708 |
| 285 | Ga0163163_10238648 | 3300014325 | Bacteria | 1867 |
| 286 | Ga0157380_10001122 | 3300014326 | Bacteria | 17262 |
| 287 | Ga0157379_10147584 | 3300014968 | Bacteria | 2121 |
| 288 | Ga0157379_10235537 | 3300014968 | Bacteria | 1660 |
| 289 | Ga0157379_10243180 | 3300014968 | Bacteria | 1632 |
| 290 | Ga0157376_10046380 | 3300014969 | Bacteria | 3583 |
| 291 | Ga0157376_10073833 | 3300014969 | Bacteria | 2906 |
| 292 | Ga0157376_10188321 | 3300014969 | Bacteria | 1890 |
| 293 | Ga0157376_10188541 | 3300014969 | Bacteria | 1889 |
| 294 | Ga0163161_10000452 | 3300017792 | Bacteria | 34028 |
| 295 | Ga0163161_10000544 | 3300017792 | Bacteria | 30601 |
| 296 | Ga0163161_10016234 | 3300017792 | Bacteria | 5196 |
| 297 | Ga0163161_10060989 | 3300017792 | Bacteria | 2746 |
| 298 | Ga0213872_10000200 | 3300021361 | Bacteria | 53095 |
| 299 | Ga0213872_10001773 | 3300021361 | Bacteria | 13482 |
| 300 | Ga0213872_10039856 | 3300021361 | Bacteria | 2144 |
| 301 | Ga0213872_10066252 | 3300021361 | Bacteria | 1630 |
| 302 | Ga0213875_10011902 | 3300021388 | Bacteria | 4314 |
| 303 | Ga0209147_101709 | 3300025229 | Bacteria | 7116 |
| 304 | Ga0209026_1000877 | 3300025250 | Bacteria | 15658 |
| 305 | Ga0209148_1000061 | 3300025254 | Bacteria | 349575 |
| 306 | Ga0209233_1000140 | 3300025261 | Bacteria | 193274 |
| 307 | Ga0209233_1007598 | 3300025261 | Bacteria | 3419 |
| 308 | Ga0209565_1000183 | 3300025263 | Bacteria | 76983 |
| 309 | Ga0209673_1001961 | 3300025273 | Bacteria | 16105 |
| 310 | Ga0209130_1000293 | 3300025284 | Bacteria | 60879 |
| 311 | Ga0209130_1009047 | 3300025284 | Bacteria | 2875 |
| 312 | Ga0209676_1000169 | 3300025292 | Bacteria | 155600 |
| 313 | Ga0209025_1000752 | 3300025294 | Bacteria | 54324 |
| 314 | Ga0209025_1000951 | 3300025294 | Bacteria | 43851 |
| 315 | Ga0209025_1002146 | 3300025294 | Bacteria | 22064 |
| 316 | Ga0209025_1006808 | 3300025294 | Bacteria | 8742 |
| 317 | Ga0209025_1007249 | 3300025294 | Bacteria | 8338 |
| 318 | Ga0209564_1000446 | 3300025295 | Bacteria | 70931 |
| 319 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 320 | Ga0209758_1001070 | 3300025297 | Bacteria | 35640 |
| 321 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 322 | Ga0209050_1000281 | 3300025298 | Bacteria | 108751 |
| 323 | Ga0209050_1001476 | 3300025298 | Bacteria | 25065 |
| 324 | Ga0209256_1000694 | 3300025299 | Bacteria | 44757 |
| 325 | Ga0209256_1003679 | 3300025299 | Bacteria | 10441 |
| 326 | Ga0209256_1010220 | 3300025299 | Bacteria | 3964 |
| 327 | Ga0209051_1002448 | 3300025303 | Bacteria | 13308 |
| 328 | Ga0209257_1000271 | 3300025304 | Bacteria | 118632 |
| 329 | Ga0209257_1000352 | 3300025304 | Bacteria | 94530 |
| 330 | Ga0209257_1002028 | 3300025304 | Bacteria | 21626 |
| 331 | Ga0207656_10022483 | 3300025321 | Bacteria | 2530 |
| 332 | Ga0207696_1000581 | 3300025711 | Bacteria | 28394 |
| 333 | Ga0207696_1001509 | 3300025711 | Bacteria | 12510 |
| 334 | Ga0207696_1015009 | 3300025711 | Bacteria | 2637 |
| 335 | Ga0207655_1001408 | 3300025728 | Bacteria | 22389 |
| 336 | Ga0207713_1017865 | 3300025735 | Bacteria | 3533 |
| 337 | Ga0207713_1022919 | 3300025735 | Bacteria | 2952 |
| 338 | Ga0207653_10000077 | 3300025885 | Bacteria | 72458 |
| 339 | Ga0207710_10002790 | 3300025900 | Bacteria | 7980 |
| 340 | Ga0207710_10069272 | 3300025900 | Bacteria | 1615 |
| 341 | Ga0207680_10040016 | 3300025903 | Bacteria | 2724 |
| 342 | Ga0207647_10001763 | 3300025904 | Bacteria | 16610 |
| 343 | Ga0207685_10001509 | 3300025905 | Bacteria | 4918 |
| 344 | Ga0207699_10000006 | 3300025906 | Bacteria | 430147 |
| 345 | Ga0207699_10024850 | 3300025906 | Bacteria | 3282 |
| 346 | Ga0207705_10004604 | 3300025909 | Bacteria | 10406 |
| 347 | Ga0207705_10040471 | 3300025909 | Bacteria | 3343 |
| 348 | Ga0207705_10132233 | 3300025909 | Bacteria | 1858 |
| 349 | Ga0207684_10000120 | 3300025910 | Bacteria | 144506 |
| 350 | Ga0207654_10000114 | 3300025911 | Bacteria | 51955 |
| 351 | Ga0207707_10040031 | 3300025912 | Bacteria | 4095 |
| 352 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 353 | Ga0207695_10000194 | 3300025913 | Bacteria | 171422 |
| 354 | Ga0207695_10000428 | 3300025913 | Bacteria | 93076 |
| 355 | Ga0207695_10000589 | 3300025913 | Bacteria | 73210 |
| 356 | Ga0207695_10008752 | 3300025913 | Bacteria | 12620 |
| 357 | Ga0207695_10010485 | 3300025913 | Bacteria | 11335 |
| 358 | Ga0207695_10013141 | 3300025913 | Bacteria | 9883 |
| 359 | Ga0207695_10015840 | 3300025913 | Bacteria | 8857 |
| 360 | Ga0207695_10023789 | 3300025913 | Bacteria | 6914 |
| 361 | Ga0207695_10027625 | 3300025913 | Bacteria | 6314 |
| 362 | Ga0207695_10170116 | 3300025913 | Bacteria | 2105 |
| 363 | Ga0207671_10000221 | 3300025914 | Bacteria | 85673 |
| 364 | Ga0207671_10073447 | 3300025914 | Bacteria | 2554 |
| 365 | Ga0207671_10099936 | 3300025914 | Bacteria | 2196 |
| 366 | Ga0207671_10166777 | 3300025914 | Bacteria | 1708 |
| 367 | Ga0207693_10007955 | 3300025915 | Bacteria | 8711 |
| 368 | Ga0207693_10085740 | 3300025915 | Bacteria | 2467 |
| 369 | Ga0207663_10000166 | 3300025916 | Bacteria | 29800 |
| 370 | Ga0207660_10011251 | 3300025917 | Bacteria | 5820 |
| 371 | Ga0207660_10099753 | 3300025917 | Bacteria | 2167 |
| 372 | Ga0207657_10020704 | 3300025919 | Bacteria | 6210 |
| 373 | Ga0207657_10045003 | 3300025919 | Bacteria | 3876 |
| 374 | Ga0207649_10001138 | 3300025920 | Bacteria | 16096 |
| 375 | Ga0207649_10016461 | 3300025920 | Bacteria | 4171 |
| 376 | Ga0207652_10000794 | 3300025921 | Bacteria | 30152 |
| 377 | Ga0207652_10119570 | 3300025921 | Bacteria | 2343 |
| 378 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 379 | Ga0207681_10000062 | 3300025923 | Bacteria | 99856 |
| 380 | Ga0207681_10058084 | 3300025923 | Bacteria | 2647 |
| 381 | Ga0207694_10000036 | 3300025924 | Bacteria | 194034 |
| 382 | Ga0207694_10003477 | 3300025924 | Bacteria | 12524 |
| 383 | Ga0207694_10006128 | 3300025924 | Bacteria | 9190 |
| 384 | Ga0207694_10009773 | 3300025924 | Bacteria | 7238 |
| 385 | Ga0207694_10021286 | 3300025924 | Bacteria | 4913 |
| 386 | Ga0207694_10029179 | 3300025924 | Bacteria | 4207 |
| 387 | Ga0207694_10075275 | 3300025924 | Bacteria | 2642 |
| 388 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 389 | Ga0207650_10026035 | 3300025925 | Bacteria | 4169 |
| 390 | Ga0207687_10198584 | 3300025927 | Bacteria | 1566 |
| 391 | Ga0207700_10020215 | 3300025928 | Bacteria | 4516 |
| 392 | Ga0207664_10034634 | 3300025929 | Bacteria | 3890 |
| 393 | Ga0207644_10002784 | 3300025931 | Bacteria | 11268 |
| 394 | Ga0207644_10002871 | 3300025931 | Bacteria | 11108 |
| 395 | Ga0207644_10022945 | 3300025931 | Bacteria | 4268 |
| 396 | Ga0207644_10039084 | 3300025931 | Bacteria | 3347 |
| 397 | Ga0207644_10088743 | 3300025931 | Bacteria | 2300 |
| 398 | Ga0207644_10177263 | 3300025931 | Bacteria | 1668 |
| 399 | Ga0207686_10149888 | 3300025934 | Bacteria | 1622 |
| 400 | Ga0207669_10070919 | 3300025937 | Bacteria | 2187 |
| 401 | Ga0207704_10055374 | 3300025938 | Bacteria | 2424 |
| 402 | Ga0207665_10027767 | 3300025939 | Bacteria | 3739 |
| 403 | Ga0207665_10055940 | 3300025939 | Bacteria | 2663 |
| 404 | Ga0207691_10244996 | 3300025940 | Bacteria | 1548 |
| 405 | Ga0207711_10000199 | 3300025941 | Bacteria | 64399 |
| 406 | Ga0207711_10000670 | 3300025941 | Bacteria | 34027 |
| 407 | Ga0207711_10002295 | 3300025941 | Bacteria | 17157 |
| 408 | Ga0207711_10013688 | 3300025941 | Bacteria | 6736 |
| 409 | Ga0207711_10068377 | 3300025941 | Bacteria | 3076 |
| 410 | Ga0207711_10114443 | 3300025941 | Bacteria | 2402 |
| 411 | Ga0207711_10165755 | 3300025941 | Bacteria | 2003 |
| 412 | Ga0207689_10012614 | 3300025942 | Bacteria | 7219 |
| 413 | Ga0207667_10000035 | 3300025949 | Bacteria | 301056 |
| 414 | Ga0207667_10001527 | 3300025949 | Bacteria | 29084 |
| 415 | Ga0207667_10005014 | 3300025949 | Bacteria | 16183 |
| 416 | Ga0207667_10059545 | 3300025949 | Bacteria | 3999 |
| 417 | Ga0207667_10155291 | 3300025949 | Bacteria | 2355 |
| 418 | Ga0207712_10011809 | 3300025961 | Bacteria | 5569 |
| 419 | Ga0207712_10137811 | 3300025961 | Bacteria | 1869 |
| 420 | Ga0207668_10000232 | 3300025972 | Bacteria | 37304 |
| 421 | Ga0207668_10032169 | 3300025972 | Bacteria | 3463 |
| 422 | Ga0207640_10036243 | 3300025981 | Unclassified | 3095 |
| 423 | Ga0207640_10080138 | 3300025981 | Bacteria | 2228 |
| 424 | Ga0207658_10000127 | 3300025986 | Bacteria | 83164 |
| 425 | Ga0207658_10000461 | 3300025986 | Bacteria | 38068 |
| 426 | Ga0207658_10000620 | 3300025986 | Bacteria | 31373 |
| 427 | Ga0207658_10001616 | 3300025986 | Bacteria | 17297 |
| 428 | Ga0207658_10007015 | 3300025986 | Bacteria | 7672 |
| 429 | Ga0207658_10102277 | 3300025986 | Bacteria | 2247 |
| 430 | Ga0207658_10217974 | 3300025986 | Bacteria | 1603 |
| 431 | Ga0207703_10000241 | 3300026035 | Bacteria | 62119 |
| 432 | Ga0207703_10000571 | 3300026035 | Bacteria | 37816 |
| 433 | Ga0207703_10000672 | 3300026035 | Bacteria | 34115 |
| 434 | Ga0207703_10000928 | 3300026035 | Bacteria | 28509 |
| 435 | Ga0207703_10003948 | 3300026035 | Bacteria | 12292 |
| 436 | Ga0207703_10047627 | 3300026035 | Bacteria | 3457 |
| 437 | Ga0207703_10300151 | 3300026035 | Bacteria | 1464 |
| 438 | Ga0207639_10000049 | 3300026041 | Bacteria | 124603 |
| 439 | Ga0207639_10005593 | 3300026041 | Bacteria | 8499 |
| 440 | Ga0207639_10013114 | 3300026041 | Bacteria | 5789 |
| 441 | Ga0207639_10115375 | 3300026041 | Bacteria | 2196 |
| 442 | Ga0207678_10020494 | 3300026067 | Bacteria | 5796 |
| 443 | Ga0207702_10021330 | 3300026078 | Bacteria | 5362 |
| 444 | Ga0207702_10050841 | 3300026078 | Bacteria | 3500 |
| 445 | Ga0207641_10000079 | 3300026088 | Bacteria | 141110 |
| 446 | Ga0207641_10000286 | 3300026088 | Bacteria | 63418 |
| 447 | Ga0207641_10000956 | 3300026088 | Bacteria | 29693 |
| 448 | Ga0207641_10012322 | 3300026088 | Bacteria | 7015 |
| 449 | Ga0207641_10013254 | 3300026088 | Bacteria | 6760 |
| 450 | Ga0207641_10026977 | 3300026088 | Bacteria | 4744 |
| 451 | Ga0207641_10052144 | 3300026088 | Bacteria | 3464 |
| 452 | Ga0207641_10109238 | 3300026088 | Bacteria | 2449 |
| 453 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 454 | Ga0207676_10000188 | 3300026095 | Bacteria | 54316 |
| 455 | Ga0207676_10003130 | 3300026095 | Bacteria | 11812 |
| 456 | Ga0207674_10010712 | 3300026116 | Bacteria | 10354 |
| 457 | Ga0207674_10016813 | 3300026116 | Bacteria | 7996 |
| 458 | Ga0207674_10243479 | 3300026116 | Unclassified | 1745 |
| 459 | Ga0207675_100000317 | 3300026118 | Bacteria | 45991 |
| 460 | Ga0207675_100000349 | 3300026118 | Bacteria | 44097 |
| 461 | Ga0207683_10008199 | 3300026121 | Bacteria | 8939 |
| 462 | Ga0207683_10008681 | 3300026121 | Bacteria | 8688 |
| 463 | Ga0207683_10008794 | 3300026121 | Bacteria | 8620 |
| 464 | Ga0207698_10000037 | 3300026142 | Bacteria | 103991 |
| 465 | Ga0207698_10002792 | 3300026142 | Bacteria | 10426 |
| 466 | Ga0207698_10188083 | 3300026142 | Bacteria | 1836 |
| 467 | Ga0209813_10002394 | 3300027866 | Bacteria | 4302 |
| 468 | Ga0268266_10000124 | 3300028379 | Bacteria | 153051 |
| 469 | Ga0268266_10000504 | 3300028379 | Bacteria | 55785 |
| 470 | Ga0268266_10002863 | 3300028379 | Bacteria | 17953 |
| 471 | Ga0268266_10037863 | 3300028379 | Bacteria | 4107 |
| 472 | Ga0268266_10201744 | 3300028379 | Bacteria | 1820 |
| 473 | Ga0268266_10341695 | 3300028379 | Bacteria | 1405 |
| 474 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 475 | Ga0268265_10000654 | 3300028380 | Bacteria | 34397 |
| 476 | Ga0268265_10009536 | 3300028380 | Bacteria | 6555 |
| 477 | Ga0268265_10057841 | 3300028380 | Bacteria | 2957 |
| 478 | Ga0268265_10088162 | 3300028380 | Bacteria | 2471 |
| 479 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 480 | Ga0268264_10000166 | 3300028381 | Bacteria | 146960 |
| 481 | Ga0268264_10011531 | 3300028381 | Bacteria | 7302 |
| 482 | Ga0268264_10014719 | 3300028381 | Bacteria | 6427 |
| 483 | Ga0268264_10015733 | 3300028381 | Bacteria | 6195 |
| 484 | Ga0268264_10020123 | 3300028381 | Bacteria | 5453 |
| 485 | Ga0268264_10077427 | 3300028381 | Bacteria | 2833 |
| 486 | Ga0268264_10141191 | 3300028381 | Bacteria | 2148 |
| 487 | Ga0307517_10064858 | 3300028786 | Bacteria | 3389 |
| 488 | Ga0307515_10005727 | 3300028794 | Bacteria | 25096 |
| 489 | Ga0307515_10133246 | 3300028794 | Bacteria | 2720 |
| 490 | Ga0265338_10010092 | 3300028800 | Bacteria | 11158 |
| 491 | Ga0265338_10043201 | 3300028800 | Bacteria | 4183 |
| 492 | Ga0265338_10068653 | 3300028800 | Bacteria | 3052 |
| 493 | Ga0237817_10004 | 3300030083 | Bacteria | 96242 |
| 494 | Ga0307511_10000403 | 3300030521 | Bacteria | 46006 |
| 495 | Ga0307511_10023061 | 3300030521 | Bacteria | 5814 |
| 496 | Ga0307511_10052012 | 3300030521 | Bacteria | 3272 |
| 497 | Ga0265328_10005696 | 3300031239 | Bacteria | 5323 |
| 498 | Ga0265328_10013792 | 3300031239 | Bacteria | 3192 |
| 499 | Ga0265320_10000015 | 3300031240 | Bacteria | 198537 |
| 500 | Ga0265320_10020085 | 3300031240 | Bacteria | 3631 |
| 501 | Ga0265340_10003747 | 3300031247 | Bacteria | 8557 |
| 502 | Ga0265340_10006930 | 3300031247 | Bacteria | 6190 |
| 503 | Ga0265340_10064928 | 3300031247 | Unclassified | 1739 |
| 504 | Ga0265339_10000031 | 3300031249 | Bacteria | 133838 |
| 505 | Ga0265339_10028565 | 3300031249 | Bacteria | 3171 |
| 506 | Ga0265331_10011667 | 3300031250 | Bacteria | 4804 |
| 507 | Ga0265316_10005257 | 3300031344 | Bacteria | 12641 |
| 508 | Ga0265316_10006928 | 3300031344 | Bacteria | 10749 |
| 509 | Ga0265316_10008777 | 3300031344 | Bacteria | 9343 |
| 510 | Ga0265316_10009534 | 3300031344 | Bacteria | 8932 |
| 511 | Ga0265316_10025277 | 3300031344 | Bacteria | 4959 |
| 512 | Ga0265316_10045089 | 3300031344 | Bacteria | 3503 |
| 513 | Ga0307513_10018516 | 3300031456 | Bacteria | 8317 |
| 514 | Ga0307513_10077216 | 3300031456 | Bacteria | 3450 |
| 515 | Ga0307513_10119798 | 3300031456 | Bacteria | 2603 |
| 516 | Ga0307509_10000130 | 3300031507 | Bacteria | 111098 |
| 517 | Ga0307508_10000126 | 3300031616 | Bacteria | 91143 |
| 518 | Ga0265314_10003138 | 3300031711 | Bacteria | 16218 |
| 519 | Ga0265314_10112977 | 3300031711 | Bacteria | 1723 |
| 520 | Ga0265342_10004281 | 3300031712 | Bacteria | 11308 |
| 521 | Ga0265342_10010688 | 3300031712 | Bacteria | 6342 |
| 522 | Ga0265342_10036416 | 3300031712 | Bacteria | 3006 |
| 523 | Ga0265342_10074316 | 3300031712 | Bacteria | 1975 |
| 524 | Ga0307510_10000011 | 3300033180 | Bacteria | 355464 |
| 525 | Ga0307510_10004620 | 3300033180 | Bacteria | 16234 |
| 526 | Ga0307510_10033334 | 3300033180 | Bacteria | 5786 |
| 527 | Ga0307510_10063757 | 3300033180 | Bacteria | 3749 |
| 528 | Ga0307510_10132960 | 3300033180 | Bacteria | 2154 |
| 529 | Ga0307510_10140117 | 3300033180 | Bacteria | 2064 |
| 530 | Ga0373955_0164656 | 3300035172 | Bacteria | 1310 |
| 531 | Ga0373927_0032204 | 3300035695 | Bacteria | 3414 |
| 532 | Ga0373927_0109687 | 3300035695 | Bacteria | 1798 |
| 533 | Ga0373937_0055077 | 3300036401 | Bacteria | 3650 |
| 534 | Ga0373937_0127780 | 3300036401 | Bacteria | 2372 |
| 535 | Ga0395899_0000307 | 3300037312 | Bacteria | 62610 |
| 536 | Ga0395900_0000052 | 3300037418 | Bacteria | 223910 |
| 537 | Ga0395900_0121822 | 3300037418 | Bacteria | 2676 |
| 538 | Ga0395900_0256511 | 3300037418 | Bacteria | 1748 |
| 539 | Ga0395898_0185834 | 3300037466 | Bacteria | 1986 |
| 540 | Ga0395905_0000102 | 3300037471 | Bacteria | 143700 |
| 541 | Ga0395905_0002282 | 3300037471 | Bacteria | 21521 |
| 542 | Ga0395905_0168713 | 3300037471 | Bacteria | 2056 |
| 543 | Ga0395905_0225808 | 3300037471 | Bacteria | 1752 |
| 544 | Ga0436364_0044893 | 3300037853 | Bacteria | 10746 |
| 545 | Ga0436364_1291741 | 3300037853 | Bacteria | 2071 |
| 546 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 547 | Ga0237819_00386 | 3300038705 | Bacteria | 15439 |
| 548 | Ga0237819_00409 | 3300038705 | Bacteria | 14853 |
| 549 | Ga0436365_1702795 | 3300039437 | Bacteria | 3124 |
| 550 | Ga0436360_0435012 | 3300039438 | Bacteria | 1692 |
| 551 | Ga0436361_0080963 | 3300039447 | Bacteria | 3667 |
| 552 | Ga0436361_0369936 | 3300039447 | Bacteria | 1551 |
| 553 | Ga0436361_0435899 | 3300039447 | Bacteria | 3168 |
| 554 | Ga0436361_0873977 | 3300039447 | Bacteria | 1674 |
| 555 | Ga0436361_0909611 | 3300039447 | Bacteria | 23210 |
| 556 | Ga0436361_1209734 | 3300039447 | Bacteria | 33478 |
| 557 | Ga0451853_0660934 | 3300041512 | Bacteria | 1913 |
| 558 | Ga0439448_0001017 | 3300042005 | Bacteria | 7005 |
| 559 | Ga0439455_0000178 | 3300042012 | Bacteria | 7325 |
| 560 | Ga0439446_0005828 | 3300042156 | Bacteria | 3185 |
| 561 | Ga0466969_0003474 | 3300044656 | Bacteria | 8376 |
| 562 | Ga0466972_0000305 | 3300044658 | Bacteria | 28977 |
| 563 | Ga0453683_0006953 | 3300044673 | Bacteria | 7715 |
| 564 | Ga0453683_0111057 | 3300044673 | Bacteria | 1724 |
| 565 | Ga0466961_0039491 | 3300044693 | Bacteria | 3026 |
| 566 | Ga0466964_0004635 | 3300044706 | Bacteria | 5084 |
| 567 | Ga0466960_0006918 | 3300044901 | Bacteria | 4574 |
| 568 | Ga0466959_0015518 | 3300045049 | Bacteria | 5551 |
| 569 | Ga0466959_0031259 | 3300045049 | Bacteria | 3940 |
| 570 | Ga0451576_0110944 | 3300045051 | Bacteria | 2854 |
| 571 | Ga0466958_0000243 | 3300045836 | Bacteria | 20957 |
| 572 | Ga0466967_0000057 | 3300045976 | Bacteria | 40180 |
| 573 | Ga0466967_0080537 | 3300045976 | Unclassified | 2939 |
| 574 | Ga0495627_001472 | 3300046453 | Bacteria | 13699 |
| 575 | Ga0495627_002884 | 3300046453 | Bacteria | 7919 |
| 576 | Ga0495592_0075874 | 3300046454 | Bacteria | 2440 |
| 577 | Ga0495592_0122538 | 3300046454 | Bacteria | 1827 |
| 578 | Ga0495590_0001116 | 3300046457 | Bacteria | 11761 |
| 579 | Ga0495629_0010818 | 3300046459 | Bacteria | 6637 |
| 580 | Ga0495629_0012092 | 3300046459 | Bacteria | 6257 |
| 581 | Ga0495638_0000029 | 3300046460 | Bacteria | 330201 |
| 582 | Ga0495638_0000097 | 3300046460 | Bacteria | 141017 |
| 583 | Ga0495638_0000230 | 3300046460 | Bacteria | 76565 |
| 584 | Ga0495638_0000768 | 3300046460 | Bacteria | 34065 |
| 585 | Ga0495638_0001674 | 3300046460 | Bacteria | 19617 |
| 586 | Ga0495638_0002405 | 3300046460 | Bacteria | 15314 |
| 587 | Ga0495638_0052036 | 3300046460 | Bacteria | 2552 |
| 588 | Ga0495638_0103253 | 3300046460 | Bacteria | 1702 |
| 589 | Ga0495651_0014106 | 3300046462 | Bacteria | 6179 |
| 590 | Ga0495651_0066244 | 3300046462 | Bacteria | 2757 |
| 591 | Ga0495653_0006478 | 3300046463 | Bacteria | 9602 |
| 592 | Ga0495653_0072953 | 3300046463 | Bacteria | 2562 |
| 593 | Ga0495650_0000207 | 3300046471 | Bacteria | 127568 |
| 594 | Ga0495650_0000507 | 3300046471 | Bacteria | 58153 |
| 595 | Ga0495650_0004993 | 3300046471 | Bacteria | 8827 |
| 596 | Ga0495650_0007626 | 3300046471 | Bacteria | 6462 |
| 597 | Ga0495580_0010829 | 3300046472 | Bacteria | 7077 |
| 598 | Ga0495582_0016198 | 3300046473 | Bacteria | 4084 |
| 599 | Ga0495639_0001872 | 3300046475 | Bacteria | 9318 |
| 600 | Ga0495662_0009632 | 3300046476 | Bacteria | 4736 |
| 601 | Ga0495662_0025364 | 3300046476 | Bacteria | 2862 |
| 602 | Ga0495664_0005007 | 3300046477 | Bacteria | 7254 |
| 603 | Ga0495594_0001478 | 3300046499 | Bacteria | 12191 |
| 604 | Ga0495594_0021779 | 3300046499 | Bacteria | 3422 |
| 605 | Ga0495596_0000042 | 3300046500 | Bacteria | 90746 |
| 606 | Ga0495596_0000782 | 3300046500 | Bacteria | 19374 |
| 607 | Ga0495607_0002129 | 3300046501 | Bacteria | 16523 |
| 608 | Ga0495583_0000025 | 3300046506 | Bacteria | 263775 |
| 609 | Ga0495583_0000913 | 3300046506 | Bacteria | 34983 |
| 610 | Ga0495583_0000997 | 3300046506 | Bacteria | 32399 |
| 611 | Ga0495583_0065571 | 3300046506 | Bacteria | 1609 |
| 612 | Ga0495606_0002191 | 3300046507 | Bacteria | 23435 |
| 613 | Ga0495606_0021604 | 3300046507 | Bacteria | 4712 |
| 614 | Ga0495610_0000044 | 3300046512 | Bacteria | 156847 |
| 615 | Ga0495610_0000140 | 3300046512 | Bacteria | 80219 |
| 616 | Ga0495610_0004058 | 3300046512 | Bacteria | 10993 |
| 617 | Ga0495610_0005028 | 3300046512 | Bacteria | 9561 |
| 618 | Ga0495610_0007327 | 3300046512 | Bacteria | 7375 |
| 619 | Ga0495616_0000009 | 3300046513 | Bacteria | 225502 |
| 620 | Ga0495616_0000105 | 3300046513 | Bacteria | 72439 |
| 621 | Ga0495620_0016175 | 3300046515 | Bacteria | 3751 |
| 622 | Ga0495620_0020458 | 3300046515 | Bacteria | 3231 |
| 623 | Ga0495628_0020334 | 3300046516 | Bacteria | 5478 |
| 624 | Ga0495630_0049678 | 3300046517 | Bacteria | 3139 |
| 625 | Ga0495631_0009701 | 3300046518 | Bacteria | 4800 |
| 626 | Ga0495631_0029316 | 3300046518 | Bacteria | 2504 |
| 627 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 628 | Ga0495632_0000548 | 3300046519 | Bacteria | 35165 |
| 629 | Ga0495632_0001216 | 3300046519 | Bacteria | 21835 |
| 630 | Ga0495632_0006687 | 3300046519 | Bacteria | 7370 |
| 631 | Ga0495632_0042069 | 3300046519 | Bacteria | 2292 |
| 632 | Ga0495632_0044015 | 3300046519 | Bacteria | 2229 |
| 633 | Ga0495637_0000065 | 3300046520 | Bacteria | 89961 |
| 634 | Ga0495637_0014041 | 3300046520 | Bacteria | 3788 |
| 635 | Ga0495643_0000006 | 3300046522 | Bacteria | 419524 |
| 636 | Ga0495643_0000023 | 3300046522 | Bacteria | 288590 |
| 637 | Ga0495643_0020344 | 3300046522 | Bacteria | 3827 |
| 638 | Ga0495643_0027011 | 3300046522 | Bacteria | 3230 |
| 639 | Ga0495643_0032491 | 3300046522 | Bacteria | 2897 |
| 640 | Ga0495648_0000020 | 3300046524 | Bacteria | 254330 |
| 641 | Ga0495648_0000024 | 3300046524 | Bacteria | 235605 |
| 642 | Ga0495648_0000039 | 3300046524 | Bacteria | 185430 |
| 643 | Ga0495663_0000001 | 3300046525 | Bacteria | 595264 |
| 644 | Ga0495663_0008113 | 3300046525 | Bacteria | 2905 |
| 645 | Ga0495663_0008171 | 3300046525 | Bacteria | 2896 |
| 646 | Ga0495666_0008071 | 3300046526 | Bacteria | 5279 |
| 647 | Ga0495652_0011950 | 3300046529 | Bacteria | 7851 |
| 648 | Ga0495652_0018558 | 3300046529 | Bacteria | 6200 |
| 649 | Ga0495654_0000016 | 3300046530 | Bacteria | 306416 |
| 650 | Ga0495665_0037746 | 3300046531 | Bacteria | 2577 |
| 651 | Ga0495640_0005892 | 3300046533 | Bacteria | 9719 |
| 652 | Ga0495587_0018167 | 3300046536 | Bacteria | 4362 |
| 653 | Ga0495587_0027874 | 3300046536 | Bacteria | 3439 |
| 654 | Ga0495587_0038200 | 3300046536 | Bacteria | 2880 |
| 655 | Ga0495609_0006904 | 3300046538 | Bacteria | 5730 |
| 656 | Ga0495597_0005066 | 3300046542 | Bacteria | 7040 |
| 657 | Ga0495645_0016723 | 3300046543 | Bacteria | 5246 |
| 658 | Ga0495645_0083729 | 3300046543 | Bacteria | 2286 |
| 659 | Ga0495645_0185974 | 3300046543 | Bacteria | 1419 |
| 660 | Ga0495622_0004603 | 3300046557 | Bacteria | 6389 |
| 661 | Ga0495633_0000053 | 3300046558 | Bacteria | 152374 |
| 662 | Ga0495633_0002210 | 3300046558 | Bacteria | 13928 |
| 663 | Ga0495633_0004208 | 3300046558 | Bacteria | 9221 |
| 664 | Ga0495668_0000040 | 3300046616 | Bacteria | 230681 |
| 665 | Ga0495668_0001965 | 3300046616 | Bacteria | 18106 |
| 666 | Ga0495668_0003290 | 3300046616 | Bacteria | 12251 |
| 667 | Ga0495668_0017143 | 3300046616 | Bacteria | 4206 |
| 668 | Ga0495668_0021863 | 3300046616 | Bacteria | 3661 |
| 669 | Ga0495668_0025141 | 3300046616 | Bacteria | 3385 |
| 670 | Ga0495634_0016623 | 3300046642 | Bacteria | 5258 |
| 671 | Ga0495611_0074587 | 3300046648 | Bacteria | 1554 |
| 672 | Ga0495625_0000043 | 3300046660 | Bacteria | 205715 |
| 673 | Ga0495625_0000309 | 3300046660 | Bacteria | 74356 |
| 674 | Ga0495625_0005652 | 3300046660 | Bacteria | 11333 |
| 675 | Ga0495625_0011140 | 3300046660 | Bacteria | 7359 |
| 676 | Ga0495625_0021125 | 3300046660 | Bacteria | 5016 |
| 677 | Ga0495625_0026481 | 3300046660 | Bacteria | 4382 |
| 678 | Ga0495625_0088495 | 3300046660 | Bacteria | 2145 |
| 679 | Ga0495635_0005335 | 3300046663 | Bacteria | 8947 |
| 680 | Ga0495635_0011701 | 3300046663 | Bacteria | 6151 |
| 681 | Ga0495661_0053680 | 3300046665 | Bacteria | 2423 |
| 682 | Ga0495599_0015557 | 3300046678 | Bacteria | 4723 |
| 683 | Ga0495599_0022266 | 3300046678 | Bacteria | 3955 |
| 684 | Ga0495599_0034708 | 3300046678 | Bacteria | 3168 |
| 685 | Ga0495613_0004523 | 3300046689 | Bacteria | 10425 |
| 686 | Ga0495613_0008424 | 3300046689 | Bacteria | 7653 |
| 687 | Ga0495613_0167852 | 3300046689 | Bacteria | 1559 |
| 688 | Ga0495624_0016039 | 3300046690 | Bacteria | 5043 |
| 689 | Ga0495670_0126148 | 3300046691 | Bacteria | 1332 |
| 690 | Ga0495671_0000008 | 3300046692 | Bacteria | 419524 |
| 691 | Ga0495671_0000022 | 3300046692 | Bacteria | 255591 |
| 692 | Ga0495600_0004065 | 3300046809 | Bacteria | 8701 |
| 693 | Ga0495600_0093711 | 3300046809 | Bacteria | 1958 |
| 694 | Ga0495600_0128654 | 3300046809 | Bacteria | 1646 |
| 695 | Ga0495581_0007250 | 3300047315 | Bacteria | 6414 |
| 696 | Ga0495604_0033035 | 3300047317 | Bacteria | 4097 |
| 697 | Ga0495604_0040496 | 3300047317 | Bacteria | 3658 |
| 698 | Ga0495604_0138315 | 3300047317 | Bacteria | 1743 |
| 699 | Ga0495636_0011288 | 3300047318 | Bacteria | 3535 |
| 700 | Ga0495636_0033267 | 3300047318 | Bacteria | 2117 |
| 701 | Ga0495674_0009581 | 3300047319 | Bacteria | 9199 |
| 702 | Ga0495674_0052629 | 3300047319 | Bacteria | 3582 |
| 703 | Ga0495674_0077543 | 3300047319 | Bacteria | 2856 |
| 704 | Ga0495672_0003581 | 3300047320 | Bacteria | 13210 |
| 705 | Ga0495672_0004568 | 3300047320 | Bacteria | 11254 |
| 706 | Ga0495676_0004023 | 3300047321 | Bacteria | 13381 |
| 707 | Ga0495680_0028251 | 3300047322 | Bacteria | 4600 |
| 708 | Ga0495683_0067141 | 3300047323 | Bacteria | 1766 |
| 709 | Ga0495687_000045 | 3300047443 | Bacteria | 211968 |
| 710 | Ga0495675_0005027 | 3300047444 | Bacteria | 8045 |
| 711 | Ga0495677_0002017 | 3300047445 | Bacteria | 8109 |
| 712 | Ga0495685_005756 | 3300047447 | Bacteria | 4048 |
| 713 | Ga0495673_0000051 | 3300047469 | Bacteria | 255511 |
| 714 | Ga0495673_0000148 | 3300047469 | Bacteria | 124135 |
| 715 | Ga0495673_0000223 | 3300047469 | Bacteria | 84150 |
| 716 | Ga0495673_0001666 | 3300047469 | Bacteria | 17102 |
| 717 | Ga0495681_0000014 | 3300047470 | Bacteria | 184395 |
| 718 | Ga0495681_0002435 | 3300047470 | Bacteria | 13285 |
| 719 | Ga0495686_0000031 | 3300047472 | Bacteria | 350171 |
| 720 | Ga0495686_0000360 | 3300047472 | Bacteria | 73639 |
| 721 | Ga0495686_0001338 | 3300047472 | Bacteria | 27578 |
| 722 | Ga0495686_0001971 | 3300047472 | Bacteria | 20395 |
| 723 | Ga0495686_0005147 | 3300047472 | Bacteria | 10421 |
| 724 | Ga0495686_0008109 | 3300047472 | Bacteria | 7767 |
| 725 | Ga0495686_0011443 | 3300047472 | Bacteria | 6250 |
| 726 | Ga0495686_0036922 | 3300047472 | Bacteria | 3133 |
| 727 | Ga0495686_0067805 | 3300047472 | Bacteria | 2202 |
| 728 | Ga0495686_0076603 | 3300047472 | Bacteria | 2049 |
| 729 | Ga0495686_0099897 | 3300047472 | Bacteria | 1751 |
| 730 | Ga0495602_0015937 | 3300048088 | Bacteria | 7567 |
| 731 | Ga0495614_0000903 | 3300048089 | Bacteria | 12613 |
| 732 | Ga0495626_0000826 | 3300048091 | Bacteria | 27802 |
| 733 | Ga0496100_0000653 | 3300048903 | Bacteria | 16429 |
| 734 | Ga0496100_0038451 | 3300048903 | Bacteria | 3032 |
| 735 | Ga0496101_0088572 | 3300048904 | Bacteria | 2299 |
| 736 | Ga0496102_0000215 | 3300048905 | Bacteria | 76113 |
| 737 | Ga0496102_0001498 | 3300048905 | Bacteria | 20623 |
| 738 | Ga0496102_0008521 | 3300048905 | Bacteria | 8791 |
| 739 | Ga0496102_0025804 | 3300048905 | Bacteria | 5234 |
| 740 | Ga0496102_0108458 | 3300048905 | Bacteria | 2586 |
| 741 | Ga0496103_0000103 | 3300048906 | Bacteria | 93232 |
| 742 | Ga0496103_0029064 | 3300048906 | Bacteria | 3358 |
| 743 | Ga0496103_0065078 | 3300048906 | Bacteria | 2274 |
| 744 | Ga0496103_0074364 | 3300048906 | Bacteria | 2130 |
| 745 | Ga0496104_0000068 | 3300048907 | Bacteria | 107801 |
| 746 | Ga0496104_0019277 | 3300048907 | Bacteria | 6238 |
| 747 | Ga0496104_0067646 | 3300048907 | Bacteria | 3394 |
| 748 | Ga0496105_0000179 | 3300048908 | Bacteria | 42036 |
| 749 | Ga0496105_0022527 | 3300048908 | Bacteria | 5102 |
| 750 | Ga0496106_0044800 | 3300048909 | Bacteria | 3322 |
| 751 | Ga0496106_0083121 | 3300048909 | Bacteria | 2462 |
| 752 | Ga0496106_0183309 | 3300048909 | Bacteria | 1663 |
| 753 | Ga0496107_0000090 | 3300048910 | Bacteria | 43763 |
| 754 | Ga0496107_0015833 | 3300048910 | Bacteria | 5289 |
| 755 | Ga0496107_0018868 | 3300048910 | Bacteria | 4862 |
| 756 | Ga0496108_0203007 | 3300048911 | Bacteria | 1720 |
| 757 | Ga0496109_0100984 | 3300048912 | Bacteria | 2677 |
| 758 | Ga0496110_0026398 | 3300048913 | Bacteria | 4970 |
| 759 | Ga0496110_0123224 | 3300048913 | Bacteria | 2337 |
| 760 | Ga0496111_0032531 | 3300048914 | Bacteria | 3719 |
| 761 | Ga0496112_0017480 | 3300048915 | Bacteria | 6738 |
| 762 | Ga0496112_0292428 | 3300048915 | Bacteria | 1575 |
| 763 | Ga0496113_0000653 | 3300048916 | Bacteria | 17494 |
| 764 | Ga0496114_0072705 | 3300048917 | Bacteria | 2892 |
| 765 | Ga0496115_0038453 | 3300048918 | Bacteria | 3796 |
| 766 | Ga0496115_0053075 | 3300048918 | Bacteria | 3253 |
| 767 | Ga0496115_0053854 | 3300048918 | Bacteria | 3230 |
| 768 | Ga0496116_0000017 | 3300048919 | Bacteria | 554463 |
| 769 | Ga0496117_0001087 | 3300048920 | Bacteria | 41120 |
| 770 | Ga0496117_0006309 | 3300048920 | Bacteria | 12062 |
| 771 | Ga0496117_0063041 | 3300048920 | Bacteria | 2536 |
| 772 | Ga0496117_0092864 | 3300048920 | Bacteria | 1937 |
| 773 | Ga0496117_0128793 | 3300048920 | Bacteria | 1538 |
| 774 | Ga0496118_0000606 | 3300048921 | Bacteria | 59016 |
| 775 | Ga0496118_0002521 | 3300048921 | Bacteria | 24575 |
| 776 | Ga0496118_0018283 | 3300048921 | Bacteria | 6329 |
| 777 | Ga0496118_0019712 | 3300048921 | Bacteria | 6016 |
| 778 | Ga0496118_0026684 | 3300048921 | Bacteria | 4912 |
| 779 | Ga0496118_0040765 | 3300048921 | Bacteria | 3687 |
| 780 | Ga0496118_0068487 | 3300048921 | Bacteria | 2577 |
| 781 | Ga0496118_0089272 | 3300048921 | Bacteria | 2128 |
| 782 | Ga0496119_0000330 | 3300048922 | Bacteria | 66230 |
| 783 | Ga0496119_0002094 | 3300048922 | Bacteria | 22525 |
| 784 | Ga0496119_0007235 | 3300048922 | Bacteria | 10047 |
| 785 | Ga0496119_0009604 | 3300048922 | Bacteria | 8260 |
| 786 | Ga0496120_0000242 | 3300048923 | Bacteria | 93148 |
| 787 | Ga0496120_0000745 | 3300048923 | Bacteria | 47313 |
| 788 | Ga0496120_0005194 | 3300048923 | Bacteria | 10500 |
| 789 | Ga0496120_0069002 | 3300048923 | Bacteria | 1948 |
| 790 | Ga0496121_0000031 | 3300048924 | Bacteria | 384119 |
| 791 | Ga0496121_0000053 | 3300048924 | Bacteria | 312611 |
| 792 | Ga0496121_0000638 | 3300048924 | Bacteria | 65466 |
| 793 | Ga0496121_0001312 | 3300048924 | Bacteria | 42600 |
| 794 | Ga0496121_0004232 | 3300048924 | Bacteria | 19533 |
| 795 | Ga0496121_0011285 | 3300048924 | Bacteria | 9951 |
| 796 | Ga0496121_0050308 | 3300048924 | Bacteria | 3522 |
| 797 | Ga0496122_0001615 | 3300048925 | Bacteria | 35217 |
| 798 | Ga0496122_0002146 | 3300048925 | Bacteria | 28989 |
| 799 | Ga0496122_0004006 | 3300048925 | Bacteria | 18770 |
| 800 | Ga0496122_0009961 | 3300048925 | Bacteria | 9900 |
| 801 | Ga0496122_0013355 | 3300048925 | Bacteria | 8043 |
| 802 | Ga0496123_0000389 | 3300048926 | Bacteria | 82399 |
| 803 | Ga0496123_0001028 | 3300048926 | Bacteria | 42363 |
| 804 | Ga0496123_0001983 | 3300048926 | Bacteria | 26520 |
| 805 | Ga0496123_0006326 | 3300048926 | Bacteria | 11503 |
| 806 | Ga0496123_0018626 | 3300048926 | Bacteria | 5510 |
| 807 | Ga0496123_0021786 | 3300048926 | Bacteria | 4967 |
| 808 | Ga0496124_0000728 | 3300048927 | Bacteria | 53915 |
| 809 | Ga0496124_0002794 | 3300048927 | Bacteria | 22120 |
| 810 | Ga0496124_0014343 | 3300048927 | Bacteria | 7665 |
| 811 | Ga0496124_0022369 | 3300048927 | Bacteria | 5796 |
| 812 | Ga0496124_0025183 | 3300048927 | Bacteria | 5393 |
| 813 | Ga0496124_0083374 | 3300048927 | Bacteria | 2622 |
| 814 | Ga0496124_0283537 | 3300048927 | Bacteria | 1206 |
| 815 | Ga0496125_0000220 | 3300048928 | Bacteria | 116658 |
| 816 | Ga0496125_0001729 | 3300048928 | Bacteria | 30361 |
| 817 | Ga0496125_0004581 | 3300048928 | Bacteria | 15819 |
| 818 | Ga0496125_0009857 | 3300048928 | Bacteria | 9719 |
| 819 | Ga0496125_0028564 | 3300048928 | Bacteria | 5034 |
| 820 | Ga0496125_0089081 | 3300048928 | Bacteria | 2322 |
| 821 | Ga0496126_0000005 | 3300048929 | Bacteria | 891906 |
| 822 | Ga0496126_0000103 | 3300048929 | Bacteria | 201037 |
| 823 | Ga0496126_0002257 | 3300048929 | Bacteria | 26580 |
| 824 | Ga0496126_0004716 | 3300048929 | Bacteria | 16092 |
| 825 | Ga0496126_0008833 | 3300048929 | Bacteria | 10806 |
| 826 | Ga0496126_0046671 | 3300048929 | Bacteria | 3970 |
| 827 | Ga0496126_0053712 | 3300048929 | Bacteria | 3653 |
| 828 | Ga0495678_000726 | 3300049459 | Bacteria | 29929 |
| 829 | Ga0501031_0010395 | 3300049568 | Bacteria | 6061 |
| 830 | Ga0501032_0000563 | 3300049569 | Bacteria | 30073 |
| 831 | Ga0501033_0001000 | 3300049570 | Bacteria | 25731 |
| 832 | Ga0501034_0002456 | 3300049571 | Bacteria | 22336 |
| 833 | Ga0501034_0080007 | 3300049571 | Bacteria | 3272 |
| 834 | Ga0501036_0000595 | 3300049572 | Bacteria | 26224 |
| 835 | Ga0501038_0002477 | 3300049574 | Bacteria | 17178 |
| 836 | Ga0501043_0005587 | 3300049579 | Bacteria | 10129 |
| 837 | Ga0501046_0000259 | 3300049580 | Bacteria | 53817 |
| 838 | Ga0501047_0000462 | 3300049581 | Bacteria | 44406 |
| 839 | Ga0501070_0132949 | 3300049586 | Bacteria | 2054 |
| 840 | Ga0501073_0013787 | 3300049589 | Bacteria | 5877 |
| 841 | Ga0501217_031165 | 3300049661 | Eukaryota | 1313 |
| 842 | Ga0501249_000096 | 3300049679 | Bacteria | 27572 |
| 843 | Ga0501249_008140 | 3300049679 | Bacteria | 2175 |
| 844 | Ga0501080_0015861 | 3300049742 | Bacteria | 6951 |
| 845 | Ga0501035_0005743 | 3300049822 | Bacteria | 11704 |
| 846 | Ga0501044_0016042 | 3300049823 | Bacteria | 8055 |
| 847 | nmdc:mga00v17_626_c2 | 3300050491 | Bacteria | 11095 |
| 848 | nmdc:mga0k408_151873_c1 | 3300050493 | Bacteria | 1379 |
| 849 | nmdc:mga0k408_161085_c1 | 3300050493 | Bacteria | 1337 |
| 850 | nmdc:mga0k408_37007_c1 | 3300050493 | Bacteria | 2801 |
| 851 | nmdc:mga0k408_53490_c1 | 3300050493 | Bacteria | 2340 |
| 852 | nmdc:mga06z11_7_c1 | 3300050494 | Bacteria | 121804 |
| 853 | nmdc:mga04h51_44_c1 | 3300050495 | Bacteria | 41495 |
| 854 | nmdc:mga07m45_224_c1 | 3300050496 | Bacteria | 6251 |
| 855 | nmdc:mga07m45_22611_c1 | 3300050496 | Bacteria | 3434 |
| 856 | nmdc:mga05p37_1887_c1 | 3300050507 | Bacteria | 24398 |
| 857 | nmdc:mga05p37_201619_c1 | 3300050507 | Bacteria | 2409 |
| 858 | nmdc:mga09592_100944_c1 | 3300050508 | Bacteria | 2471 |
| 859 | nmdc:mga09592_115913_c1 | 3300050508 | Bacteria | 2299 |
| 860 | nmdc:mga09592_116662_c1 | 3300050508 | Bacteria | 2291 |
| 861 | nmdc:mga06r32_103332_c1 | 3300050510 | Bacteria | 2798 |
| 862 | nmdc:mga06r32_38564_c1 | 3300050510 | Bacteria | 4528 |
| 863 | nmdc:mga0n895_307050_c1 | 3300050512 | Bacteria | 1608 |
| 864 | nmdc:mga0rr50_27527_c1 | 3300050513 | Bacteria | 3982 |
| 865 | nmdc:mga0rr50_385134_c1 | 3300050513 | Bacteria | 1183 |
| 866 | nmdc:mga08x19_25_c1 | 3300050514 | Bacteria | 222966 |
| 867 | nmdc:mga08x19_80704_c1 | 3300050514 | Bacteria | 2135 |
| 868 | nmdc:mga0sz30_3618_c1 | 3300050516 | Bacteria | 3892 |
| 869 | nmdc:mga0sz30_43021_c1 | 3300050516 | Bacteria | 1901 |
| 870 | Ga0500635_0000061 | 3300053080 | Bacteria | 71946 |
| 871 | Ga0500578_0000041 | 3300053086 | Bacteria | 129580 |
| 872 | Ga0500643_000170 | 3300053087 | Bacteria | 63864 |
| 873 | Ga0500643_000660 | 3300053087 | Bacteria | 23099 |
| 874 | Ga0500643_000718 | 3300053087 | Bacteria | 21827 |
| 875 | Ga0500643_001750 | 3300053087 | Bacteria | 11992 |
| 876 | Ga0500643_007890 | 3300053087 | Bacteria | 4240 |
| 877 | Ga0500644_0002176 | 3300053088 | Bacteria | 4958 |
| 878 | Ga0500651_0000022 | 3300053093 | Bacteria | 136412 |
| 879 | Ga0500651_0039289 | 3300053093 | Bacteria | 2980 |
| 880 | Ga0500651_0049417 | 3300053093 | Bacteria | 2641 |
| 881 | Ga0500641_0001732 | 3300053096 | Bacteria | 7762 |
| 882 | Ga0500641_0015363 | 3300053096 | Bacteria | 2840 |
| 883 | Ga0500555_001173 | 3300053103 | Bacteria | 8590 |
| 884 | Ga0500555_001444 | 3300053103 | Bacteria | 7280 |
| 885 | Ga0500556_0000408 | 3300053104 | Bacteria | 31362 |
| 886 | Ga0500556_0000688 | 3300053104 | Bacteria | 20792 |
| 887 | Ga0500556_0033350 | 3300053104 | Bacteria | 1765 |
| 888 | Ga0500562_003809 | 3300053108 | Bacteria | 3798 |
| 889 | Ga0500562_009173 | 3300053108 | Bacteria | 2500 |
| 890 | Ga0500572_036862 | 3300053111 | Bacteria | 1399 |
| 891 | Ga0500594_0000094 | 3300053118 | Bacteria | 26295 |
| 892 | Ga0500595_003665 | 3300053119 | Bacteria | 7109 |
| 893 | Ga0500595_006099 | 3300053119 | Bacteria | 5166 |
| 894 | Ga0500595_020044 | 3300053119 | Bacteria | 2414 |
| 895 | Ga0500595_020821 | 3300053119 | Bacteria | 2352 |
| 896 | Ga0500607_000036 | 3300053121 | Bacteria | 87178 |
| 897 | Ga0500607_004589 | 3300053121 | Bacteria | 9439 |
| 898 | Ga0500608_000917 | 3300053122 | Bacteria | 10616 |
| 899 | Ga0500608_003578 | 3300053122 | Bacteria | 5856 |
| 900 | Ga0500614_001255 | 3300053123 | Bacteria | 6139 |
| 901 | Ga0500618_000022 | 3300053125 | Bacteria | 157907 |
| 902 | Ga0500618_003726 | 3300053125 | Bacteria | 5114 |
| 903 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 904 | Ga0500642_0006809 | 3300053130 | Bacteria | 3795 |
| 905 | Ga0500655_002148 | 3300053133 | Bacteria | 3645 |
| 906 | Ga0500655_006939 | 3300053133 | Bacteria | 2036 |
| 907 | Ga0500658_0003121 | 3300053134 | Bacteria | 6334 |
| 908 | Ga0500658_0013133 | 3300053134 | Bacteria | 3057 |
| 909 | Ga0500559_0000010 | 3300053136 | Bacteria | 165569 |
| 910 | Ga0500559_0000054 | 3300053136 | Bacteria | 90695 |
| 911 | Ga0500559_0000927 | 3300053136 | Bacteria | 18564 |
| 912 | Ga0500559_0000952 | 3300053136 | Bacteria | 18219 |
| 913 | Ga0500564_000586 | 3300053138 | Bacteria | 10997 |
| 914 | Ga0500564_016955 | 3300053138 | Bacteria | 3305 |
| 915 | Ga0500577_0000155 | 3300053142 | Bacteria | 17094 |
| 916 | Ga0500604_0015380 | 3300053151 | Bacteria | 2095 |
| 917 | Ga0500616_0006036 | 3300053153 | Bacteria | 8053 |
| 918 | Ga0500616_0008561 | 3300053153 | Bacteria | 6336 |
| 919 | Ga0500616_0013118 | 3300053153 | Bacteria | 4824 |
| 920 | Ga0500622_0000263 | 3300053156 | Bacteria | 53731 |
| 921 | Ga0500622_0004025 | 3300053156 | Bacteria | 9463 |
| 922 | Ga0500622_0004435 | 3300053156 | Bacteria | 8819 |
| 923 | Ga0500622_0006978 | 3300053156 | Bacteria | 6467 |
| 924 | Ga0500624_000008 | 3300053157 | Bacteria | 181801 |
| 925 | Ga0500638_034229 | 3300053162 | Bacteria | 2458 |
| 926 | Ga0500637_0000037 | 3300053178 | Bacteria | 47475 |
| 927 | Ga0500637_0012166 | 3300053178 | Bacteria | 4477 |
| 928 | Ga0500637_0082583 | 3300053178 | Bacteria | 1857 |
| 929 | Ga0500567_000780 | 3300053723 | Bacteria | 11897 |
| 930 | Ga0500625_000001 | 3300053729 | Bacteria | 395993 |
| 931 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 932 | Ga0500645_000716 | 3300053730 | Bacteria | 20575 |
| 933 | Ga0500645_001988 | 3300053730 | Bacteria | 9630 |
| 934 | Ga0500645_003225 | 3300053730 | Bacteria | 6751 |
| 935 | Ga0500645_005582 | 3300053730 | Bacteria | 4606 |
| 936 | Ga0500609_002181 | 3300053731 | Bacteria | 2797 |
| 937 | Ga0500661_002175 | 3300055283 | Bacteria | 3699 |
| 938 | Ga0500661_008361 | 3300055283 | Bacteria | 1903 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046525 | Ga0495663_0008171 | Ga0495663_0008171_13_1155 | 314 |
| 2 | 3300037418 | Ga0395900_0256511 | Ga0395900_0256511_14_1054 | 319 |
| 3 | 3300044673 | Ga0453683_0111057 | Ga0453683_0111057_22_1152 | 336 |
| 4 | 3300050513 | nmdc:mga0rr50_385134_c1 | nmdc:mga0rr50_385134_c1_20_1150 | 336 |
| 5 | 3300010375 | Ga0105239_10142023 | Ga0105239_101420232 | 337 |
| 6 | 3300039447 | Ga0436361_0369936 | Ga0436361_0369936_461_1540 | 341 |
| 7 | 3300048905 | Ga0496102_0108458 | Ga0496102_0108458_1422_2546 | 342 |
| 8 | 3300035172 | Ga0373955_0164656 | Ga0373955_0164656_23_1141 | 343 |
| 9 | 3300050493 | nmdc:mga0k408_161085_c1 | nmdc:mga0k408_161085_c1_240_1322 | 343 |
| 10 | 3300003322 | rootL2_10015516 | rootL2_100155166 | 348 |
| 11 | 3300047472 | Ga0495686_0076603 | Ga0495686_0076603_889_1995 | 351 |
| 12 | 3300050496 | nmdc:mga07m45_22611_c1 | nmdc:mga07m45_22611_c1_14_1174 | 354 |
| 13 | 3300013307 | Ga0157372_10189762 | Ga0157372_101897622 | 355 |
| 14 | 3300048927 | Ga0496124_0283537 | Ga0496124_0283537_12_1196 | 356 |
| 15 | 3300046515 | Ga0495620_0020458 | Ga0495620_0020458_2036_3220 | 357 |
| 16 | 3300046454 | Ga0495592_0075874 | Ga0495592_0075874_208_1515 | 362 |
| 17 | 3300046462 | Ga0495651_0014106 | Ga0495651_0014106_1029_2336 | 362 |
| 18 | 3300046463 | Ga0495653_0072953 | Ga0495653_0072953_68_1375 | 362 |
| 19 | 3300046476 | Ga0495662_0009632 | Ga0495662_0009632_3311_4618 | 362 |
| 20 | 3300046516 | Ga0495628_0020334 | Ga0495628_0020334_2096_3403 | 362 |
| 21 | 3300046529 | Ga0495652_0018558 | Ga0495652_0018558_461_1768 | 362 |
| 22 | 3300046536 | Ga0495587_0027874 | Ga0495587_0027874_1289_2596 | 362 |
| 23 | 3300046543 | Ga0495645_0185974 | Ga0495645_0185974_53_1360 | 362 |
| 24 | 3300046663 | Ga0495635_0011701 | Ga0495635_0011701_3705_5012 | 362 |
| 25 | 3300046678 | Ga0495599_0015557 | Ga0495599_0015557_3322_4629 | 362 |
| 26 | 3300046809 | Ga0495600_0128654 | Ga0495600_0128654_202_1509 | 362 |
| 27 | 3300047317 | Ga0495604_0138315 | Ga0495604_0138315_79_1386 | 362 |
| 28 | 3300047319 | Ga0495674_0009581 | Ga0495674_0009581_3097_4404 | 362 |
| 29 | 3300009093 | Ga0105240_10008070 | Ga0105240_100080705 | 365 |
| 30 | 3300046691 | Ga0495670_0126148 | Ga0495670_0126148_125_1309 | 369 |
| 31 | 3300053151 | Ga0500604_0015380 | Ga0500604_0015380_18_1202 | 371 |
| 32 | 3300044673 | Ga0453683_0006953 | Ga0453683_0006953_399_1847 | 377 |
| 33 | 3300045051 | Ga0451576_0110944 | Ga0451576_0110944_1220_2668 | 377 |
| 34 | 3300005843 | Ga0068860_100000115 | Ga0068860_10000011525 | 379 |
| 35 | 3300028381 | Ga0268264_10000002 | Ga0268264_10000002439 | 379 |
| 36 | 3300053119 | Ga0500595_020821 | Ga0500595_020821_1116_2339 | 379 |
| 37 | 3300037418 | Ga0395900_0121822 | Ga0395900_0121822_1279_2628 | 380 |
| 38 | 3300005327 | Ga0070658_10123037 | Ga0070658_101230372 | 381 |
| 39 | 3300005347 | Ga0070668_100006248 | Ga0070668_1000062482 | 381 |
| 40 | 3300009098 | Ga0105245_10030431 | Ga0105245_100304314 | 381 |
| 41 | 3300025909 | Ga0207705_10132233 | Ga0207705_101322332 | 381 |
| 42 | 3300025914 | Ga0207671_10099936 | Ga0207671_100999362 | 381 |
| 43 | 3300028380 | Ga0268265_10000654 | Ga0268265_1000065418 | 381 |
| 44 | 3300028800 | Ga0265338_10043201 | Ga0265338_100432012 | 381 |
| 45 | 3300017792 | Ga0163161_10060989 | Ga0163161_100609892 | 382 |
| 46 | 3300053178 | Ga0500637_0082583 | Ga0500637_0082583_197_1507 | 382 |
| 47 | 3300047445 | Ga0495677_0002017 | Ga0495677_0002017_2549_3901 | 383 |
| 48 | 3300025250 | Ga0209026_1000877 | Ga0209026_100087712 | 384 |
| 49 | 3300031344 | Ga0265316_10045089 | Ga0265316_100450892 | 384 |
| 50 | 3300005335 | Ga0070666_10050620 | Ga0070666_100506202 | 385 |
| 51 | 3300005355 | Ga0070671_100006472 | Ga0070671_1000064725 | 385 |
| 52 | 3300005436 | Ga0070713_100012623 | Ga0070713_1000126235 | 385 |
| 53 | 3300005437 | Ga0070710_10021405 | Ga0070710_100214052 | 385 |
| 54 | 3300005439 | Ga0070711_100027640 | Ga0070711_1000276402 | 385 |
| 55 | 3300005456 | Ga0070678_100026536 | Ga0070678_1000265363 | 385 |
| 56 | 3300005548 | Ga0070665_100004072 | Ga0070665_1000040725 | 385 |
| 57 | 3300005614 | Ga0068856_100017538 | Ga0068856_1000175383 | 385 |
| 58 | 3300005616 | Ga0068852_100266566 | Ga0068852_1002665662 | 385 |
| 59 | 3300005842 | Ga0068858_100047698 | Ga0068858_1000476983 | 385 |
| 60 | 3300005843 | Ga0068860_100023799 | Ga0068860_1000237992 | 385 |
| 61 | 3300006163 | Ga0070715_10001793 | Ga0070715_100017932 | 385 |
| 62 | 3300006173 | Ga0070716_100001919 | Ga0070716_1000019197 | 385 |
| 63 | 3300006175 | Ga0070712_100015972 | Ga0070712_1000159722 | 385 |
| 64 | 3300006237 | Ga0097621_100061202 | Ga0097621_1000612022 | 385 |
| 65 | 3300006358 | Ga0068871_100061545 | Ga0068871_1000615452 | 385 |
| 66 | 3300009174 | Ga0105241_10022023 | Ga0105241_100220233 | 385 |
| 67 | 3300009176 | Ga0105242_10091962 | Ga0105242_100919622 | 385 |
| 68 | 3300009545 | Ga0105237_10224682 | Ga0105237_102246822 | 385 |
| 69 | 3300010375 | Ga0105239_10086325 | Ga0105239_100863252 | 385 |
| 70 | 3300013296 | Ga0157374_10200222 | Ga0157374_102002222 | 385 |
| 71 | 3300013296 | Ga0157374_10235609 | Ga0157374_102356092 | 385 |
| 72 | 3300013297 | Ga0157378_10263189 | Ga0157378_102631892 | 385 |
| 73 | 3300013306 | Ga0163162_10267967 | Ga0163162_102679672 | 385 |
| 74 | 3300013308 | Ga0157375_10294207 | Ga0157375_102942072 | 385 |
| 75 | 3300014968 | Ga0157379_10243180 | Ga0157379_102431802 | 385 |
| 76 | 3300014969 | Ga0157376_10188541 | Ga0157376_101885412 | 385 |
| 77 | 3300025900 | Ga0207710_10069272 | Ga0207710_100692722 | 385 |
| 78 | 3300025903 | Ga0207680_10040016 | Ga0207680_100400162 | 385 |
| 79 | 3300025905 | Ga0207685_10001509 | Ga0207685_100015093 | 385 |
| 80 | 3300025915 | Ga0207693_10007955 | Ga0207693_100079554 | 385 |
| 81 | 3300025928 | Ga0207700_10020215 | Ga0207700_100202151 | 385 |
| 82 | 3300025931 | Ga0207644_10039084 | Ga0207644_100390842 | 385 |
| 83 | 3300025934 | Ga0207686_10149888 | Ga0207686_101498882 | 385 |
| 84 | 3300025939 | Ga0207665_10055940 | Ga0207665_100559403 | 385 |
| 85 | 3300026035 | Ga0207703_10047627 | Ga0207703_100476272 | 385 |
| 86 | 3300026121 | Ga0207683_10008794 | Ga0207683_100087944 | 385 |
| 87 | 3300026142 | Ga0207698_10188083 | Ga0207698_101880832 | 385 |
| 88 | 3300028381 | Ga0268264_10141191 | Ga0268264_101411911 | 385 |
| 89 | 3300047320 | Ga0495672_0003581 | Ga0495672_0003581_10512_11843 | 385 |
| 90 | 3300048903 | Ga0496100_0038451 | Ga0496100_0038451_315_1625 | 385 |
| 91 | 3300048904 | Ga0496101_0088572 | Ga0496101_0088572_359_1669 | 385 |
| 92 | 3300048905 | Ga0496102_0000215 | Ga0496102_0000215_18640_20013 | 385 |
| 93 | 3300048905 | Ga0496102_0008521 | Ga0496102_0008521_278_1588 | 385 |
| 94 | 3300048906 | Ga0496103_0065078 | Ga0496103_0065078_843_2153 | 385 |
| 95 | 3300048906 | Ga0496103_0074364 | Ga0496103_0074364_584_1957 | 385 |
| 96 | 3300048908 | Ga0496105_0022527 | Ga0496105_0022527_3062_4372 | 385 |
| 97 | 3300048909 | Ga0496106_0044800 | Ga0496106_0044800_1652_2962 | 385 |
| 98 | 3300048910 | Ga0496107_0015833 | Ga0496107_0015833_2401_3711 | 385 |
| 99 | 3300048911 | Ga0496108_0203007 | Ga0496108_0203007_93_1403 | 385 |
| 100 | 3300048913 | Ga0496110_0026398 | Ga0496110_0026398_1647_2957 | 385 |
| 101 | 3300048914 | Ga0496111_0032531 | Ga0496111_0032531_742_2052 | 385 |
| 102 | 3300048917 | Ga0496114_0072705 | Ga0496114_0072705_162_1472 | 385 |
| 103 | 3300048918 | Ga0496115_0038453 | Ga0496115_0038453_1394_2704 | 385 |
| 104 | 3300005518 | Ga0070699_100229015 | Ga0070699_1002290151 | 386 |
| 105 | 3300009177 | Ga0105248_10001588 | Ga0105248_1000158820 | 386 |
| 106 | 3300025941 | Ga0207711_10013688 | Ga0207711_100136882 | 386 |
| 107 | 3300031240 | Ga0265320_10020085 | Ga0265320_100200852 | 386 |
| 108 | 3300031249 | Ga0265339_10028565 | Ga0265339_100285653 | 386 |
| 109 | 3300048924 | Ga0496121_0000053 | Ga0496121_0000053_196034_197350 | 386 |
| 110 | 3300050507 | nmdc:mga05p37_201619_c1 | nmdc:mga05p37_201619_c1_906_2246 | 386 |
| 111 | 3300050508 | nmdc:mga09592_100944_c1 | nmdc:mga09592_100944_c1_1170_2450 | 386 |
| 112 | 3300005843 | Ga0068860_100360785 | Ga0068860_1003607851 | 387 |
| 113 | 3300009177 | Ga0105248_10097301 | Ga0105248_100973012 | 387 |
| 114 | 3300013296 | Ga0157374_10194710 | Ga0157374_101947102 | 387 |
| 115 | 3300014968 | Ga0157379_10235537 | Ga0157379_102355372 | 387 |
| 116 | 3300014969 | Ga0157376_10188321 | Ga0157376_101883212 | 387 |
| 117 | 3300028381 | Ga0268264_10077427 | Ga0268264_100774272 | 387 |
| 118 | 3300035695 | Ga0373927_0032204 | Ga0373927_0032204_64_1374 | 387 |
| 119 | 3300036401 | Ga0373937_0127780 | Ga0373937_0127780_887_2197 | 387 |
| 120 | 3300037853 | Ga0436364_1291741 | Ga0436364_1291741_413_1633 | 387 |
| 121 | 3300046517 | Ga0495630_0049678 | Ga0495630_0049678_725_2035 | 387 |
| 122 | 3300047318 | Ga0495636_0033267 | Ga0495636_0033267_135_1508 | 387 |
| 123 | 3300047447 | Ga0495685_005756 | Ga0495685_005756_2588_3961 | 387 |
| 124 | 3300049661 | Ga0501217_031165 | Ga0501217_031165_60_1274 | 387 |
| 125 | 3300033180 | Ga0307510_10140117 | Ga0307510_101401172 | 388 |
| 126 | 3300044693 | Ga0466961_0039491 | Ga0466961_0039491_973_2280 | 388 |
| 127 | 3300046472 | Ga0495580_0010829 | Ga0495580_0010829_2341_3651 | 388 |
| 128 | 3300055283 | Ga0500661_002175 | Ga0500661_002175_373_1680 | 388 |
| 129 | 3300005983 | Ga0081540_1006248 | Ga0081540_10062483 | 389 |
| 130 | 3300046460 | Ga0495638_0002405 | Ga0495638_0002405_4573_5889 | 389 |
| 131 | 3300046513 | Ga0495616_0000105 | Ga0495616_0000105_50504_51820 | 389 |
| 132 | 3300046519 | Ga0495632_0006687 | Ga0495632_0006687_2018_3334 | 389 |
| 133 | 3300053731 | Ga0500609_002181 | Ga0500609_002181_998_2314 | 389 |
| 134 | 3300033180 | Ga0307510_10004620 | Ga0307510_1000462014 | 391 |
| 135 | 3300046459 | Ga0495629_0012092 | Ga0495629_0012092_4232_5539 | 391 |
| 136 | 3300046462 | Ga0495651_0066244 | Ga0495651_0066244_475_1782 | 391 |
| 137 | 3300046463 | Ga0495653_0006478 | Ga0495653_0006478_3812_5119 | 391 |
| 138 | 3300046473 | Ga0495582_0016198 | Ga0495582_0016198_2512_3819 | 391 |
| 139 | 3300046475 | Ga0495639_0001872 | Ga0495639_0001872_4033_5340 | 391 |
| 140 | 3300046476 | Ga0495662_0025364 | Ga0495662_0025364_38_1345 | 391 |
| 141 | 3300046477 | Ga0495664_0005007 | Ga0495664_0005007_994_2301 | 391 |
| 142 | 3300046499 | Ga0495594_0021779 | Ga0495594_0021779_442_1749 | 391 |
| 143 | 3300046526 | Ga0495666_0008071 | Ga0495666_0008071_3479_4786 | 391 |
| 144 | 3300046529 | Ga0495652_0011950 | Ga0495652_0011950_2541_3848 | 391 |
| 145 | 3300046531 | Ga0495665_0037746 | Ga0495665_0037746_392_1699 | 391 |
| 146 | 3300046533 | Ga0495640_0005892 | Ga0495640_0005892_603_1910 | 391 |
| 147 | 3300046536 | Ga0495587_0038200 | Ga0495587_0038200_1561_2868 | 391 |
| 148 | 3300046642 | Ga0495634_0016623 | Ga0495634_0016623_45_1352 | 391 |
| 149 | 3300046663 | Ga0495635_0005335 | Ga0495635_0005335_6647_7954 | 391 |
| 150 | 3300046678 | Ga0495599_0022266 | Ga0495599_0022266_1776_3083 | 391 |
| 151 | 3300046689 | Ga0495613_0008424 | Ga0495613_0008424_1580_2887 | 391 |
| 152 | 3300046690 | Ga0495624_0016039 | Ga0495624_0016039_2965_4272 | 391 |
| 153 | 3300046809 | Ga0495600_0004065 | Ga0495600_0004065_5183_6490 | 391 |
| 154 | 3300047319 | Ga0495674_0077543 | Ga0495674_0077543_1075_2382 | 391 |
| 155 | 3300047321 | Ga0495676_0004023 | Ga0495676_0004023_5429_6736 | 391 |
| 156 | 3300047322 | Ga0495680_0028251 | Ga0495680_0028251_2987_4294 | 391 |
| 157 | 3300047444 | Ga0495675_0005027 | Ga0495675_0005027_458_1765 | 391 |
| 158 | 3300048089 | Ga0495614_0000903 | Ga0495614_0000903_8902_10209 | 391 |
| 159 | 3300025913 | Ga0207695_10008752 | Ga0207695_100087528 | 392 |
| 160 | 3300028379 | Ga0268266_10341695 | Ga0268266_103416951 | 392 |
| 161 | 3300048929 | Ga0496126_0008833 | Ga0496126_0008833_3494_4804 | 392 |
| 162 | 3300049568 | Ga0501031_0010395 | Ga0501031_0010395_2296_3603 | 392 |
| 163 | 3300049570 | Ga0501033_0001000 | Ga0501033_0001000_18776_20083 | 392 |
| 164 | 3300049571 | Ga0501034_0002456 | Ga0501034_0002456_12055_13362 | 392 |
| 165 | 3300049572 | Ga0501036_0000595 | Ga0501036_0000595_2399_3706 | 392 |
| 166 | 3300049574 | Ga0501038_0002477 | Ga0501038_0002477_6552_7859 | 392 |
| 167 | 3300049579 | Ga0501043_0005587 | Ga0501043_0005587_4229_5536 | 392 |
| 168 | 3300049580 | Ga0501046_0000259 | Ga0501046_0000259_27913_29220 | 392 |
| 169 | 3300049581 | Ga0501047_0000462 | Ga0501047_0000462_21857_23164 | 392 |
| 170 | 3300049586 | Ga0501070_0132949 | Ga0501070_0132949_717_2024 | 392 |
| 171 | 3300049589 | Ga0501073_0013787 | Ga0501073_0013787_4446_5753 | 392 |
| 172 | 3300049742 | Ga0501080_0015861 | Ga0501080_0015861_4507_5814 | 392 |
| 173 | 3300049822 | Ga0501035_0005743 | Ga0501035_0005743_3971_5278 | 392 |
| 174 | 3300049823 | Ga0501044_0016042 | Ga0501044_0016042_2106_3413 | 392 |
| 175 | 3300049569 | Ga0501032_0000563 | Ga0501032_0000563_22344_23651 | 393 |
| 176 | 3300005331 | Ga0070670_100197846 | Ga0070670_1001978461 | 394 |
| 177 | 3300005338 | Ga0068868_100008257 | Ga0068868_1000082571 | 394 |
| 178 | 3300005344 | Ga0070661_100140601 | Ga0070661_1001406011 | 394 |
| 179 | 3300005367 | Ga0070667_100028597 | Ga0070667_1000285974 | 394 |
| 180 | 3300005456 | Ga0070678_100014881 | Ga0070678_1000148812 | 394 |
| 181 | 3300005842 | Ga0068858_100095925 | Ga0068858_1000959252 | 394 |
| 182 | 3300006237 | Ga0097621_100027460 | Ga0097621_1000274602 | 394 |
| 183 | 3300006914 | Ga0075436_100001730 | Ga0075436_10000173012 | 394 |
| 184 | 3300011119 | Ga0105246_10046101 | Ga0105246_100461012 | 394 |
| 185 | 3300013105 | Ga0157369_10056791 | Ga0157369_100567913 | 394 |
| 186 | 3300014969 | Ga0157376_10046380 | Ga0157376_100463802 | 394 |
| 187 | 3300025284 | Ga0209130_1009047 | Ga0209130_10090472 | 394 |
| 188 | 3300025294 | Ga0209025_1007249 | Ga0209025_10072493 | 394 |
| 189 | 3300025321 | Ga0207656_10022483 | Ga0207656_100224831 | 394 |
| 190 | 3300026035 | Ga0207703_10300151 | Ga0207703_103001511 | 394 |
| 191 | 3300026121 | Ga0207683_10008199 | Ga0207683_100081992 | 394 |
| 192 | 3300028379 | Ga0268266_10037863 | Ga0268266_100378634 | 394 |
| 193 | 3300050514 | nmdc:mga08x19_25_c1 | nmdc:mga08x19_25_c1_99824_101188 | 394 |
| 194 | 3300003322 | rootL2_10015514 | rootL2_100155142 | 395 |
| 195 | 3300005563 | Ga0068855_100003681 | Ga0068855_1000036818 | 395 |
| 196 | 3300009093 | Ga0105240_10001088 | Ga0105240_1000108838 | 395 |
| 197 | 3300025913 | Ga0207695_10010485 | Ga0207695_100104854 | 395 |
| 198 | 3300025949 | Ga0207667_10001527 | Ga0207667_1000152715 | 395 |
| 199 | 3300025972 | Ga0207668_10032169 | Ga0207668_100321693 | 395 |
| 200 | 3300037466 | Ga0395898_0185834 | Ga0395898_0185834_222_1541 | 395 |
| 201 | 3300046471 | Ga0495650_0007626 | Ga0495650_0007626_1218_2573 | 395 |
| 202 | 3300046660 | Ga0495625_0005652 | Ga0495625_0005652_9852_11204 | 396 |
| 203 | 3300053133 | Ga0500655_006939 | Ga0500655_006939_333_1649 | 396 |
| 204 | 3300053156 | Ga0500622_0004435 | Ga0500622_0004435_4258_5574 | 396 |
| 205 | 3300003762 | Ga0055542_1005438 | Ga0055542_10054382 | 397 |
| 206 | 3300005355 | Ga0070671_100114478 | Ga0070671_1001144781 | 397 |
| 207 | 3300005535 | Ga0070684_100022634 | Ga0070684_1000226344 | 397 |
| 208 | 3300021361 | Ga0213872_10039856 | Ga0213872_100398562 | 397 |
| 209 | 3300025254 | Ga0209148_1000061 | Ga0209148_1000061204 | 397 |
| 210 | 3300025931 | Ga0207644_10088743 | Ga0207644_100887431 | 397 |
| 211 | 3300046459 | Ga0495629_0010818 | Ga0495629_0010818_4380_5687 | 397 |
| 212 | 3300046499 | Ga0495594_0001478 | Ga0495594_0001478_10061_11368 | 397 |
| 213 | 3300046689 | Ga0495613_0004523 | Ga0495613_0004523_6293_7600 | 397 |
| 214 | 3300047315 | Ga0495581_0007250 | Ga0495581_0007250_833_2140 | 397 |
| 215 | 3300048929 | Ga0496126_0004716 | Ga0496126_0004716_2845_4152 | 397 |
| 216 | 3300031344 | Ga0265316_10009534 | Ga0265316_100095344 | 398 |
| 217 | 3300047323 | Ga0495683_0067141 | Ga0495683_0067141_167_1474 | 398 |
| 218 | 3300053096 | Ga0500641_0001732 | Ga0500641_0001732_479_1795 | 398 |
| 219 | 3300005614 | Ga0068856_100102561 | Ga0068856_1001025612 | 399 |
| 220 | 3300005618 | Ga0068864_100000088 | Ga0068864_10000008831 | 399 |
| 221 | 3300013306 | Ga0163162_10013600 | Ga0163162_100136002 | 399 |
| 222 | 3300026095 | Ga0207676_10003130 | Ga0207676_100031304 | 399 |
| 223 | 3300042005 | Ga0439448_0001017 | Ga0439448_0001017_2768_4090 | 399 |
| 224 | 3300042012 | Ga0439455_0000178 | Ga0439455_0000178_844_2166 | 399 |
| 225 | 3300046665 | Ga0495661_0053680 | Ga0495661_0053680_129_1436 | 399 |
| 226 | 3300053087 | Ga0500643_000660 | Ga0500643_000660_12890_14215 | 399 |
| 227 | 3300053087 | Ga0500643_000718 | Ga0500643_000718_8559_9911 | 399 |
| 228 | 3300053093 | Ga0500651_0000022 | Ga0500651_0000022_82894_84201 | 399 |
| 229 | 3300053096 | Ga0500641_0015363 | Ga0500641_0015363_989_2314 | 399 |
| 230 | 3300053104 | Ga0500556_0033350 | Ga0500556_0033350_123_1448 | 399 |
| 231 | 3300053153 | Ga0500616_0006036 | Ga0500616_0006036_6169_7494 | 399 |
| 232 | 3300053730 | Ga0500645_000716 | Ga0500645_000716_14064_15389 | 399 |
| 233 | 3300005434 | Ga0070709_10024313 | Ga0070709_100243132 | 400 |
| 234 | 3300005458 | Ga0070681_10064516 | Ga0070681_100645162 | 400 |
| 235 | 3300006042 | Ga0075368_10000886 | Ga0075368_100008864 | 400 |
| 236 | 3300006847 | Ga0075431_100004452 | Ga0075431_10000445216 | 400 |
| 237 | 3300009093 | Ga0105240_10029267 | Ga0105240_100292672 | 400 |
| 238 | 3300013105 | Ga0157369_10168113 | Ga0157369_101681132 | 400 |
| 239 | 3300025906 | Ga0207699_10024850 | Ga0207699_100248502 | 400 |
| 240 | 3300025913 | Ga0207695_10027625 | Ga0207695_100276257 | 400 |
| 241 | 3300025939 | Ga0207665_10027767 | Ga0207665_100277672 | 400 |
| 242 | 3300025949 | Ga0207667_10155291 | Ga0207667_101552912 | 400 |
| 243 | 3300033180 | Ga0307510_10063757 | Ga0307510_100637574 | 400 |
| 244 | 3300050493 | nmdc:mga0k408_151873_c1 | nmdc:mga0k408_151873_c1_14_1312 | 400 |
| 245 | 3300050510 | nmdc:mga06r32_38564_c1 | nmdc:mga06r32_38564_c1_2042_3382 | 400 |
| 246 | 3300031250 | Ga0265331_10011667 | Ga0265331_100116672 | 401 |
| 247 | 3300031344 | Ga0265316_10008777 | Ga0265316_100087771 | 401 |
| 248 | 3300039438 | Ga0436360_0435012 | Ga0436360_0435012_50_1306 | 401 |
| 249 | 3300044656 | Ga0466969_0003474 | Ga0466969_0003474_110_1366 | 401 |
| 250 | 3300046454 | Ga0495592_0122538 | Ga0495592_0122538_266_1684 | 401 |
| 251 | 3300046512 | Ga0495610_0007327 | Ga0495610_0007327_3947_5278 | 401 |
| 252 | 3300047317 | Ga0495604_0040496 | Ga0495604_0040496_2212_3630 | 401 |
| 253 | 3300048907 | Ga0496104_0067646 | Ga0496104_0067646_543_1850 | 401 |
| 254 | 3300005335 | Ga0070666_10039404 | Ga0070666_100394042 | 402 |
| 255 | 3300005355 | Ga0070671_100004362 | Ga0070671_1000043622 | 402 |
| 256 | 3300005367 | Ga0070667_100048519 | Ga0070667_1000485193 | 402 |
| 257 | 3300005439 | Ga0070711_100000026 | Ga0070711_10000002624 | 402 |
| 258 | 3300005841 | Ga0068863_100114615 | Ga0068863_1001146154 | 402 |
| 259 | 3300009177 | Ga0105248_10162397 | Ga0105248_101623972 | 402 |
| 260 | 3300009551 | Ga0105238_10126233 | Ga0105238_101262332 | 402 |
| 261 | 3300013296 | Ga0157374_10017350 | Ga0157374_100173507 | 402 |
| 262 | 3300014325 | Ga0163163_10001191 | Ga0163163_1000119112 | 402 |
| 263 | 3300014325 | Ga0163163_10238648 | Ga0163163_102386482 | 402 |
| 264 | 3300025916 | Ga0207663_10000166 | Ga0207663_100001664 | 402 |
| 265 | 3300025929 | Ga0207664_10034634 | Ga0207664_100346342 | 402 |
| 266 | 3300025931 | Ga0207644_10002784 | Ga0207644_1000278410 | 402 |
| 267 | 3300025941 | Ga0207711_10165755 | Ga0207711_101657552 | 402 |
| 268 | 3300026088 | Ga0207641_10052144 | Ga0207641_100521442 | 402 |
| 269 | 3300028800 | Ga0265338_10010092 | Ga0265338_100100925 | 402 |
| 270 | 3300031239 | Ga0265328_10005696 | Ga0265328_100056961 | 402 |
| 271 | 3300031247 | Ga0265340_10064928 | Ga0265340_100649282 | 402 |
| 272 | 3300031249 | Ga0265339_10000031 | Ga0265339_10000031105 | 402 |
| 273 | 3300031344 | Ga0265316_10005257 | Ga0265316_100052574 | 402 |
| 274 | 3300031711 | Ga0265314_10112977 | Ga0265314_101129772 | 402 |
| 275 | 3300031712 | Ga0265342_10010688 | Ga0265342_100106882 | 402 |
| 276 | 3300031712 | Ga0265342_10036416 | Ga0265342_100364161 | 402 |
| 277 | 3300033180 | Ga0307510_10033334 | Ga0307510_100333342 | 402 |
| 278 | 3300036401 | Ga0373937_0055077 | Ga0373937_0055077_715_2010 | 402 |
| 279 | 3300048910 | Ga0496107_0018868 | Ga0496107_0018868_1031_2338 | 402 |
| 280 | 3300048918 | Ga0496115_0053075 | Ga0496115_0053075_1603_2910 | 402 |
| 281 | 3300053156 | Ga0500622_0006978 | Ga0500622_0006978_715_2016 | 402 |
| 282 | iso_pu_bacteria | 2643221729 | 2644708284 | 402 |
| 283 | iso_pu_bacteria | 2643221730 | 2644714882 | 402 |
| 284 | iso_pu_bacteria | 2684622632 | 2685148608 | 402 |
| 285 | iso_pu_bacteria | 2695420987 | 2698324561 | 402 |
| 286 | iso_pu_bacteria | 2703719227 | 2705992541 | 402 |
| 287 | iso_pu_bacteria | 2718218445 | 2721503989 | 402 |
| 288 | iso_pu_bacteria | 2738541358 | 2739158234 | 402 |
| 289 | iso_pu_bacteria | 2738543006 | 2739211355 | 402 |
| 290 | iso_pu_bacteria | 2818991443 | 2819583412 | 402 |
| 291 | iso_pu_bacteria | 2929233124 | 2929233857 | 402 |
| 292 | iso_pu_bacteria | 2938917290 | 2938918028 | 402 |
| 293 | iso_pu_bacteria | 2947426588 | 2947427353 | 402 |
| 294 | iso_pu_bacteria | 2965761152 | 2965761921 | 402 |
| 295 | iso_pu_bacteria | 2979083700 | 2979084348 | 402 |
| 296 | iso_pu_bacteria | 8022792930 | 8022796099 | 402 |
| 297 | iso_pu_bacteria | 8023438354 | 8023438808 | 402 |
| 298 | iso_pu_bacteria | 8023444577 | 8023450478 | 402 |
| 299 | iso_pu_bacteria | 8057582654 | 8057583418 | 402 |
| 300 | 2162886007 | SwRhRL2b_contig_2526931 | SwRhRL2b_0864.00003370 | 403 |
| 301 | 3300003791 | Ga0055530_10000091 | Ga0055530_1000009129 | 403 |
| 302 | 3300003794 | Ga0055531_10001862 | Ga0055531_1000186212 | 403 |
| 303 | 3300005262 | Ga0065165_1000784 | Ga0065165_10007844 | 403 |
| 304 | 3300005289 | Ga0065704_10083431 | Ga0065704_100834312 | 403 |
| 305 | 3300005344 | Ga0070661_100001532 | Ga0070661_1000015329 | 403 |
| 306 | 3300005347 | Ga0070668_100007185 | Ga0070668_1000071857 | 403 |
| 307 | 3300005355 | Ga0070671_100019361 | Ga0070671_1000193612 | 403 |
| 308 | 3300005455 | Ga0070663_100082894 | Ga0070663_1000828942 | 403 |
| 309 | 3300005539 | Ga0068853_100000120 | Ga0068853_10000012021 | 403 |
| 310 | 3300005548 | Ga0070665_100005090 | Ga0070665_1000050905 | 403 |
| 311 | 3300005563 | Ga0068855_100000801 | Ga0068855_10000080118 | 403 |
| 312 | 3300005577 | Ga0068857_100219300 | Ga0068857_1002193002 | 403 |
| 313 | 3300005578 | Ga0068854_100020566 | Ga0068854_1000205662 | 403 |
| 314 | 3300005614 | Ga0068856_100005698 | Ga0068856_1000056983 | 403 |
| 315 | 3300005616 | Ga0068852_100000077 | Ga0068852_10000007726 | 403 |
| 316 | 3300009011 | Ga0105251_10022289 | Ga0105251_100222892 | 403 |
| 317 | 3300009093 | Ga0105240_10007974 | Ga0105240_100079742 | 403 |
| 318 | 3300009174 | Ga0105241_10000236 | Ga0105241_1000023618 | 403 |
| 319 | 3300009545 | Ga0105237_10000607 | Ga0105237_1000060717 | 403 |
| 320 | 3300009551 | Ga0105238_10000332 | Ga0105238_1000033222 | 403 |
| 321 | 3300009553 | Ga0105249_10057440 | Ga0105249_100574401 | 403 |
| 322 | 3300010375 | Ga0105239_10001070 | Ga0105239_1000107033 | 403 |
| 323 | 3300013105 | Ga0157369_10002432 | Ga0157369_1000243218 | 403 |
| 324 | 3300013105 | Ga0157369_10097974 | Ga0157369_100979742 | 403 |
| 325 | 3300013306 | Ga0163162_10001307 | Ga0163162_1000130712 | 403 |
| 326 | 3300013307 | Ga0157372_10012597 | Ga0157372_100125976 | 403 |
| 327 | 3300025297 | Ga0209758_1001070 | Ga0209758_10010707 | 403 |
| 328 | 3300025298 | Ga0209050_1000029 | Ga0209050_100002930 | 403 |
| 329 | 3300025304 | Ga0209257_1000271 | Ga0209257_100027192 | 403 |
| 330 | 3300025711 | Ga0207696_1015009 | Ga0207696_10150092 | 403 |
| 331 | 3300025735 | Ga0207713_1017865 | Ga0207713_10178653 | 403 |
| 332 | 3300025911 | Ga0207654_10000114 | Ga0207654_1000011420 | 403 |
| 333 | 3300025913 | Ga0207695_10000428 | Ga0207695_1000042857 | 403 |
| 334 | 3300025914 | Ga0207671_10000221 | Ga0207671_1000022151 | 403 |
| 335 | 3300025920 | Ga0207649_10001138 | Ga0207649_100011388 | 403 |
| 336 | 3300025924 | Ga0207694_10000036 | Ga0207694_10000036104 | 403 |
| 337 | 3300025931 | Ga0207644_10022945 | Ga0207644_100229452 | 403 |
| 338 | 3300025941 | Ga0207711_10114443 | Ga0207711_101144432 | 403 |
| 339 | 3300025981 | Ga0207640_10036243 | Ga0207640_100362432 | 403 |
| 340 | 3300025986 | Ga0207658_10001616 | Ga0207658_100016163 | 403 |
| 341 | 3300026041 | Ga0207639_10000049 | Ga0207639_1000004980 | 403 |
| 342 | 3300026067 | Ga0207678_10020494 | Ga0207678_100204941 | 403 |
| 343 | 3300026116 | Ga0207674_10243479 | Ga0207674_102434792 | 403 |
| 344 | 3300026142 | Ga0207698_10000037 | Ga0207698_1000003766 | 403 |
| 345 | 3300028379 | Ga0268266_10002863 | Ga0268266_1000286312 | 403 |
| 346 | 3300028380 | Ga0268265_10057841 | Ga0268265_100578412 | 403 |
| 347 | 3300046460 | Ga0495638_0000768 | Ga0495638_0000768_29147_30484 | 403 |
| 348 | 3300046506 | Ga0495583_0065571 | Ga0495583_0065571_99_1364 | 403 |
| 349 | 3300046542 | Ga0495597_0005066 | Ga0495597_0005066_5547_6812 | 403 |
| 350 | 3300046557 | Ga0495622_0004603 | Ga0495622_0004603_2808_4073 | 403 |
| 351 | 3300047318 | Ga0495636_0011288 | Ga0495636_0011288_678_1985 | 403 |
| 352 | 3300048923 | Ga0496120_0069002 | Ga0496120_0069002_71_1390 | 403 |
| 353 | 3300050496 | nmdc:mga07m45_224_c1 | nmdc:mga07m45_224_c1_4325_5653 | 403 |
| 354 | 3300053093 | Ga0500651_0039289 | Ga0500651_0039289_1369_2634 | 403 |
| 355 | 3300053123 | Ga0500614_001255 | Ga0500614_001255_4651_5916 | 403 |
| 356 | 3300053134 | Ga0500658_0013133 | Ga0500658_0013133_558_1907 | 403 |
| 357 | 3300005530 | Ga0070679_100011129 | Ga0070679_1000111294 | 404 |
| 358 | 3300005539 | Ga0068853_100002521 | Ga0068853_10000252112 | 404 |
| 359 | 3300005548 | Ga0070665_100012980 | Ga0070665_1000129807 | 404 |
| 360 | 3300005617 | Ga0068859_100070714 | Ga0068859_1000707142 | 404 |
| 361 | 3300006931 | Ga0097620_100070714 | Ga0097620_1000707143 | 404 |
| 362 | 3300009093 | Ga0105240_10009372 | Ga0105240_100093723 | 404 |
| 363 | 3300009098 | Ga0105245_10153788 | Ga0105245_101537881 | 404 |
| 364 | 3300009177 | Ga0105248_10045373 | Ga0105248_100453734 | 404 |
| 365 | 3300010375 | Ga0105239_10002886 | Ga0105239_1000288615 | 404 |
| 366 | 3300013296 | Ga0157374_10116314 | Ga0157374_101163142 | 404 |
| 367 | 3300025292 | Ga0209676_1000169 | Ga0209676_100016979 | 404 |
| 368 | 3300025298 | Ga0209050_1000281 | Ga0209050_100028155 | 404 |
| 369 | 3300025303 | Ga0209051_1002448 | Ga0209051_10024487 | 404 |
| 370 | 3300025304 | Ga0209257_1002028 | Ga0209257_10020286 | 404 |
| 371 | 3300025913 | Ga0207695_10000194 | Ga0207695_100001948 | 404 |
| 372 | 3300025921 | Ga0207652_10000794 | Ga0207652_1000079415 | 404 |
| 373 | 3300025924 | Ga0207694_10021286 | Ga0207694_100212863 | 404 |
| 374 | 3300026041 | Ga0207639_10005593 | Ga0207639_100055932 | 404 |
| 375 | 3300026116 | Ga0207674_10016813 | Ga0207674_100168135 | 404 |
| 376 | 3300031240 | Ga0265320_10000015 | Ga0265320_10000015123 | 404 |
| 377 | 3300031344 | Ga0265316_10006928 | Ga0265316_1000692811 | 404 |
| 378 | 3300031456 | Ga0307513_10077216 | Ga0307513_100772162 | 404 |
| 379 | 3300031712 | Ga0265342_10004281 | Ga0265342_100042817 | 404 |
| 380 | 3300045976 | Ga0466967_0080537 | Ga0466967_0080537_349_1656 | 404 |
| 381 | 3300047472 | Ga0495686_0036922 | Ga0495686_0036922_237_1553 | 404 |
| 382 | 3300048924 | Ga0496121_0000031 | Ga0496121_0000031_171697_173055 | 404 |
| 383 | 3300049571 | Ga0501034_0080007 | Ga0501034_0080007_1701_3014 | 404 |
| 384 | 3300050516 | nmdc:mga0sz30_3618_c1 | nmdc:mga0sz30_3618_c1_1703_3019 | 404 |
| 385 | 3300006871 | Ga0075434_100312332 | Ga0075434_1003123321 | 405 |
| 386 | 3300006914 | Ga0075436_100099073 | Ga0075436_1000990732 | 405 |
| 387 | 3300007076 | Ga0075435_100033347 | Ga0075435_1000333473 | 405 |
| 388 | 3300021361 | Ga0213872_10001773 | Ga0213872_100017732 | 405 |
| 389 | 3300021361 | Ga0213872_10066252 | Ga0213872_100662522 | 405 |
| 390 | 3300025913 | Ga0207695_10000001 | Ga0207695_100000011198 | 405 |
| 391 | 3300031247 | Ga0265340_10006930 | Ga0265340_100069302 | 405 |
| 392 | 3300031344 | Ga0265316_10025277 | Ga0265316_100252773 | 405 |
| 393 | 3300039447 | Ga0436361_1209734 | Ga0436361_1209734_25791_27110 | 405 |
| 394 | 3300046689 | Ga0495613_0167852 | Ga0495613_0167852_11_1324 | 405 |
| 395 | 3300048903 | Ga0496100_0000653 | Ga0496100_0000653_13544_14875 | 405 |
| 396 | 3300048905 | Ga0496102_0001498 | Ga0496102_0001498_2086_3417 | 405 |
| 397 | 3300048906 | Ga0496103_0000103 | Ga0496103_0000103_17217_18548 | 405 |
| 398 | 3300048907 | Ga0496104_0019277 | Ga0496104_0019277_4195_5526 | 405 |
| 399 | 3300048908 | Ga0496105_0000179 | Ga0496105_0000179_30133_31464 | 405 |
| 400 | 3300048915 | Ga0496112_0017480 | Ga0496112_0017480_1392_2723 | 405 |
| 401 | 3300048916 | Ga0496113_0000653 | Ga0496113_0000653_734_2065 | 405 |
| 402 | 3300048920 | Ga0496117_0001087 | Ga0496117_0001087_22572_23903 | 405 |
| 403 | 3300048921 | Ga0496118_0002521 | Ga0496118_0002521_17217_18548 | 405 |
| 404 | 3300048922 | Ga0496119_0002094 | Ga0496119_0002094_9117_10448 | 405 |
| 405 | 3300048923 | Ga0496120_0000745 | Ga0496120_0000745_30135_31466 | 405 |
| 406 | 3300048925 | Ga0496122_0002146 | Ga0496122_0002146_15875_17206 | 405 |
| 407 | 3300048926 | Ga0496123_0001028 | Ga0496123_0001028_28237_29568 | 405 |
| 408 | 3300048927 | Ga0496124_0022369 | Ga0496124_0022369_1921_3252 | 405 |
| 409 | 3300048928 | Ga0496125_0001729 | Ga0496125_0001729_11813_13144 | 405 |
| 410 | 3300048928 | Ga0496125_0028564 | Ga0496125_0028564_1808_3133 | 405 |
| 411 | 3300048929 | Ga0496126_0000103 | Ga0496126_0000103_167089_168420 | 405 |
| 412 | 3300050493 | nmdc:mga0k408_53490_c1 | nmdc:mga0k408_53490_c1_448_1734 | 405 |
| 413 | 3300050512 | nmdc:mga0n895_307050_c1 | nmdc:mga0n895_307050_c1_104_1414 | 405 |
| 414 | 3300050513 | nmdc:mga0rr50_27527_c1 | nmdc:mga0rr50_27527_c1_1270_2580 | 405 |
| 415 | 3300050514 | nmdc:mga08x19_80704_c1 | nmdc:mga08x19_80704_c1_656_1966 | 405 |
| 416 | 3300002987 | JGI25159J45721_1008128 | JGI25159J45721_10081282 | 406 |
| 417 | 3300005329 | Ga0070683_100000653 | Ga0070683_10000065319 | 406 |
| 418 | 3300005367 | Ga0070667_100000174 | Ga0070667_10000017432 | 406 |
| 419 | 3300005563 | Ga0068855_100223228 | Ga0068855_1002232282 | 406 |
| 420 | 3300005841 | Ga0068863_100001506 | Ga0068863_10000150617 | 406 |
| 421 | 3300005843 | Ga0068860_100000125 | Ga0068860_10000012544 | 406 |
| 422 | 3300009011 | Ga0105251_10009021 | Ga0105251_100090212 | 406 |
| 423 | 3300009036 | Ga0105244_10004535 | Ga0105244_100045353 | 406 |
| 424 | 3300009036 | Ga0105244_10030107 | Ga0105244_100301072 | 406 |
| 425 | 3300009092 | Ga0105250_10032285 | Ga0105250_100322852 | 406 |
| 426 | 3300009092 | Ga0105250_10038247 | Ga0105250_100382471 | 406 |
| 427 | 3300009174 | Ga0105241_10197284 | Ga0105241_101972841 | 406 |
| 428 | 3300011119 | Ga0105246_10006176 | Ga0105246_100061764 | 406 |
| 429 | 3300013296 | Ga0157374_10019466 | Ga0157374_100194664 | 406 |
| 430 | 3300025229 | Ga0209147_101709 | Ga0209147_1017098 | 406 |
| 431 | 3300025284 | Ga0209130_1000293 | Ga0209130_100029318 | 406 |
| 432 | 3300025294 | Ga0209025_1000752 | Ga0209025_100075223 | 406 |
| 433 | 3300025294 | Ga0209025_1000951 | Ga0209025_100095116 | 406 |
| 434 | 3300025294 | Ga0209025_1002146 | Ga0209025_10021464 | 406 |
| 435 | 3300025294 | Ga0209025_1006808 | Ga0209025_10068086 | 406 |
| 436 | 3300025711 | Ga0207696_1000581 | Ga0207696_100058112 | 406 |
| 437 | 3300025711 | Ga0207696_1001509 | Ga0207696_10015092 | 406 |
| 438 | 3300025728 | Ga0207655_1001408 | Ga0207655_100140810 | 406 |
| 439 | 3300025735 | Ga0207713_1022919 | Ga0207713_10229193 | 406 |
| 440 | 3300026088 | Ga0207641_10000956 | Ga0207641_1000095618 | 406 |
| 441 | 3300028381 | Ga0268264_10000166 | Ga0268264_1000016665 | 406 |
| 442 | 3300028794 | Ga0307515_10133246 | Ga0307515_101332463 | 406 |
| 443 | 3300030083 | Ga0237817_10004 | Ga0237817_100048 | 406 |
| 444 | 3300038705 | Ga0237819_00386 | Ga0237819_00386_10577_11869 | 406 |
| 445 | 3300038705 | Ga0237819_00409 | Ga0237819_00409_9268_10560 | 406 |
| 446 | 3300045976 | Ga0466967_0000057 | Ga0466967_0000057_10385_11677 | 406 |
| 447 | 3300046457 | Ga0495590_0001116 | Ga0495590_0001116_1210_2547 | 406 |
| 448 | 3300046460 | Ga0495638_0052036 | Ga0495638_0052036_471_1787 | 406 |
| 449 | 3300046512 | Ga0495610_0004058 | Ga0495610_0004058_2397_3734 | 406 |
| 450 | 3300046518 | Ga0495631_0009701 | Ga0495631_0009701_3230_4567 | 406 |
| 451 | 3300046616 | Ga0495668_0000040 | Ga0495668_0000040_119139_120461 | 406 |
| 452 | 3300046616 | Ga0495668_0001965 | Ga0495668_0001965_7342_8679 | 406 |
| 453 | 3300047472 | Ga0495686_0000360 | Ga0495686_0000360_1757_3094 | 406 |
| 454 | 3300048909 | Ga0496106_0183309 | Ga0496106_0183309_171_1493 | 406 |
| 455 | 3300048920 | Ga0496117_0128793 | Ga0496117_0128793_78_1394 | 406 |
| 456 | 3300048921 | Ga0496118_0040765 | Ga0496118_0040765_2285_3601 | 406 |
| 457 | 3300048922 | Ga0496119_0009604 | Ga0496119_0009604_6696_8012 | 406 |
| 458 | 3300049459 | Ga0495678_000726 | Ga0495678_000726_1985_3322 | 406 |
| 459 | 3300053086 | Ga0500578_0000041 | Ga0500578_0000041_126014_127351 | 406 |
| 460 | 3300053108 | Ga0500562_009173 | Ga0500562_009173_583_1920 | 406 |
| 461 | 3300053118 | Ga0500594_0000094 | Ga0500594_0000094_24480_25817 | 406 |
| 462 | 3300053156 | Ga0500622_0000263 | Ga0500622_0000263_44071_45408 | 406 |
| 463 | 3300053730 | Ga0500645_003225 | Ga0500645_003225_5098_6420 | 406 |
| 464 | 3300005327 | Ga0070658_10002919 | Ga0070658_1000291910 | 407 |
| 465 | 3300005334 | Ga0068869_100026773 | Ga0068869_1000267734 | 407 |
| 466 | 3300005336 | Ga0070680_100078754 | Ga0070680_1000787543 | 407 |
| 467 | 3300021361 | Ga0213872_10000200 | Ga0213872_1000020030 | 407 |
| 468 | 3300025909 | Ga0207705_10040471 | Ga0207705_100404713 | 407 |
| 469 | 3300025942 | Ga0207689_10012614 | Ga0207689_100126147 | 407 |
| 470 | 3300031456 | Ga0307513_10018516 | Ga0307513_100185166 | 407 |
| 471 | 3300037471 | Ga0395905_0000102 | Ga0395905_0000102_27615_29003 | 407 |
| 472 | 3300037471 | Ga0395905_0225808 | Ga0395905_0225808_352_1716 | 407 |
| 473 | 3300039447 | Ga0436361_0080963 | Ga0436361_0080963_2036_3358 | 407 |
| 474 | 3300039447 | Ga0436361_0435899 | Ga0436361_0435899_70_1392 | 407 |
| 475 | 3300046507 | Ga0495606_0002191 | Ga0495606_0002191_19075_20391 | 407 |
| 476 | 3300046524 | Ga0495648_0000039 | Ga0495648_0000039_20316_21653 | 407 |
| 477 | 3300048915 | Ga0496112_0292428 | Ga0496112_0292428_76_1389 | 407 |
| 478 | 3300053088 | Ga0500644_0002176 | Ga0500644_0002176_2593_3930 | 407 |
| 479 | 3300053133 | Ga0500655_002148 | Ga0500655_002148_2115_3440 | 407 |
| 480 | 3300053138 | Ga0500564_000586 | Ga0500564_000586_2212_3549 | 407 |
| 481 | 3300055283 | Ga0500661_008361 | Ga0500661_008361_435_1721 | 407 |
| 482 | 3300006051 | Ga0075364_10000807 | Ga0075364_100008075 | 408 |
| 483 | 3300030521 | Ga0307511_10000403 | Ga0307511_1000040329 | 408 |
| 484 | 3300030521 | Ga0307511_10023061 | Ga0307511_100230611 | 408 |
| 485 | 3300046616 | Ga0495668_0017143 | Ga0495668_0017143_1646_2962 | 408 |
| 486 | 3300046660 | Ga0495625_0026481 | Ga0495625_0026481_1697_3013 | 408 |
| 487 | 3300050491 | nmdc:mga00v17_626_c2 | nmdc:mga00v17_626_c2_2858_4237 | 408 |
| 488 | 3300050493 | nmdc:mga0k408_37007_c1 | nmdc:mga0k408_37007_c1_577_1893 | 408 |
| 489 | 3300053119 | Ga0500595_020044 | Ga0500595_020044_135_1460 | 408 |
| 490 | 3300002459 | JGI24751J29686_10000086 | JGI24751J29686_1000008613 | 409 |
| 491 | 3300005331 | Ga0070670_100000003 | Ga0070670_100000003185 | 409 |
| 492 | 3300005353 | Ga0070669_100000084 | Ga0070669_10000008475 | 409 |
| 493 | 3300005618 | Ga0068864_100000005 | Ga0068864_10000000549 | 409 |
| 494 | 3300025923 | Ga0207681_10000005 | Ga0207681_10000005547 | 409 |
| 495 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004182 | 409 |
| 496 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006528 | 409 |
| 497 | 3300028794 | Ga0307515_10005727 | Ga0307515_100057272 | 409 |
| 498 | 3300030521 | Ga0307511_10052012 | Ga0307511_100520122 | 409 |
| 499 | 3300046460 | Ga0495638_0103253 | Ga0495638_0103253_186_1607 | 409 |
| 500 | 3300048909 | Ga0496106_0083121 | Ga0496106_0083121_28_1344 | 409 |
| 501 | 3300048910 | Ga0496107_0000090 | Ga0496107_0000090_14111_15427 | 409 |
| 502 | 3300048924 | Ga0496121_0001312 | Ga0496121_0001312_2683_3999 | 409 |
| 503 | 3300050516 | nmdc:mga0sz30_43021_c1 | nmdc:mga0sz30_43021_c1_337_1689 | 409 |
| 504 | 3300053122 | Ga0500608_000917 | Ga0500608_000917_2412_3752 | 409 |
| 505 | 3300053723 | Ga0500567_000780 | Ga0500567_000780_8607_9947 | 409 |
| 506 | 3300053729 | Ga0500625_000001 | Ga0500625_000001_263605_264945 | 409 |
| 507 | 3300003323 | rootH1_10092427 | rootH1_100924272 | 410 |
| 508 | 3300005329 | Ga0070683_100003219 | Ga0070683_10000321910 | 410 |
| 509 | 3300005336 | Ga0070680_100102337 | Ga0070680_1001023372 | 410 |
| 510 | 3300005355 | Ga0070671_100004490 | Ga0070671_1000044902 | 410 |
| 511 | 3300005367 | Ga0070667_100079384 | Ga0070667_1000793842 | 410 |
| 512 | 3300005458 | Ga0070681_10244762 | Ga0070681_102447621 | 410 |
| 513 | 3300005544 | Ga0070686_100059630 | Ga0070686_1000596302 | 410 |
| 514 | 3300005548 | Ga0070665_100080621 | Ga0070665_1000806212 | 410 |
| 515 | 3300005617 | Ga0068859_100000120 | Ga0068859_10000012040 | 410 |
| 516 | 3300005841 | Ga0068863_100007525 | Ga0068863_1000075256 | 410 |
| 517 | 3300005842 | Ga0068858_100002961 | Ga0068858_1000029618 | 410 |
| 518 | 3300005843 | Ga0068860_100087974 | Ga0068860_1000879741 | 410 |
| 519 | 3300006358 | Ga0068871_100018941 | Ga0068871_1000189412 | 410 |
| 520 | 3300006931 | Ga0097620_100000120 | Ga0097620_10000012040 | 410 |
| 521 | 3300009092 | Ga0105250_10023339 | Ga0105250_100233392 | 410 |
| 522 | 3300009101 | Ga0105247_10000055 | Ga0105247_10000055113 | 410 |
| 523 | 3300009177 | Ga0105248_10012654 | Ga0105248_100126543 | 410 |
| 524 | 3300009553 | Ga0105249_10017204 | Ga0105249_100172045 | 410 |
| 525 | 3300013105 | Ga0157369_10406047 | Ga0157369_104060471 | 410 |
| 526 | 3300013306 | Ga0163162_10069456 | Ga0163162_100694563 | 410 |
| 527 | 3300014325 | Ga0163163_10017374 | Ga0163163_100173744 | 410 |
| 528 | 3300025900 | Ga0207710_10002790 | Ga0207710_100027905 | 410 |
| 529 | 3300025917 | Ga0207660_10099753 | Ga0207660_100997532 | 410 |
| 530 | 3300025931 | Ga0207644_10002871 | Ga0207644_100028713 | 410 |
| 531 | 3300025941 | Ga0207711_10068377 | Ga0207711_100683772 | 410 |
| 532 | 3300025961 | Ga0207712_10011809 | Ga0207712_100118092 | 410 |
| 533 | 3300025986 | Ga0207658_10217974 | Ga0207658_102179741 | 410 |
| 534 | 3300026035 | Ga0207703_10003948 | Ga0207703_100039485 | 410 |
| 535 | 3300028379 | Ga0268266_10201744 | Ga0268266_102017442 | 410 |
| 536 | 3300031712 | Ga0265342_10074316 | Ga0265342_100743162 | 410 |
| 537 | 3300046519 | Ga0495632_0000001 | Ga0495632_0000001_573673_574986 | 410 |
| 538 | 3300046520 | Ga0495637_0000065 | Ga0495637_0000065_20722_22035 | 410 |
| 539 | 3300046522 | Ga0495643_0000006 | Ga0495643_0000006_264835_266148 | 410 |
| 540 | 3300046522 | Ga0495643_0020344 | Ga0495643_0020344_2107_3444 | 410 |
| 541 | 3300046525 | Ga0495663_0000001 | Ga0495663_0000001_298310_299623 | 410 |
| 542 | 3300046558 | Ga0495633_0000053 | Ga0495633_0000053_125322_126635 | 410 |
| 543 | 3300046558 | Ga0495633_0004208 | Ga0495633_0004208_2843_4156 | 410 |
| 544 | 3300046660 | Ga0495625_0088495 | Ga0495625_0088495_34_1362 | 410 |
| 545 | 3300046692 | Ga0495671_0000008 | Ga0495671_0000008_264835_266148 | 410 |
| 546 | 3300047469 | Ga0495673_0000148 | Ga0495673_0000148_2122_3471 | 410 |
| 547 | 3300047470 | Ga0495681_0002435 | Ga0495681_0002435_10234_11547 | 410 |
| 548 | 3300047472 | Ga0495686_0008109 | Ga0495686_0008109_4053_5366 | 410 |
| 549 | 3300047472 | Ga0495686_0067805 | Ga0495686_0067805_106_1422 | 410 |
| 550 | 3300048905 | Ga0496102_0025804 | Ga0496102_0025804_3056_4366 | 410 |
| 551 | 3300048924 | Ga0496121_0000638 | Ga0496121_0000638_60244_61554 | 410 |
| 552 | 3300048925 | Ga0496122_0009961 | Ga0496122_0009961_618_1955 | 410 |
| 553 | 3300048926 | Ga0496123_0006326 | Ga0496123_0006326_9794_11131 | 410 |
| 554 | 3300048927 | Ga0496124_0083374 | Ga0496124_0083374_726_2063 | 410 |
| 555 | 3300053087 | Ga0500643_007890 | Ga0500643_007890_257_1585 | 410 |
| 556 | 3300053093 | Ga0500651_0049417 | Ga0500651_0049417_191_1528 | 410 |
| 557 | 3300053130 | Ga0500642_0006809 | Ga0500642_0006809_1252_2589 | 410 |
| 558 | 3300053156 | Ga0500622_0004025 | Ga0500622_0004025_6918_8285 | 410 |
| 559 | 3300005347 | Ga0070668_100000739 | Ga0070668_10000073916 | 411 |
| 560 | 3300005353 | Ga0070669_100036071 | Ga0070669_1000360712 | 411 |
| 561 | 3300005367 | Ga0070667_100000162 | Ga0070667_10000016264 | 411 |
| 562 | 3300005841 | Ga0068863_100000047 | Ga0068863_1000000479 | 411 |
| 563 | 3300005843 | Ga0068860_100008267 | Ga0068860_1000082679 | 411 |
| 564 | 3300025923 | Ga0207681_10058084 | Ga0207681_100580843 | 411 |
| 565 | 3300025972 | Ga0207668_10000232 | Ga0207668_100002329 | 411 |
| 566 | 3300025986 | Ga0207658_10000127 | Ga0207658_100001279 | 411 |
| 567 | 3300026088 | Ga0207641_10000079 | Ga0207641_100000799 | 411 |
| 568 | 3300028381 | Ga0268264_10020123 | Ga0268264_100201234 | 411 |
| 569 | 3300046460 | Ga0495638_0001674 | Ga0495638_0001674_147_1463 | 411 |
| 570 | 3300046471 | Ga0495650_0000207 | Ga0495650_0000207_60524_61840 | 411 |
| 571 | 3300046471 | Ga0495650_0004993 | Ga0495650_0004993_1638_2978 | 411 |
| 572 | 3300046515 | Ga0495620_0016175 | Ga0495620_0016175_2291_3607 | 411 |
| 573 | 3300046530 | Ga0495654_0000016 | Ga0495654_0000016_244217_245533 | 411 |
| 574 | 3300047320 | Ga0495672_0004568 | Ga0495672_0004568_8883_10199 | 411 |
| 575 | 3300047469 | Ga0495673_0000223 | Ga0495673_0000223_6634_7950 | 411 |
| 576 | 3300053104 | Ga0500556_0000688 | Ga0500556_0000688_3198_4514 | 411 |
| 577 | 3300053134 | Ga0500658_0003121 | Ga0500658_0003121_488_1804 | 411 |
| 578 | 3300053153 | Ga0500616_0008561 | Ga0500616_0008561_3108_4424 | 411 |
| 579 | 3300005329 | Ga0070683_100051339 | Ga0070683_1000513393 | 412 |
| 580 | 3300005344 | Ga0070661_100029231 | Ga0070661_1000292312 | 412 |
| 581 | 3300005614 | Ga0068856_100065917 | Ga0068856_1000659172 | 412 |
| 582 | 3300005618 | Ga0068864_100005216 | Ga0068864_1000052167 | 412 |
| 583 | 3300005834 | Ga0068851_10022628 | Ga0068851_100226282 | 412 |
| 584 | 3300005841 | Ga0068863_100000023 | Ga0068863_100000023137 | 412 |
| 585 | 3300005842 | Ga0068858_100005876 | Ga0068858_10000587610 | 412 |
| 586 | 3300009174 | Ga0105241_10022832 | Ga0105241_100228324 | 412 |
| 587 | 3300009551 | Ga0105238_10054217 | Ga0105238_100542173 | 412 |
| 588 | 3300013105 | Ga0157369_10127959 | Ga0157369_101279592 | 412 |
| 589 | 3300026035 | Ga0207703_10000571 | Ga0207703_1000057127 | 412 |
| 590 | 3300026088 | Ga0207641_10000286 | Ga0207641_1000028610 | 412 |
| 591 | 3300026095 | Ga0207676_10000188 | Ga0207676_1000018811 | 412 |
| 592 | 3300046512 | Ga0495610_0000044 | Ga0495610_0000044_47024_48373 | 412 |
| 593 | 3300048927 | Ga0496124_0000728 | Ga0496124_0000728_19224_20573 | 412 |
| 594 | 3300046453 | Ga0495627_002884 | Ga0495627_002884_4298_5614 | 413 |
| 595 | 3300046512 | Ga0495610_0005028 | Ga0495610_0005028_3662_5011 | 413 |
| 596 | 3300046522 | Ga0495643_0000023 | Ga0495643_0000023_218956_220305 | 413 |
| 597 | 3300046660 | Ga0495625_0000043 | Ga0495625_0000043_33718_35034 | 413 |
| 598 | 3300048918 | Ga0496115_0053854 | Ga0496115_0053854_1203_2519 | 413 |
| 599 | 3300048928 | Ga0496125_0089081 | Ga0496125_0089081_951_2300 | 413 |
| 600 | 3300053108 | Ga0500562_003809 | Ga0500562_003809_2047_3396 | 413 |
| 601 | 3300053136 | Ga0500559_0000927 | Ga0500559_0000927_2857_4173 | 413 |
| 602 | 3300053142 | Ga0500577_0000155 | Ga0500577_0000155_12680_14011 | 413 |
| 603 | 3300053153 | Ga0500616_0013118 | Ga0500616_0013118_2939_4264 | 413 |
| 604 | 3300005406 | Ga0070703_10000111 | Ga0070703_1000011138 | 414 |
| 605 | 3300005434 | Ga0070709_10000003 | Ga0070709_10000003111 | 414 |
| 606 | 3300005440 | Ga0070705_100000002 | Ga0070705_10000000256 | 414 |
| 607 | 3300005445 | Ga0070708_100256935 | Ga0070708_1002569351 | 414 |
| 608 | 3300005467 | Ga0070706_100000066 | Ga0070706_10000006651 | 414 |
| 609 | 3300005518 | Ga0070699_100000236 | Ga0070699_10000023614 | 414 |
| 610 | 3300005546 | Ga0070696_100000017 | Ga0070696_10000001760 | 414 |
| 611 | 3300005546 | Ga0070696_100089553 | Ga0070696_1000895533 | 414 |
| 612 | 3300009147 | Ga0114129_10010022 | Ga0114129_100100227 | 414 |
| 613 | 3300009147 | Ga0114129_10215573 | Ga0114129_102155733 | 414 |
| 614 | 3300009147 | Ga0114129_10275530 | Ga0114129_102755302 | 414 |
| 615 | 3300009177 | Ga0105248_10248992 | Ga0105248_102489921 | 414 |
| 616 | 3300025885 | Ga0207653_10000077 | Ga0207653_1000007718 | 414 |
| 617 | 3300025906 | Ga0207699_10000006 | Ga0207699_10000006125 | 414 |
| 618 | 3300025910 | Ga0207684_10000120 | Ga0207684_1000012088 | 414 |
| 619 | 3300039447 | Ga0436361_0909611 | Ga0436361_0909611_11023_12342 | 414 |
| 620 | 3300042156 | Ga0439446_0005828 | Ga0439446_0005828_381_1697 | 414 |
| 621 | 3300046460 | Ga0495638_0000029 | Ga0495638_0000029_138412_139773 | 414 |
| 622 | 3300046506 | Ga0495583_0000913 | Ga0495583_0000913_23719_25080 | 414 |
| 623 | 3300046519 | Ga0495632_0000548 | Ga0495632_0000548_10158_11519 | 414 |
| 624 | 3300046524 | Ga0495648_0000020 | Ga0495648_0000020_62560_63921 | 414 |
| 625 | 3300046558 | Ga0495633_0002210 | Ga0495633_0002210_7096_8457 | 414 |
| 626 | 3300046616 | Ga0495668_0021863 | Ga0495668_0021863_2264_3601 | 414 |
| 627 | 3300046660 | Ga0495625_0011140 | Ga0495625_0011140_5904_7220 | 414 |
| 628 | 3300046692 | Ga0495671_0000022 | Ga0495671_0000022_62489_63850 | 414 |
| 629 | 3300047469 | Ga0495673_0000051 | Ga0495673_0000051_191762_193123 | 414 |
| 630 | 3300050507 | nmdc:mga05p37_1887_c1 | nmdc:mga05p37_1887_c1_6139_7503 | 414 |
| 631 | 3300053121 | Ga0500607_004589 | Ga0500607_004589_7878_9206 | 414 |
| 632 | iso_pu_bacteria | 2884215851 | 2884217242 | 414 |
| 633 | 3300005719 | Ga0068861_100249567 | Ga0068861_1002495671 | 415 |
| 634 | 3300005843 | Ga0068860_100007819 | Ga0068860_10000781910 | 415 |
| 635 | 3300005844 | Ga0068862_100000001 | Ga0068862_100000001404 | 415 |
| 636 | 3300026118 | Ga0207675_100000349 | Ga0207675_10000034910 | 415 |
| 637 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001632 | 415 |
| 638 | 3300028381 | Ga0268264_10014719 | Ga0268264_100147192 | 415 |
| 639 | 3300053125 | Ga0500618_000022 | Ga0500618_000022_32286_33602 | 415 |
| 640 | 3300053136 | Ga0500559_0000054 | Ga0500559_0000054_15127_16443 | 415 |
| 641 | 3300053730 | Ga0500645_001988 | Ga0500645_001988_6042_7409 | 415 |
| 642 | 3300053730 | Ga0500645_005582 | Ga0500645_005582_547_1875 | 415 |
| 643 | 3300005295 | Ga0065707_10127388 | Ga0065707_101273881 | 416 |
| 644 | 3300005842 | Ga0068858_100000094 | Ga0068858_10000009425 | 416 |
| 645 | 3300006042 | Ga0075368_10000447 | Ga0075368_100004476 | 416 |
| 646 | 3300006178 | Ga0075367_10000022 | Ga0075367_1000002215 | 416 |
| 647 | 3300006195 | Ga0075366_10047605 | Ga0075366_100476052 | 416 |
| 648 | 3300006353 | Ga0075370_10066079 | Ga0075370_100660792 | 416 |
| 649 | 3300009098 | Ga0105245_10100590 | Ga0105245_101005903 | 416 |
| 650 | 3300009177 | Ga0105248_10109781 | Ga0105248_101097812 | 416 |
| 651 | 3300009553 | Ga0105249_10267670 | Ga0105249_102676701 | 416 |
| 652 | 3300025915 | Ga0207693_10085740 | Ga0207693_100857403 | 416 |
| 653 | 3300026035 | Ga0207703_10000928 | Ga0207703_1000092826 | 416 |
| 654 | 3300027866 | Ga0209813_10002394 | Ga0209813_100023944 | 416 |
| 655 | 3300046512 | Ga0495610_0000140 | Ga0495610_0000140_62258_63574 | 416 |
| 656 | 3300046518 | Ga0495631_0029316 | Ga0495631_0029316_127_1443 | 416 |
| 657 | 3300046660 | Ga0495625_0021125 | Ga0495625_0021125_149_1465 | 416 |
| 658 | 3300048925 | Ga0496122_0001615 | Ga0496122_0001615_32141_33508 | 416 |
| 659 | 3300048926 | Ga0496123_0001983 | Ga0496123_0001983_16270_17637 | 416 |
| 660 | 3300050494 | nmdc:mga06z11_7_c1 | nmdc:mga06z11_7_c1_71510_72841 | 416 |
| 661 | 3300050495 | nmdc:mga04h51_44_c1 | nmdc:mga04h51_44_c1_37902_39233 | 416 |
| 662 | 3300053157 | Ga0500624_000008 | Ga0500624_000008_100988_102364 | 416 |
| 663 | 3300053178 | Ga0500637_0000037 | Ga0500637_0000037_24151_25527 | 416 |
| 664 | iso_pu_bacteria | 2928100450 | 2928101847 | 416 |
| 665 | 3300005844 | Ga0068862_100007196 | Ga0068862_1000071964 | 417 |
| 666 | 3300009177 | Ga0105248_10041647 | Ga0105248_100416472 | 417 |
| 667 | 3300013306 | Ga0163162_10287298 | Ga0163162_102872982 | 417 |
| 668 | 3300017792 | Ga0163161_10000544 | Ga0163161_1000054419 | 417 |
| 669 | 3300025931 | Ga0207644_10177263 | Ga0207644_101772632 | 417 |
| 670 | 3300025986 | Ga0207658_10102277 | Ga0207658_101022772 | 417 |
| 671 | 3300026088 | Ga0207641_10109238 | Ga0207641_101092382 | 417 |
| 672 | 3300037853 | Ga0436364_0044893 | Ga0436364_0044893_3753_5060 | 417 |
| 673 | 3300046500 | Ga0495596_0000042 | Ga0495596_0000042_40167_41534 | 417 |
| 674 | 3300046507 | Ga0495606_0021604 | Ga0495606_0021604_3163_4530 | 417 |
| 675 | 3300046513 | Ga0495616_0000009 | Ga0495616_0000009_122521_123846 | 417 |
| 676 | 3300046522 | Ga0495643_0027011 | Ga0495643_0027011_239_1606 | 417 |
| 677 | 3300046538 | Ga0495609_0006904 | Ga0495609_0006904_3924_5291 | 417 |
| 678 | 3300047472 | Ga0495686_0005147 | Ga0495686_0005147_2393_3712 | 417 |
| 679 | 3300048920 | Ga0496117_0006309 | Ga0496117_0006309_3968_5290 | 417 |
| 680 | 3300048921 | Ga0496118_0000606 | Ga0496118_0000606_43118_44440 | 417 |
| 681 | iso_pu_bacteria | 2510917020 | 2511125591 | 417 |
| 682 | iso_pu_bacteria | 2582581280 | 2585154571 | 417 |
| 683 | iso_pu_bacteria | 2582581293 | 2585198540 | 417 |
| 684 | iso_pu_bacteria | 2585428106 | 2587919766 | 417 |
| 685 | iso_pu_bacteria | 2643221545 | 2643750391 | 417 |
| 686 | iso_pu_bacteria | 2643221552 | 2643780333 | 417 |
| 687 | iso_pu_bacteria | 2643221583 | 2643926926 | 417 |
| 688 | iso_pu_bacteria | 2643221584 | 2643932172 | 417 |
| 689 | iso_pu_bacteria | 2643221640 | 2644223609 | 417 |
| 690 | iso_pu_bacteria | 2643221642 | 2644236303 | 417 |
| 691 | iso_pu_bacteria | 2643221691 | 2644507279 | 417 |
| 692 | iso_pu_bacteria | 2739367756 | 2739790770 | 417 |
| 693 | iso_pu_bacteria | 2791355048 | 2792459339 | 417 |
| 694 | iso_pu_bacteria | 2818991435 | 2819538360 | 417 |
| 695 | iso_pu_bacteria | 2818991454 | 2819649390 | 417 |
| 696 | iso_pu_bacteria | 2843744320 | 2843744736 | 417 |
| 697 | iso_pu_bacteria | 2849560528 | 2849563520 | 417 |
| 698 | iso_pu_bacteria | 2849573788 | 2849577547 | 417 |
| 699 | iso_pu_bacteria | 2851153111 | 2851157896 | 417 |
| 700 | iso_pu_bacteria | 2898329390 | 2898330627 | 417 |
| 701 | 3300005327 | Ga0070658_10005267 | Ga0070658_100052674 | 418 |
| 702 | 3300005339 | Ga0070660_100013911 | Ga0070660_1000139116 | 418 |
| 703 | 3300005339 | Ga0070660_100033918 | Ga0070660_1000339185 | 418 |
| 704 | 3300005366 | Ga0070659_100003866 | Ga0070659_1000038665 | 418 |
| 705 | 3300005435 | Ga0070714_100028179 | Ga0070714_1000281794 | 418 |
| 706 | 3300005539 | Ga0068853_100024916 | Ga0068853_1000249163 | 418 |
| 707 | 3300005563 | Ga0068855_100015111 | Ga0068855_1000151117 | 418 |
| 708 | 3300005614 | Ga0068856_100227121 | Ga0068856_1002271212 | 418 |
| 709 | 3300005616 | Ga0068852_100005962 | Ga0068852_1000059625 | 418 |
| 710 | 3300005834 | Ga0068851_10006050 | Ga0068851_100060503 | 418 |
| 711 | 3300006028 | Ga0070717_10051550 | Ga0070717_100515502 | 418 |
| 712 | 3300009093 | Ga0105240_10001097 | Ga0105240_1000109722 | 418 |
| 713 | 3300009093 | Ga0105240_10006037 | Ga0105240_100060374 | 418 |
| 714 | 3300009093 | Ga0105240_10007626 | Ga0105240_100076266 | 418 |
| 715 | 3300009093 | Ga0105240_10054737 | Ga0105240_100547372 | 418 |
| 716 | 3300009545 | Ga0105237_10098447 | Ga0105237_100984473 | 418 |
| 717 | 3300009551 | Ga0105238_10006830 | Ga0105238_100068308 | 418 |
| 718 | 3300009551 | Ga0105238_10035909 | Ga0105238_100359092 | 418 |
| 719 | 3300010375 | Ga0105239_10018071 | Ga0105239_100180713 | 418 |
| 720 | 3300010375 | Ga0105239_10255785 | Ga0105239_102557852 | 418 |
| 721 | 3300011119 | Ga0105246_10002204 | Ga0105246_100022044 | 418 |
| 722 | 3300013104 | Ga0157370_10158449 | Ga0157370_101584492 | 418 |
| 723 | 3300013105 | Ga0157369_10005268 | Ga0157369_100052685 | 418 |
| 724 | 3300013105 | Ga0157369_10016374 | Ga0157369_100163745 | 418 |
| 725 | 3300013105 | Ga0157369_10051635 | Ga0157369_100516355 | 418 |
| 726 | 3300013307 | Ga0157372_10016888 | Ga0157372_100168885 | 418 |
| 727 | 3300025261 | Ga0209233_1007598 | Ga0209233_10075983 | 418 |
| 728 | 3300025909 | Ga0207705_10004604 | Ga0207705_100046044 | 418 |
| 729 | 3300025913 | Ga0207695_10000589 | Ga0207695_1000058936 | 418 |
| 730 | 3300025913 | Ga0207695_10013141 | Ga0207695_100131417 | 418 |
| 731 | 3300025914 | Ga0207671_10073447 | Ga0207671_100734472 | 418 |
| 732 | 3300025919 | Ga0207657_10020704 | Ga0207657_100207046 | 418 |
| 733 | 3300025919 | Ga0207657_10045003 | Ga0207657_100450035 | 418 |
| 734 | 3300025920 | Ga0207649_10016461 | Ga0207649_100164612 | 418 |
| 735 | 3300025924 | Ga0207694_10003477 | Ga0207694_100034774 | 418 |
| 736 | 3300025924 | Ga0207694_10006128 | Ga0207694_100061284 | 418 |
| 737 | 3300025949 | Ga0207667_10005014 | Ga0207667_100050148 | 418 |
| 738 | 3300025949 | Ga0207667_10059545 | Ga0207667_100595453 | 418 |
| 739 | 3300026041 | Ga0207639_10013114 | Ga0207639_100131144 | 418 |
| 740 | 3300026041 | Ga0207639_10115375 | Ga0207639_101153752 | 418 |
| 741 | 3300026078 | Ga0207702_10050841 | Ga0207702_100508412 | 418 |
| 742 | 3300031711 | Ga0265314_10003138 | Ga0265314_100031387 | 418 |
| 743 | 3300046519 | Ga0495632_0044015 | Ga0495632_0044015_820_2187 | 418 |
| 744 | 3300046522 | Ga0495643_0032491 | Ga0495643_0032491_258_1565 | 418 |
| 745 | 3300046536 | Ga0495587_0018167 | Ga0495587_0018167_1301_2608 | 418 |
| 746 | 3300046543 | Ga0495645_0016723 | Ga0495645_0016723_2784_4091 | 418 |
| 747 | 3300046543 | Ga0495645_0083729 | Ga0495645_0083729_660_1982 | 418 |
| 748 | 3300046616 | Ga0495668_0003290 | Ga0495668_0003290_6103_7428 | 418 |
| 749 | 3300046678 | Ga0495599_0034708 | Ga0495599_0034708_498_1805 | 418 |
| 750 | 3300046809 | Ga0495600_0093711 | Ga0495600_0093711_224_1531 | 418 |
| 751 | 3300047317 | Ga0495604_0033035 | Ga0495604_0033035_2705_4012 | 418 |
| 752 | 3300047472 | Ga0495686_0011443 | Ga0495686_0011443_3378_4691 | 418 |
| 753 | 3300048088 | Ga0495602_0015937 | Ga0495602_0015937_6082_7404 | 418 |
| 754 | 3300049679 | Ga0501249_008140 | Ga0501249_008140_583_1890 | 418 |
| 755 | 3300053138 | Ga0500564_016955 | Ga0500564_016955_851_2191 | 418 |
| 756 | iso_pu_bacteria | 2582581279 | 2585148735 | 418 |
| 757 | 3300002076 | JGI24749J21850_1000001 | JGI24749J21850_100000137 | 419 |
| 758 | 3300005295 | Ga0065707_10084403 | Ga0065707_100844034 | 419 |
| 759 | 3300005336 | Ga0070680_100080691 | Ga0070680_1000806913 | 419 |
| 760 | 3300005367 | Ga0070667_100000453 | Ga0070667_10000045319 | 419 |
| 761 | 3300005436 | Ga0070713_100012419 | Ga0070713_1000124196 | 419 |
| 762 | 3300005530 | Ga0070679_100051727 | Ga0070679_1000517271 | 419 |
| 763 | 3300005548 | Ga0070665_100006874 | Ga0070665_1000068745 | 419 |
| 764 | 3300005617 | Ga0068859_100116748 | Ga0068859_1001167481 | 419 |
| 765 | 3300005842 | Ga0068858_100000647 | Ga0068858_10000064714 | 419 |
| 766 | 3300006358 | Ga0068871_100187475 | Ga0068871_1001874752 | 419 |
| 767 | 3300006931 | Ga0097620_100116747 | Ga0097620_1001167473 | 419 |
| 768 | 3300009093 | Ga0105240_10028229 | Ga0105240_100282293 | 419 |
| 769 | 3300009093 | Ga0105240_10030435 | Ga0105240_100304352 | 419 |
| 770 | 3300009093 | Ga0105240_10105715 | Ga0105240_101057151 | 419 |
| 771 | 3300009177 | Ga0105248_10000222 | Ga0105248_1000022241 | 419 |
| 772 | 3300010375 | Ga0105239_10281882 | Ga0105239_102818822 | 419 |
| 773 | 3300014326 | Ga0157380_10001122 | Ga0157380_1000112211 | 419 |
| 774 | 3300014968 | Ga0157379_10147584 | Ga0157379_101475842 | 419 |
| 775 | 3300014969 | Ga0157376_10073833 | Ga0157376_100738333 | 419 |
| 776 | 3300025912 | Ga0207707_10040031 | Ga0207707_100400313 | 419 |
| 777 | 3300025913 | Ga0207695_10015840 | Ga0207695_100158402 | 419 |
| 778 | 3300025913 | Ga0207695_10023789 | Ga0207695_100237893 | 419 |
| 779 | 3300025913 | Ga0207695_10170116 | Ga0207695_101701161 | 419 |
| 780 | 3300025914 | Ga0207671_10166777 | Ga0207671_101667772 | 419 |
| 781 | 3300025917 | Ga0207660_10011251 | Ga0207660_100112516 | 419 |
| 782 | 3300025921 | Ga0207652_10119570 | Ga0207652_101195702 | 419 |
| 783 | 3300025924 | Ga0207694_10029179 | Ga0207694_100291793 | 419 |
| 784 | 3300025941 | Ga0207711_10000199 | Ga0207711_1000019916 | 419 |
| 785 | 3300025986 | Ga0207658_10000620 | Ga0207658_1000062021 | 419 |
| 786 | 3300026035 | Ga0207703_10000672 | Ga0207703_1000067217 | 419 |
| 787 | 3300028379 | Ga0268266_10000504 | Ga0268266_100005045 | 419 |
| 788 | 3300028800 | Ga0265338_10068653 | Ga0265338_100686532 | 419 |
| 789 | 3300031247 | Ga0265340_10003747 | Ga0265340_100037476 | 419 |
| 790 | 3300031507 | Ga0307509_10000130 | Ga0307509_1000013083 | 419 |
| 791 | 3300033180 | Ga0307510_10000011 | Ga0307510_10000011235 | 419 |
| 792 | 3300033180 | Ga0307510_10132960 | Ga0307510_101329602 | 419 |
| 793 | 3300035695 | Ga0373927_0109687 | Ga0373927_0109687_386_1696 | 419 |
| 794 | 3300039437 | Ga0436365_1702795 | Ga0436365_1702795_1531_2841 | 419 |
| 795 | 3300039447 | Ga0436361_0873977 | Ga0436361_0873977_70_1380 | 419 |
| 796 | 3300045049 | Ga0466959_0031259 | Ga0466959_0031259_529_1839 | 419 |
| 797 | 3300046519 | Ga0495632_0042069 | Ga0495632_0042069_866_2176 | 419 |
| 798 | 3300046648 | Ga0495611_0074587 | Ga0495611_0074587_160_1470 | 419 |
| 799 | 3300048907 | Ga0496104_0000068 | Ga0496104_0000068_14054_15376 | 419 |
| 800 | 3300048919 | Ga0496116_0000017 | Ga0496116_0000017_407783_409132 | 419 |
| 801 | 3300048921 | Ga0496118_0068487 | Ga0496118_0068487_873_2222 | 419 |
| 802 | 3300048922 | Ga0496119_0000330 | Ga0496119_0000330_52333_53643 | 419 |
| 803 | 3300048922 | Ga0496119_0007235 | Ga0496119_0007235_2388_3698 | 419 |
| 804 | 3300048923 | Ga0496120_0000242 | Ga0496120_0000242_9796_11106 | 419 |
| 805 | 3300048923 | Ga0496120_0005194 | Ga0496120_0005194_1091_2401 | 419 |
| 806 | 3300048924 | Ga0496121_0004232 | Ga0496121_0004232_6950_8260 | 419 |
| 807 | 3300048924 | Ga0496121_0050308 | Ga0496121_0050308_691_2001 | 419 |
| 808 | 3300048925 | Ga0496122_0013355 | Ga0496122_0013355_3348_4697 | 419 |
| 809 | 3300048926 | Ga0496123_0000389 | Ga0496123_0000389_38771_40120 | 419 |
| 810 | 3300048927 | Ga0496124_0002794 | Ga0496124_0002794_5328_6677 | 419 |
| 811 | 3300048927 | Ga0496124_0014343 | Ga0496124_0014343_2982_4331 | 419 |
| 812 | 3300048928 | Ga0496125_0000220 | Ga0496125_0000220_47448_48758 | 419 |
| 813 | 3300048928 | Ga0496125_0004581 | Ga0496125_0004581_1479_2789 | 419 |
| 814 | 3300048929 | Ga0496126_0002257 | Ga0496126_0002257_18257_19606 | 419 |
| 815 | 3300048929 | Ga0496126_0053712 | Ga0496126_0053712_758_2068 | 419 |
| 816 | 3300053111 | Ga0500572_036862 | Ga0500572_036862_69_1379 | 419 |
| 817 | iso_pu_bacteria | 2857504554 | 2857506001 | 419 |
| 818 | iso_pu_bacteria | 2928027323 | 2928029559 | 419 |
| 819 | 3300046453 | Ga0495627_001472 | Ga0495627_001472_8003_9352 | 420 |
| 820 | 3300046471 | Ga0495650_0000507 | Ga0495650_0000507_50214_51563 | 420 |
| 821 | 3300046506 | Ga0495583_0000997 | Ga0495583_0000997_13597_14937 | 420 |
| 822 | 3300046519 | Ga0495632_0001216 | Ga0495632_0001216_18362_19711 | 420 |
| 823 | 3300047470 | Ga0495681_0000014 | Ga0495681_0000014_80763_82112 | 420 |
| 824 | 3300053087 | Ga0500643_001750 | Ga0500643_001750_1131_2444 | 420 |
| 825 | 3300053103 | Ga0500555_001173 | Ga0500555_001173_5110_6450 | 420 |
| 826 | iso_pu_bacteria | 2738541275 | 2738710202 | 420 |
| 827 | iso_pu_bacteria | 2738541301 | 2738848627 | 420 |
| 828 | iso_pu_bacteria | 2738541304 | 2738864356 | 420 |
| 829 | iso_pu_bacteria | 2738543022 | 2739296874 | 420 |
| 830 | iso_pu_bacteria | 2738543033 | 2739358552 | 420 |
| 831 | iso_pu_bacteria | 2928959182 | 2928959939 | 420 |
| 832 | 3300003775 | Ga0055524_1023436 | Ga0055524_10234361 | 421 |
| 833 | 3300003794 | Ga0055531_10022604 | Ga0055531_100226042 | 421 |
| 834 | 3300005262 | Ga0065165_1000279 | Ga0065165_100027984 | 421 |
| 835 | 3300005466 | Ga0070685_10006416 | Ga0070685_100064166 | 421 |
| 836 | 3300005563 | Ga0068855_100151387 | Ga0068855_1001513871 | 421 |
| 837 | 3300006880 | Ga0075429_100100214 | Ga0075429_1001002142 | 421 |
| 838 | 3300009177 | Ga0105248_10000619 | Ga0105248_1000061912 | 421 |
| 839 | 3300009551 | Ga0105238_10038338 | Ga0105238_100383387 | 421 |
| 840 | 3300025263 | Ga0209565_1000183 | Ga0209565_100018330 | 421 |
| 841 | 3300025273 | Ga0209673_1001961 | Ga0209673_100196117 | 421 |
| 842 | 3300025295 | Ga0209564_1000446 | Ga0209564_100044646 | 421 |
| 843 | 3300025299 | Ga0209256_1000694 | Ga0209256_100069417 | 421 |
| 844 | 3300025299 | Ga0209256_1003679 | Ga0209256_10036792 | 421 |
| 845 | 3300025299 | Ga0209256_1010220 | Ga0209256_10102206 | 421 |
| 846 | 3300025304 | Ga0209257_1000352 | Ga0209257_100035265 | 421 |
| 847 | 3300025924 | Ga0207694_10075275 | Ga0207694_100752752 | 421 |
| 848 | 3300025941 | Ga0207711_10000670 | Ga0207711_1000067020 | 421 |
| 849 | 3300037312 | Ga0395899_0000307 | Ga0395899_0000307_52464_53780 | 421 |
| 850 | 3300037418 | Ga0395900_0000052 | Ga0395900_0000052_30233_31549 | 421 |
| 851 | 3300037471 | Ga0395905_0002282 | Ga0395905_0002282_15151_16467 | 421 |
| 852 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_756451_757767 | 421 |
| 853 | 3300041512 | Ga0451853_0660934 | Ga0451853_0660934_517_1833 | 421 |
| 854 | 3300045836 | Ga0466958_0000243 | Ga0466958_0000243_17888_19213 | 421 |
| 855 | 3300046460 | Ga0495638_0000230 | Ga0495638_0000230_61908_63224 | 421 |
| 856 | 3300046506 | Ga0495583_0000025 | Ga0495583_0000025_227960_229288 | 421 |
| 857 | 3300046520 | Ga0495637_0014041 | Ga0495637_0014041_1600_2916 | 421 |
| 858 | 3300046616 | Ga0495668_0025141 | Ga0495668_0025141_1931_3247 | 421 |
| 859 | 3300047319 | Ga0495674_0052629 | Ga0495674_0052629_1412_2728 | 421 |
| 860 | 3300047469 | Ga0495673_0001666 | Ga0495673_0001666_14849_16165 | 421 |
| 861 | 3300047472 | Ga0495686_0001338 | Ga0495686_0001338_17367_18713 | 421 |
| 862 | 3300048920 | Ga0496117_0092864 | Ga0496117_0092864_405_1748 | 421 |
| 863 | 3300048921 | Ga0496118_0018283 | Ga0496118_0018283_402_1745 | 421 |
| 864 | 3300050508 | nmdc:mga09592_115913_c1 | nmdc:mga09592_115913_c1_837_2198 | 421 |
| 865 | 3300053119 | Ga0500595_006099 | Ga0500595_006099_110_1429 | 421 |
| 866 | 3300053125 | Ga0500618_003726 | Ga0500618_003726_1336_2700 | 421 |
| 867 | 3300053136 | Ga0500559_0000010 | Ga0500559_0000010_70563_71879 | 421 |
| 868 | 3300001989 | JGI24739J22299_10004388 | JGI24739J22299_100043882 | 422 |
| 869 | 3300003316 | rootH1_10006386 | rootH1_100063861 | 422 |
| 870 | 3300005834 | Ga0068851_10034142 | Ga0068851_100341422 | 422 |
| 871 | 3300021388 | Ga0213875_10011902 | Ga0213875_100119023 | 422 |
| 872 | 3300025298 | Ga0209050_1001476 | Ga0209050_100147624 | 422 |
| 873 | 3300025904 | Ga0207647_10001763 | Ga0207647_1000176311 | 422 |
| 874 | 3300028786 | Ga0307517_10064858 | Ga0307517_100648582 | 422 |
| 875 | 3300047472 | Ga0495686_0001971 | Ga0495686_0001971_16937_18292 | 422 |
| 876 | 3300048920 | Ga0496117_0063041 | Ga0496117_0063041_68_1423 | 422 |
| 877 | 3300048921 | Ga0496118_0026684 | Ga0496118_0026684_638_1993 | 422 |
| 878 | 3300049679 | Ga0501249_000096 | Ga0501249_000096_5086_6408 | 422 |
| 879 | iso_pu_bacteria | 2919138771 | 2919139282 | 422 |
| 880 | 3300005347 | Ga0070668_100001077 | Ga0070668_1000010774 | 423 |
| 881 | 3300026078 | Ga0207702_10021330 | Ga0207702_100213303 | 423 |
| 882 | 3300026116 | Ga0207674_10010712 | Ga0207674_100107129 | 423 |
| 883 | 3300026142 | Ga0207698_10002792 | Ga0207698_100027923 | 423 |
| 884 | 3300037471 | Ga0395905_0168713 | Ga0395905_0168713_336_1694 | 423 |
| 885 | iso_pu_bacteria | 2512564014 | 2512642168 | 423 |
| 886 | iso_pu_bacteria | 2751185897 | 2753767143 | 423 |
| 887 | 3300046500 | Ga0495596_0000782 | Ga0495596_0000782_2596_3960 | 424 |
| 888 | iso_pu_bacteria | 2739367664 | 2739648920 | 424 |
| 889 | iso_pu_bacteria | 2739367865 | 2740027393 | 424 |
| 890 | 3300005617 | Ga0068859_100002276 | Ga0068859_10000227611 | 425 |
| 891 | 3300005719 | Ga0068861_100026207 | Ga0068861_1000262071 | 425 |
| 892 | 3300006931 | Ga0097620_100002276 | Ga0097620_1000022763 | 425 |
| 893 | 3300009177 | Ga0105248_10019560 | Ga0105248_100195601 | 425 |
| 894 | 3300017792 | Ga0163161_10000452 | Ga0163161_1000045221 | 425 |
| 895 | 3300026088 | Ga0207641_10012322 | Ga0207641_100123224 | 425 |
| 896 | 3300026118 | Ga0207675_100000317 | Ga0207675_10000031743 | 425 |
| 897 | 3300044658 | Ga0466972_0000305 | Ga0466972_0000305_13341_14705 | 425 |
| 898 | 3300044706 | Ga0466964_0004635 | Ga0466964_0004635_3169_4533 | 425 |
| 899 | 3300044901 | Ga0466960_0006918 | Ga0466960_0006918_425_1789 | 425 |
| 900 | 3300046501 | Ga0495607_0002129 | Ga0495607_0002129_1622_2965 | 425 |
| 901 | 3300047472 | Ga0495686_0000031 | Ga0495686_0000031_263621_264970 | 425 |
| 902 | 3300053121 | Ga0500607_000036 | Ga0500607_000036_49596_51038 | 425 |
| 903 | 3300053136 | Ga0500559_0000952 | Ga0500559_0000952_15016_16458 | 425 |
| 904 | iso_pu_bacteria | 2599185354 | 2600202796 | 425 |
| 905 | 3300048929 | Ga0496126_0000005 | Ga0496126_0000005_206872_208278 | 426 |
| 906 | iso_pu_bacteria | 2818991438 | 2819552413 | 426 |
| 907 | 3300017792 | Ga0163161_10016234 | Ga0163161_100162342 | 427 |
| 908 | 3300025961 | Ga0207712_10137811 | Ga0207712_101378111 | 427 |
| 909 | 3300048091 | Ga0495626_0000826 | Ga0495626_0000826_21495_22907 | 427 |
| 910 | 3300048912 | Ga0496109_0100984 | Ga0496109_0100984_957_2294 | 427 |
| 911 | 3300048913 | Ga0496110_0123224 | Ga0496110_0123224_432_1769 | 427 |
| 912 | 3300048925 | Ga0496122_0004006 | Ga0496122_0004006_11254_12591 | 427 |
| 913 | 3300048926 | Ga0496123_0021786 | Ga0496123_0021786_3388_4725 | 427 |
| 914 | 3300048927 | Ga0496124_0025183 | Ga0496124_0025183_223_1560 | 427 |
| 915 | 3300048928 | Ga0496125_0009857 | Ga0496125_0009857_3442_4779 | 427 |
| 916 | 3300053103 | Ga0500555_001444 | Ga0500555_001444_4893_6287 | 427 |
| 917 | iso_pu_bacteria | 2984555340 | 2984557485 | 427 |
| 918 | iso_pu_bacteria | 2984564862 | 2984568155 | 427 |
| 919 | 3300002077 | JGI24744J21845_10015581 | JGI24744J21845_100155812 | 428 |
| 920 | 3300005355 | Ga0070671_100081026 | Ga0070671_1000810262 | 428 |
| 921 | 3300005456 | Ga0070678_100160307 | Ga0070678_1001603072 | 428 |
| 922 | 3300005563 | Ga0068855_100000029 | Ga0068855_10000002965 | 428 |
| 923 | 3300025937 | Ga0207669_10070919 | Ga0207669_100709192 | 428 |
| 924 | 3300025940 | Ga0207691_10244996 | Ga0207691_102449961 | 428 |
| 925 | 3300025949 | Ga0207667_10000035 | Ga0207667_10000035158 | 428 |
| 926 | 3300026121 | Ga0207683_10008681 | Ga0207683_100086816 | 428 |
| 927 | 3300053080 | Ga0500635_0000061 | Ga0500635_0000061_64190_65593 | 428 |
| 928 | 3300053087 | Ga0500643_000170 | Ga0500643_000170_32583_33953 | 428 |
| 929 | 3300053119 | Ga0500595_003665 | Ga0500595_003665_4817_6220 | 428 |
| 930 | 3300053122 | Ga0500608_003578 | Ga0500608_003578_2094_3497 | 428 |
| 931 | 3300053162 | Ga0500638_034229 | Ga0500638_034229_507_1910 | 428 |
| 932 | 3300053178 | Ga0500637_0012166 | Ga0500637_0012166_807_2210 | 428 |
| 933 | iso_pu_bacteria | 2808606401 | 2809063892 | 428 |
| 934 | iso_pu_bacteria | 2808606404 | 2809079860 | 428 |
| 935 | iso_pu_bacteria | 2808606405 | 2809084225 | 428 |
| 936 | iso_pu_bacteria | 2880518877 | 2880523421 | 428 |
| 937 | 3300003214 | JGI25165J46597_1000071 | JGI25165J46597_100007162 | 429 |
| 938 | 3300005842 | Ga0068858_100000093 | Ga0068858_10000009343 | 429 |
| 939 | 3300009098 | Ga0105245_10001260 | Ga0105245_1000126011 | 429 |
| 940 | 3300013297 | Ga0157378_10060639 | Ga0157378_100606392 | 429 |
| 941 | 3300025261 | Ga0209233_1000140 | Ga0209233_1000140124 | 429 |
| 942 | 3300025927 | Ga0207687_10198584 | Ga0207687_101985842 | 429 |
| 943 | 3300025981 | Ga0207640_10080138 | Ga0207640_100801382 | 429 |
| 944 | 3300026035 | Ga0207703_10000241 | Ga0207703_1000024152 | 429 |
| 945 | 3300050508 | nmdc:mga09592_116662_c1 | nmdc:mga09592_116662_c1_298_1716 | 429 |
| 946 | 3300050510 | nmdc:mga06r32_103332_c1 | nmdc:mga06r32_103332_c1_987_2405 | 429 |
| 947 | iso_pu_bacteria | 2884960567 | 2884961712 | 429 |
| 948 | 3300005355 | Ga0070671_100070644 | Ga0070671_1000706442 | 430 |
| 949 | 3300046460 | Ga0495638_0000097 | Ga0495638_0000097_91516_92865 | 430 |
| 950 | 3300046525 | Ga0495663_0008113 | Ga0495663_0008113_450_1799 | 430 |
| 951 | 3300047472 | Ga0495686_0099897 | Ga0495686_0099897_126_1475 | 430 |
| 952 | 3300003215 | JGI25153J46596_10000005 | JGI25153J46596_10000005398 | 431 |
| 953 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001398 | 431 |
| 954 | 3300045049 | Ga0466959_0015518 | Ga0466959_0015518_3309_4745 | 431 |
| 955 | 3300046524 | Ga0495648_0000024 | Ga0495648_0000024_80686_82041 | 431 |
| 956 | 3300047443 | Ga0495687_000045 | Ga0495687_000045_183711_185066 | 431 |
| 957 | 3300053104 | Ga0500556_0000408 | Ga0500556_0000408_5803_7152 | 431 |
| 958 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_475346_476695 | 431 |
| 959 | 3300053730 | Ga0500645_000001 | Ga0500645_000001_227276_228631 | 431 |
| 960 | 3300031456 | Ga0307513_10119798 | Ga0307513_101197982 | 432 |
| 961 | 3300031616 | Ga0307508_10000126 | Ga0307508_1000012635 | 432 |
| 962 | 3300046660 | Ga0495625_0000309 | Ga0495625_0000309_14213_15568 | 432 |
| 963 | 3300031239 | Ga0265328_10013792 | Ga0265328_100137923 | 433 |
| 964 | 3300048921 | Ga0496118_0019712 | Ga0496118_0019712_3716_5071 | 433 |
| 965 | 3300005457 | Ga0070662_100020516 | Ga0070662_1000205162 | 434 |
| 966 | iso_pu_bacteria | 2510917021 | 2511130971 | 434 |
| 967 | 3300006881 | Ga0068865_100052620 | Ga0068865_1000526202 | 435 |
| 968 | 3300009551 | Ga0105238_10020209 | Ga0105238_100202092 | 435 |
| 969 | 3300025924 | Ga0207694_10009773 | Ga0207694_100097734 | 435 |
| 970 | 3300025938 | Ga0207704_10055374 | Ga0207704_100553742 | 435 |
| 971 | iso_pu_bacteria | 8054302542 | 8054306222 | 436 |
| 972 | iso_pu_bacteria | 2990265787 | 2990267585 | 437 |
| 973 | iso_pu_bacteria | 2993693658 | 2993695180 | 437 |
| 974 | 2162886007 | SwRhRL2b_contig_2235436 | SwRhRL2b_0637.00007680 | 438 |
| 975 | 3300005289 | Ga0065704_10070176 | Ga0065704_1007017690 | 438 |
| 976 | 3300005289 | Ga0065704_10094793 | Ga0065704_100947933 | 438 |
| 977 | 3300005335 | Ga0070666_10092487 | Ga0070666_100924872 | 438 |
| 978 | 3300005347 | Ga0070668_100008702 | Ga0070668_1000087026 | 438 |
| 979 | 3300005353 | Ga0070669_100000393 | Ga0070669_10000039335 | 438 |
| 980 | 3300005367 | Ga0070667_100000112 | Ga0070667_10000011287 | 438 |
| 981 | 3300005367 | Ga0070667_100009649 | Ga0070667_1000096496 | 438 |
| 982 | 3300005548 | Ga0070665_100000150 | Ga0070665_10000015095 | 438 |
| 983 | 3300005841 | Ga0068863_100008711 | Ga0068863_1000087116 | 438 |
| 984 | 3300005843 | Ga0068860_100058444 | Ga0068860_1000584444 | 438 |
| 985 | 3300005844 | Ga0068862_100001478 | Ga0068862_10000147816 | 438 |
| 986 | 3300005844 | Ga0068862_100015582 | Ga0068862_1000155823 | 438 |
| 987 | 3300009011 | Ga0105251_10000694 | Ga0105251_1000069420 | 438 |
| 988 | 3300025923 | Ga0207681_10000062 | Ga0207681_1000006257 | 438 |
| 989 | 3300025925 | Ga0207650_10026035 | Ga0207650_100260353 | 438 |
| 990 | 3300025941 | Ga0207711_10002295 | Ga0207711_1000229514 | 438 |
| 991 | 3300025986 | Ga0207658_10000461 | Ga0207658_1000046115 | 438 |
| 992 | 3300025986 | Ga0207658_10007015 | Ga0207658_100070156 | 438 |
| 993 | 3300026088 | Ga0207641_10013254 | Ga0207641_100132545 | 438 |
| 994 | 3300026088 | Ga0207641_10026977 | Ga0207641_100269772 | 438 |
| 995 | 3300028379 | Ga0268266_10000124 | Ga0268266_1000012417 | 438 |
| 996 | 3300028380 | Ga0268265_10009536 | Ga0268265_100095364 | 438 |
| 997 | 3300028380 | Ga0268265_10088162 | Ga0268265_100881622 | 438 |
| 998 | 3300028381 | Ga0268264_10011531 | Ga0268264_100115316 | 438 |
| 999 | 3300028381 | Ga0268264_10015733 | Ga0268264_100157333 | 438 |
| 1000 | 3300048906 | Ga0496103_0029064 | Ga0496103_0029064_448_1827 | 438 |
| 1001 | 3300048921 | Ga0496118_0089272 | Ga0496118_0089272_486_1865 | 438 |
| 1002 | 3300048924 | Ga0496121_0011285 | Ga0496121_0011285_6784_8163 | 438 |
| 1003 | 3300048926 | Ga0496123_0018626 | Ga0496123_0018626_2758_4137 | 438 |
| 1004 | 3300048929 | Ga0496126_0046671 | Ga0496126_0046671_265_1644 | 438 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5iof-assembly1.cif.gz_A | structure of the transmembrane domain of the transporter slc26dg | 0.7209 | 33 | 413 |
| 5da0-assembly1.cif.gz_A | structure of the the slc26 transporter slc26dg in complex with a nanobody | 0.7195 | 33 | 415 |
| 7v73-assembly1.cif.gz_A | thermostabilized human prestin in complex with chloride | 0.7101 | 34 | 411 |
| 5iof-assembly1.cif.gz_A | structure of the transmembrane domain of the transporter slc26dg | 0.7059 | 33 | 413 |
| 8uc1-assembly1.cif.gz_B | cryo-em structure of dolphin prestin in low cl buffer | 0.6978 | 32 | 415 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57772_21_432_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9106 | 35 | 432 | 1.20.1740.10 |
| af_Q57772_21_432_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8785 | 35 | 432 | 1.20.1740.10 |
| af_P76103_4_381_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6082 | 34 | 409 | 1.20.1740.10 |
| af_P76103_4_381_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.5982 | 34 | 409 | 1.20.1740.10 |
| af_Q6ZIE6_46_504_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.5302 | 42 | 421 | 1.20.1730.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-R5ZCG8-F1-model_v4 | deleted | 0.9616 | 20 | 226 |
|
| AF-A0A3M1XUJ6-F1-model_v4 | NCS2 family permease | 0.9613 | 17 | 228 |
GO:0005886
GO:0012505 GO:0015207 |
| AF-A0A831LR38-F1-model_v4 | NCS2 family permease | 0.9595 | 19 | 229 |
GO:0005345
GO:0005886 GO:0012505 |
| AF-A0A1L8ZAD8-F1-model_v4 | Guanine permease | 0.9525 | 46 | 215 |
GO:0005345
GO:0005886 GO:0012505 |
| AF-A0A3M1XUJ6-F1-model_v4 | NCS2 family permease | 0.9483 | 17 | 228 |
GO:0005886
GO:0012505 GO:0015207 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar