F487968

General Info

Members Datasets Scaffolds Average Seq Length
1004 454 938 419

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10013792|Ga0265328_100137923
Length 492
Sequence VSPRRRNDGSGGDAARGRVPGARGRLFSGACGAGARRLRATAGTGSELRVVDAMAGTIERYFRLAEQGTTVRTEVLAGLTTFLTMAYIVVVNPVILGEAGMPVAAVAAATCLAAGFGSILMGLVSNYPLALAPGMGLNAYFTFTVVKGMGVPWPTALGCVFLSGAAFLLLTVVGVRQLIISAMPRALFAAVAGGVGLFIAFIGLGDAGVIVARPGTMVGLGSLTTPTAALSLLGLLLIAALQARRVRGAMLLGILATAAVGWGIGLVHVAPGAYHAGDLAAAAFKLDVPAALNLKGGIGLSLVEIVFVFLFVDLFDNVGTLVAVTRKAGLVAPDGSIPRLNRILVVDSIAMAAGALVGTSPVTSYIESAAGVAAGGRTGLTSVVVGALFLVTLLFAPLVQAIPAAATAPALILVGGMMMGALAEVDWTEPGESIPAFLTVIMIPLSYSIANGLAFGITSHAALKLVRGDVRRGDWLIYVLAALCVARFVYLA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
4 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
5 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
6 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
7 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
8 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
9 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
10 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
11 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
12 2643221583 Caulobacter sp. Root655 Isolate Unclassified
13 2643221584 Caulobacter sp. Root656 Isolate Unclassified
14 2643221640 Caulobacter sp. Root342 Isolate Unclassified
15 2643221642 Caulobacter sp. Root343 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2643221729 Bacillus sp. Root11 Isolate Unclassified
18 2643221730 Bacillus sp. Root131 Isolate Unclassified
19 2684622632 Bacillus cereus 905 Isolate Unclassified
20 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
21 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
22 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
23 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
24 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
25 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
26 2738541358 Bacillus sp. OV752 Isolate Unclassified
27 2738543006 Bacillus sp. OK077 Isolate Unclassified
28 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
29 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
30 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
31 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
32 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
33 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
34 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
35 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
36 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
37 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
38 2818991435 Caulobacter henricii 536 Isolate Unclassified
39 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
40 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
41 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
42 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
43 2849560528 Caulobacter zeae 410 Isolate Unclassified
44 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
45 2851153111 Caulobacter radicis 736 Isolate Unclassified
46 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
47 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
48 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
49 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
50 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
51 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
52 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
53 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
54 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
55 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
56 2938917290 Bacillus sp. CR71 Isolate Unclassified
57 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
58 2965761152 Bacillus sp. COPE52 Isolate Unclassified
59 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
60 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
61 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
62 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
63 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
64 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
65 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
66 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
67 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
68 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
69 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
70 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
71 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
72 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
73 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
74 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
75 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
76 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
77 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
80 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
81 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
82 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
83 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
84 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
85 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
86 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
87 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
88 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
89 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
96 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
97 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
98 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
99 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
100 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
101 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
102 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
106 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
107 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
108 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
109 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
110 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
111 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
112 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
113 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
114 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
115 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
118 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
119 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
120 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
121 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
122 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
125 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
126 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
127 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
128 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
129 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
130 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
131 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
132 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
133 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
134 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
137 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
138 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
140 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
141 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
146 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
148 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
149 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
150 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
151 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
154 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
156 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
161 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
162 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
163 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
164 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
165 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
166 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
167 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
168 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
169 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
170 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
171 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
172 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
173 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
176 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
177 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
181 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
188 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
244 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
248 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
249 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
250 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
251 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
252 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
253 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
254 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
255 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
256 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
257 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
260 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
261 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
262 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
276 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
277 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
278 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
279 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
280 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
281 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
282 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
283 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
284 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
285 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
286 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
290 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
291 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
310 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
311 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
312 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
315 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
316 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
317 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
318 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
319 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
320 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
323 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
327 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
330 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
331 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
332 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
333 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
334 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
339 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
342 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
343 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
348 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
349 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
350 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
351 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
352 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
353 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
354 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
355 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
356 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
359 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
360 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
381 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
399 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
400 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
401 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
402 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
403 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
409 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
416 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
417 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
418 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
419 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
420 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
421 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
422 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
423 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
424 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
425 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
426 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
427 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
428 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
429 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
430 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
431 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
432 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
433 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
434 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
435 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
436 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
437 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
438 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
439 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
442 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
443 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
444 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
445 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
446 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
447 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
448 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
449 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
450 8022792930 Bacillus sp. Xin Isolate Rhizosphere
451 8023438354 Bacillus sp. BH2 Isolate Unclassified
452 8023444577 Bacillus sp. BH32 Isolate Unclassified
453 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
454 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 0
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 12.35
Nodule 0
Rhizoplane 3.59
Rhizosphere 70.92
Stem 0
Stem Tuber 0
Unclassified 12.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2235436 2162886007 Bacteria 72815
2 SwRhRL2b_contig_2526931 2162886007 Bacteria 3420
3 JGI24739J22299_10004388 3300001989 Bacteria 5401
4 JGI24749J21850_1000001 3300002076 Bacteria 67089
5 JGI24744J21845_10015581 3300002077 Bacteria 1518
6 JGI24751J29686_10000086 3300002459 Bacteria 52241
7 JGI25159J45721_1008128 3300002987 Bacteria 2915
8 JGI25165J46597_1000071 3300003214 Bacteria 193222
9 JGI25153J46596_10000005 3300003215 Bacteria 492839
10 rootH1_10006386 3300003316 Bacteria 2019
11 rootH1_10006386 3300003323 Bacteria 30831
12 rootL2_10015514 3300003322 Bacteria 4232
13 rootL2_10015516 3300003322 Bacteria 6785
14 rootH1_10092427 3300003323 Bacteria 2056
15 Ga0055542_1005438 3300003762 Bacteria 2880
16 Ga0055524_1023436 3300003775 Bacteria 1987
17 Ga0055530_10000091 3300003791 Bacteria 78039
18 Ga0055531_10001862 3300003794 Bacteria 14812
19 Ga0055531_10022604 3300003794 Bacteria 2390
20 Ga0065165_1000279 3300005262 Bacteria 87186
21 Ga0065165_1000784 3300005262 Bacteria 42627
22 Ga0065704_10070176 3300005289 Bacteria 138803
23 Ga0065704_10083431 3300005289 Bacteria 3467
24 Ga0065704_10094793 3300005289 Bacteria 2524
25 Ga0065707_10084403 3300005295 Bacteria 7235
26 Ga0065707_10127388 3300005295 Bacteria 1985
27 Ga0070658_10002919 3300005327 Bacteria 14175
28 Ga0070658_10005267 3300005327 Bacteria 10504
29 Ga0070658_10123037 3300005327 Bacteria 2157
30 Ga0070683_100000653 3300005329 Bacteria 25046
31 Ga0070683_100003219 3300005329 Bacteria 13178
32 Ga0070683_100051339 3300005329 Bacteria 3818
33 Ga0070670_100000003 3300005331 Bacteria 529510
34 Ga0070670_100197846 3300005331 Bacteria 1746
35 Ga0068869_100026773 3300005334 Bacteria 4016
36 Ga0070666_10039404 3300005335 Bacteria 3149
37 Ga0070666_10050620 3300005335 Bacteria 2794
38 Ga0070666_10092487 3300005335 Bacteria 2079
39 Ga0070680_100078754 3300005336 Bacteria 2716
40 Ga0070680_100080691 3300005336 Bacteria 2683
41 Ga0070680_100102337 3300005336 Bacteria 2379
42 Ga0068868_100008257 3300005338 Bacteria 7453
43 Ga0070660_100013911 3300005339 Bacteria 5788
44 Ga0070660_100033918 3300005339 Bacteria 3852
45 Ga0070661_100001532 3300005344 Bacteria 16096
46 Ga0070661_100029231 3300005344 Bacteria 3976
47 Ga0070661_100140601 3300005344 Bacteria 1819
48 Ga0070668_100000739 3300005347 Bacteria 22344
49 Ga0070668_100001077 3300005347 Bacteria 19225
50 Ga0070668_100006248 3300005347 Bacteria 8823
51 Ga0070668_100007185 3300005347 Bacteria 8256
52 Ga0070668_100008702 3300005347 Bacteria 7538
53 Ga0070669_100000084 3300005353 Bacteria 91046
54 Ga0070669_100000393 3300005353 Bacteria 33445
55 Ga0070669_100036071 3300005353 Bacteria 3582
56 Ga0070671_100004362 3300005355 Bacteria 11188
57 Ga0070671_100004490 3300005355 Bacteria 11043
58 Ga0070671_100006472 3300005355 Bacteria 9364
59 Ga0070671_100019361 3300005355 Bacteria 5539
60 Ga0070671_100070644 3300005355 Bacteria 2913
61 Ga0070671_100081026 3300005355 Bacteria 2714
62 Ga0070671_100114478 3300005355 Bacteria 2267
63 Ga0070659_100003866 3300005366 Bacteria 10671
64 Ga0070667_100000112 3300005367 Bacteria 104843
65 Ga0070667_100000162 3300005367 Bacteria 83150
66 Ga0070667_100000174 3300005367 Bacteria 79730
67 Ga0070667_100000453 3300005367 Bacteria 42432
68 Ga0070667_100009649 3300005367 Bacteria 8007
69 Ga0070667_100028597 3300005367 Bacteria 4641
70 Ga0070667_100048519 3300005367 Bacteria 3574
71 Ga0070667_100079384 3300005367 Bacteria 2805
72 Ga0070703_10000111 3300005406 Bacteria 42242
73 Ga0070709_10000003 3300005434 Bacteria 295541
74 Ga0070709_10024313 3300005434 Bacteria 3565
75 Ga0070714_100028179 3300005435 Bacteria 4657
76 Ga0070713_100012419 3300005436 Bacteria 6247
77 Ga0070713_100012623 3300005436 Bacteria 6206
78 Ga0070710_10021405 3300005437 Bacteria 3370
79 Ga0070711_100000026 3300005439 Bacteria 109906
80 Ga0070711_100027640 3300005439 Bacteria 3726
81 Ga0070705_100000002 3300005440 Bacteria 137084
82 Ga0070708_100256935 3300005445 Unclassified 1642
83 Ga0070663_100082894 3300005455 Bacteria 2360
84 Ga0070678_100014881 3300005456 Bacteria 4925
85 Ga0070678_100026536 3300005456 Bacteria 3919
86 Ga0070678_100160307 3300005456 Bacteria 1822
87 Ga0070662_100020516 3300005457 Bacteria 4500
88 Ga0070681_10064516 3300005458 Bacteria 3632
89 Ga0070681_10244762 3300005458 Unclassified 1706
90 Ga0070685_10006416 3300005466 Bacteria 5996
91 Ga0070706_100000066 3300005467 Bacteria 120884
92 Ga0070699_100000236 3300005518 Bacteria 53800
93 Ga0070699_100229015 3300005518 Bacteria 1657
94 Ga0070679_100011129 3300005530 Bacteria 8567
95 Ga0070679_100051727 3300005530 Bacteria 4092
96 Ga0070684_100022634 3300005535 Bacteria 5245
97 Ga0068853_100000120 3300005539 Bacteria 52962
98 Ga0068853_100002521 3300005539 Bacteria 13743
99 Ga0068853_100024916 3300005539 Bacteria 5020
100 Ga0070686_100059630 3300005544 Bacteria 2459
101 Ga0070696_100000017 3300005546 Bacteria 74201
102 Ga0070696_100089553 3300005546 Bacteria 2188
103 Ga0070665_100000150 3300005548 Bacteria 127885
104 Ga0070665_100004072 3300005548 Bacteria 15376
105 Ga0070665_100005090 3300005548 Bacteria 13636
106 Ga0070665_100006874 3300005548 Bacteria 11565
107 Ga0070665_100012980 3300005548 Bacteria 8392
108 Ga0070665_100080621 3300005548 Bacteria 3260
109 Ga0068855_100000029 3300005563 Bacteria 171278
110 Ga0068855_100000801 3300005563 Bacteria 38932
111 Ga0068855_100003681 3300005563 Bacteria 18753
112 Ga0068855_100015111 3300005563 Bacteria 9295
113 Ga0068855_100151387 3300005563 Bacteria 2638
114 Ga0068855_100223228 3300005563 Bacteria 2112
115 Ga0068857_100219300 3300005577 Unclassified 1737
116 Ga0068854_100020566 3300005578 Unclassified 4468
117 Ga0068856_100005698 3300005614 Bacteria 12266
118 Ga0068856_100017538 3300005614 Bacteria 6937
119 Ga0068856_100065917 3300005614 Bacteria 3578
120 Ga0068856_100102561 3300005614 Bacteria 2855
121 Ga0068856_100227121 3300005614 Bacteria 1882
122 Ga0068852_100000077 3300005616 Bacteria 69050
123 Ga0068852_100005962 3300005616 Bacteria 8773
124 Ga0068852_100266566 3300005616 Bacteria 1647
125 Ga0068859_100000120 3300005617 Bacteria 74447
126 Ga0068859_100002276 3300005617 Bacteria 19488
127 Ga0068859_100070714 3300005617 Bacteria 3525
128 Ga0068859_100116748 3300005617 Bacteria 2733
129 Ga0068864_100000005 3300005618 Bacteria 400840
130 Ga0068864_100000088 3300005618 Bacteria 98366
131 Ga0068864_100005216 3300005618 Bacteria 10650
132 Ga0068861_100026207 3300005719 Bacteria 4237
133 Ga0068861_100249567 3300005719 Bacteria 1513
134 Ga0068851_10006050 3300005834 Bacteria 5518
135 Ga0068851_10022628 3300005834 Bacteria 3064
136 Ga0068851_10034142 3300005834 Bacteria 2538
137 Ga0068863_100000023 3300005841 Bacteria 186490
138 Ga0068863_100000047 3300005841 Bacteria 140249
139 Ga0068863_100001506 3300005841 Bacteria 23038
140 Ga0068863_100007525 3300005841 Bacteria 10653
141 Ga0068863_100008711 3300005841 Bacteria 9911
142 Ga0068863_100114615 3300005841 Bacteria 2568
143 Ga0068858_100000093 3300005842 Bacteria 93236
144 Ga0068858_100000094 3300005842 Bacteria 93130
145 Ga0068858_100000647 3300005842 Bacteria 36268
146 Ga0068858_100002961 3300005842 Bacteria 17057
147 Ga0068858_100005876 3300005842 Bacteria 11982
148 Ga0068858_100047698 3300005842 Bacteria 3970
149 Ga0068858_100095925 3300005842 Bacteria 2763
150 Ga0068860_100000115 3300005843 Bacteria 128506
151 Ga0068860_100000125 3300005843 Bacteria 123363
152 Ga0068860_100007819 3300005843 Bacteria 10674
153 Ga0068860_100008267 3300005843 Bacteria 10356
154 Ga0068860_100023799 3300005843 Bacteria 5920
155 Ga0068860_100058444 3300005843 Bacteria 3666
156 Ga0068860_100087974 3300005843 Bacteria 2957
157 Ga0068860_100360785 3300005843 Bacteria 1432
158 Ga0068862_100000001 3300005844 Bacteria 523031
159 Ga0068862_100001478 3300005844 Bacteria 21538
160 Ga0068862_100007196 3300005844 Bacteria 9240
161 Ga0068862_100015582 3300005844 Bacteria 6314
162 Ga0081540_1006248 3300005983 Bacteria 8723
163 Ga0070717_10051550 3300006028 Bacteria 3387
164 Ga0075368_10000447 3300006042 Bacteria 12179
165 Ga0075368_10000886 3300006042 Bacteria 9289
166 Ga0075364_10000807 3300006051 Bacteria 16518
167 Ga0070715_10001793 3300006163 Bacteria 6394
168 Ga0070716_100001919 3300006173 Bacteria 9458
169 Ga0070712_100015972 3300006175 Bacteria 4842
170 Ga0075367_10000022 3300006178 Bacteria 33901
171 Ga0075366_10047605 3300006195 Bacteria 2542
172 Ga0097621_100027460 3300006237 Bacteria 4476
173 Ga0097621_100061202 3300006237 Bacteria 3087
174 Ga0075370_10066079 3300006353 Bacteria 2063
175 Ga0068871_100018941 3300006358 Bacteria 5246
176 Ga0068871_100061545 3300006358 Bacteria 3066
177 Ga0068871_100187475 3300006358 Bacteria 1780
178 Ga0075431_100004452 3300006847 Bacteria 13740
179 Ga0075434_100312332 3300006871 Bacteria 1592
180 Ga0075429_100100214 3300006880 Bacteria 2528
181 Ga0068865_100052620 3300006881 Bacteria 2823
182 Ga0075436_100001730 3300006914 Bacteria 14953
183 Ga0075436_100099073 3300006914 Bacteria 2029
184 Ga0097620_100000120 3300006931 Bacteria 74447
185 Ga0097620_100002276 3300006931 Bacteria 19488
186 Ga0097620_100070714 3300006931 Bacteria 3525
187 Ga0097620_100116747 3300006931 Bacteria 2733
188 Ga0075435_100033347 3300007076 Bacteria 4071
189 Ga0105251_10000694 3300009011 Bacteria 31101
190 Ga0105251_10009021 3300009011 Bacteria 5943
191 Ga0105251_10022289 3300009011 Bacteria 3291
192 Ga0105244_10004535 3300009036 Bacteria 9522
193 Ga0105244_10030107 3300009036 Bacteria 2891
194 Ga0105250_10023339 3300009092 Bacteria 2492
195 Ga0105250_10032285 3300009092 Bacteria 2103
196 Ga0105250_10038247 3300009092 Bacteria 1924
197 Ga0105240_10001088 3300009093 Bacteria 47994
198 Ga0105240_10001097 3300009093 Bacteria 47790
199 Ga0105240_10006037 3300009093 Bacteria 17907
200 Ga0105240_10007626 3300009093 Bacteria 15671
201 Ga0105240_10007974 3300009093 Bacteria 15271
202 Ga0105240_10008070 3300009093 Bacteria 15132
203 Ga0105240_10009372 3300009093 Bacteria 13876
204 Ga0105240_10028229 3300009093 Bacteria 7333
205 Ga0105240_10029267 3300009093 Bacteria 7180
206 Ga0105240_10030435 3300009093 Bacteria 7016
207 Ga0105240_10054737 3300009093 Bacteria 4998
208 Ga0105240_10105715 3300009093 Bacteria 3416
209 Ga0105245_10001260 3300009098 Bacteria 22888
210 Ga0105245_10030431 3300009098 Bacteria 4773
211 Ga0105245_10100590 3300009098 Bacteria 2674
212 Ga0105245_10153788 3300009098 Bacteria 2177
213 Ga0105247_10000055 3300009101 Bacteria 134197
214 Ga0114129_10010022 3300009147 Bacteria 13508
215 Ga0114129_10215573 3300009147 Bacteria 2592
216 Ga0114129_10275530 3300009147 Bacteria 2249
217 Ga0105241_10000236 3300009174 Bacteria 41893
218 Ga0105241_10022023 3300009174 Bacteria 4717
219 Ga0105241_10022832 3300009174 Bacteria 4637
220 Ga0105241_10197284 3300009174 Bacteria 1679
221 Ga0105242_10091962 3300009176 Bacteria 2555
222 Ga0105248_10000222 3300009177 Bacteria 65122
223 Ga0105248_10000619 3300009177 Bacteria 40470
224 Ga0105248_10001588 3300009177 Bacteria 25327
225 Ga0105248_10012654 3300009177 Bacteria 9311
226 Ga0105248_10019560 3300009177 Bacteria 7495
227 Ga0105248_10041647 3300009177 Bacteria 5149
228 Ga0105248_10045373 3300009177 Bacteria 4929
229 Ga0105248_10097301 3300009177 Bacteria 3316
230 Ga0105248_10109781 3300009177 Bacteria 3110
231 Ga0105248_10162397 3300009177 Bacteria 2519
232 Ga0105248_10248992 3300009177 Unclassified 2000
233 Ga0105237_10000607 3300009545 Bacteria 49998
234 Ga0105237_10098447 3300009545 Bacteria 2916
235 Ga0105237_10224682 3300009545 Bacteria 1878
236 Ga0105238_10000332 3300009551 Bacteria 51604
237 Ga0105238_10006830 3300009551 Bacteria 11394
238 Ga0105238_10020209 3300009551 Bacteria 6778
239 Ga0105238_10035909 3300009551 Bacteria 5039
240 Ga0105238_10038338 3300009551 Bacteria 4867
241 Ga0105238_10054217 3300009551 Bacteria 4028
242 Ga0105238_10126233 3300009551 Bacteria 2537
243 Ga0105249_10017204 3300009553 Bacteria 6418
244 Ga0105249_10057440 3300009553 Bacteria 3565
245 Ga0105249_10267670 3300009553 Bacteria 1701
246 Ga0105239_10001070 3300010375 Bacteria 38047
247 Ga0105239_10002886 3300010375 Bacteria 21477
248 Ga0105239_10018071 3300010375 Bacteria 7800
249 Ga0105239_10086325 3300010375 Bacteria 3459
250 Ga0105239_10142023 3300010375 Bacteria 2676
251 Ga0105239_10255785 3300010375 Bacteria 1967
252 Ga0105239_10281882 3300010375 Bacteria 1871
253 Ga0105246_10002204 3300011119 Bacteria 11750
254 Ga0105246_10006176 3300011119 Bacteria 7312
255 Ga0105246_10046101 3300011119 Bacteria 2972
256 Ga0157370_10158449 3300013104 Bacteria 2106
257 Ga0157369_10002432 3300013105 Bacteria 22368
258 Ga0157369_10005268 3300013105 Bacteria 15078
259 Ga0157369_10016374 3300013105 Bacteria 8341
260 Ga0157369_10051635 3300013105 Unclassified 4449
261 Ga0157369_10056791 3300013105 Bacteria 4224
262 Ga0157369_10097974 3300013105 Bacteria 3128
263 Ga0157369_10127959 3300013105 Bacteria 2692
264 Ga0157369_10168113 3300013105 Bacteria 2311
265 Ga0157369_10406047 3300013105 Bacteria 1413
266 Ga0157374_10017350 3300013296 Bacteria 6337
267 Ga0157374_10019466 3300013296 Bacteria 6008
268 Ga0157374_10116314 3300013296 Bacteria 2576
269 Ga0157374_10194710 3300013296 Bacteria 1983
270 Ga0157374_10200222 3300013296 Bacteria 1955
271 Ga0157374_10235609 3300013296 Unclassified 1799
272 Ga0157378_10060639 3300013297 Bacteria 3375
273 Ga0157378_10263189 3300013297 Bacteria 1656
274 Ga0163162_10001307 3300013306 Bacteria 23298
275 Ga0163162_10013600 3300013306 Bacteria 7951
276 Ga0163162_10069456 3300013306 Bacteria 3575
277 Ga0163162_10267967 3300013306 Bacteria 1839
278 Ga0163162_10287298 3300013306 Bacteria 1777
279 Ga0157372_10012597 3300013307 Bacteria 9005
280 Ga0157372_10016888 3300013307 Bacteria 7835
281 Ga0157372_10189762 3300013307 Bacteria 2380
282 Ga0157375_10294207 3300013308 Bacteria 1787
283 Ga0163163_10001191 3300014325 Bacteria 22056
284 Ga0163163_10017374 3300014325 Bacteria 6708
285 Ga0163163_10238648 3300014325 Bacteria 1867
286 Ga0157380_10001122 3300014326 Bacteria 17262
287 Ga0157379_10147584 3300014968 Bacteria 2121
288 Ga0157379_10235537 3300014968 Bacteria 1660
289 Ga0157379_10243180 3300014968 Bacteria 1632
290 Ga0157376_10046380 3300014969 Bacteria 3583
291 Ga0157376_10073833 3300014969 Bacteria 2906
292 Ga0157376_10188321 3300014969 Bacteria 1890
293 Ga0157376_10188541 3300014969 Bacteria 1889
294 Ga0163161_10000452 3300017792 Bacteria 34028
295 Ga0163161_10000544 3300017792 Bacteria 30601
296 Ga0163161_10016234 3300017792 Bacteria 5196
297 Ga0163161_10060989 3300017792 Bacteria 2746
298 Ga0213872_10000200 3300021361 Bacteria 53095
299 Ga0213872_10001773 3300021361 Bacteria 13482
300 Ga0213872_10039856 3300021361 Bacteria 2144
301 Ga0213872_10066252 3300021361 Bacteria 1630
302 Ga0213875_10011902 3300021388 Bacteria 4314
303 Ga0209147_101709 3300025229 Bacteria 7116
304 Ga0209026_1000877 3300025250 Bacteria 15658
305 Ga0209148_1000061 3300025254 Bacteria 349575
306 Ga0209233_1000140 3300025261 Bacteria 193274
307 Ga0209233_1007598 3300025261 Bacteria 3419
308 Ga0209565_1000183 3300025263 Bacteria 76983
309 Ga0209673_1001961 3300025273 Bacteria 16105
310 Ga0209130_1000293 3300025284 Bacteria 60879
311 Ga0209130_1009047 3300025284 Bacteria 2875
312 Ga0209676_1000169 3300025292 Bacteria 155600
313 Ga0209025_1000752 3300025294 Bacteria 54324
314 Ga0209025_1000951 3300025294 Bacteria 43851
315 Ga0209025_1002146 3300025294 Bacteria 22064
316 Ga0209025_1006808 3300025294 Bacteria 8742
317 Ga0209025_1007249 3300025294 Bacteria 8338
318 Ga0209564_1000446 3300025295 Bacteria 70931
319 Ga0209758_1000001 3300025297 Bacteria 1981790
320 Ga0209758_1001070 3300025297 Bacteria 35640
321 Ga0209050_1000029 3300025298 Bacteria 465801
322 Ga0209050_1000281 3300025298 Bacteria 108751
323 Ga0209050_1001476 3300025298 Bacteria 25065
324 Ga0209256_1000694 3300025299 Bacteria 44757
325 Ga0209256_1003679 3300025299 Bacteria 10441
326 Ga0209256_1010220 3300025299 Bacteria 3964
327 Ga0209051_1002448 3300025303 Bacteria 13308
328 Ga0209257_1000271 3300025304 Bacteria 118632
329 Ga0209257_1000352 3300025304 Bacteria 94530
330 Ga0209257_1002028 3300025304 Bacteria 21626
331 Ga0207656_10022483 3300025321 Bacteria 2530
332 Ga0207696_1000581 3300025711 Bacteria 28394
333 Ga0207696_1001509 3300025711 Bacteria 12510
334 Ga0207696_1015009 3300025711 Bacteria 2637
335 Ga0207655_1001408 3300025728 Bacteria 22389
336 Ga0207713_1017865 3300025735 Bacteria 3533
337 Ga0207713_1022919 3300025735 Bacteria 2952
338 Ga0207653_10000077 3300025885 Bacteria 72458
339 Ga0207710_10002790 3300025900 Bacteria 7980
340 Ga0207710_10069272 3300025900 Bacteria 1615
341 Ga0207680_10040016 3300025903 Bacteria 2724
342 Ga0207647_10001763 3300025904 Bacteria 16610
343 Ga0207685_10001509 3300025905 Bacteria 4918
344 Ga0207699_10000006 3300025906 Bacteria 430147
345 Ga0207699_10024850 3300025906 Bacteria 3282
346 Ga0207705_10004604 3300025909 Bacteria 10406
347 Ga0207705_10040471 3300025909 Bacteria 3343
348 Ga0207705_10132233 3300025909 Bacteria 1858
349 Ga0207684_10000120 3300025910 Bacteria 144506
350 Ga0207654_10000114 3300025911 Bacteria 51955
351 Ga0207707_10040031 3300025912 Bacteria 4095
352 Ga0207695_10000001 3300025913 Bacteria 2888630
353 Ga0207695_10000194 3300025913 Bacteria 171422
354 Ga0207695_10000428 3300025913 Bacteria 93076
355 Ga0207695_10000589 3300025913 Bacteria 73210
356 Ga0207695_10008752 3300025913 Bacteria 12620
357 Ga0207695_10010485 3300025913 Bacteria 11335
358 Ga0207695_10013141 3300025913 Bacteria 9883
359 Ga0207695_10015840 3300025913 Bacteria 8857
360 Ga0207695_10023789 3300025913 Bacteria 6914
361 Ga0207695_10027625 3300025913 Bacteria 6314
362 Ga0207695_10170116 3300025913 Bacteria 2105
363 Ga0207671_10000221 3300025914 Bacteria 85673
364 Ga0207671_10073447 3300025914 Bacteria 2554
365 Ga0207671_10099936 3300025914 Bacteria 2196
366 Ga0207671_10166777 3300025914 Bacteria 1708
367 Ga0207693_10007955 3300025915 Bacteria 8711
368 Ga0207693_10085740 3300025915 Bacteria 2467
369 Ga0207663_10000166 3300025916 Bacteria 29800
370 Ga0207660_10011251 3300025917 Bacteria 5820
371 Ga0207660_10099753 3300025917 Bacteria 2167
372 Ga0207657_10020704 3300025919 Bacteria 6210
373 Ga0207657_10045003 3300025919 Bacteria 3876
374 Ga0207649_10001138 3300025920 Bacteria 16096
375 Ga0207649_10016461 3300025920 Bacteria 4171
376 Ga0207652_10000794 3300025921 Bacteria 30152
377 Ga0207652_10119570 3300025921 Bacteria 2343
378 Ga0207681_10000005 3300025923 Bacteria 555724
379 Ga0207681_10000062 3300025923 Bacteria 99856
380 Ga0207681_10058084 3300025923 Bacteria 2647
381 Ga0207694_10000036 3300025924 Bacteria 194034
382 Ga0207694_10003477 3300025924 Bacteria 12524
383 Ga0207694_10006128 3300025924 Bacteria 9190
384 Ga0207694_10009773 3300025924 Bacteria 7238
385 Ga0207694_10021286 3300025924 Bacteria 4913
386 Ga0207694_10029179 3300025924 Bacteria 4207
387 Ga0207694_10075275 3300025924 Bacteria 2642
388 Ga0207650_10000004 3300025925 Bacteria 743372
389 Ga0207650_10026035 3300025925 Bacteria 4169
390 Ga0207687_10198584 3300025927 Bacteria 1566
391 Ga0207700_10020215 3300025928 Bacteria 4516
392 Ga0207664_10034634 3300025929 Bacteria 3890
393 Ga0207644_10002784 3300025931 Bacteria 11268
394 Ga0207644_10002871 3300025931 Bacteria 11108
395 Ga0207644_10022945 3300025931 Bacteria 4268
396 Ga0207644_10039084 3300025931 Bacteria 3347
397 Ga0207644_10088743 3300025931 Bacteria 2300
398 Ga0207644_10177263 3300025931 Bacteria 1668
399 Ga0207686_10149888 3300025934 Bacteria 1622
400 Ga0207669_10070919 3300025937 Bacteria 2187
401 Ga0207704_10055374 3300025938 Bacteria 2424
402 Ga0207665_10027767 3300025939 Bacteria 3739
403 Ga0207665_10055940 3300025939 Bacteria 2663
404 Ga0207691_10244996 3300025940 Bacteria 1548
405 Ga0207711_10000199 3300025941 Bacteria 64399
406 Ga0207711_10000670 3300025941 Bacteria 34027
407 Ga0207711_10002295 3300025941 Bacteria 17157
408 Ga0207711_10013688 3300025941 Bacteria 6736
409 Ga0207711_10068377 3300025941 Bacteria 3076
410 Ga0207711_10114443 3300025941 Bacteria 2402
411 Ga0207711_10165755 3300025941 Bacteria 2003
412 Ga0207689_10012614 3300025942 Bacteria 7219
413 Ga0207667_10000035 3300025949 Bacteria 301056
414 Ga0207667_10001527 3300025949 Bacteria 29084
415 Ga0207667_10005014 3300025949 Bacteria 16183
416 Ga0207667_10059545 3300025949 Bacteria 3999
417 Ga0207667_10155291 3300025949 Bacteria 2355
418 Ga0207712_10011809 3300025961 Bacteria 5569
419 Ga0207712_10137811 3300025961 Bacteria 1869
420 Ga0207668_10000232 3300025972 Bacteria 37304
421 Ga0207668_10032169 3300025972 Bacteria 3463
422 Ga0207640_10036243 3300025981 Unclassified 3095
423 Ga0207640_10080138 3300025981 Bacteria 2228
424 Ga0207658_10000127 3300025986 Bacteria 83164
425 Ga0207658_10000461 3300025986 Bacteria 38068
426 Ga0207658_10000620 3300025986 Bacteria 31373
427 Ga0207658_10001616 3300025986 Bacteria 17297
428 Ga0207658_10007015 3300025986 Bacteria 7672
429 Ga0207658_10102277 3300025986 Bacteria 2247
430 Ga0207658_10217974 3300025986 Bacteria 1603
431 Ga0207703_10000241 3300026035 Bacteria 62119
432 Ga0207703_10000571 3300026035 Bacteria 37816
433 Ga0207703_10000672 3300026035 Bacteria 34115
434 Ga0207703_10000928 3300026035 Bacteria 28509
435 Ga0207703_10003948 3300026035 Bacteria 12292
436 Ga0207703_10047627 3300026035 Bacteria 3457
437 Ga0207703_10300151 3300026035 Bacteria 1464
438 Ga0207639_10000049 3300026041 Bacteria 124603
439 Ga0207639_10005593 3300026041 Bacteria 8499
440 Ga0207639_10013114 3300026041 Bacteria 5789
441 Ga0207639_10115375 3300026041 Bacteria 2196
442 Ga0207678_10020494 3300026067 Bacteria 5796
443 Ga0207702_10021330 3300026078 Bacteria 5362
444 Ga0207702_10050841 3300026078 Bacteria 3500
445 Ga0207641_10000079 3300026088 Bacteria 141110
446 Ga0207641_10000286 3300026088 Bacteria 63418
447 Ga0207641_10000956 3300026088 Bacteria 29693
448 Ga0207641_10012322 3300026088 Bacteria 7015
449 Ga0207641_10013254 3300026088 Bacteria 6760
450 Ga0207641_10026977 3300026088 Bacteria 4744
451 Ga0207641_10052144 3300026088 Bacteria 3464
452 Ga0207641_10109238 3300026088 Bacteria 2449
453 Ga0207676_10000006 3300026095 Bacteria 681936
454 Ga0207676_10000188 3300026095 Bacteria 54316
455 Ga0207676_10003130 3300026095 Bacteria 11812
456 Ga0207674_10010712 3300026116 Bacteria 10354
457 Ga0207674_10016813 3300026116 Bacteria 7996
458 Ga0207674_10243479 3300026116 Unclassified 1745
459 Ga0207675_100000317 3300026118 Bacteria 45991
460 Ga0207675_100000349 3300026118 Bacteria 44097
461 Ga0207683_10008199 3300026121 Bacteria 8939
462 Ga0207683_10008681 3300026121 Bacteria 8688
463 Ga0207683_10008794 3300026121 Bacteria 8620
464 Ga0207698_10000037 3300026142 Bacteria 103991
465 Ga0207698_10002792 3300026142 Bacteria 10426
466 Ga0207698_10188083 3300026142 Bacteria 1836
467 Ga0209813_10002394 3300027866 Bacteria 4302
468 Ga0268266_10000124 3300028379 Bacteria 153051
469 Ga0268266_10000504 3300028379 Bacteria 55785
470 Ga0268266_10002863 3300028379 Bacteria 17953
471 Ga0268266_10037863 3300028379 Bacteria 4107
472 Ga0268266_10201744 3300028379 Bacteria 1820
473 Ga0268266_10341695 3300028379 Bacteria 1405
474 Ga0268265_10000001 3300028380 Bacteria 1230727
475 Ga0268265_10000654 3300028380 Bacteria 34397
476 Ga0268265_10009536 3300028380 Bacteria 6555
477 Ga0268265_10057841 3300028380 Bacteria 2957
478 Ga0268265_10088162 3300028380 Bacteria 2471
479 Ga0268264_10000002 3300028381 Bacteria 1153045
480 Ga0268264_10000166 3300028381 Bacteria 146960
481 Ga0268264_10011531 3300028381 Bacteria 7302
482 Ga0268264_10014719 3300028381 Bacteria 6427
483 Ga0268264_10015733 3300028381 Bacteria 6195
484 Ga0268264_10020123 3300028381 Bacteria 5453
485 Ga0268264_10077427 3300028381 Bacteria 2833
486 Ga0268264_10141191 3300028381 Bacteria 2148
487 Ga0307517_10064858 3300028786 Bacteria 3389
488 Ga0307515_10005727 3300028794 Bacteria 25096
489 Ga0307515_10133246 3300028794 Bacteria 2720
490 Ga0265338_10010092 3300028800 Bacteria 11158
491 Ga0265338_10043201 3300028800 Bacteria 4183
492 Ga0265338_10068653 3300028800 Bacteria 3052
493 Ga0237817_10004 3300030083 Bacteria 96242
494 Ga0307511_10000403 3300030521 Bacteria 46006
495 Ga0307511_10023061 3300030521 Bacteria 5814
496 Ga0307511_10052012 3300030521 Bacteria 3272
497 Ga0265328_10005696 3300031239 Bacteria 5323
498 Ga0265328_10013792 3300031239 Bacteria 3192
499 Ga0265320_10000015 3300031240 Bacteria 198537
500 Ga0265320_10020085 3300031240 Bacteria 3631
501 Ga0265340_10003747 3300031247 Bacteria 8557
502 Ga0265340_10006930 3300031247 Bacteria 6190
503 Ga0265340_10064928 3300031247 Unclassified 1739
504 Ga0265339_10000031 3300031249 Bacteria 133838
505 Ga0265339_10028565 3300031249 Bacteria 3171
506 Ga0265331_10011667 3300031250 Bacteria 4804
507 Ga0265316_10005257 3300031344 Bacteria 12641
508 Ga0265316_10006928 3300031344 Bacteria 10749
509 Ga0265316_10008777 3300031344 Bacteria 9343
510 Ga0265316_10009534 3300031344 Bacteria 8932
511 Ga0265316_10025277 3300031344 Bacteria 4959
512 Ga0265316_10045089 3300031344 Bacteria 3503
513 Ga0307513_10018516 3300031456 Bacteria 8317
514 Ga0307513_10077216 3300031456 Bacteria 3450
515 Ga0307513_10119798 3300031456 Bacteria 2603
516 Ga0307509_10000130 3300031507 Bacteria 111098
517 Ga0307508_10000126 3300031616 Bacteria 91143
518 Ga0265314_10003138 3300031711 Bacteria 16218
519 Ga0265314_10112977 3300031711 Bacteria 1723
520 Ga0265342_10004281 3300031712 Bacteria 11308
521 Ga0265342_10010688 3300031712 Bacteria 6342
522 Ga0265342_10036416 3300031712 Bacteria 3006
523 Ga0265342_10074316 3300031712 Bacteria 1975
524 Ga0307510_10000011 3300033180 Bacteria 355464
525 Ga0307510_10004620 3300033180 Bacteria 16234
526 Ga0307510_10033334 3300033180 Bacteria 5786
527 Ga0307510_10063757 3300033180 Bacteria 3749
528 Ga0307510_10132960 3300033180 Bacteria 2154
529 Ga0307510_10140117 3300033180 Bacteria 2064
530 Ga0373955_0164656 3300035172 Bacteria 1310
531 Ga0373927_0032204 3300035695 Bacteria 3414
532 Ga0373927_0109687 3300035695 Bacteria 1798
533 Ga0373937_0055077 3300036401 Bacteria 3650
534 Ga0373937_0127780 3300036401 Bacteria 2372
535 Ga0395899_0000307 3300037312 Bacteria 62610
536 Ga0395900_0000052 3300037418 Bacteria 223910
537 Ga0395900_0121822 3300037418 Bacteria 2676
538 Ga0395900_0256511 3300037418 Bacteria 1748
539 Ga0395898_0185834 3300037466 Bacteria 1986
540 Ga0395905_0000102 3300037471 Bacteria 143700
541 Ga0395905_0002282 3300037471 Bacteria 21521
542 Ga0395905_0168713 3300037471 Bacteria 2056
543 Ga0395905_0225808 3300037471 Bacteria 1752
544 Ga0436364_0044893 3300037853 Bacteria 10746
545 Ga0436364_1291741 3300037853 Bacteria 2071
546 Ga0395901_0000001 3300038443 Bacteria 800383
547 Ga0237819_00386 3300038705 Bacteria 15439
548 Ga0237819_00409 3300038705 Bacteria 14853
549 Ga0436365_1702795 3300039437 Bacteria 3124
550 Ga0436360_0435012 3300039438 Bacteria 1692
551 Ga0436361_0080963 3300039447 Bacteria 3667
552 Ga0436361_0369936 3300039447 Bacteria 1551
553 Ga0436361_0435899 3300039447 Bacteria 3168
554 Ga0436361_0873977 3300039447 Bacteria 1674
555 Ga0436361_0909611 3300039447 Bacteria 23210
556 Ga0436361_1209734 3300039447 Bacteria 33478
557 Ga0451853_0660934 3300041512 Bacteria 1913
558 Ga0439448_0001017 3300042005 Bacteria 7005
559 Ga0439455_0000178 3300042012 Bacteria 7325
560 Ga0439446_0005828 3300042156 Bacteria 3185
561 Ga0466969_0003474 3300044656 Bacteria 8376
562 Ga0466972_0000305 3300044658 Bacteria 28977
563 Ga0453683_0006953 3300044673 Bacteria 7715
564 Ga0453683_0111057 3300044673 Bacteria 1724
565 Ga0466961_0039491 3300044693 Bacteria 3026
566 Ga0466964_0004635 3300044706 Bacteria 5084
567 Ga0466960_0006918 3300044901 Bacteria 4574
568 Ga0466959_0015518 3300045049 Bacteria 5551
569 Ga0466959_0031259 3300045049 Bacteria 3940
570 Ga0451576_0110944 3300045051 Bacteria 2854
571 Ga0466958_0000243 3300045836 Bacteria 20957
572 Ga0466967_0000057 3300045976 Bacteria 40180
573 Ga0466967_0080537 3300045976 Unclassified 2939
574 Ga0495627_001472 3300046453 Bacteria 13699
575 Ga0495627_002884 3300046453 Bacteria 7919
576 Ga0495592_0075874 3300046454 Bacteria 2440
577 Ga0495592_0122538 3300046454 Bacteria 1827
578 Ga0495590_0001116 3300046457 Bacteria 11761
579 Ga0495629_0010818 3300046459 Bacteria 6637
580 Ga0495629_0012092 3300046459 Bacteria 6257
581 Ga0495638_0000029 3300046460 Bacteria 330201
582 Ga0495638_0000097 3300046460 Bacteria 141017
583 Ga0495638_0000230 3300046460 Bacteria 76565
584 Ga0495638_0000768 3300046460 Bacteria 34065
585 Ga0495638_0001674 3300046460 Bacteria 19617
586 Ga0495638_0002405 3300046460 Bacteria 15314
587 Ga0495638_0052036 3300046460 Bacteria 2552
588 Ga0495638_0103253 3300046460 Bacteria 1702
589 Ga0495651_0014106 3300046462 Bacteria 6179
590 Ga0495651_0066244 3300046462 Bacteria 2757
591 Ga0495653_0006478 3300046463 Bacteria 9602
592 Ga0495653_0072953 3300046463 Bacteria 2562
593 Ga0495650_0000207 3300046471 Bacteria 127568
594 Ga0495650_0000507 3300046471 Bacteria 58153
595 Ga0495650_0004993 3300046471 Bacteria 8827
596 Ga0495650_0007626 3300046471 Bacteria 6462
597 Ga0495580_0010829 3300046472 Bacteria 7077
598 Ga0495582_0016198 3300046473 Bacteria 4084
599 Ga0495639_0001872 3300046475 Bacteria 9318
600 Ga0495662_0009632 3300046476 Bacteria 4736
601 Ga0495662_0025364 3300046476 Bacteria 2862
602 Ga0495664_0005007 3300046477 Bacteria 7254
603 Ga0495594_0001478 3300046499 Bacteria 12191
604 Ga0495594_0021779 3300046499 Bacteria 3422
605 Ga0495596_0000042 3300046500 Bacteria 90746
606 Ga0495596_0000782 3300046500 Bacteria 19374
607 Ga0495607_0002129 3300046501 Bacteria 16523
608 Ga0495583_0000025 3300046506 Bacteria 263775
609 Ga0495583_0000913 3300046506 Bacteria 34983
610 Ga0495583_0000997 3300046506 Bacteria 32399
611 Ga0495583_0065571 3300046506 Bacteria 1609
612 Ga0495606_0002191 3300046507 Bacteria 23435
613 Ga0495606_0021604 3300046507 Bacteria 4712
614 Ga0495610_0000044 3300046512 Bacteria 156847
615 Ga0495610_0000140 3300046512 Bacteria 80219
616 Ga0495610_0004058 3300046512 Bacteria 10993
617 Ga0495610_0005028 3300046512 Bacteria 9561
618 Ga0495610_0007327 3300046512 Bacteria 7375
619 Ga0495616_0000009 3300046513 Bacteria 225502
620 Ga0495616_0000105 3300046513 Bacteria 72439
621 Ga0495620_0016175 3300046515 Bacteria 3751
622 Ga0495620_0020458 3300046515 Bacteria 3231
623 Ga0495628_0020334 3300046516 Bacteria 5478
624 Ga0495630_0049678 3300046517 Bacteria 3139
625 Ga0495631_0009701 3300046518 Bacteria 4800
626 Ga0495631_0029316 3300046518 Bacteria 2504
627 Ga0495632_0000001 3300046519 Bacteria 873295
628 Ga0495632_0000548 3300046519 Bacteria 35165
629 Ga0495632_0001216 3300046519 Bacteria 21835
630 Ga0495632_0006687 3300046519 Bacteria 7370
631 Ga0495632_0042069 3300046519 Bacteria 2292
632 Ga0495632_0044015 3300046519 Bacteria 2229
633 Ga0495637_0000065 3300046520 Bacteria 89961
634 Ga0495637_0014041 3300046520 Bacteria 3788
635 Ga0495643_0000006 3300046522 Bacteria 419524
636 Ga0495643_0000023 3300046522 Bacteria 288590
637 Ga0495643_0020344 3300046522 Bacteria 3827
638 Ga0495643_0027011 3300046522 Bacteria 3230
639 Ga0495643_0032491 3300046522 Bacteria 2897
640 Ga0495648_0000020 3300046524 Bacteria 254330
641 Ga0495648_0000024 3300046524 Bacteria 235605
642 Ga0495648_0000039 3300046524 Bacteria 185430
643 Ga0495663_0000001 3300046525 Bacteria 595264
644 Ga0495663_0008113 3300046525 Bacteria 2905
645 Ga0495663_0008171 3300046525 Bacteria 2896
646 Ga0495666_0008071 3300046526 Bacteria 5279
647 Ga0495652_0011950 3300046529 Bacteria 7851
648 Ga0495652_0018558 3300046529 Bacteria 6200
649 Ga0495654_0000016 3300046530 Bacteria 306416
650 Ga0495665_0037746 3300046531 Bacteria 2577
651 Ga0495640_0005892 3300046533 Bacteria 9719
652 Ga0495587_0018167 3300046536 Bacteria 4362
653 Ga0495587_0027874 3300046536 Bacteria 3439
654 Ga0495587_0038200 3300046536 Bacteria 2880
655 Ga0495609_0006904 3300046538 Bacteria 5730
656 Ga0495597_0005066 3300046542 Bacteria 7040
657 Ga0495645_0016723 3300046543 Bacteria 5246
658 Ga0495645_0083729 3300046543 Bacteria 2286
659 Ga0495645_0185974 3300046543 Bacteria 1419
660 Ga0495622_0004603 3300046557 Bacteria 6389
661 Ga0495633_0000053 3300046558 Bacteria 152374
662 Ga0495633_0002210 3300046558 Bacteria 13928
663 Ga0495633_0004208 3300046558 Bacteria 9221
664 Ga0495668_0000040 3300046616 Bacteria 230681
665 Ga0495668_0001965 3300046616 Bacteria 18106
666 Ga0495668_0003290 3300046616 Bacteria 12251
667 Ga0495668_0017143 3300046616 Bacteria 4206
668 Ga0495668_0021863 3300046616 Bacteria 3661
669 Ga0495668_0025141 3300046616 Bacteria 3385
670 Ga0495634_0016623 3300046642 Bacteria 5258
671 Ga0495611_0074587 3300046648 Bacteria 1554
672 Ga0495625_0000043 3300046660 Bacteria 205715
673 Ga0495625_0000309 3300046660 Bacteria 74356
674 Ga0495625_0005652 3300046660 Bacteria 11333
675 Ga0495625_0011140 3300046660 Bacteria 7359
676 Ga0495625_0021125 3300046660 Bacteria 5016
677 Ga0495625_0026481 3300046660 Bacteria 4382
678 Ga0495625_0088495 3300046660 Bacteria 2145
679 Ga0495635_0005335 3300046663 Bacteria 8947
680 Ga0495635_0011701 3300046663 Bacteria 6151
681 Ga0495661_0053680 3300046665 Bacteria 2423
682 Ga0495599_0015557 3300046678 Bacteria 4723
683 Ga0495599_0022266 3300046678 Bacteria 3955
684 Ga0495599_0034708 3300046678 Bacteria 3168
685 Ga0495613_0004523 3300046689 Bacteria 10425
686 Ga0495613_0008424 3300046689 Bacteria 7653
687 Ga0495613_0167852 3300046689 Bacteria 1559
688 Ga0495624_0016039 3300046690 Bacteria 5043
689 Ga0495670_0126148 3300046691 Bacteria 1332
690 Ga0495671_0000008 3300046692 Bacteria 419524
691 Ga0495671_0000022 3300046692 Bacteria 255591
692 Ga0495600_0004065 3300046809 Bacteria 8701
693 Ga0495600_0093711 3300046809 Bacteria 1958
694 Ga0495600_0128654 3300046809 Bacteria 1646
695 Ga0495581_0007250 3300047315 Bacteria 6414
696 Ga0495604_0033035 3300047317 Bacteria 4097
697 Ga0495604_0040496 3300047317 Bacteria 3658
698 Ga0495604_0138315 3300047317 Bacteria 1743
699 Ga0495636_0011288 3300047318 Bacteria 3535
700 Ga0495636_0033267 3300047318 Bacteria 2117
701 Ga0495674_0009581 3300047319 Bacteria 9199
702 Ga0495674_0052629 3300047319 Bacteria 3582
703 Ga0495674_0077543 3300047319 Bacteria 2856
704 Ga0495672_0003581 3300047320 Bacteria 13210
705 Ga0495672_0004568 3300047320 Bacteria 11254
706 Ga0495676_0004023 3300047321 Bacteria 13381
707 Ga0495680_0028251 3300047322 Bacteria 4600
708 Ga0495683_0067141 3300047323 Bacteria 1766
709 Ga0495687_000045 3300047443 Bacteria 211968
710 Ga0495675_0005027 3300047444 Bacteria 8045
711 Ga0495677_0002017 3300047445 Bacteria 8109
712 Ga0495685_005756 3300047447 Bacteria 4048
713 Ga0495673_0000051 3300047469 Bacteria 255511
714 Ga0495673_0000148 3300047469 Bacteria 124135
715 Ga0495673_0000223 3300047469 Bacteria 84150
716 Ga0495673_0001666 3300047469 Bacteria 17102
717 Ga0495681_0000014 3300047470 Bacteria 184395
718 Ga0495681_0002435 3300047470 Bacteria 13285
719 Ga0495686_0000031 3300047472 Bacteria 350171
720 Ga0495686_0000360 3300047472 Bacteria 73639
721 Ga0495686_0001338 3300047472 Bacteria 27578
722 Ga0495686_0001971 3300047472 Bacteria 20395
723 Ga0495686_0005147 3300047472 Bacteria 10421
724 Ga0495686_0008109 3300047472 Bacteria 7767
725 Ga0495686_0011443 3300047472 Bacteria 6250
726 Ga0495686_0036922 3300047472 Bacteria 3133
727 Ga0495686_0067805 3300047472 Bacteria 2202
728 Ga0495686_0076603 3300047472 Bacteria 2049
729 Ga0495686_0099897 3300047472 Bacteria 1751
730 Ga0495602_0015937 3300048088 Bacteria 7567
731 Ga0495614_0000903 3300048089 Bacteria 12613
732 Ga0495626_0000826 3300048091 Bacteria 27802
733 Ga0496100_0000653 3300048903 Bacteria 16429
734 Ga0496100_0038451 3300048903 Bacteria 3032
735 Ga0496101_0088572 3300048904 Bacteria 2299
736 Ga0496102_0000215 3300048905 Bacteria 76113
737 Ga0496102_0001498 3300048905 Bacteria 20623
738 Ga0496102_0008521 3300048905 Bacteria 8791
739 Ga0496102_0025804 3300048905 Bacteria 5234
740 Ga0496102_0108458 3300048905 Bacteria 2586
741 Ga0496103_0000103 3300048906 Bacteria 93232
742 Ga0496103_0029064 3300048906 Bacteria 3358
743 Ga0496103_0065078 3300048906 Bacteria 2274
744 Ga0496103_0074364 3300048906 Bacteria 2130
745 Ga0496104_0000068 3300048907 Bacteria 107801
746 Ga0496104_0019277 3300048907 Bacteria 6238
747 Ga0496104_0067646 3300048907 Bacteria 3394
748 Ga0496105_0000179 3300048908 Bacteria 42036
749 Ga0496105_0022527 3300048908 Bacteria 5102
750 Ga0496106_0044800 3300048909 Bacteria 3322
751 Ga0496106_0083121 3300048909 Bacteria 2462
752 Ga0496106_0183309 3300048909 Bacteria 1663
753 Ga0496107_0000090 3300048910 Bacteria 43763
754 Ga0496107_0015833 3300048910 Bacteria 5289
755 Ga0496107_0018868 3300048910 Bacteria 4862
756 Ga0496108_0203007 3300048911 Bacteria 1720
757 Ga0496109_0100984 3300048912 Bacteria 2677
758 Ga0496110_0026398 3300048913 Bacteria 4970
759 Ga0496110_0123224 3300048913 Bacteria 2337
760 Ga0496111_0032531 3300048914 Bacteria 3719
761 Ga0496112_0017480 3300048915 Bacteria 6738
762 Ga0496112_0292428 3300048915 Bacteria 1575
763 Ga0496113_0000653 3300048916 Bacteria 17494
764 Ga0496114_0072705 3300048917 Bacteria 2892
765 Ga0496115_0038453 3300048918 Bacteria 3796
766 Ga0496115_0053075 3300048918 Bacteria 3253
767 Ga0496115_0053854 3300048918 Bacteria 3230
768 Ga0496116_0000017 3300048919 Bacteria 554463
769 Ga0496117_0001087 3300048920 Bacteria 41120
770 Ga0496117_0006309 3300048920 Bacteria 12062
771 Ga0496117_0063041 3300048920 Bacteria 2536
772 Ga0496117_0092864 3300048920 Bacteria 1937
773 Ga0496117_0128793 3300048920 Bacteria 1538
774 Ga0496118_0000606 3300048921 Bacteria 59016
775 Ga0496118_0002521 3300048921 Bacteria 24575
776 Ga0496118_0018283 3300048921 Bacteria 6329
777 Ga0496118_0019712 3300048921 Bacteria 6016
778 Ga0496118_0026684 3300048921 Bacteria 4912
779 Ga0496118_0040765 3300048921 Bacteria 3687
780 Ga0496118_0068487 3300048921 Bacteria 2577
781 Ga0496118_0089272 3300048921 Bacteria 2128
782 Ga0496119_0000330 3300048922 Bacteria 66230
783 Ga0496119_0002094 3300048922 Bacteria 22525
784 Ga0496119_0007235 3300048922 Bacteria 10047
785 Ga0496119_0009604 3300048922 Bacteria 8260
786 Ga0496120_0000242 3300048923 Bacteria 93148
787 Ga0496120_0000745 3300048923 Bacteria 47313
788 Ga0496120_0005194 3300048923 Bacteria 10500
789 Ga0496120_0069002 3300048923 Bacteria 1948
790 Ga0496121_0000031 3300048924 Bacteria 384119
791 Ga0496121_0000053 3300048924 Bacteria 312611
792 Ga0496121_0000638 3300048924 Bacteria 65466
793 Ga0496121_0001312 3300048924 Bacteria 42600
794 Ga0496121_0004232 3300048924 Bacteria 19533
795 Ga0496121_0011285 3300048924 Bacteria 9951
796 Ga0496121_0050308 3300048924 Bacteria 3522
797 Ga0496122_0001615 3300048925 Bacteria 35217
798 Ga0496122_0002146 3300048925 Bacteria 28989
799 Ga0496122_0004006 3300048925 Bacteria 18770
800 Ga0496122_0009961 3300048925 Bacteria 9900
801 Ga0496122_0013355 3300048925 Bacteria 8043
802 Ga0496123_0000389 3300048926 Bacteria 82399
803 Ga0496123_0001028 3300048926 Bacteria 42363
804 Ga0496123_0001983 3300048926 Bacteria 26520
805 Ga0496123_0006326 3300048926 Bacteria 11503
806 Ga0496123_0018626 3300048926 Bacteria 5510
807 Ga0496123_0021786 3300048926 Bacteria 4967
808 Ga0496124_0000728 3300048927 Bacteria 53915
809 Ga0496124_0002794 3300048927 Bacteria 22120
810 Ga0496124_0014343 3300048927 Bacteria 7665
811 Ga0496124_0022369 3300048927 Bacteria 5796
812 Ga0496124_0025183 3300048927 Bacteria 5393
813 Ga0496124_0083374 3300048927 Bacteria 2622
814 Ga0496124_0283537 3300048927 Bacteria 1206
815 Ga0496125_0000220 3300048928 Bacteria 116658
816 Ga0496125_0001729 3300048928 Bacteria 30361
817 Ga0496125_0004581 3300048928 Bacteria 15819
818 Ga0496125_0009857 3300048928 Bacteria 9719
819 Ga0496125_0028564 3300048928 Bacteria 5034
820 Ga0496125_0089081 3300048928 Bacteria 2322
821 Ga0496126_0000005 3300048929 Bacteria 891906
822 Ga0496126_0000103 3300048929 Bacteria 201037
823 Ga0496126_0002257 3300048929 Bacteria 26580
824 Ga0496126_0004716 3300048929 Bacteria 16092
825 Ga0496126_0008833 3300048929 Bacteria 10806
826 Ga0496126_0046671 3300048929 Bacteria 3970
827 Ga0496126_0053712 3300048929 Bacteria 3653
828 Ga0495678_000726 3300049459 Bacteria 29929
829 Ga0501031_0010395 3300049568 Bacteria 6061
830 Ga0501032_0000563 3300049569 Bacteria 30073
831 Ga0501033_0001000 3300049570 Bacteria 25731
832 Ga0501034_0002456 3300049571 Bacteria 22336
833 Ga0501034_0080007 3300049571 Bacteria 3272
834 Ga0501036_0000595 3300049572 Bacteria 26224
835 Ga0501038_0002477 3300049574 Bacteria 17178
836 Ga0501043_0005587 3300049579 Bacteria 10129
837 Ga0501046_0000259 3300049580 Bacteria 53817
838 Ga0501047_0000462 3300049581 Bacteria 44406
839 Ga0501070_0132949 3300049586 Bacteria 2054
840 Ga0501073_0013787 3300049589 Bacteria 5877
841 Ga0501217_031165 3300049661 Eukaryota 1313
842 Ga0501249_000096 3300049679 Bacteria 27572
843 Ga0501249_008140 3300049679 Bacteria 2175
844 Ga0501080_0015861 3300049742 Bacteria 6951
845 Ga0501035_0005743 3300049822 Bacteria 11704
846 Ga0501044_0016042 3300049823 Bacteria 8055
847 nmdc:mga00v17_626_c2 3300050491 Bacteria 11095
848 nmdc:mga0k408_151873_c1 3300050493 Bacteria 1379
849 nmdc:mga0k408_161085_c1 3300050493 Bacteria 1337
850 nmdc:mga0k408_37007_c1 3300050493 Bacteria 2801
851 nmdc:mga0k408_53490_c1 3300050493 Bacteria 2340
852 nmdc:mga06z11_7_c1 3300050494 Bacteria 121804
853 nmdc:mga04h51_44_c1 3300050495 Bacteria 41495
854 nmdc:mga07m45_224_c1 3300050496 Bacteria 6251
855 nmdc:mga07m45_22611_c1 3300050496 Bacteria 3434
856 nmdc:mga05p37_1887_c1 3300050507 Bacteria 24398
857 nmdc:mga05p37_201619_c1 3300050507 Bacteria 2409
858 nmdc:mga09592_100944_c1 3300050508 Bacteria 2471
859 nmdc:mga09592_115913_c1 3300050508 Bacteria 2299
860 nmdc:mga09592_116662_c1 3300050508 Bacteria 2291
861 nmdc:mga06r32_103332_c1 3300050510 Bacteria 2798
862 nmdc:mga06r32_38564_c1 3300050510 Bacteria 4528
863 nmdc:mga0n895_307050_c1 3300050512 Bacteria 1608
864 nmdc:mga0rr50_27527_c1 3300050513 Bacteria 3982
865 nmdc:mga0rr50_385134_c1 3300050513 Bacteria 1183
866 nmdc:mga08x19_25_c1 3300050514 Bacteria 222966
867 nmdc:mga08x19_80704_c1 3300050514 Bacteria 2135
868 nmdc:mga0sz30_3618_c1 3300050516 Bacteria 3892
869 nmdc:mga0sz30_43021_c1 3300050516 Bacteria 1901
870 Ga0500635_0000061 3300053080 Bacteria 71946
871 Ga0500578_0000041 3300053086 Bacteria 129580
872 Ga0500643_000170 3300053087 Bacteria 63864
873 Ga0500643_000660 3300053087 Bacteria 23099
874 Ga0500643_000718 3300053087 Bacteria 21827
875 Ga0500643_001750 3300053087 Bacteria 11992
876 Ga0500643_007890 3300053087 Bacteria 4240
877 Ga0500644_0002176 3300053088 Bacteria 4958
878 Ga0500651_0000022 3300053093 Bacteria 136412
879 Ga0500651_0039289 3300053093 Bacteria 2980
880 Ga0500651_0049417 3300053093 Bacteria 2641
881 Ga0500641_0001732 3300053096 Bacteria 7762
882 Ga0500641_0015363 3300053096 Bacteria 2840
883 Ga0500555_001173 3300053103 Bacteria 8590
884 Ga0500555_001444 3300053103 Bacteria 7280
885 Ga0500556_0000408 3300053104 Bacteria 31362
886 Ga0500556_0000688 3300053104 Bacteria 20792
887 Ga0500556_0033350 3300053104 Bacteria 1765
888 Ga0500562_003809 3300053108 Bacteria 3798
889 Ga0500562_009173 3300053108 Bacteria 2500
890 Ga0500572_036862 3300053111 Bacteria 1399
891 Ga0500594_0000094 3300053118 Bacteria 26295
892 Ga0500595_003665 3300053119 Bacteria 7109
893 Ga0500595_006099 3300053119 Bacteria 5166
894 Ga0500595_020044 3300053119 Bacteria 2414
895 Ga0500595_020821 3300053119 Bacteria 2352
896 Ga0500607_000036 3300053121 Bacteria 87178
897 Ga0500607_004589 3300053121 Bacteria 9439
898 Ga0500608_000917 3300053122 Bacteria 10616
899 Ga0500608_003578 3300053122 Bacteria 5856
900 Ga0500614_001255 3300053123 Bacteria 6139
901 Ga0500618_000022 3300053125 Bacteria 157907
902 Ga0500618_003726 3300053125 Bacteria 5114
903 Ga0500642_0000001 3300053130 Bacteria 1468402
904 Ga0500642_0006809 3300053130 Bacteria 3795
905 Ga0500655_002148 3300053133 Bacteria 3645
906 Ga0500655_006939 3300053133 Bacteria 2036
907 Ga0500658_0003121 3300053134 Bacteria 6334
908 Ga0500658_0013133 3300053134 Bacteria 3057
909 Ga0500559_0000010 3300053136 Bacteria 165569
910 Ga0500559_0000054 3300053136 Bacteria 90695
911 Ga0500559_0000927 3300053136 Bacteria 18564
912 Ga0500559_0000952 3300053136 Bacteria 18219
913 Ga0500564_000586 3300053138 Bacteria 10997
914 Ga0500564_016955 3300053138 Bacteria 3305
915 Ga0500577_0000155 3300053142 Bacteria 17094
916 Ga0500604_0015380 3300053151 Bacteria 2095
917 Ga0500616_0006036 3300053153 Bacteria 8053
918 Ga0500616_0008561 3300053153 Bacteria 6336
919 Ga0500616_0013118 3300053153 Bacteria 4824
920 Ga0500622_0000263 3300053156 Bacteria 53731
921 Ga0500622_0004025 3300053156 Bacteria 9463
922 Ga0500622_0004435 3300053156 Bacteria 8819
923 Ga0500622_0006978 3300053156 Bacteria 6467
924 Ga0500624_000008 3300053157 Bacteria 181801
925 Ga0500638_034229 3300053162 Bacteria 2458
926 Ga0500637_0000037 3300053178 Bacteria 47475
927 Ga0500637_0012166 3300053178 Bacteria 4477
928 Ga0500637_0082583 3300053178 Bacteria 1857
929 Ga0500567_000780 3300053723 Bacteria 11897
930 Ga0500625_000001 3300053729 Bacteria 395993
931 Ga0500645_000001 3300053730 Bacteria 455558
932 Ga0500645_000716 3300053730 Bacteria 20575
933 Ga0500645_001988 3300053730 Bacteria 9630
934 Ga0500645_003225 3300053730 Bacteria 6751
935 Ga0500645_005582 3300053730 Bacteria 4606
936 Ga0500609_002181 3300053731 Bacteria 2797
937 Ga0500661_002175 3300055283 Bacteria 3699
938 Ga0500661_008361 3300055283 Bacteria 1903

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046525 Ga0495663_0008171 Ga0495663_0008171_13_1155 314
2 3300037418 Ga0395900_0256511 Ga0395900_0256511_14_1054 319
3 3300044673 Ga0453683_0111057 Ga0453683_0111057_22_1152 336
4 3300050513 nmdc:mga0rr50_385134_c1 nmdc:mga0rr50_385134_c1_20_1150 336
5 3300010375 Ga0105239_10142023 Ga0105239_101420232 337
6 3300039447 Ga0436361_0369936 Ga0436361_0369936_461_1540 341
7 3300048905 Ga0496102_0108458 Ga0496102_0108458_1422_2546 342
8 3300035172 Ga0373955_0164656 Ga0373955_0164656_23_1141 343
9 3300050493 nmdc:mga0k408_161085_c1 nmdc:mga0k408_161085_c1_240_1322 343
10 3300003322 rootL2_10015516 rootL2_100155166 348
11 3300047472 Ga0495686_0076603 Ga0495686_0076603_889_1995 351
12 3300050496 nmdc:mga07m45_22611_c1 nmdc:mga07m45_22611_c1_14_1174 354
13 3300013307 Ga0157372_10189762 Ga0157372_101897622 355
14 3300048927 Ga0496124_0283537 Ga0496124_0283537_12_1196 356
15 3300046515 Ga0495620_0020458 Ga0495620_0020458_2036_3220 357
16 3300046454 Ga0495592_0075874 Ga0495592_0075874_208_1515 362
17 3300046462 Ga0495651_0014106 Ga0495651_0014106_1029_2336 362
18 3300046463 Ga0495653_0072953 Ga0495653_0072953_68_1375 362
19 3300046476 Ga0495662_0009632 Ga0495662_0009632_3311_4618 362
20 3300046516 Ga0495628_0020334 Ga0495628_0020334_2096_3403 362
21 3300046529 Ga0495652_0018558 Ga0495652_0018558_461_1768 362
22 3300046536 Ga0495587_0027874 Ga0495587_0027874_1289_2596 362
23 3300046543 Ga0495645_0185974 Ga0495645_0185974_53_1360 362
24 3300046663 Ga0495635_0011701 Ga0495635_0011701_3705_5012 362
25 3300046678 Ga0495599_0015557 Ga0495599_0015557_3322_4629 362
26 3300046809 Ga0495600_0128654 Ga0495600_0128654_202_1509 362
27 3300047317 Ga0495604_0138315 Ga0495604_0138315_79_1386 362
28 3300047319 Ga0495674_0009581 Ga0495674_0009581_3097_4404 362
29 3300009093 Ga0105240_10008070 Ga0105240_100080705 365
30 3300046691 Ga0495670_0126148 Ga0495670_0126148_125_1309 369
31 3300053151 Ga0500604_0015380 Ga0500604_0015380_18_1202 371
32 3300044673 Ga0453683_0006953 Ga0453683_0006953_399_1847 377
33 3300045051 Ga0451576_0110944 Ga0451576_0110944_1220_2668 377
34 3300005843 Ga0068860_100000115 Ga0068860_10000011525 379
35 3300028381 Ga0268264_10000002 Ga0268264_10000002439 379
36 3300053119 Ga0500595_020821 Ga0500595_020821_1116_2339 379
37 3300037418 Ga0395900_0121822 Ga0395900_0121822_1279_2628 380
38 3300005327 Ga0070658_10123037 Ga0070658_101230372 381
39 3300005347 Ga0070668_100006248 Ga0070668_1000062482 381
40 3300009098 Ga0105245_10030431 Ga0105245_100304314 381
41 3300025909 Ga0207705_10132233 Ga0207705_101322332 381
42 3300025914 Ga0207671_10099936 Ga0207671_100999362 381
43 3300028380 Ga0268265_10000654 Ga0268265_1000065418 381
44 3300028800 Ga0265338_10043201 Ga0265338_100432012 381
45 3300017792 Ga0163161_10060989 Ga0163161_100609892 382
46 3300053178 Ga0500637_0082583 Ga0500637_0082583_197_1507 382
47 3300047445 Ga0495677_0002017 Ga0495677_0002017_2549_3901 383
48 3300025250 Ga0209026_1000877 Ga0209026_100087712 384
49 3300031344 Ga0265316_10045089 Ga0265316_100450892 384
50 3300005335 Ga0070666_10050620 Ga0070666_100506202 385
51 3300005355 Ga0070671_100006472 Ga0070671_1000064725 385
52 3300005436 Ga0070713_100012623 Ga0070713_1000126235 385
53 3300005437 Ga0070710_10021405 Ga0070710_100214052 385
54 3300005439 Ga0070711_100027640 Ga0070711_1000276402 385
55 3300005456 Ga0070678_100026536 Ga0070678_1000265363 385
56 3300005548 Ga0070665_100004072 Ga0070665_1000040725 385
57 3300005614 Ga0068856_100017538 Ga0068856_1000175383 385
58 3300005616 Ga0068852_100266566 Ga0068852_1002665662 385
59 3300005842 Ga0068858_100047698 Ga0068858_1000476983 385
60 3300005843 Ga0068860_100023799 Ga0068860_1000237992 385
61 3300006163 Ga0070715_10001793 Ga0070715_100017932 385
62 3300006173 Ga0070716_100001919 Ga0070716_1000019197 385
63 3300006175 Ga0070712_100015972 Ga0070712_1000159722 385
64 3300006237 Ga0097621_100061202 Ga0097621_1000612022 385
65 3300006358 Ga0068871_100061545 Ga0068871_1000615452 385
66 3300009174 Ga0105241_10022023 Ga0105241_100220233 385
67 3300009176 Ga0105242_10091962 Ga0105242_100919622 385
68 3300009545 Ga0105237_10224682 Ga0105237_102246822 385
69 3300010375 Ga0105239_10086325 Ga0105239_100863252 385
70 3300013296 Ga0157374_10200222 Ga0157374_102002222 385
71 3300013296 Ga0157374_10235609 Ga0157374_102356092 385
72 3300013297 Ga0157378_10263189 Ga0157378_102631892 385
73 3300013306 Ga0163162_10267967 Ga0163162_102679672 385
74 3300013308 Ga0157375_10294207 Ga0157375_102942072 385
75 3300014968 Ga0157379_10243180 Ga0157379_102431802 385
76 3300014969 Ga0157376_10188541 Ga0157376_101885412 385
77 3300025900 Ga0207710_10069272 Ga0207710_100692722 385
78 3300025903 Ga0207680_10040016 Ga0207680_100400162 385
79 3300025905 Ga0207685_10001509 Ga0207685_100015093 385
80 3300025915 Ga0207693_10007955 Ga0207693_100079554 385
81 3300025928 Ga0207700_10020215 Ga0207700_100202151 385
82 3300025931 Ga0207644_10039084 Ga0207644_100390842 385
83 3300025934 Ga0207686_10149888 Ga0207686_101498882 385
84 3300025939 Ga0207665_10055940 Ga0207665_100559403 385
85 3300026035 Ga0207703_10047627 Ga0207703_100476272 385
86 3300026121 Ga0207683_10008794 Ga0207683_100087944 385
87 3300026142 Ga0207698_10188083 Ga0207698_101880832 385
88 3300028381 Ga0268264_10141191 Ga0268264_101411911 385
89 3300047320 Ga0495672_0003581 Ga0495672_0003581_10512_11843 385
90 3300048903 Ga0496100_0038451 Ga0496100_0038451_315_1625 385
91 3300048904 Ga0496101_0088572 Ga0496101_0088572_359_1669 385
92 3300048905 Ga0496102_0000215 Ga0496102_0000215_18640_20013 385
93 3300048905 Ga0496102_0008521 Ga0496102_0008521_278_1588 385
94 3300048906 Ga0496103_0065078 Ga0496103_0065078_843_2153 385
95 3300048906 Ga0496103_0074364 Ga0496103_0074364_584_1957 385
96 3300048908 Ga0496105_0022527 Ga0496105_0022527_3062_4372 385
97 3300048909 Ga0496106_0044800 Ga0496106_0044800_1652_2962 385
98 3300048910 Ga0496107_0015833 Ga0496107_0015833_2401_3711 385
99 3300048911 Ga0496108_0203007 Ga0496108_0203007_93_1403 385
100 3300048913 Ga0496110_0026398 Ga0496110_0026398_1647_2957 385
101 3300048914 Ga0496111_0032531 Ga0496111_0032531_742_2052 385
102 3300048917 Ga0496114_0072705 Ga0496114_0072705_162_1472 385
103 3300048918 Ga0496115_0038453 Ga0496115_0038453_1394_2704 385
104 3300005518 Ga0070699_100229015 Ga0070699_1002290151 386
105 3300009177 Ga0105248_10001588 Ga0105248_1000158820 386
106 3300025941 Ga0207711_10013688 Ga0207711_100136882 386
107 3300031240 Ga0265320_10020085 Ga0265320_100200852 386
108 3300031249 Ga0265339_10028565 Ga0265339_100285653 386
109 3300048924 Ga0496121_0000053 Ga0496121_0000053_196034_197350 386
110 3300050507 nmdc:mga05p37_201619_c1 nmdc:mga05p37_201619_c1_906_2246 386
111 3300050508 nmdc:mga09592_100944_c1 nmdc:mga09592_100944_c1_1170_2450 386
112 3300005843 Ga0068860_100360785 Ga0068860_1003607851 387
113 3300009177 Ga0105248_10097301 Ga0105248_100973012 387
114 3300013296 Ga0157374_10194710 Ga0157374_101947102 387
115 3300014968 Ga0157379_10235537 Ga0157379_102355372 387
116 3300014969 Ga0157376_10188321 Ga0157376_101883212 387
117 3300028381 Ga0268264_10077427 Ga0268264_100774272 387
118 3300035695 Ga0373927_0032204 Ga0373927_0032204_64_1374 387
119 3300036401 Ga0373937_0127780 Ga0373937_0127780_887_2197 387
120 3300037853 Ga0436364_1291741 Ga0436364_1291741_413_1633 387
121 3300046517 Ga0495630_0049678 Ga0495630_0049678_725_2035 387
122 3300047318 Ga0495636_0033267 Ga0495636_0033267_135_1508 387
123 3300047447 Ga0495685_005756 Ga0495685_005756_2588_3961 387
124 3300049661 Ga0501217_031165 Ga0501217_031165_60_1274 387
125 3300033180 Ga0307510_10140117 Ga0307510_101401172 388
126 3300044693 Ga0466961_0039491 Ga0466961_0039491_973_2280 388
127 3300046472 Ga0495580_0010829 Ga0495580_0010829_2341_3651 388
128 3300055283 Ga0500661_002175 Ga0500661_002175_373_1680 388
129 3300005983 Ga0081540_1006248 Ga0081540_10062483 389
130 3300046460 Ga0495638_0002405 Ga0495638_0002405_4573_5889 389
131 3300046513 Ga0495616_0000105 Ga0495616_0000105_50504_51820 389
132 3300046519 Ga0495632_0006687 Ga0495632_0006687_2018_3334 389
133 3300053731 Ga0500609_002181 Ga0500609_002181_998_2314 389
134 3300033180 Ga0307510_10004620 Ga0307510_1000462014 391
135 3300046459 Ga0495629_0012092 Ga0495629_0012092_4232_5539 391
136 3300046462 Ga0495651_0066244 Ga0495651_0066244_475_1782 391
137 3300046463 Ga0495653_0006478 Ga0495653_0006478_3812_5119 391
138 3300046473 Ga0495582_0016198 Ga0495582_0016198_2512_3819 391
139 3300046475 Ga0495639_0001872 Ga0495639_0001872_4033_5340 391
140 3300046476 Ga0495662_0025364 Ga0495662_0025364_38_1345 391
141 3300046477 Ga0495664_0005007 Ga0495664_0005007_994_2301 391
142 3300046499 Ga0495594_0021779 Ga0495594_0021779_442_1749 391
143 3300046526 Ga0495666_0008071 Ga0495666_0008071_3479_4786 391
144 3300046529 Ga0495652_0011950 Ga0495652_0011950_2541_3848 391
145 3300046531 Ga0495665_0037746 Ga0495665_0037746_392_1699 391
146 3300046533 Ga0495640_0005892 Ga0495640_0005892_603_1910 391
147 3300046536 Ga0495587_0038200 Ga0495587_0038200_1561_2868 391
148 3300046642 Ga0495634_0016623 Ga0495634_0016623_45_1352 391
149 3300046663 Ga0495635_0005335 Ga0495635_0005335_6647_7954 391
150 3300046678 Ga0495599_0022266 Ga0495599_0022266_1776_3083 391
151 3300046689 Ga0495613_0008424 Ga0495613_0008424_1580_2887 391
152 3300046690 Ga0495624_0016039 Ga0495624_0016039_2965_4272 391
153 3300046809 Ga0495600_0004065 Ga0495600_0004065_5183_6490 391
154 3300047319 Ga0495674_0077543 Ga0495674_0077543_1075_2382 391
155 3300047321 Ga0495676_0004023 Ga0495676_0004023_5429_6736 391
156 3300047322 Ga0495680_0028251 Ga0495680_0028251_2987_4294 391
157 3300047444 Ga0495675_0005027 Ga0495675_0005027_458_1765 391
158 3300048089 Ga0495614_0000903 Ga0495614_0000903_8902_10209 391
159 3300025913 Ga0207695_10008752 Ga0207695_100087528 392
160 3300028379 Ga0268266_10341695 Ga0268266_103416951 392
161 3300048929 Ga0496126_0008833 Ga0496126_0008833_3494_4804 392
162 3300049568 Ga0501031_0010395 Ga0501031_0010395_2296_3603 392
163 3300049570 Ga0501033_0001000 Ga0501033_0001000_18776_20083 392
164 3300049571 Ga0501034_0002456 Ga0501034_0002456_12055_13362 392
165 3300049572 Ga0501036_0000595 Ga0501036_0000595_2399_3706 392
166 3300049574 Ga0501038_0002477 Ga0501038_0002477_6552_7859 392
167 3300049579 Ga0501043_0005587 Ga0501043_0005587_4229_5536 392
168 3300049580 Ga0501046_0000259 Ga0501046_0000259_27913_29220 392
169 3300049581 Ga0501047_0000462 Ga0501047_0000462_21857_23164 392
170 3300049586 Ga0501070_0132949 Ga0501070_0132949_717_2024 392
171 3300049589 Ga0501073_0013787 Ga0501073_0013787_4446_5753 392
172 3300049742 Ga0501080_0015861 Ga0501080_0015861_4507_5814 392
173 3300049822 Ga0501035_0005743 Ga0501035_0005743_3971_5278 392
174 3300049823 Ga0501044_0016042 Ga0501044_0016042_2106_3413 392
175 3300049569 Ga0501032_0000563 Ga0501032_0000563_22344_23651 393
176 3300005331 Ga0070670_100197846 Ga0070670_1001978461 394
177 3300005338 Ga0068868_100008257 Ga0068868_1000082571 394
178 3300005344 Ga0070661_100140601 Ga0070661_1001406011 394
179 3300005367 Ga0070667_100028597 Ga0070667_1000285974 394
180 3300005456 Ga0070678_100014881 Ga0070678_1000148812 394
181 3300005842 Ga0068858_100095925 Ga0068858_1000959252 394
182 3300006237 Ga0097621_100027460 Ga0097621_1000274602 394
183 3300006914 Ga0075436_100001730 Ga0075436_10000173012 394
184 3300011119 Ga0105246_10046101 Ga0105246_100461012 394
185 3300013105 Ga0157369_10056791 Ga0157369_100567913 394
186 3300014969 Ga0157376_10046380 Ga0157376_100463802 394
187 3300025284 Ga0209130_1009047 Ga0209130_10090472 394
188 3300025294 Ga0209025_1007249 Ga0209025_10072493 394
189 3300025321 Ga0207656_10022483 Ga0207656_100224831 394
190 3300026035 Ga0207703_10300151 Ga0207703_103001511 394
191 3300026121 Ga0207683_10008199 Ga0207683_100081992 394
192 3300028379 Ga0268266_10037863 Ga0268266_100378634 394
193 3300050514 nmdc:mga08x19_25_c1 nmdc:mga08x19_25_c1_99824_101188 394
194 3300003322 rootL2_10015514 rootL2_100155142 395
195 3300005563 Ga0068855_100003681 Ga0068855_1000036818 395
196 3300009093 Ga0105240_10001088 Ga0105240_1000108838 395
197 3300025913 Ga0207695_10010485 Ga0207695_100104854 395
198 3300025949 Ga0207667_10001527 Ga0207667_1000152715 395
199 3300025972 Ga0207668_10032169 Ga0207668_100321693 395
200 3300037466 Ga0395898_0185834 Ga0395898_0185834_222_1541 395
201 3300046471 Ga0495650_0007626 Ga0495650_0007626_1218_2573 395
202 3300046660 Ga0495625_0005652 Ga0495625_0005652_9852_11204 396
203 3300053133 Ga0500655_006939 Ga0500655_006939_333_1649 396
204 3300053156 Ga0500622_0004435 Ga0500622_0004435_4258_5574 396
205 3300003762 Ga0055542_1005438 Ga0055542_10054382 397
206 3300005355 Ga0070671_100114478 Ga0070671_1001144781 397
207 3300005535 Ga0070684_100022634 Ga0070684_1000226344 397
208 3300021361 Ga0213872_10039856 Ga0213872_100398562 397
209 3300025254 Ga0209148_1000061 Ga0209148_1000061204 397
210 3300025931 Ga0207644_10088743 Ga0207644_100887431 397
211 3300046459 Ga0495629_0010818 Ga0495629_0010818_4380_5687 397
212 3300046499 Ga0495594_0001478 Ga0495594_0001478_10061_11368 397
213 3300046689 Ga0495613_0004523 Ga0495613_0004523_6293_7600 397
214 3300047315 Ga0495581_0007250 Ga0495581_0007250_833_2140 397
215 3300048929 Ga0496126_0004716 Ga0496126_0004716_2845_4152 397
216 3300031344 Ga0265316_10009534 Ga0265316_100095344 398
217 3300047323 Ga0495683_0067141 Ga0495683_0067141_167_1474 398
218 3300053096 Ga0500641_0001732 Ga0500641_0001732_479_1795 398
219 3300005614 Ga0068856_100102561 Ga0068856_1001025612 399
220 3300005618 Ga0068864_100000088 Ga0068864_10000008831 399
221 3300013306 Ga0163162_10013600 Ga0163162_100136002 399
222 3300026095 Ga0207676_10003130 Ga0207676_100031304 399
223 3300042005 Ga0439448_0001017 Ga0439448_0001017_2768_4090 399
224 3300042012 Ga0439455_0000178 Ga0439455_0000178_844_2166 399
225 3300046665 Ga0495661_0053680 Ga0495661_0053680_129_1436 399
226 3300053087 Ga0500643_000660 Ga0500643_000660_12890_14215 399
227 3300053087 Ga0500643_000718 Ga0500643_000718_8559_9911 399
228 3300053093 Ga0500651_0000022 Ga0500651_0000022_82894_84201 399
229 3300053096 Ga0500641_0015363 Ga0500641_0015363_989_2314 399
230 3300053104 Ga0500556_0033350 Ga0500556_0033350_123_1448 399
231 3300053153 Ga0500616_0006036 Ga0500616_0006036_6169_7494 399
232 3300053730 Ga0500645_000716 Ga0500645_000716_14064_15389 399
233 3300005434 Ga0070709_10024313 Ga0070709_100243132 400
234 3300005458 Ga0070681_10064516 Ga0070681_100645162 400
235 3300006042 Ga0075368_10000886 Ga0075368_100008864 400
236 3300006847 Ga0075431_100004452 Ga0075431_10000445216 400
237 3300009093 Ga0105240_10029267 Ga0105240_100292672 400
238 3300013105 Ga0157369_10168113 Ga0157369_101681132 400
239 3300025906 Ga0207699_10024850 Ga0207699_100248502 400
240 3300025913 Ga0207695_10027625 Ga0207695_100276257 400
241 3300025939 Ga0207665_10027767 Ga0207665_100277672 400
242 3300025949 Ga0207667_10155291 Ga0207667_101552912 400
243 3300033180 Ga0307510_10063757 Ga0307510_100637574 400
244 3300050493 nmdc:mga0k408_151873_c1 nmdc:mga0k408_151873_c1_14_1312 400
245 3300050510 nmdc:mga06r32_38564_c1 nmdc:mga06r32_38564_c1_2042_3382 400
246 3300031250 Ga0265331_10011667 Ga0265331_100116672 401
247 3300031344 Ga0265316_10008777 Ga0265316_100087771 401
248 3300039438 Ga0436360_0435012 Ga0436360_0435012_50_1306 401
249 3300044656 Ga0466969_0003474 Ga0466969_0003474_110_1366 401
250 3300046454 Ga0495592_0122538 Ga0495592_0122538_266_1684 401
251 3300046512 Ga0495610_0007327 Ga0495610_0007327_3947_5278 401
252 3300047317 Ga0495604_0040496 Ga0495604_0040496_2212_3630 401
253 3300048907 Ga0496104_0067646 Ga0496104_0067646_543_1850 401
254 3300005335 Ga0070666_10039404 Ga0070666_100394042 402
255 3300005355 Ga0070671_100004362 Ga0070671_1000043622 402
256 3300005367 Ga0070667_100048519 Ga0070667_1000485193 402
257 3300005439 Ga0070711_100000026 Ga0070711_10000002624 402
258 3300005841 Ga0068863_100114615 Ga0068863_1001146154 402
259 3300009177 Ga0105248_10162397 Ga0105248_101623972 402
260 3300009551 Ga0105238_10126233 Ga0105238_101262332 402
261 3300013296 Ga0157374_10017350 Ga0157374_100173507 402
262 3300014325 Ga0163163_10001191 Ga0163163_1000119112 402
263 3300014325 Ga0163163_10238648 Ga0163163_102386482 402
264 3300025916 Ga0207663_10000166 Ga0207663_100001664 402
265 3300025929 Ga0207664_10034634 Ga0207664_100346342 402
266 3300025931 Ga0207644_10002784 Ga0207644_1000278410 402
267 3300025941 Ga0207711_10165755 Ga0207711_101657552 402
268 3300026088 Ga0207641_10052144 Ga0207641_100521442 402
269 3300028800 Ga0265338_10010092 Ga0265338_100100925 402
270 3300031239 Ga0265328_10005696 Ga0265328_100056961 402
271 3300031247 Ga0265340_10064928 Ga0265340_100649282 402
272 3300031249 Ga0265339_10000031 Ga0265339_10000031105 402
273 3300031344 Ga0265316_10005257 Ga0265316_100052574 402
274 3300031711 Ga0265314_10112977 Ga0265314_101129772 402
275 3300031712 Ga0265342_10010688 Ga0265342_100106882 402
276 3300031712 Ga0265342_10036416 Ga0265342_100364161 402
277 3300033180 Ga0307510_10033334 Ga0307510_100333342 402
278 3300036401 Ga0373937_0055077 Ga0373937_0055077_715_2010 402
279 3300048910 Ga0496107_0018868 Ga0496107_0018868_1031_2338 402
280 3300048918 Ga0496115_0053075 Ga0496115_0053075_1603_2910 402
281 3300053156 Ga0500622_0006978 Ga0500622_0006978_715_2016 402
282 iso_pu_bacteria 2643221729 2644708284 402
283 iso_pu_bacteria 2643221730 2644714882 402
284 iso_pu_bacteria 2684622632 2685148608 402
285 iso_pu_bacteria 2695420987 2698324561 402
286 iso_pu_bacteria 2703719227 2705992541 402
287 iso_pu_bacteria 2718218445 2721503989 402
288 iso_pu_bacteria 2738541358 2739158234 402
289 iso_pu_bacteria 2738543006 2739211355 402
290 iso_pu_bacteria 2818991443 2819583412 402
291 iso_pu_bacteria 2929233124 2929233857 402
292 iso_pu_bacteria 2938917290 2938918028 402
293 iso_pu_bacteria 2947426588 2947427353 402
294 iso_pu_bacteria 2965761152 2965761921 402
295 iso_pu_bacteria 2979083700 2979084348 402
296 iso_pu_bacteria 8022792930 8022796099 402
297 iso_pu_bacteria 8023438354 8023438808 402
298 iso_pu_bacteria 8023444577 8023450478 402
299 iso_pu_bacteria 8057582654 8057583418 402
300 2162886007 SwRhRL2b_contig_2526931 SwRhRL2b_0864.00003370 403
301 3300003791 Ga0055530_10000091 Ga0055530_1000009129 403
302 3300003794 Ga0055531_10001862 Ga0055531_1000186212 403
303 3300005262 Ga0065165_1000784 Ga0065165_10007844 403
304 3300005289 Ga0065704_10083431 Ga0065704_100834312 403
305 3300005344 Ga0070661_100001532 Ga0070661_1000015329 403
306 3300005347 Ga0070668_100007185 Ga0070668_1000071857 403
307 3300005355 Ga0070671_100019361 Ga0070671_1000193612 403
308 3300005455 Ga0070663_100082894 Ga0070663_1000828942 403
309 3300005539 Ga0068853_100000120 Ga0068853_10000012021 403
310 3300005548 Ga0070665_100005090 Ga0070665_1000050905 403
311 3300005563 Ga0068855_100000801 Ga0068855_10000080118 403
312 3300005577 Ga0068857_100219300 Ga0068857_1002193002 403
313 3300005578 Ga0068854_100020566 Ga0068854_1000205662 403
314 3300005614 Ga0068856_100005698 Ga0068856_1000056983 403
315 3300005616 Ga0068852_100000077 Ga0068852_10000007726 403
316 3300009011 Ga0105251_10022289 Ga0105251_100222892 403
317 3300009093 Ga0105240_10007974 Ga0105240_100079742 403
318 3300009174 Ga0105241_10000236 Ga0105241_1000023618 403
319 3300009545 Ga0105237_10000607 Ga0105237_1000060717 403
320 3300009551 Ga0105238_10000332 Ga0105238_1000033222 403
321 3300009553 Ga0105249_10057440 Ga0105249_100574401 403
322 3300010375 Ga0105239_10001070 Ga0105239_1000107033 403
323 3300013105 Ga0157369_10002432 Ga0157369_1000243218 403
324 3300013105 Ga0157369_10097974 Ga0157369_100979742 403
325 3300013306 Ga0163162_10001307 Ga0163162_1000130712 403
326 3300013307 Ga0157372_10012597 Ga0157372_100125976 403
327 3300025297 Ga0209758_1001070 Ga0209758_10010707 403
328 3300025298 Ga0209050_1000029 Ga0209050_100002930 403
329 3300025304 Ga0209257_1000271 Ga0209257_100027192 403
330 3300025711 Ga0207696_1015009 Ga0207696_10150092 403
331 3300025735 Ga0207713_1017865 Ga0207713_10178653 403
332 3300025911 Ga0207654_10000114 Ga0207654_1000011420 403
333 3300025913 Ga0207695_10000428 Ga0207695_1000042857 403
334 3300025914 Ga0207671_10000221 Ga0207671_1000022151 403
335 3300025920 Ga0207649_10001138 Ga0207649_100011388 403
336 3300025924 Ga0207694_10000036 Ga0207694_10000036104 403
337 3300025931 Ga0207644_10022945 Ga0207644_100229452 403
338 3300025941 Ga0207711_10114443 Ga0207711_101144432 403
339 3300025981 Ga0207640_10036243 Ga0207640_100362432 403
340 3300025986 Ga0207658_10001616 Ga0207658_100016163 403
341 3300026041 Ga0207639_10000049 Ga0207639_1000004980 403
342 3300026067 Ga0207678_10020494 Ga0207678_100204941 403
343 3300026116 Ga0207674_10243479 Ga0207674_102434792 403
344 3300026142 Ga0207698_10000037 Ga0207698_1000003766 403
345 3300028379 Ga0268266_10002863 Ga0268266_1000286312 403
346 3300028380 Ga0268265_10057841 Ga0268265_100578412 403
347 3300046460 Ga0495638_0000768 Ga0495638_0000768_29147_30484 403
348 3300046506 Ga0495583_0065571 Ga0495583_0065571_99_1364 403
349 3300046542 Ga0495597_0005066 Ga0495597_0005066_5547_6812 403
350 3300046557 Ga0495622_0004603 Ga0495622_0004603_2808_4073 403
351 3300047318 Ga0495636_0011288 Ga0495636_0011288_678_1985 403
352 3300048923 Ga0496120_0069002 Ga0496120_0069002_71_1390 403
353 3300050496 nmdc:mga07m45_224_c1 nmdc:mga07m45_224_c1_4325_5653 403
354 3300053093 Ga0500651_0039289 Ga0500651_0039289_1369_2634 403
355 3300053123 Ga0500614_001255 Ga0500614_001255_4651_5916 403
356 3300053134 Ga0500658_0013133 Ga0500658_0013133_558_1907 403
357 3300005530 Ga0070679_100011129 Ga0070679_1000111294 404
358 3300005539 Ga0068853_100002521 Ga0068853_10000252112 404
359 3300005548 Ga0070665_100012980 Ga0070665_1000129807 404
360 3300005617 Ga0068859_100070714 Ga0068859_1000707142 404
361 3300006931 Ga0097620_100070714 Ga0097620_1000707143 404
362 3300009093 Ga0105240_10009372 Ga0105240_100093723 404
363 3300009098 Ga0105245_10153788 Ga0105245_101537881 404
364 3300009177 Ga0105248_10045373 Ga0105248_100453734 404
365 3300010375 Ga0105239_10002886 Ga0105239_1000288615 404
366 3300013296 Ga0157374_10116314 Ga0157374_101163142 404
367 3300025292 Ga0209676_1000169 Ga0209676_100016979 404
368 3300025298 Ga0209050_1000281 Ga0209050_100028155 404
369 3300025303 Ga0209051_1002448 Ga0209051_10024487 404
370 3300025304 Ga0209257_1002028 Ga0209257_10020286 404
371 3300025913 Ga0207695_10000194 Ga0207695_100001948 404
372 3300025921 Ga0207652_10000794 Ga0207652_1000079415 404
373 3300025924 Ga0207694_10021286 Ga0207694_100212863 404
374 3300026041 Ga0207639_10005593 Ga0207639_100055932 404
375 3300026116 Ga0207674_10016813 Ga0207674_100168135 404
376 3300031240 Ga0265320_10000015 Ga0265320_10000015123 404
377 3300031344 Ga0265316_10006928 Ga0265316_1000692811 404
378 3300031456 Ga0307513_10077216 Ga0307513_100772162 404
379 3300031712 Ga0265342_10004281 Ga0265342_100042817 404
380 3300045976 Ga0466967_0080537 Ga0466967_0080537_349_1656 404
381 3300047472 Ga0495686_0036922 Ga0495686_0036922_237_1553 404
382 3300048924 Ga0496121_0000031 Ga0496121_0000031_171697_173055 404
383 3300049571 Ga0501034_0080007 Ga0501034_0080007_1701_3014 404
384 3300050516 nmdc:mga0sz30_3618_c1 nmdc:mga0sz30_3618_c1_1703_3019 404
385 3300006871 Ga0075434_100312332 Ga0075434_1003123321 405
386 3300006914 Ga0075436_100099073 Ga0075436_1000990732 405
387 3300007076 Ga0075435_100033347 Ga0075435_1000333473 405
388 3300021361 Ga0213872_10001773 Ga0213872_100017732 405
389 3300021361 Ga0213872_10066252 Ga0213872_100662522 405
390 3300025913 Ga0207695_10000001 Ga0207695_100000011198 405
391 3300031247 Ga0265340_10006930 Ga0265340_100069302 405
392 3300031344 Ga0265316_10025277 Ga0265316_100252773 405
393 3300039447 Ga0436361_1209734 Ga0436361_1209734_25791_27110 405
394 3300046689 Ga0495613_0167852 Ga0495613_0167852_11_1324 405
395 3300048903 Ga0496100_0000653 Ga0496100_0000653_13544_14875 405
396 3300048905 Ga0496102_0001498 Ga0496102_0001498_2086_3417 405
397 3300048906 Ga0496103_0000103 Ga0496103_0000103_17217_18548 405
398 3300048907 Ga0496104_0019277 Ga0496104_0019277_4195_5526 405
399 3300048908 Ga0496105_0000179 Ga0496105_0000179_30133_31464 405
400 3300048915 Ga0496112_0017480 Ga0496112_0017480_1392_2723 405
401 3300048916 Ga0496113_0000653 Ga0496113_0000653_734_2065 405
402 3300048920 Ga0496117_0001087 Ga0496117_0001087_22572_23903 405
403 3300048921 Ga0496118_0002521 Ga0496118_0002521_17217_18548 405
404 3300048922 Ga0496119_0002094 Ga0496119_0002094_9117_10448 405
405 3300048923 Ga0496120_0000745 Ga0496120_0000745_30135_31466 405
406 3300048925 Ga0496122_0002146 Ga0496122_0002146_15875_17206 405
407 3300048926 Ga0496123_0001028 Ga0496123_0001028_28237_29568 405
408 3300048927 Ga0496124_0022369 Ga0496124_0022369_1921_3252 405
409 3300048928 Ga0496125_0001729 Ga0496125_0001729_11813_13144 405
410 3300048928 Ga0496125_0028564 Ga0496125_0028564_1808_3133 405
411 3300048929 Ga0496126_0000103 Ga0496126_0000103_167089_168420 405
412 3300050493 nmdc:mga0k408_53490_c1 nmdc:mga0k408_53490_c1_448_1734 405
413 3300050512 nmdc:mga0n895_307050_c1 nmdc:mga0n895_307050_c1_104_1414 405
414 3300050513 nmdc:mga0rr50_27527_c1 nmdc:mga0rr50_27527_c1_1270_2580 405
415 3300050514 nmdc:mga08x19_80704_c1 nmdc:mga08x19_80704_c1_656_1966 405
416 3300002987 JGI25159J45721_1008128 JGI25159J45721_10081282 406
417 3300005329 Ga0070683_100000653 Ga0070683_10000065319 406
418 3300005367 Ga0070667_100000174 Ga0070667_10000017432 406
419 3300005563 Ga0068855_100223228 Ga0068855_1002232282 406
420 3300005841 Ga0068863_100001506 Ga0068863_10000150617 406
421 3300005843 Ga0068860_100000125 Ga0068860_10000012544 406
422 3300009011 Ga0105251_10009021 Ga0105251_100090212 406
423 3300009036 Ga0105244_10004535 Ga0105244_100045353 406
424 3300009036 Ga0105244_10030107 Ga0105244_100301072 406
425 3300009092 Ga0105250_10032285 Ga0105250_100322852 406
426 3300009092 Ga0105250_10038247 Ga0105250_100382471 406
427 3300009174 Ga0105241_10197284 Ga0105241_101972841 406
428 3300011119 Ga0105246_10006176 Ga0105246_100061764 406
429 3300013296 Ga0157374_10019466 Ga0157374_100194664 406
430 3300025229 Ga0209147_101709 Ga0209147_1017098 406
431 3300025284 Ga0209130_1000293 Ga0209130_100029318 406
432 3300025294 Ga0209025_1000752 Ga0209025_100075223 406
433 3300025294 Ga0209025_1000951 Ga0209025_100095116 406
434 3300025294 Ga0209025_1002146 Ga0209025_10021464 406
435 3300025294 Ga0209025_1006808 Ga0209025_10068086 406
436 3300025711 Ga0207696_1000581 Ga0207696_100058112 406
437 3300025711 Ga0207696_1001509 Ga0207696_10015092 406
438 3300025728 Ga0207655_1001408 Ga0207655_100140810 406
439 3300025735 Ga0207713_1022919 Ga0207713_10229193 406
440 3300026088 Ga0207641_10000956 Ga0207641_1000095618 406
441 3300028381 Ga0268264_10000166 Ga0268264_1000016665 406
442 3300028794 Ga0307515_10133246 Ga0307515_101332463 406
443 3300030083 Ga0237817_10004 Ga0237817_100048 406
444 3300038705 Ga0237819_00386 Ga0237819_00386_10577_11869 406
445 3300038705 Ga0237819_00409 Ga0237819_00409_9268_10560 406
446 3300045976 Ga0466967_0000057 Ga0466967_0000057_10385_11677 406
447 3300046457 Ga0495590_0001116 Ga0495590_0001116_1210_2547 406
448 3300046460 Ga0495638_0052036 Ga0495638_0052036_471_1787 406
449 3300046512 Ga0495610_0004058 Ga0495610_0004058_2397_3734 406
450 3300046518 Ga0495631_0009701 Ga0495631_0009701_3230_4567 406
451 3300046616 Ga0495668_0000040 Ga0495668_0000040_119139_120461 406
452 3300046616 Ga0495668_0001965 Ga0495668_0001965_7342_8679 406
453 3300047472 Ga0495686_0000360 Ga0495686_0000360_1757_3094 406
454 3300048909 Ga0496106_0183309 Ga0496106_0183309_171_1493 406
455 3300048920 Ga0496117_0128793 Ga0496117_0128793_78_1394 406
456 3300048921 Ga0496118_0040765 Ga0496118_0040765_2285_3601 406
457 3300048922 Ga0496119_0009604 Ga0496119_0009604_6696_8012 406
458 3300049459 Ga0495678_000726 Ga0495678_000726_1985_3322 406
459 3300053086 Ga0500578_0000041 Ga0500578_0000041_126014_127351 406
460 3300053108 Ga0500562_009173 Ga0500562_009173_583_1920 406
461 3300053118 Ga0500594_0000094 Ga0500594_0000094_24480_25817 406
462 3300053156 Ga0500622_0000263 Ga0500622_0000263_44071_45408 406
463 3300053730 Ga0500645_003225 Ga0500645_003225_5098_6420 406
464 3300005327 Ga0070658_10002919 Ga0070658_1000291910 407
465 3300005334 Ga0068869_100026773 Ga0068869_1000267734 407
466 3300005336 Ga0070680_100078754 Ga0070680_1000787543 407
467 3300021361 Ga0213872_10000200 Ga0213872_1000020030 407
468 3300025909 Ga0207705_10040471 Ga0207705_100404713 407
469 3300025942 Ga0207689_10012614 Ga0207689_100126147 407
470 3300031456 Ga0307513_10018516 Ga0307513_100185166 407
471 3300037471 Ga0395905_0000102 Ga0395905_0000102_27615_29003 407
472 3300037471 Ga0395905_0225808 Ga0395905_0225808_352_1716 407
473 3300039447 Ga0436361_0080963 Ga0436361_0080963_2036_3358 407
474 3300039447 Ga0436361_0435899 Ga0436361_0435899_70_1392 407
475 3300046507 Ga0495606_0002191 Ga0495606_0002191_19075_20391 407
476 3300046524 Ga0495648_0000039 Ga0495648_0000039_20316_21653 407
477 3300048915 Ga0496112_0292428 Ga0496112_0292428_76_1389 407
478 3300053088 Ga0500644_0002176 Ga0500644_0002176_2593_3930 407
479 3300053133 Ga0500655_002148 Ga0500655_002148_2115_3440 407
480 3300053138 Ga0500564_000586 Ga0500564_000586_2212_3549 407
481 3300055283 Ga0500661_008361 Ga0500661_008361_435_1721 407
482 3300006051 Ga0075364_10000807 Ga0075364_100008075 408
483 3300030521 Ga0307511_10000403 Ga0307511_1000040329 408
484 3300030521 Ga0307511_10023061 Ga0307511_100230611 408
485 3300046616 Ga0495668_0017143 Ga0495668_0017143_1646_2962 408
486 3300046660 Ga0495625_0026481 Ga0495625_0026481_1697_3013 408
487 3300050491 nmdc:mga00v17_626_c2 nmdc:mga00v17_626_c2_2858_4237 408
488 3300050493 nmdc:mga0k408_37007_c1 nmdc:mga0k408_37007_c1_577_1893 408
489 3300053119 Ga0500595_020044 Ga0500595_020044_135_1460 408
490 3300002459 JGI24751J29686_10000086 JGI24751J29686_1000008613 409
491 3300005331 Ga0070670_100000003 Ga0070670_100000003185 409
492 3300005353 Ga0070669_100000084 Ga0070669_10000008475 409
493 3300005618 Ga0068864_100000005 Ga0068864_10000000549 409
494 3300025923 Ga0207681_10000005 Ga0207681_10000005547 409
495 3300025925 Ga0207650_10000004 Ga0207650_10000004182 409
496 3300026095 Ga0207676_10000006 Ga0207676_10000006528 409
497 3300028794 Ga0307515_10005727 Ga0307515_100057272 409
498 3300030521 Ga0307511_10052012 Ga0307511_100520122 409
499 3300046460 Ga0495638_0103253 Ga0495638_0103253_186_1607 409
500 3300048909 Ga0496106_0083121 Ga0496106_0083121_28_1344 409
501 3300048910 Ga0496107_0000090 Ga0496107_0000090_14111_15427 409
502 3300048924 Ga0496121_0001312 Ga0496121_0001312_2683_3999 409
503 3300050516 nmdc:mga0sz30_43021_c1 nmdc:mga0sz30_43021_c1_337_1689 409
504 3300053122 Ga0500608_000917 Ga0500608_000917_2412_3752 409
505 3300053723 Ga0500567_000780 Ga0500567_000780_8607_9947 409
506 3300053729 Ga0500625_000001 Ga0500625_000001_263605_264945 409
507 3300003323 rootH1_10092427 rootH1_100924272 410
508 3300005329 Ga0070683_100003219 Ga0070683_10000321910 410
509 3300005336 Ga0070680_100102337 Ga0070680_1001023372 410
510 3300005355 Ga0070671_100004490 Ga0070671_1000044902 410
511 3300005367 Ga0070667_100079384 Ga0070667_1000793842 410
512 3300005458 Ga0070681_10244762 Ga0070681_102447621 410
513 3300005544 Ga0070686_100059630 Ga0070686_1000596302 410
514 3300005548 Ga0070665_100080621 Ga0070665_1000806212 410
515 3300005617 Ga0068859_100000120 Ga0068859_10000012040 410
516 3300005841 Ga0068863_100007525 Ga0068863_1000075256 410
517 3300005842 Ga0068858_100002961 Ga0068858_1000029618 410
518 3300005843 Ga0068860_100087974 Ga0068860_1000879741 410
519 3300006358 Ga0068871_100018941 Ga0068871_1000189412 410
520 3300006931 Ga0097620_100000120 Ga0097620_10000012040 410
521 3300009092 Ga0105250_10023339 Ga0105250_100233392 410
522 3300009101 Ga0105247_10000055 Ga0105247_10000055113 410
523 3300009177 Ga0105248_10012654 Ga0105248_100126543 410
524 3300009553 Ga0105249_10017204 Ga0105249_100172045 410
525 3300013105 Ga0157369_10406047 Ga0157369_104060471 410
526 3300013306 Ga0163162_10069456 Ga0163162_100694563 410
527 3300014325 Ga0163163_10017374 Ga0163163_100173744 410
528 3300025900 Ga0207710_10002790 Ga0207710_100027905 410
529 3300025917 Ga0207660_10099753 Ga0207660_100997532 410
530 3300025931 Ga0207644_10002871 Ga0207644_100028713 410
531 3300025941 Ga0207711_10068377 Ga0207711_100683772 410
532 3300025961 Ga0207712_10011809 Ga0207712_100118092 410
533 3300025986 Ga0207658_10217974 Ga0207658_102179741 410
534 3300026035 Ga0207703_10003948 Ga0207703_100039485 410
535 3300028379 Ga0268266_10201744 Ga0268266_102017442 410
536 3300031712 Ga0265342_10074316 Ga0265342_100743162 410
537 3300046519 Ga0495632_0000001 Ga0495632_0000001_573673_574986 410
538 3300046520 Ga0495637_0000065 Ga0495637_0000065_20722_22035 410
539 3300046522 Ga0495643_0000006 Ga0495643_0000006_264835_266148 410
540 3300046522 Ga0495643_0020344 Ga0495643_0020344_2107_3444 410
541 3300046525 Ga0495663_0000001 Ga0495663_0000001_298310_299623 410
542 3300046558 Ga0495633_0000053 Ga0495633_0000053_125322_126635 410
543 3300046558 Ga0495633_0004208 Ga0495633_0004208_2843_4156 410
544 3300046660 Ga0495625_0088495 Ga0495625_0088495_34_1362 410
545 3300046692 Ga0495671_0000008 Ga0495671_0000008_264835_266148 410
546 3300047469 Ga0495673_0000148 Ga0495673_0000148_2122_3471 410
547 3300047470 Ga0495681_0002435 Ga0495681_0002435_10234_11547 410
548 3300047472 Ga0495686_0008109 Ga0495686_0008109_4053_5366 410
549 3300047472 Ga0495686_0067805 Ga0495686_0067805_106_1422 410
550 3300048905 Ga0496102_0025804 Ga0496102_0025804_3056_4366 410
551 3300048924 Ga0496121_0000638 Ga0496121_0000638_60244_61554 410
552 3300048925 Ga0496122_0009961 Ga0496122_0009961_618_1955 410
553 3300048926 Ga0496123_0006326 Ga0496123_0006326_9794_11131 410
554 3300048927 Ga0496124_0083374 Ga0496124_0083374_726_2063 410
555 3300053087 Ga0500643_007890 Ga0500643_007890_257_1585 410
556 3300053093 Ga0500651_0049417 Ga0500651_0049417_191_1528 410
557 3300053130 Ga0500642_0006809 Ga0500642_0006809_1252_2589 410
558 3300053156 Ga0500622_0004025 Ga0500622_0004025_6918_8285 410
559 3300005347 Ga0070668_100000739 Ga0070668_10000073916 411
560 3300005353 Ga0070669_100036071 Ga0070669_1000360712 411
561 3300005367 Ga0070667_100000162 Ga0070667_10000016264 411
562 3300005841 Ga0068863_100000047 Ga0068863_1000000479 411
563 3300005843 Ga0068860_100008267 Ga0068860_1000082679 411
564 3300025923 Ga0207681_10058084 Ga0207681_100580843 411
565 3300025972 Ga0207668_10000232 Ga0207668_100002329 411
566 3300025986 Ga0207658_10000127 Ga0207658_100001279 411
567 3300026088 Ga0207641_10000079 Ga0207641_100000799 411
568 3300028381 Ga0268264_10020123 Ga0268264_100201234 411
569 3300046460 Ga0495638_0001674 Ga0495638_0001674_147_1463 411
570 3300046471 Ga0495650_0000207 Ga0495650_0000207_60524_61840 411
571 3300046471 Ga0495650_0004993 Ga0495650_0004993_1638_2978 411
572 3300046515 Ga0495620_0016175 Ga0495620_0016175_2291_3607 411
573 3300046530 Ga0495654_0000016 Ga0495654_0000016_244217_245533 411
574 3300047320 Ga0495672_0004568 Ga0495672_0004568_8883_10199 411
575 3300047469 Ga0495673_0000223 Ga0495673_0000223_6634_7950 411
576 3300053104 Ga0500556_0000688 Ga0500556_0000688_3198_4514 411
577 3300053134 Ga0500658_0003121 Ga0500658_0003121_488_1804 411
578 3300053153 Ga0500616_0008561 Ga0500616_0008561_3108_4424 411
579 3300005329 Ga0070683_100051339 Ga0070683_1000513393 412
580 3300005344 Ga0070661_100029231 Ga0070661_1000292312 412
581 3300005614 Ga0068856_100065917 Ga0068856_1000659172 412
582 3300005618 Ga0068864_100005216 Ga0068864_1000052167 412
583 3300005834 Ga0068851_10022628 Ga0068851_100226282 412
584 3300005841 Ga0068863_100000023 Ga0068863_100000023137 412
585 3300005842 Ga0068858_100005876 Ga0068858_10000587610 412
586 3300009174 Ga0105241_10022832 Ga0105241_100228324 412
587 3300009551 Ga0105238_10054217 Ga0105238_100542173 412
588 3300013105 Ga0157369_10127959 Ga0157369_101279592 412
589 3300026035 Ga0207703_10000571 Ga0207703_1000057127 412
590 3300026088 Ga0207641_10000286 Ga0207641_1000028610 412
591 3300026095 Ga0207676_10000188 Ga0207676_1000018811 412
592 3300046512 Ga0495610_0000044 Ga0495610_0000044_47024_48373 412
593 3300048927 Ga0496124_0000728 Ga0496124_0000728_19224_20573 412
594 3300046453 Ga0495627_002884 Ga0495627_002884_4298_5614 413
595 3300046512 Ga0495610_0005028 Ga0495610_0005028_3662_5011 413
596 3300046522 Ga0495643_0000023 Ga0495643_0000023_218956_220305 413
597 3300046660 Ga0495625_0000043 Ga0495625_0000043_33718_35034 413
598 3300048918 Ga0496115_0053854 Ga0496115_0053854_1203_2519 413
599 3300048928 Ga0496125_0089081 Ga0496125_0089081_951_2300 413
600 3300053108 Ga0500562_003809 Ga0500562_003809_2047_3396 413
601 3300053136 Ga0500559_0000927 Ga0500559_0000927_2857_4173 413
602 3300053142 Ga0500577_0000155 Ga0500577_0000155_12680_14011 413
603 3300053153 Ga0500616_0013118 Ga0500616_0013118_2939_4264 413
604 3300005406 Ga0070703_10000111 Ga0070703_1000011138 414
605 3300005434 Ga0070709_10000003 Ga0070709_10000003111 414
606 3300005440 Ga0070705_100000002 Ga0070705_10000000256 414
607 3300005445 Ga0070708_100256935 Ga0070708_1002569351 414
608 3300005467 Ga0070706_100000066 Ga0070706_10000006651 414
609 3300005518 Ga0070699_100000236 Ga0070699_10000023614 414
610 3300005546 Ga0070696_100000017 Ga0070696_10000001760 414
611 3300005546 Ga0070696_100089553 Ga0070696_1000895533 414
612 3300009147 Ga0114129_10010022 Ga0114129_100100227 414
613 3300009147 Ga0114129_10215573 Ga0114129_102155733 414
614 3300009147 Ga0114129_10275530 Ga0114129_102755302 414
615 3300009177 Ga0105248_10248992 Ga0105248_102489921 414
616 3300025885 Ga0207653_10000077 Ga0207653_1000007718 414
617 3300025906 Ga0207699_10000006 Ga0207699_10000006125 414
618 3300025910 Ga0207684_10000120 Ga0207684_1000012088 414
619 3300039447 Ga0436361_0909611 Ga0436361_0909611_11023_12342 414
620 3300042156 Ga0439446_0005828 Ga0439446_0005828_381_1697 414
621 3300046460 Ga0495638_0000029 Ga0495638_0000029_138412_139773 414
622 3300046506 Ga0495583_0000913 Ga0495583_0000913_23719_25080 414
623 3300046519 Ga0495632_0000548 Ga0495632_0000548_10158_11519 414
624 3300046524 Ga0495648_0000020 Ga0495648_0000020_62560_63921 414
625 3300046558 Ga0495633_0002210 Ga0495633_0002210_7096_8457 414
626 3300046616 Ga0495668_0021863 Ga0495668_0021863_2264_3601 414
627 3300046660 Ga0495625_0011140 Ga0495625_0011140_5904_7220 414
628 3300046692 Ga0495671_0000022 Ga0495671_0000022_62489_63850 414
629 3300047469 Ga0495673_0000051 Ga0495673_0000051_191762_193123 414
630 3300050507 nmdc:mga05p37_1887_c1 nmdc:mga05p37_1887_c1_6139_7503 414
631 3300053121 Ga0500607_004589 Ga0500607_004589_7878_9206 414
632 iso_pu_bacteria 2884215851 2884217242 414
633 3300005719 Ga0068861_100249567 Ga0068861_1002495671 415
634 3300005843 Ga0068860_100007819 Ga0068860_10000781910 415
635 3300005844 Ga0068862_100000001 Ga0068862_100000001404 415
636 3300026118 Ga0207675_100000349 Ga0207675_10000034910 415
637 3300028380 Ga0268265_10000001 Ga0268265_10000001632 415
638 3300028381 Ga0268264_10014719 Ga0268264_100147192 415
639 3300053125 Ga0500618_000022 Ga0500618_000022_32286_33602 415
640 3300053136 Ga0500559_0000054 Ga0500559_0000054_15127_16443 415
641 3300053730 Ga0500645_001988 Ga0500645_001988_6042_7409 415
642 3300053730 Ga0500645_005582 Ga0500645_005582_547_1875 415
643 3300005295 Ga0065707_10127388 Ga0065707_101273881 416
644 3300005842 Ga0068858_100000094 Ga0068858_10000009425 416
645 3300006042 Ga0075368_10000447 Ga0075368_100004476 416
646 3300006178 Ga0075367_10000022 Ga0075367_1000002215 416
647 3300006195 Ga0075366_10047605 Ga0075366_100476052 416
648 3300006353 Ga0075370_10066079 Ga0075370_100660792 416
649 3300009098 Ga0105245_10100590 Ga0105245_101005903 416
650 3300009177 Ga0105248_10109781 Ga0105248_101097812 416
651 3300009553 Ga0105249_10267670 Ga0105249_102676701 416
652 3300025915 Ga0207693_10085740 Ga0207693_100857403 416
653 3300026035 Ga0207703_10000928 Ga0207703_1000092826 416
654 3300027866 Ga0209813_10002394 Ga0209813_100023944 416
655 3300046512 Ga0495610_0000140 Ga0495610_0000140_62258_63574 416
656 3300046518 Ga0495631_0029316 Ga0495631_0029316_127_1443 416
657 3300046660 Ga0495625_0021125 Ga0495625_0021125_149_1465 416
658 3300048925 Ga0496122_0001615 Ga0496122_0001615_32141_33508 416
659 3300048926 Ga0496123_0001983 Ga0496123_0001983_16270_17637 416
660 3300050494 nmdc:mga06z11_7_c1 nmdc:mga06z11_7_c1_71510_72841 416
661 3300050495 nmdc:mga04h51_44_c1 nmdc:mga04h51_44_c1_37902_39233 416
662 3300053157 Ga0500624_000008 Ga0500624_000008_100988_102364 416
663 3300053178 Ga0500637_0000037 Ga0500637_0000037_24151_25527 416
664 iso_pu_bacteria 2928100450 2928101847 416
665 3300005844 Ga0068862_100007196 Ga0068862_1000071964 417
666 3300009177 Ga0105248_10041647 Ga0105248_100416472 417
667 3300013306 Ga0163162_10287298 Ga0163162_102872982 417
668 3300017792 Ga0163161_10000544 Ga0163161_1000054419 417
669 3300025931 Ga0207644_10177263 Ga0207644_101772632 417
670 3300025986 Ga0207658_10102277 Ga0207658_101022772 417
671 3300026088 Ga0207641_10109238 Ga0207641_101092382 417
672 3300037853 Ga0436364_0044893 Ga0436364_0044893_3753_5060 417
673 3300046500 Ga0495596_0000042 Ga0495596_0000042_40167_41534 417
674 3300046507 Ga0495606_0021604 Ga0495606_0021604_3163_4530 417
675 3300046513 Ga0495616_0000009 Ga0495616_0000009_122521_123846 417
676 3300046522 Ga0495643_0027011 Ga0495643_0027011_239_1606 417
677 3300046538 Ga0495609_0006904 Ga0495609_0006904_3924_5291 417
678 3300047472 Ga0495686_0005147 Ga0495686_0005147_2393_3712 417
679 3300048920 Ga0496117_0006309 Ga0496117_0006309_3968_5290 417
680 3300048921 Ga0496118_0000606 Ga0496118_0000606_43118_44440 417
681 iso_pu_bacteria 2510917020 2511125591 417
682 iso_pu_bacteria 2582581280 2585154571 417
683 iso_pu_bacteria 2582581293 2585198540 417
684 iso_pu_bacteria 2585428106 2587919766 417
685 iso_pu_bacteria 2643221545 2643750391 417
686 iso_pu_bacteria 2643221552 2643780333 417
687 iso_pu_bacteria 2643221583 2643926926 417
688 iso_pu_bacteria 2643221584 2643932172 417
689 iso_pu_bacteria 2643221640 2644223609 417
690 iso_pu_bacteria 2643221642 2644236303 417
691 iso_pu_bacteria 2643221691 2644507279 417
692 iso_pu_bacteria 2739367756 2739790770 417
693 iso_pu_bacteria 2791355048 2792459339 417
694 iso_pu_bacteria 2818991435 2819538360 417
695 iso_pu_bacteria 2818991454 2819649390 417
696 iso_pu_bacteria 2843744320 2843744736 417
697 iso_pu_bacteria 2849560528 2849563520 417
698 iso_pu_bacteria 2849573788 2849577547 417
699 iso_pu_bacteria 2851153111 2851157896 417
700 iso_pu_bacteria 2898329390 2898330627 417
701 3300005327 Ga0070658_10005267 Ga0070658_100052674 418
702 3300005339 Ga0070660_100013911 Ga0070660_1000139116 418
703 3300005339 Ga0070660_100033918 Ga0070660_1000339185 418
704 3300005366 Ga0070659_100003866 Ga0070659_1000038665 418
705 3300005435 Ga0070714_100028179 Ga0070714_1000281794 418
706 3300005539 Ga0068853_100024916 Ga0068853_1000249163 418
707 3300005563 Ga0068855_100015111 Ga0068855_1000151117 418
708 3300005614 Ga0068856_100227121 Ga0068856_1002271212 418
709 3300005616 Ga0068852_100005962 Ga0068852_1000059625 418
710 3300005834 Ga0068851_10006050 Ga0068851_100060503 418
711 3300006028 Ga0070717_10051550 Ga0070717_100515502 418
712 3300009093 Ga0105240_10001097 Ga0105240_1000109722 418
713 3300009093 Ga0105240_10006037 Ga0105240_100060374 418
714 3300009093 Ga0105240_10007626 Ga0105240_100076266 418
715 3300009093 Ga0105240_10054737 Ga0105240_100547372 418
716 3300009545 Ga0105237_10098447 Ga0105237_100984473 418
717 3300009551 Ga0105238_10006830 Ga0105238_100068308 418
718 3300009551 Ga0105238_10035909 Ga0105238_100359092 418
719 3300010375 Ga0105239_10018071 Ga0105239_100180713 418
720 3300010375 Ga0105239_10255785 Ga0105239_102557852 418
721 3300011119 Ga0105246_10002204 Ga0105246_100022044 418
722 3300013104 Ga0157370_10158449 Ga0157370_101584492 418
723 3300013105 Ga0157369_10005268 Ga0157369_100052685 418
724 3300013105 Ga0157369_10016374 Ga0157369_100163745 418
725 3300013105 Ga0157369_10051635 Ga0157369_100516355 418
726 3300013307 Ga0157372_10016888 Ga0157372_100168885 418
727 3300025261 Ga0209233_1007598 Ga0209233_10075983 418
728 3300025909 Ga0207705_10004604 Ga0207705_100046044 418
729 3300025913 Ga0207695_10000589 Ga0207695_1000058936 418
730 3300025913 Ga0207695_10013141 Ga0207695_100131417 418
731 3300025914 Ga0207671_10073447 Ga0207671_100734472 418
732 3300025919 Ga0207657_10020704 Ga0207657_100207046 418
733 3300025919 Ga0207657_10045003 Ga0207657_100450035 418
734 3300025920 Ga0207649_10016461 Ga0207649_100164612 418
735 3300025924 Ga0207694_10003477 Ga0207694_100034774 418
736 3300025924 Ga0207694_10006128 Ga0207694_100061284 418
737 3300025949 Ga0207667_10005014 Ga0207667_100050148 418
738 3300025949 Ga0207667_10059545 Ga0207667_100595453 418
739 3300026041 Ga0207639_10013114 Ga0207639_100131144 418
740 3300026041 Ga0207639_10115375 Ga0207639_101153752 418
741 3300026078 Ga0207702_10050841 Ga0207702_100508412 418
742 3300031711 Ga0265314_10003138 Ga0265314_100031387 418
743 3300046519 Ga0495632_0044015 Ga0495632_0044015_820_2187 418
744 3300046522 Ga0495643_0032491 Ga0495643_0032491_258_1565 418
745 3300046536 Ga0495587_0018167 Ga0495587_0018167_1301_2608 418
746 3300046543 Ga0495645_0016723 Ga0495645_0016723_2784_4091 418
747 3300046543 Ga0495645_0083729 Ga0495645_0083729_660_1982 418
748 3300046616 Ga0495668_0003290 Ga0495668_0003290_6103_7428 418
749 3300046678 Ga0495599_0034708 Ga0495599_0034708_498_1805 418
750 3300046809 Ga0495600_0093711 Ga0495600_0093711_224_1531 418
751 3300047317 Ga0495604_0033035 Ga0495604_0033035_2705_4012 418
752 3300047472 Ga0495686_0011443 Ga0495686_0011443_3378_4691 418
753 3300048088 Ga0495602_0015937 Ga0495602_0015937_6082_7404 418
754 3300049679 Ga0501249_008140 Ga0501249_008140_583_1890 418
755 3300053138 Ga0500564_016955 Ga0500564_016955_851_2191 418
756 iso_pu_bacteria 2582581279 2585148735 418
757 3300002076 JGI24749J21850_1000001 JGI24749J21850_100000137 419
758 3300005295 Ga0065707_10084403 Ga0065707_100844034 419
759 3300005336 Ga0070680_100080691 Ga0070680_1000806913 419
760 3300005367 Ga0070667_100000453 Ga0070667_10000045319 419
761 3300005436 Ga0070713_100012419 Ga0070713_1000124196 419
762 3300005530 Ga0070679_100051727 Ga0070679_1000517271 419
763 3300005548 Ga0070665_100006874 Ga0070665_1000068745 419
764 3300005617 Ga0068859_100116748 Ga0068859_1001167481 419
765 3300005842 Ga0068858_100000647 Ga0068858_10000064714 419
766 3300006358 Ga0068871_100187475 Ga0068871_1001874752 419
767 3300006931 Ga0097620_100116747 Ga0097620_1001167473 419
768 3300009093 Ga0105240_10028229 Ga0105240_100282293 419
769 3300009093 Ga0105240_10030435 Ga0105240_100304352 419
770 3300009093 Ga0105240_10105715 Ga0105240_101057151 419
771 3300009177 Ga0105248_10000222 Ga0105248_1000022241 419
772 3300010375 Ga0105239_10281882 Ga0105239_102818822 419
773 3300014326 Ga0157380_10001122 Ga0157380_1000112211 419
774 3300014968 Ga0157379_10147584 Ga0157379_101475842 419
775 3300014969 Ga0157376_10073833 Ga0157376_100738333 419
776 3300025912 Ga0207707_10040031 Ga0207707_100400313 419
777 3300025913 Ga0207695_10015840 Ga0207695_100158402 419
778 3300025913 Ga0207695_10023789 Ga0207695_100237893 419
779 3300025913 Ga0207695_10170116 Ga0207695_101701161 419
780 3300025914 Ga0207671_10166777 Ga0207671_101667772 419
781 3300025917 Ga0207660_10011251 Ga0207660_100112516 419
782 3300025921 Ga0207652_10119570 Ga0207652_101195702 419
783 3300025924 Ga0207694_10029179 Ga0207694_100291793 419
784 3300025941 Ga0207711_10000199 Ga0207711_1000019916 419
785 3300025986 Ga0207658_10000620 Ga0207658_1000062021 419
786 3300026035 Ga0207703_10000672 Ga0207703_1000067217 419
787 3300028379 Ga0268266_10000504 Ga0268266_100005045 419
788 3300028800 Ga0265338_10068653 Ga0265338_100686532 419
789 3300031247 Ga0265340_10003747 Ga0265340_100037476 419
790 3300031507 Ga0307509_10000130 Ga0307509_1000013083 419
791 3300033180 Ga0307510_10000011 Ga0307510_10000011235 419
792 3300033180 Ga0307510_10132960 Ga0307510_101329602 419
793 3300035695 Ga0373927_0109687 Ga0373927_0109687_386_1696 419
794 3300039437 Ga0436365_1702795 Ga0436365_1702795_1531_2841 419
795 3300039447 Ga0436361_0873977 Ga0436361_0873977_70_1380 419
796 3300045049 Ga0466959_0031259 Ga0466959_0031259_529_1839 419
797 3300046519 Ga0495632_0042069 Ga0495632_0042069_866_2176 419
798 3300046648 Ga0495611_0074587 Ga0495611_0074587_160_1470 419
799 3300048907 Ga0496104_0000068 Ga0496104_0000068_14054_15376 419
800 3300048919 Ga0496116_0000017 Ga0496116_0000017_407783_409132 419
801 3300048921 Ga0496118_0068487 Ga0496118_0068487_873_2222 419
802 3300048922 Ga0496119_0000330 Ga0496119_0000330_52333_53643 419
803 3300048922 Ga0496119_0007235 Ga0496119_0007235_2388_3698 419
804 3300048923 Ga0496120_0000242 Ga0496120_0000242_9796_11106 419
805 3300048923 Ga0496120_0005194 Ga0496120_0005194_1091_2401 419
806 3300048924 Ga0496121_0004232 Ga0496121_0004232_6950_8260 419
807 3300048924 Ga0496121_0050308 Ga0496121_0050308_691_2001 419
808 3300048925 Ga0496122_0013355 Ga0496122_0013355_3348_4697 419
809 3300048926 Ga0496123_0000389 Ga0496123_0000389_38771_40120 419
810 3300048927 Ga0496124_0002794 Ga0496124_0002794_5328_6677 419
811 3300048927 Ga0496124_0014343 Ga0496124_0014343_2982_4331 419
812 3300048928 Ga0496125_0000220 Ga0496125_0000220_47448_48758 419
813 3300048928 Ga0496125_0004581 Ga0496125_0004581_1479_2789 419
814 3300048929 Ga0496126_0002257 Ga0496126_0002257_18257_19606 419
815 3300048929 Ga0496126_0053712 Ga0496126_0053712_758_2068 419
816 3300053111 Ga0500572_036862 Ga0500572_036862_69_1379 419
817 iso_pu_bacteria 2857504554 2857506001 419
818 iso_pu_bacteria 2928027323 2928029559 419
819 3300046453 Ga0495627_001472 Ga0495627_001472_8003_9352 420
820 3300046471 Ga0495650_0000507 Ga0495650_0000507_50214_51563 420
821 3300046506 Ga0495583_0000997 Ga0495583_0000997_13597_14937 420
822 3300046519 Ga0495632_0001216 Ga0495632_0001216_18362_19711 420
823 3300047470 Ga0495681_0000014 Ga0495681_0000014_80763_82112 420
824 3300053087 Ga0500643_001750 Ga0500643_001750_1131_2444 420
825 3300053103 Ga0500555_001173 Ga0500555_001173_5110_6450 420
826 iso_pu_bacteria 2738541275 2738710202 420
827 iso_pu_bacteria 2738541301 2738848627 420
828 iso_pu_bacteria 2738541304 2738864356 420
829 iso_pu_bacteria 2738543022 2739296874 420
830 iso_pu_bacteria 2738543033 2739358552 420
831 iso_pu_bacteria 2928959182 2928959939 420
832 3300003775 Ga0055524_1023436 Ga0055524_10234361 421
833 3300003794 Ga0055531_10022604 Ga0055531_100226042 421
834 3300005262 Ga0065165_1000279 Ga0065165_100027984 421
835 3300005466 Ga0070685_10006416 Ga0070685_100064166 421
836 3300005563 Ga0068855_100151387 Ga0068855_1001513871 421
837 3300006880 Ga0075429_100100214 Ga0075429_1001002142 421
838 3300009177 Ga0105248_10000619 Ga0105248_1000061912 421
839 3300009551 Ga0105238_10038338 Ga0105238_100383387 421
840 3300025263 Ga0209565_1000183 Ga0209565_100018330 421
841 3300025273 Ga0209673_1001961 Ga0209673_100196117 421
842 3300025295 Ga0209564_1000446 Ga0209564_100044646 421
843 3300025299 Ga0209256_1000694 Ga0209256_100069417 421
844 3300025299 Ga0209256_1003679 Ga0209256_10036792 421
845 3300025299 Ga0209256_1010220 Ga0209256_10102206 421
846 3300025304 Ga0209257_1000352 Ga0209257_100035265 421
847 3300025924 Ga0207694_10075275 Ga0207694_100752752 421
848 3300025941 Ga0207711_10000670 Ga0207711_1000067020 421
849 3300037312 Ga0395899_0000307 Ga0395899_0000307_52464_53780 421
850 3300037418 Ga0395900_0000052 Ga0395900_0000052_30233_31549 421
851 3300037471 Ga0395905_0002282 Ga0395905_0002282_15151_16467 421
852 3300038443 Ga0395901_0000001 Ga0395901_0000001_756451_757767 421
853 3300041512 Ga0451853_0660934 Ga0451853_0660934_517_1833 421
854 3300045836 Ga0466958_0000243 Ga0466958_0000243_17888_19213 421
855 3300046460 Ga0495638_0000230 Ga0495638_0000230_61908_63224 421
856 3300046506 Ga0495583_0000025 Ga0495583_0000025_227960_229288 421
857 3300046520 Ga0495637_0014041 Ga0495637_0014041_1600_2916 421
858 3300046616 Ga0495668_0025141 Ga0495668_0025141_1931_3247 421
859 3300047319 Ga0495674_0052629 Ga0495674_0052629_1412_2728 421
860 3300047469 Ga0495673_0001666 Ga0495673_0001666_14849_16165 421
861 3300047472 Ga0495686_0001338 Ga0495686_0001338_17367_18713 421
862 3300048920 Ga0496117_0092864 Ga0496117_0092864_405_1748 421
863 3300048921 Ga0496118_0018283 Ga0496118_0018283_402_1745 421
864 3300050508 nmdc:mga09592_115913_c1 nmdc:mga09592_115913_c1_837_2198 421
865 3300053119 Ga0500595_006099 Ga0500595_006099_110_1429 421
866 3300053125 Ga0500618_003726 Ga0500618_003726_1336_2700 421
867 3300053136 Ga0500559_0000010 Ga0500559_0000010_70563_71879 421
868 3300001989 JGI24739J22299_10004388 JGI24739J22299_100043882 422
869 3300003316 rootH1_10006386 rootH1_100063861 422
870 3300005834 Ga0068851_10034142 Ga0068851_100341422 422
871 3300021388 Ga0213875_10011902 Ga0213875_100119023 422
872 3300025298 Ga0209050_1001476 Ga0209050_100147624 422
873 3300025904 Ga0207647_10001763 Ga0207647_1000176311 422
874 3300028786 Ga0307517_10064858 Ga0307517_100648582 422
875 3300047472 Ga0495686_0001971 Ga0495686_0001971_16937_18292 422
876 3300048920 Ga0496117_0063041 Ga0496117_0063041_68_1423 422
877 3300048921 Ga0496118_0026684 Ga0496118_0026684_638_1993 422
878 3300049679 Ga0501249_000096 Ga0501249_000096_5086_6408 422
879 iso_pu_bacteria 2919138771 2919139282 422
880 3300005347 Ga0070668_100001077 Ga0070668_1000010774 423
881 3300026078 Ga0207702_10021330 Ga0207702_100213303 423
882 3300026116 Ga0207674_10010712 Ga0207674_100107129 423
883 3300026142 Ga0207698_10002792 Ga0207698_100027923 423
884 3300037471 Ga0395905_0168713 Ga0395905_0168713_336_1694 423
885 iso_pu_bacteria 2512564014 2512642168 423
886 iso_pu_bacteria 2751185897 2753767143 423
887 3300046500 Ga0495596_0000782 Ga0495596_0000782_2596_3960 424
888 iso_pu_bacteria 2739367664 2739648920 424
889 iso_pu_bacteria 2739367865 2740027393 424
890 3300005617 Ga0068859_100002276 Ga0068859_10000227611 425
891 3300005719 Ga0068861_100026207 Ga0068861_1000262071 425
892 3300006931 Ga0097620_100002276 Ga0097620_1000022763 425
893 3300009177 Ga0105248_10019560 Ga0105248_100195601 425
894 3300017792 Ga0163161_10000452 Ga0163161_1000045221 425
895 3300026088 Ga0207641_10012322 Ga0207641_100123224 425
896 3300026118 Ga0207675_100000317 Ga0207675_10000031743 425
897 3300044658 Ga0466972_0000305 Ga0466972_0000305_13341_14705 425
898 3300044706 Ga0466964_0004635 Ga0466964_0004635_3169_4533 425
899 3300044901 Ga0466960_0006918 Ga0466960_0006918_425_1789 425
900 3300046501 Ga0495607_0002129 Ga0495607_0002129_1622_2965 425
901 3300047472 Ga0495686_0000031 Ga0495686_0000031_263621_264970 425
902 3300053121 Ga0500607_000036 Ga0500607_000036_49596_51038 425
903 3300053136 Ga0500559_0000952 Ga0500559_0000952_15016_16458 425
904 iso_pu_bacteria 2599185354 2600202796 425
905 3300048929 Ga0496126_0000005 Ga0496126_0000005_206872_208278 426
906 iso_pu_bacteria 2818991438 2819552413 426
907 3300017792 Ga0163161_10016234 Ga0163161_100162342 427
908 3300025961 Ga0207712_10137811 Ga0207712_101378111 427
909 3300048091 Ga0495626_0000826 Ga0495626_0000826_21495_22907 427
910 3300048912 Ga0496109_0100984 Ga0496109_0100984_957_2294 427
911 3300048913 Ga0496110_0123224 Ga0496110_0123224_432_1769 427
912 3300048925 Ga0496122_0004006 Ga0496122_0004006_11254_12591 427
913 3300048926 Ga0496123_0021786 Ga0496123_0021786_3388_4725 427
914 3300048927 Ga0496124_0025183 Ga0496124_0025183_223_1560 427
915 3300048928 Ga0496125_0009857 Ga0496125_0009857_3442_4779 427
916 3300053103 Ga0500555_001444 Ga0500555_001444_4893_6287 427
917 iso_pu_bacteria 2984555340 2984557485 427
918 iso_pu_bacteria 2984564862 2984568155 427
919 3300002077 JGI24744J21845_10015581 JGI24744J21845_100155812 428
920 3300005355 Ga0070671_100081026 Ga0070671_1000810262 428
921 3300005456 Ga0070678_100160307 Ga0070678_1001603072 428
922 3300005563 Ga0068855_100000029 Ga0068855_10000002965 428
923 3300025937 Ga0207669_10070919 Ga0207669_100709192 428
924 3300025940 Ga0207691_10244996 Ga0207691_102449961 428
925 3300025949 Ga0207667_10000035 Ga0207667_10000035158 428
926 3300026121 Ga0207683_10008681 Ga0207683_100086816 428
927 3300053080 Ga0500635_0000061 Ga0500635_0000061_64190_65593 428
928 3300053087 Ga0500643_000170 Ga0500643_000170_32583_33953 428
929 3300053119 Ga0500595_003665 Ga0500595_003665_4817_6220 428
930 3300053122 Ga0500608_003578 Ga0500608_003578_2094_3497 428
931 3300053162 Ga0500638_034229 Ga0500638_034229_507_1910 428
932 3300053178 Ga0500637_0012166 Ga0500637_0012166_807_2210 428
933 iso_pu_bacteria 2808606401 2809063892 428
934 iso_pu_bacteria 2808606404 2809079860 428
935 iso_pu_bacteria 2808606405 2809084225 428
936 iso_pu_bacteria 2880518877 2880523421 428
937 3300003214 JGI25165J46597_1000071 JGI25165J46597_100007162 429
938 3300005842 Ga0068858_100000093 Ga0068858_10000009343 429
939 3300009098 Ga0105245_10001260 Ga0105245_1000126011 429
940 3300013297 Ga0157378_10060639 Ga0157378_100606392 429
941 3300025261 Ga0209233_1000140 Ga0209233_1000140124 429
942 3300025927 Ga0207687_10198584 Ga0207687_101985842 429
943 3300025981 Ga0207640_10080138 Ga0207640_100801382 429
944 3300026035 Ga0207703_10000241 Ga0207703_1000024152 429
945 3300050508 nmdc:mga09592_116662_c1 nmdc:mga09592_116662_c1_298_1716 429
946 3300050510 nmdc:mga06r32_103332_c1 nmdc:mga06r32_103332_c1_987_2405 429
947 iso_pu_bacteria 2884960567 2884961712 429
948 3300005355 Ga0070671_100070644 Ga0070671_1000706442 430
949 3300046460 Ga0495638_0000097 Ga0495638_0000097_91516_92865 430
950 3300046525 Ga0495663_0008113 Ga0495663_0008113_450_1799 430
951 3300047472 Ga0495686_0099897 Ga0495686_0099897_126_1475 430
952 3300003215 JGI25153J46596_10000005 JGI25153J46596_10000005398 431
953 3300025297 Ga0209758_1000001 Ga0209758_1000001398 431
954 3300045049 Ga0466959_0015518 Ga0466959_0015518_3309_4745 431
955 3300046524 Ga0495648_0000024 Ga0495648_0000024_80686_82041 431
956 3300047443 Ga0495687_000045 Ga0495687_000045_183711_185066 431
957 3300053104 Ga0500556_0000408 Ga0500556_0000408_5803_7152 431
958 3300053130 Ga0500642_0000001 Ga0500642_0000001_475346_476695 431
959 3300053730 Ga0500645_000001 Ga0500645_000001_227276_228631 431
960 3300031456 Ga0307513_10119798 Ga0307513_101197982 432
961 3300031616 Ga0307508_10000126 Ga0307508_1000012635 432
962 3300046660 Ga0495625_0000309 Ga0495625_0000309_14213_15568 432
963 3300031239 Ga0265328_10013792 Ga0265328_100137923 433
964 3300048921 Ga0496118_0019712 Ga0496118_0019712_3716_5071 433
965 3300005457 Ga0070662_100020516 Ga0070662_1000205162 434
966 iso_pu_bacteria 2510917021 2511130971 434
967 3300006881 Ga0068865_100052620 Ga0068865_1000526202 435
968 3300009551 Ga0105238_10020209 Ga0105238_100202092 435
969 3300025924 Ga0207694_10009773 Ga0207694_100097734 435
970 3300025938 Ga0207704_10055374 Ga0207704_100553742 435
971 iso_pu_bacteria 8054302542 8054306222 436
972 iso_pu_bacteria 2990265787 2990267585 437
973 iso_pu_bacteria 2993693658 2993695180 437
974 2162886007 SwRhRL2b_contig_2235436 SwRhRL2b_0637.00007680 438
975 3300005289 Ga0065704_10070176 Ga0065704_1007017690 438
976 3300005289 Ga0065704_10094793 Ga0065704_100947933 438
977 3300005335 Ga0070666_10092487 Ga0070666_100924872 438
978 3300005347 Ga0070668_100008702 Ga0070668_1000087026 438
979 3300005353 Ga0070669_100000393 Ga0070669_10000039335 438
980 3300005367 Ga0070667_100000112 Ga0070667_10000011287 438
981 3300005367 Ga0070667_100009649 Ga0070667_1000096496 438
982 3300005548 Ga0070665_100000150 Ga0070665_10000015095 438
983 3300005841 Ga0068863_100008711 Ga0068863_1000087116 438
984 3300005843 Ga0068860_100058444 Ga0068860_1000584444 438
985 3300005844 Ga0068862_100001478 Ga0068862_10000147816 438
986 3300005844 Ga0068862_100015582 Ga0068862_1000155823 438
987 3300009011 Ga0105251_10000694 Ga0105251_1000069420 438
988 3300025923 Ga0207681_10000062 Ga0207681_1000006257 438
989 3300025925 Ga0207650_10026035 Ga0207650_100260353 438
990 3300025941 Ga0207711_10002295 Ga0207711_1000229514 438
991 3300025986 Ga0207658_10000461 Ga0207658_1000046115 438
992 3300025986 Ga0207658_10007015 Ga0207658_100070156 438
993 3300026088 Ga0207641_10013254 Ga0207641_100132545 438
994 3300026088 Ga0207641_10026977 Ga0207641_100269772 438
995 3300028379 Ga0268266_10000124 Ga0268266_1000012417 438
996 3300028380 Ga0268265_10009536 Ga0268265_100095364 438
997 3300028380 Ga0268265_10088162 Ga0268265_100881622 438
998 3300028381 Ga0268264_10011531 Ga0268264_100115316 438
999 3300028381 Ga0268264_10015733 Ga0268264_100157333 438
1000 3300048906 Ga0496103_0029064 Ga0496103_0029064_448_1827 438
1001 3300048921 Ga0496118_0089272 Ga0496118_0089272_486_1865 438
1002 3300048924 Ga0496121_0011285 Ga0496121_0011285_6784_8163 438
1003 3300048926 Ga0496123_0018626 Ga0496123_0018626_2758_4137 438
1004 3300048929 Ga0496126_0046671 Ga0496126_0046671_265_1644 438

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00860

Xan_ur_permease

Permease family

72

455

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iof-assembly1.cif.gz_A structure of the transmembrane domain of the transporter slc26dg 0.7209 33 413
5da0-assembly1.cif.gz_A structure of the the slc26 transporter slc26dg in complex with a nanobody 0.7195 33 415
7v73-assembly1.cif.gz_A thermostabilized human prestin in complex with chloride 0.7101 34 411
5iof-assembly1.cif.gz_A structure of the transmembrane domain of the transporter slc26dg 0.7059 33 413
8uc1-assembly1.cif.gz_B cryo-em structure of dolphin prestin in low cl buffer 0.6978 32 415
ID Description Score Start End Superfamily
af_Q57772_21_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9106 35 432 1.20.1740.10
af_Q57772_21_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8785 35 432 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6082 34 409 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.5982 34 409 1.20.1740.10
af_Q6ZIE6_46_504_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.5302 42 421 1.20.1730.10
ID Description Score Start End GO Terms
AF-R5ZCG8-F1-model_v4 deleted 0.9616 20 226
AF-A0A3M1XUJ6-F1-model_v4 NCS2 family permease 0.9613 17 228 GO:0005886
GO:0012505
GO:0015207
AF-A0A831LR38-F1-model_v4 NCS2 family permease 0.9595 19 229 GO:0005345
GO:0005886
GO:0012505
AF-A0A1L8ZAD8-F1-model_v4 Guanine permease 0.9525 46 215 GO:0005345
GO:0005886
GO:0012505
AF-A0A3M1XUJ6-F1-model_v4 NCS2 family permease 0.9483 17 228 GO:0005886
GO:0012505
GO:0015207

Feature Viewer

pLDDT pTM Quality
80.57 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map