F487982
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1005 | 457 | 2010 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10165338|Ga0075365_101653382 |
| Length | 288 |
| Sequence | MLAIAGPITSVRYDSPDKGGTHNQTAISVLAQRQTSLNEGTRLMFDLTGKTALVTGATGGIGNAIARALHHQGATVAISGTRREVLDQFAGELNERVHVLPCNLAEKDEVEALVPKSEEAMGQLDILVANAGITKDNLLVQLRDEDWDQVVAVNLTATFRLARAALRGMMRRRFGRIIGIASVVGVTGNPGQGNYTATKAGMIGMIKSIAGEYAKRGVTANSIAPGFIATAMTDKLNDKQRDAILARVPAGRLGAGADVAAATVFLASDEAGYVTGQTLHVNGGMAMI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 192 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 204 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 254 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 255 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 256 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 259 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 260 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 261 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 262 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 391 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 394 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 395 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 396 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 397 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 398 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 399 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 403 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 404 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 405 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 406 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 407 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 408 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 409 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 411 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 412 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 413 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 415 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 416 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 417 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 418 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 419 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 421 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 422 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 423 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 424 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 426 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 427 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 428 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 429 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 430 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 434 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 435 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 436 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 437 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 438 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 439 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 440 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 441 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 442 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 443 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 444 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 445 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 446 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 447 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 448 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 449 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 450 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 451 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 452 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 453 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 454 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 455 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 456 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 457 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.51 |
| Metatranscriptomes | 0.1 |
| Isolates | 2.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.15 |
| Nodule | 0.1 |
| Rhizoplane | 3.68 |
| Rhizosphere | 80.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075365_10165338 | 3300006038 | Bacteria | 1543 |
| 2 | JGI25153J46596_10000054 | 3300003215 | Bacteria | 136806 |
| 3 | JGI25153J46596_10005338 | 3300003215 | Bacteria | 6754 |
| 4 | rootH1_10164059 | 3300003316 | Bacteria | 1658 |
| 5 | rootH2_10052210 | 3300003320 | Bacteria | 35441 |
| 6 | rootL2_10218209 | 3300003322 | Unclassified | 2979 |
| 7 | rootH1_10219969 | 3300003323 | Bacteria | 1300 |
| 8 | Ga0055530_10000135 | 3300003791 | Bacteria | 65036 |
| 9 | Ga0055531_10040955 | 3300003794 | Bacteria | 1349 |
| 10 | Ga0055531_10042648 | 3300003794 | Bacteria | 1294 |
| 11 | JGI25405J52794_10026189 | 3300003911 | Bacteria | 1197 |
| 12 | Ga0065165_1000563 | 3300005262 | Bacteria | 55229 |
| 13 | Ga0065704_10171961 | 3300005289 | Bacteria | 1286 |
| 14 | Ga0065704_10204155 | 3300005289 | Bacteria | 1134 |
| 15 | Ga0065715_10166128 | 3300005293 | Unclassified | 1584 |
| 16 | Ga0070658_10000059 | 3300005327 | Bacteria | 112781 |
| 17 | Ga0070658_10008345 | 3300005327 | Bacteria | 8332 |
| 18 | Ga0070658_10026519 | 3300005327 | Bacteria | 4649 |
| 19 | Ga0070658_10185814 | 3300005327 | Unclassified | 1750 |
| 20 | Ga0070676_10007291 | 3300005328 | Bacteria | 5931 |
| 21 | Ga0070676_10016919 | 3300005328 | Bacteria | 4031 |
| 22 | Ga0070683_100023828 | 3300005329 | Bacteria | 5478 |
| 23 | Ga0070690_100150919 | 3300005330 | Bacteria | 1585 |
| 24 | Ga0070670_100004475 | 3300005331 | Bacteria | 11708 |
| 25 | Ga0070670_100151241 | 3300005331 | Bacteria | 2009 |
| 26 | Ga0070677_10017189 | 3300005333 | Bacteria | 2586 |
| 27 | Ga0068869_100009547 | 3300005334 | Bacteria | 6299 |
| 28 | Ga0070666_10070550 | 3300005335 | Bacteria | 2377 |
| 29 | Ga0070680_100012557 | 3300005336 | Bacteria | 6584 |
| 30 | Ga0070680_100015196 | 3300005336 | Bacteria | 6030 |
| 31 | Ga0070680_100054683 | 3300005336 | Bacteria | 3260 |
| 32 | Ga0070680_100069381 | 3300005336 | Bacteria | 2894 |
| 33 | Ga0070680_100085886 | 3300005336 | Bacteria | 2600 |
| 34 | Ga0070682_100392218 | 3300005337 | Bacteria | 1047 |
| 35 | Ga0068868_100803488 | 3300005338 | Bacteria | 849 |
| 36 | Ga0070660_100048416 | 3300005339 | Bacteria | 3265 |
| 37 | Ga0070689_100021631 | 3300005340 | Bacteria | 4791 |
| 38 | Ga0070689_100187038 | 3300005340 | Bacteria | 1685 |
| 39 | Ga0070689_100310547 | 3300005340 | Bacteria | 1314 |
| 40 | Ga0070691_10052485 | 3300005341 | Bacteria | 1949 |
| 41 | Ga0070691_10333279 | 3300005341 | Bacteria | 838 |
| 42 | Ga0070661_100006288 | 3300005344 | Bacteria | 8194 |
| 43 | Ga0070661_100075453 | 3300005344 | Bacteria | 2484 |
| 44 | Ga0070668_100005964 | 3300005347 | Bacteria | 9036 |
| 45 | Ga0070668_100064590 | 3300005347 | Bacteria | 2838 |
| 46 | Ga0070668_100117910 | 3300005347 | Bacteria | 2119 |
| 47 | Ga0070668_100219341 | 3300005347 | Bacteria | 1568 |
| 48 | Ga0070668_100339965 | 3300005347 | Bacteria | 1268 |
| 49 | Ga0070669_100010472 | 3300005353 | Bacteria | 6586 |
| 50 | Ga0070669_100339713 | 3300005353 | Bacteria | 1216 |
| 51 | Ga0070675_100203670 | 3300005354 | Bacteria | 1718 |
| 52 | Ga0070671_100103151 | 3300005355 | Bacteria | 2393 |
| 53 | Ga0070673_100344741 | 3300005364 | Bacteria | 1321 |
| 54 | Ga0070688_100004472 | 3300005365 | Bacteria | 7280 |
| 55 | Ga0070688_100048736 | 3300005365 | Unclassified | 2633 |
| 56 | Ga0070688_100237137 | 3300005365 | Bacteria | 1293 |
| 57 | Ga0070659_100053819 | 3300005366 | Bacteria | 3169 |
| 58 | Ga0070659_100143047 | 3300005366 | Bacteria | 1947 |
| 59 | Ga0070667_100226114 | 3300005367 | Bacteria | 1667 |
| 60 | Ga0070709_10013740 | 3300005434 | Bacteria | 4559 |
| 61 | Ga0070709_10068208 | 3300005434 | Bacteria | 2286 |
| 62 | Ga0070714_100000490 | 3300005435 | Bacteria | 28629 |
| 63 | Ga0070713_100000278 | 3300005436 | Bacteria | 33610 |
| 64 | Ga0070713_100092449 | 3300005436 | Bacteria | 2605 |
| 65 | Ga0070713_100461690 | 3300005436 | Bacteria | 1194 |
| 66 | Ga0070710_10003676 | 3300005437 | Bacteria | 7254 |
| 67 | Ga0070710_10004304 | 3300005437 | Bacteria | 6748 |
| 68 | Ga0070701_10177097 | 3300005438 | Bacteria | 1246 |
| 69 | Ga0070711_100003976 | 3300005439 | Bacteria | 8689 |
| 70 | Ga0070711_100053143 | 3300005439 | Bacteria | 2790 |
| 71 | Ga0070700_100451148 | 3300005441 | Bacteria | 979 |
| 72 | Ga0070678_100017547 | 3300005456 | Bacteria | 4614 |
| 73 | Ga0070678_100021018 | 3300005456 | Bacteria | 4295 |
| 74 | Ga0070678_100216832 | 3300005456 | Bacteria | 1589 |
| 75 | Ga0070681_10006100 | 3300005458 | Bacteria | 11695 |
| 76 | Ga0070681_10008082 | 3300005458 | Bacteria | 10294 |
| 77 | Ga0070681_10044484 | 3300005458 | Bacteria | 4445 |
| 78 | Ga0068867_100087828 | 3300005459 | Unclassified | 2355 |
| 79 | Ga0070685_10004976 | 3300005466 | Bacteria | 6730 |
| 80 | Ga0070685_10047083 | 3300005466 | Bacteria | 2478 |
| 81 | Ga0070685_10129927 | 3300005466 | Bacteria | 1574 |
| 82 | Ga0070699_100187786 | 3300005518 | Bacteria | 1835 |
| 83 | Ga0070679_100032781 | 3300005530 | Bacteria | 5141 |
| 84 | Ga0070684_100117049 | 3300005535 | Bacteria | 2394 |
| 85 | Ga0070684_100266404 | 3300005535 | Bacteria | 1568 |
| 86 | Ga0070697_100283296 | 3300005536 | Bacteria | 1422 |
| 87 | Ga0068853_100005273 | 3300005539 | Bacteria | 10121 |
| 88 | Ga0068853_100078999 | 3300005539 | Bacteria | 2876 |
| 89 | Ga0068853_100341419 | 3300005539 | Bacteria | 1391 |
| 90 | Ga0070672_100016229 | 3300005543 | Bacteria | 5327 |
| 91 | Ga0070672_100153850 | 3300005543 | Bacteria | 1904 |
| 92 | Ga0070672_100195947 | 3300005543 | Bacteria | 1688 |
| 93 | Ga0070696_100069257 | 3300005546 | Bacteria | 2478 |
| 94 | Ga0070696_100469248 | 3300005546 | Bacteria | 996 |
| 95 | Ga0070693_100003633 | 3300005547 | Bacteria | 7208 |
| 96 | Ga0070665_100047432 | 3300005548 | Bacteria | 4312 |
| 97 | Ga0070665_100318342 | 3300005548 | Bacteria | 1560 |
| 98 | Ga0070665_100378526 | 3300005548 | Bacteria | 1423 |
| 99 | Ga0070704_100346552 | 3300005549 | Bacteria | 1252 |
| 100 | Ga0070704_100370403 | 3300005549 | Bacteria | 1214 |
| 101 | Ga0070704_100446949 | 3300005549 | Bacteria | 1112 |
| 102 | Ga0068855_100000009 | 3300005563 | Bacteria | 246035 |
| 103 | Ga0068855_100000093 | 3300005563 | Bacteria | 106968 |
| 104 | Ga0068855_100002770 | 3300005563 | Bacteria | 21581 |
| 105 | Ga0068855_100079212 | 3300005563 | Bacteria | 3811 |
| 106 | Ga0068855_100101153 | 3300005563 | Bacteria | 3318 |
| 107 | Ga0068855_100214717 | 3300005563 | Bacteria | 2160 |
| 108 | Ga0068855_100276319 | 3300005563 | Bacteria | 1867 |
| 109 | Ga0070664_100671954 | 3300005564 | Bacteria | 963 |
| 110 | Ga0068857_100106220 | 3300005577 | Bacteria | 2521 |
| 111 | Ga0068857_100585764 | 3300005577 | Bacteria | 1053 |
| 112 | Ga0068857_100595835 | 3300005577 | Bacteria | 1044 |
| 113 | Ga0068857_100942842 | 3300005577 | Bacteria | 829 |
| 114 | Ga0068854_100133504 | 3300005578 | Bacteria | 1898 |
| 115 | Ga0068854_100290918 | 3300005578 | Bacteria | 1318 |
| 116 | Ga0068854_100703289 | 3300005578 | Bacteria | 872 |
| 117 | Ga0068856_100014274 | 3300005614 | Bacteria | 7681 |
| 118 | Ga0068856_100049571 | 3300005614 | Bacteria | 4138 |
| 119 | Ga0068856_100081363 | 3300005614 | Bacteria | 3213 |
| 120 | Ga0068856_100246423 | 3300005614 | Bacteria | 1802 |
| 121 | Ga0070702_100429686 | 3300005615 | Bacteria | 953 |
| 122 | Ga0068852_100273793 | 3300005616 | Bacteria | 1625 |
| 123 | Ga0068859_100021820 | 3300005617 | Bacteria | 6421 |
| 124 | Ga0068859_100142510 | 3300005617 | Bacteria | 2470 |
| 125 | Ga0068859_100206335 | 3300005617 | Unclassified | 2050 |
| 126 | Ga0068864_100000154 | 3300005618 | Bacteria | 63744 |
| 127 | Ga0068864_100041370 | 3300005618 | Bacteria | 3942 |
| 128 | Ga0068861_100084612 | 3300005719 | Unclassified | 2490 |
| 129 | Ga0068870_10102381 | 3300005840 | Bacteria | 1621 |
| 130 | Ga0068863_100000172 | 3300005841 | Bacteria | 68888 |
| 131 | Ga0068863_100254720 | 3300005841 | Bacteria | 1696 |
| 132 | Ga0068858_100000639 | 3300005842 | Bacteria | 36426 |
| 133 | Ga0068858_100166226 | 3300005842 | Bacteria | 2079 |
| 134 | Ga0068858_100595772 | 3300005842 | Bacteria | 1072 |
| 135 | Ga0068860_100000151 | 3300005843 | Bacteria | 112208 |
| 136 | Ga0068860_100008879 | 3300005843 | Bacteria | 10013 |
| 137 | Ga0068860_100011656 | 3300005843 | Bacteria | 8668 |
| 138 | Ga0068860_100754858 | 3300005843 | Bacteria | 985 |
| 139 | Ga0068860_100902311 | 3300005843 | Bacteria | 900 |
| 140 | Ga0068862_100007610 | 3300005844 | Bacteria | 8974 |
| 141 | Ga0068862_100014501 | 3300005844 | Bacteria | 6541 |
| 142 | Ga0068862_100057627 | 3300005844 | Bacteria | 3332 |
| 143 | Ga0068862_100263434 | 3300005844 | Bacteria | 1574 |
| 144 | Ga0081455_10000347 | 3300005937 | Bacteria | 60756 |
| 145 | Ga0081455_10000477 | 3300005937 | Bacteria | 51914 |
| 146 | Ga0081455_10002412 | 3300005937 | Bacteria | 22295 |
| 147 | Ga0081455_10012372 | 3300005937 | Bacteria | 8515 |
| 148 | Ga0081455_10029489 | 3300005937 | Bacteria | 5002 |
| 149 | Ga0081455_10046937 | 3300005937 | Bacteria | 3744 |
| 150 | Ga0081455_10078322 | 3300005937 | Bacteria | 2716 |
| 151 | Ga0081538_10001364 | 3300005981 | Bacteria | 25135 |
| 152 | Ga0081540_1000015 | 3300005983 | Bacteria | 178704 |
| 153 | Ga0081540_1004841 | 3300005983 | Bacteria | 10144 |
| 154 | Ga0081540_1030763 | 3300005983 | Bacteria | 2967 |
| 155 | Ga0081539_10005853 | 3300005985 | Bacteria | 12191 |
| 156 | Ga0070717_10000297 | 3300006028 | Bacteria | 33338 |
| 157 | Ga0070717_10124057 | 3300006028 | Bacteria | 2215 |
| 158 | Ga0070717_10141223 | 3300006028 | Bacteria | 2077 |
| 159 | Ga0070717_10420344 | 3300006028 | Bacteria | 1202 |
| 160 | Ga0070717_10735450 | 3300006028 | Bacteria | 897 |
| 161 | Ga0075365_10030532 | 3300006038 | Bacteria | 3452 |
| 162 | Ga0075363_100077948 | 3300006048 | Bacteria | 1809 |
| 163 | Ga0075364_10157580 | 3300006051 | Bacteria | 1531 |
| 164 | Ga0075364_10179402 | 3300006051 | Bacteria | 1432 |
| 165 | Ga0070715_10005158 | 3300006163 | Bacteria | 4339 |
| 166 | Ga0070712_100000896 | 3300006175 | Bacteria | 17862 |
| 167 | Ga0070712_100015199 | 3300006175 | Bacteria | 4951 |
| 168 | Ga0070712_100036096 | 3300006175 | Bacteria | 3360 |
| 169 | Ga0075367_10026095 | 3300006178 | Bacteria | 3309 |
| 170 | Ga0075367_10308272 | 3300006178 | Bacteria | 997 |
| 171 | Ga0075366_10027423 | 3300006195 | Bacteria | 3341 |
| 172 | Ga0075366_10220123 | 3300006195 | Bacteria | 1156 |
| 173 | Ga0097621_100397803 | 3300006237 | Bacteria | 1233 |
| 174 | Ga0075370_10061817 | 3300006353 | Bacteria | 2134 |
| 175 | Ga0075370_10062100 | 3300006353 | Bacteria | 2129 |
| 176 | Ga0068871_100265200 | 3300006358 | Unclassified | 1499 |
| 177 | Ga0075428_100000430 | 3300006844 | Bacteria | 41652 |
| 178 | Ga0075428_100181493 | 3300006844 | Bacteria | 2278 |
| 179 | Ga0075428_100214466 | 3300006844 | Bacteria | 2079 |
| 180 | Ga0075428_100382111 | 3300006844 | Bacteria | 1510 |
| 181 | Ga0075430_100128522 | 3300006846 | Bacteria | 2112 |
| 182 | Ga0075431_100000086 | 3300006847 | Bacteria | 56252 |
| 183 | Ga0075431_100019049 | 3300006847 | Bacteria | 6993 |
| 184 | Ga0075431_100123707 | 3300006847 | Bacteria | 2669 |
| 185 | Ga0075431_100360403 | 3300006847 | Bacteria | 1460 |
| 186 | Ga0075433_10029411 | 3300006852 | Bacteria | 4681 |
| 187 | Ga0075433_10071279 | 3300006852 | Bacteria | 3055 |
| 188 | Ga0075433_10162923 | 3300006852 | Bacteria | 1985 |
| 189 | Ga0075434_100018441 | 3300006871 | Bacteria | 6743 |
| 190 | Ga0075434_100288912 | 3300006871 | Bacteria | 1659 |
| 191 | Ga0075434_100788154 | 3300006871 | Bacteria | 967 |
| 192 | Ga0075429_100082076 | 3300006880 | Bacteria | 2810 |
| 193 | Ga0075429_100326146 | 3300006880 | Bacteria | 1344 |
| 194 | Ga0068865_100211830 | 3300006881 | Bacteria | 1510 |
| 195 | Ga0097620_100021824 | 3300006931 | Bacteria | 6421 |
| 196 | Ga0097620_100142526 | 3300006931 | Bacteria | 2470 |
| 197 | Ga0097620_100206334 | 3300006931 | Unclassified | 2050 |
| 198 | Ga0075435_100032914 | 3300007076 | Bacteria | 4097 |
| 199 | Ga0075435_100213931 | 3300007076 | Bacteria | 1636 |
| 200 | Ga0075435_100634722 | 3300007076 | Bacteria | 927 |
| 201 | Ga0099794_10000814 | 3300007265 | Bacteria | 10538 |
| 202 | Ga0105240_10000094 | 3300009093 | Bacteria | 181637 |
| 203 | Ga0105240_10001341 | 3300009093 | Bacteria | 42205 |
| 204 | Ga0105240_10012709 | 3300009093 | Bacteria | 11605 |
| 205 | Ga0105240_10091571 | 3300009093 | Bacteria | 3714 |
| 206 | Ga0105240_10131409 | 3300009093 | Bacteria | 3002 |
| 207 | Ga0105240_10299790 | 3300009093 | Bacteria | 1839 |
| 208 | Ga0111539_10001374 | 3300009094 | Bacteria | 32371 |
| 209 | Ga0111539_10019117 | 3300009094 | Bacteria | 8466 |
| 210 | Ga0111539_10029219 | 3300009094 | Bacteria | 6718 |
| 211 | Ga0111539_10054138 | 3300009094 | Bacteria | 4775 |
| 212 | Ga0111539_10297775 | 3300009094 | Bacteria | 1877 |
| 213 | Ga0111539_10779185 | 3300009094 | Bacteria | 1113 |
| 214 | Ga0105245_10101542 | 3300009098 | Bacteria | 2663 |
| 215 | Ga0114129_10000243 | 3300009147 | Bacteria | 61230 |
| 216 | Ga0114129_10007283 | 3300009147 | Bacteria | 15749 |
| 217 | Ga0114129_10013235 | 3300009147 | Bacteria | 11749 |
| 218 | Ga0114129_10035725 | 3300009147 | Bacteria | 7020 |
| 219 | Ga0114129_10184579 | 3300009147 | Bacteria | 2836 |
| 220 | Ga0114129_10205921 | 3300009147 | Bacteria | 2662 |
| 221 | Ga0105248_10024422 | 3300009177 | Bacteria | 6721 |
| 222 | Ga0105248_10060900 | 3300009177 | Bacteria | 4237 |
| 223 | Ga0105248_10065402 | 3300009177 | Bacteria | 4083 |
| 224 | Ga0105237_10784813 | 3300009545 | Bacteria | 959 |
| 225 | Ga0105237_10972741 | 3300009545 | Bacteria | 856 |
| 226 | Ga0105238_10039621 | 3300009551 | Bacteria | 4778 |
| 227 | Ga0105238_10118377 | 3300009551 | Bacteria | 2629 |
| 228 | Ga0105238_10295610 | 3300009551 | Bacteria | 1603 |
| 229 | Ga0105238_10822266 | 3300009551 | Bacteria | 945 |
| 230 | Ga0105238_11027720 | 3300009551 | Bacteria | 845 |
| 231 | Ga0105249_10109094 | 3300009553 | Bacteria | 2613 |
| 232 | Ga0105249_10352395 | 3300009553 | Bacteria | 1491 |
| 233 | Ga0105249_10383816 | 3300009553 | Bacteria | 1431 |
| 234 | Ga0105249_10820214 | 3300009553 | Bacteria | 995 |
| 235 | Ga0105239_10243793 | 3300010375 | Bacteria | 2017 |
| 236 | Ga0105239_11154845 | 3300010375 | Bacteria | 892 |
| 237 | Ga0105246_10296963 | 3300011119 | Bacteria | 1302 |
| 238 | Ga0157371_10020758 | 3300013102 | Bacteria | 4832 |
| 239 | Ga0157371_10223626 | 3300013102 | Bacteria | 1352 |
| 240 | Ga0157370_10002875 | 3300013104 | Bacteria | 20517 |
| 241 | Ga0157370_10011925 | 3300013104 | Bacteria | 9062 |
| 242 | Ga0157370_10193886 | 3300013104 | Bacteria | 1886 |
| 243 | Ga0157369_10196501 | 3300013105 | Bacteria | 2118 |
| 244 | Ga0157369_10651347 | 3300013105 | Bacteria | 1086 |
| 245 | Ga0157374_10006020 | 3300013296 | Bacteria | 10263 |
| 246 | Ga0157374_11057301 | 3300013296 | Bacteria | 832 |
| 247 | Ga0157378_10113810 | 3300013297 | Bacteria | 2485 |
| 248 | Ga0157378_10216303 | 3300013297 | Bacteria | 1820 |
| 249 | Ga0157378_10242253 | 3300013297 | Bacteria | 1723 |
| 250 | Ga0163162_10037368 | 3300013306 | Unclassified | 4846 |
| 251 | Ga0163162_10385835 | 3300013306 | Unclassified | 1534 |
| 252 | Ga0157372_10025787 | 3300013307 | Bacteria | 6393 |
| 253 | Ga0157375_10053720 | 3300013308 | Bacteria | 3965 |
| 254 | Ga0157375_11682575 | 3300013308 | Unclassified | 751 |
| 255 | Ga0163163_10019627 | 3300014325 | Bacteria | 6349 |
| 256 | Ga0163163_10059375 | 3300014325 | Bacteria | 3783 |
| 257 | Ga0163163_10918670 | 3300014325 | Bacteria | 939 |
| 258 | Ga0157380_10034981 | 3300014326 | Bacteria | 3877 |
| 259 | Ga0157380_10096177 | 3300014326 | Bacteria | 2455 |
| 260 | Ga0157380_10154705 | 3300014326 | Bacteria | 1986 |
| 261 | Ga0157377_10024421 | 3300014745 | Unclassified | 3213 |
| 262 | Ga0157377_10068405 | 3300014745 | Bacteria | 2046 |
| 263 | Ga0157379_10427938 | 3300014968 | Bacteria | 1220 |
| 264 | Ga0157376_10257362 | 3300014969 | Bacteria | 1633 |
| 265 | Ga0157376_10359570 | 3300014969 | Bacteria | 1396 |
| 266 | Ga0157376_10546622 | 3300014969 | Bacteria | 1145 |
| 267 | Ga0163161_10091543 | 3300017792 | Bacteria | 2251 |
| 268 | Ga0163161_10207866 | 3300017792 | Unclassified | 1511 |
| 269 | Ga0213872_10003321 | 3300021361 | Bacteria | 8966 |
| 270 | Ga0213872_10147704 | 3300021361 | Bacteria | 1028 |
| 271 | Ga0213876_10000134 | 3300021384 | Bacteria | 80875 |
| 272 | Ga0213876_10004326 | 3300021384 | Bacteria | 7958 |
| 273 | Ga0213876_10112654 | 3300021384 | Bacteria | 1444 |
| 274 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 275 | Ga0213875_10002695 | 3300021388 | Bacteria | 10484 |
| 276 | Ga0213875_10008291 | 3300021388 | Bacteria | 5327 |
| 277 | Ga0213875_10086068 | 3300021388 | Bacteria | 1466 |
| 278 | Ga0213875_10093515 | 3300021388 | Bacteria | 1402 |
| 279 | Ga0213871_10001032 | 3300021441 | Bacteria | 4386 |
| 280 | Ga0213871_10061498 | 3300021441 | Bacteria | 1047 |
| 281 | Ga0209026_1001732 | 3300025250 | Bacteria | 9090 |
| 282 | Ga0209026_1010008 | 3300025250 | Bacteria | 1803 |
| 283 | Ga0209148_1009797 | 3300025254 | Bacteria | 1846 |
| 284 | Ga0209758_1000119 | 3300025297 | Bacteria | 195545 |
| 285 | Ga0209758_1000252 | 3300025297 | Bacteria | 108214 |
| 286 | Ga0209758_1000682 | 3300025297 | Bacteria | 50599 |
| 287 | Ga0209050_1000141 | 3300025298 | Bacteria | 173116 |
| 288 | Ga0209050_1003817 | 3300025298 | Bacteria | 10753 |
| 289 | Ga0207426_1026381 | 3300025302 | Bacteria | 1946 |
| 290 | Ga0207426_1050950 | 3300025302 | Bacteria | 1232 |
| 291 | Ga0207426_1053149 | 3300025302 | Bacteria | 1197 |
| 292 | Ga0209257_1000190 | 3300025304 | Bacteria | 153686 |
| 293 | Ga0209257_1000288 | 3300025304 | Bacteria | 111141 |
| 294 | Ga0209257_1000562 | 3300025304 | Bacteria | 63202 |
| 295 | Ga0207653_10010527 | 3300025885 | Bacteria | 2884 |
| 296 | Ga0207682_10009231 | 3300025893 | Bacteria | 3897 |
| 297 | Ga0207692_10001592 | 3300025898 | Bacteria | 8547 |
| 298 | Ga0207642_10092372 | 3300025899 | Bacteria | 1498 |
| 299 | Ga0207680_10095618 | 3300025903 | Bacteria | 1899 |
| 300 | Ga0207680_10416950 | 3300025903 | Bacteria | 950 |
| 301 | Ga0207685_10002629 | 3300025905 | Bacteria | 4168 |
| 302 | Ga0207699_10009773 | 3300025906 | Bacteria | 4791 |
| 303 | Ga0207699_10035071 | 3300025906 | Bacteria | 2852 |
| 304 | Ga0207645_10009341 | 3300025907 | Bacteria | 6789 |
| 305 | Ga0207645_10281570 | 3300025907 | Bacteria | 1104 |
| 306 | Ga0207643_10015054 | 3300025908 | Bacteria | 4206 |
| 307 | Ga0207643_10152198 | 3300025908 | Bacteria | 1387 |
| 308 | Ga0207705_10000195 | 3300025909 | Bacteria | 61397 |
| 309 | Ga0207705_10144164 | 3300025909 | Bacteria | 1781 |
| 310 | Ga0207705_10197352 | 3300025909 | Bacteria | 1524 |
| 311 | Ga0207684_10022472 | 3300025910 | Bacteria | 5383 |
| 312 | Ga0207707_10006763 | 3300025912 | Bacteria | 10012 |
| 313 | Ga0207707_10049755 | 3300025912 | Bacteria | 3651 |
| 314 | Ga0207707_10081952 | 3300025912 | Bacteria | 2816 |
| 315 | Ga0207707_10093101 | 3300025912 | Bacteria | 2633 |
| 316 | Ga0207707_10760750 | 3300025912 | Bacteria | 809 |
| 317 | Ga0207695_10000419 | 3300025913 | Bacteria | 94504 |
| 318 | Ga0207695_10001861 | 3300025913 | Bacteria | 33054 |
| 319 | Ga0207695_10385409 | 3300025913 | Bacteria | 1287 |
| 320 | Ga0207695_10391725 | 3300025913 | Bacteria | 1274 |
| 321 | Ga0207671_10356418 | 3300025914 | Bacteria | 1160 |
| 322 | Ga0207693_10005248 | 3300025915 | Bacteria | 10840 |
| 323 | Ga0207693_10045878 | 3300025915 | Bacteria | 3433 |
| 324 | Ga0207663_10007163 | 3300025916 | Bacteria | 5767 |
| 325 | Ga0207663_10242979 | 3300025916 | Bacteria | 1321 |
| 326 | Ga0207663_10471939 | 3300025916 | Bacteria | 971 |
| 327 | Ga0207660_10043058 | 3300025917 | Bacteria | 3171 |
| 328 | Ga0207660_10101300 | 3300025917 | Bacteria | 2151 |
| 329 | Ga0207660_10124343 | 3300025917 | Bacteria | 1957 |
| 330 | Ga0207660_10132914 | 3300025917 | Bacteria | 1896 |
| 331 | Ga0207660_10185168 | 3300025917 | Bacteria | 1619 |
| 332 | Ga0207657_10021183 | 3300025919 | Bacteria | 6124 |
| 333 | Ga0207649_10397255 | 3300025920 | Bacteria | 1031 |
| 334 | Ga0207652_10018761 | 3300025921 | Bacteria | 5678 |
| 335 | Ga0207652_10281177 | 3300025921 | Bacteria | 1501 |
| 336 | Ga0207646_10438762 | 3300025922 | Bacteria | 1178 |
| 337 | Ga0207681_10040157 | 3300025923 | Bacteria | 3112 |
| 338 | Ga0207681_10060574 | 3300025923 | Bacteria | 2599 |
| 339 | Ga0207681_10306321 | 3300025923 | Bacteria | 1258 |
| 340 | Ga0207694_10030714 | 3300025924 | Bacteria | 4102 |
| 341 | Ga0207694_10120857 | 3300025924 | Bacteria | 2091 |
| 342 | Ga0207650_10010512 | 3300025925 | Bacteria | 6348 |
| 343 | Ga0207687_10182829 | 3300025927 | Bacteria | 1625 |
| 344 | Ga0207700_10000380 | 3300025928 | Bacteria | 25773 |
| 345 | Ga0207700_10121010 | 3300025928 | Bacteria | 2122 |
| 346 | Ga0207700_10254317 | 3300025928 | Bacteria | 1502 |
| 347 | Ga0207700_10679945 | 3300025928 | Bacteria | 918 |
| 348 | Ga0207664_10005464 | 3300025929 | Bacteria | 8690 |
| 349 | Ga0207664_10008858 | 3300025929 | Bacteria | 7040 |
| 350 | Ga0207664_10810576 | 3300025929 | Bacteria | 842 |
| 351 | Ga0207690_10379830 | 3300025932 | Bacteria | 1122 |
| 352 | Ga0207706_10081394 | 3300025933 | Bacteria | 2845 |
| 353 | Ga0207686_10150068 | 3300025934 | Bacteria | 1622 |
| 354 | Ga0207670_10001178 | 3300025936 | Bacteria | 13805 |
| 355 | Ga0207670_10002994 | 3300025936 | Bacteria | 8920 |
| 356 | Ga0207670_10036512 | 3300025936 | Bacteria | 3196 |
| 357 | Ga0207670_10161876 | 3300025936 | Bacteria | 1671 |
| 358 | Ga0207670_10369997 | 3300025936 | Bacteria | 1139 |
| 359 | Ga0207665_10034393 | 3300025939 | Bacteria | 3362 |
| 360 | Ga0207665_10077328 | 3300025939 | Bacteria | 2284 |
| 361 | Ga0207691_10079984 | 3300025940 | Bacteria | 2941 |
| 362 | Ga0207691_10105100 | 3300025940 | Bacteria | 2515 |
| 363 | Ga0207711_10021082 | 3300025941 | Bacteria | 5442 |
| 364 | Ga0207711_10028623 | 3300025941 | Bacteria | 4691 |
| 365 | Ga0207711_10073803 | 3300025941 | Bacteria | 2966 |
| 366 | Ga0207689_10006787 | 3300025942 | Bacteria | 10075 |
| 367 | Ga0207689_10309093 | 3300025942 | Bacteria | 1311 |
| 368 | Ga0207679_10476363 | 3300025945 | Bacteria | 1111 |
| 369 | Ga0207667_10000045 | 3300025949 | Bacteria | 246053 |
| 370 | Ga0207667_10000588 | 3300025949 | Bacteria | 47296 |
| 371 | Ga0207667_10005483 | 3300025949 | Bacteria | 15466 |
| 372 | Ga0207667_10146786 | 3300025949 | Bacteria | 2428 |
| 373 | Ga0207667_10177908 | 3300025949 | Bacteria | 2185 |
| 374 | Ga0207667_10300231 | 3300025949 | Bacteria | 1641 |
| 375 | Ga0207667_10304937 | 3300025949 | Bacteria | 1627 |
| 376 | Ga0207667_10691039 | 3300025949 | Bacteria | 1023 |
| 377 | Ga0207651_10004995 | 3300025960 | Bacteria | 6762 |
| 378 | Ga0207651_10105642 | 3300025960 | Bacteria | 2101 |
| 379 | Ga0207651_10113471 | 3300025960 | Bacteria | 2039 |
| 380 | Ga0207712_10004918 | 3300025961 | Bacteria | 8449 |
| 381 | Ga0207712_10172730 | 3300025961 | Bacteria | 1691 |
| 382 | Ga0207712_10248547 | 3300025961 | Bacteria | 1436 |
| 383 | Ga0207712_10332399 | 3300025961 | Bacteria | 1257 |
| 384 | Ga0207668_10029854 | 3300025972 | Bacteria | 3578 |
| 385 | Ga0207668_10459451 | 3300025972 | Bacteria | 1088 |
| 386 | Ga0207668_10516854 | 3300025972 | Bacteria | 1029 |
| 387 | Ga0207640_10110400 | 3300025981 | Bacteria | 1948 |
| 388 | Ga0207658_10124226 | 3300025986 | Bacteria | 2063 |
| 389 | Ga0207658_10178234 | 3300025986 | Bacteria | 1757 |
| 390 | Ga0207677_10436448 | 3300026023 | Bacteria | 1119 |
| 391 | Ga0207677_10497113 | 3300026023 | Bacteria | 1054 |
| 392 | Ga0207703_10000289 | 3300026035 | Bacteria | 55525 |
| 393 | Ga0207703_10444934 | 3300026035 | Bacteria | 1209 |
| 394 | Ga0207703_10495861 | 3300026035 | Bacteria | 1146 |
| 395 | Ga0207639_10236214 | 3300026041 | Bacteria | 1587 |
| 396 | Ga0207678_10464079 | 3300026067 | Bacteria | 1102 |
| 397 | Ga0207678_10790741 | 3300026067 | Bacteria | 837 |
| 398 | Ga0207708_10054966 | 3300026075 | Bacteria | 3036 |
| 399 | Ga0207702_10062359 | 3300026078 | Bacteria | 3183 |
| 400 | Ga0207702_10070400 | 3300026078 | Bacteria | 3008 |
| 401 | Ga0207702_10117617 | 3300026078 | Bacteria | 2374 |
| 402 | Ga0207702_10161501 | 3300026078 | Bacteria | 2046 |
| 403 | Ga0207702_10196561 | 3300026078 | Bacteria | 1867 |
| 404 | Ga0207641_10000160 | 3300026088 | Bacteria | 95407 |
| 405 | Ga0207641_10200544 | 3300026088 | Bacteria | 1839 |
| 406 | Ga0207641_10296121 | 3300026088 | Bacteria | 1527 |
| 407 | Ga0207641_10481912 | 3300026088 | Bacteria | 1202 |
| 408 | Ga0207648_10134622 | 3300026089 | Bacteria | 2176 |
| 409 | Ga0207648_10157664 | 3300026089 | Bacteria | 2004 |
| 410 | Ga0207676_10000375 | 3300026095 | Bacteria | 38069 |
| 411 | Ga0207676_10385140 | 3300026095 | Bacteria | 1306 |
| 412 | Ga0207674_10031884 | 3300026116 | Bacteria | 5532 |
| 413 | Ga0207674_10049513 | 3300026116 | Bacteria | 4297 |
| 414 | Ga0207674_10121839 | 3300026116 | Bacteria | 2575 |
| 415 | Ga0207674_10386736 | 3300026116 | Bacteria | 1352 |
| 416 | Ga0207674_10591405 | 3300026116 | Bacteria | 1072 |
| 417 | Ga0207675_100008841 | 3300026118 | Bacteria | 9452 |
| 418 | Ga0207675_100059146 | 3300026118 | Bacteria | 3576 |
| 419 | Ga0207675_100444674 | 3300026118 | Bacteria | 1284 |
| 420 | Ga0207683_10009099 | 3300026121 | Bacteria | 8465 |
| 421 | Ga0207683_10027341 | 3300026121 | Bacteria | 4929 |
| 422 | Ga0209981_1000501 | 3300027378 | Bacteria | 4989 |
| 423 | Ga0207428_10007141 | 3300027907 | Bacteria | 10218 |
| 424 | Ga0207428_10084960 | 3300027907 | Bacteria | 2465 |
| 425 | Ga0207428_10264931 | 3300027907 | Bacteria | 1279 |
| 426 | Ga0207428_10337781 | 3300027907 | Bacteria | 1110 |
| 427 | Ga0268266_10331239 | 3300028379 | Bacteria | 1427 |
| 428 | Ga0268265_10006267 | 3300028380 | Bacteria | 8057 |
| 429 | Ga0268265_10011714 | 3300028380 | Bacteria | 5930 |
| 430 | Ga0268265_10031043 | 3300028380 | Bacteria | 3855 |
| 431 | Ga0268265_10067990 | 3300028380 | Unclassified | 2760 |
| 432 | Ga0268265_10224239 | 3300028380 | Bacteria | 1647 |
| 433 | Ga0268265_10374729 | 3300028380 | Bacteria | 1307 |
| 434 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 435 | Ga0268264_10195286 | 3300028381 | Bacteria | 1847 |
| 436 | Ga0268264_10754189 | 3300028381 | Bacteria | 970 |
| 437 | Ga0265334_10006434 | 3300028573 | Bacteria | 5058 |
| 438 | Ga0265334_10068347 | 3300028573 | Bacteria | 1327 |
| 439 | Ga0265318_10025807 | 3300028577 | Bacteria | 2317 |
| 440 | Ga0307517_10127623 | 3300028786 | Bacteria | 1848 |
| 441 | Ga0307515_10286314 | 3300028794 | Bacteria | 1349 |
| 442 | Ga0265338_10020456 | 3300028800 | Bacteria | 6960 |
| 443 | Ga0265338_10021228 | 3300028800 | Bacteria | 6782 |
| 444 | Ga0265338_10022862 | 3300028800 | Bacteria | 6451 |
| 445 | Ga0265338_10044555 | 3300028800 | Bacteria | 4095 |
| 446 | Ga0265338_10143331 | 3300028800 | Bacteria | 1868 |
| 447 | Ga0307511_10025571 | 3300030521 | Bacteria | 5436 |
| 448 | Ga0265332_10000535 | 3300031238 | Bacteria | 25809 |
| 449 | Ga0265325_10002369 | 3300031241 | Bacteria | 12747 |
| 450 | Ga0265329_10033233 | 3300031242 | Bacteria | 1668 |
| 451 | Ga0265340_10003508 | 3300031247 | Bacteria | 8827 |
| 452 | Ga0265340_10079674 | 3300031247 | Bacteria | 1543 |
| 453 | Ga0265340_10167149 | 3300031247 | Bacteria | 997 |
| 454 | Ga0265339_10002291 | 3300031249 | Bacteria | 13811 |
| 455 | Ga0265339_10005076 | 3300031249 | Bacteria | 8843 |
| 456 | Ga0265339_10005282 | 3300031249 | Bacteria | 8613 |
| 457 | Ga0265331_10015628 | 3300031250 | Bacteria | 4003 |
| 458 | Ga0265327_10000054 | 3300031251 | Bacteria | 250337 |
| 459 | Ga0265327_10000190 | 3300031251 | Bacteria | 130086 |
| 460 | Ga0265327_10004615 | 3300031251 | Bacteria | 12107 |
| 461 | Ga0265327_10071826 | 3300031251 | Bacteria | 1730 |
| 462 | Ga0265327_10203634 | 3300031251 | Bacteria | 895 |
| 463 | Ga0265316_10013043 | 3300031344 | Bacteria | 7413 |
| 464 | Ga0307513_10014691 | 3300031456 | Bacteria | 9529 |
| 465 | Ga0307513_10155963 | 3300031456 | Bacteria | 2183 |
| 466 | Ga0265313_10000116 | 3300031595 | Bacteria | 80097 |
| 467 | Ga0265313_10000183 | 3300031595 | Bacteria | 66629 |
| 468 | Ga0307508_10060187 | 3300031616 | Bacteria | 3359 |
| 469 | Ga0307508_10100583 | 3300031616 | Bacteria | 2486 |
| 470 | Ga0265314_10004504 | 3300031711 | Bacteria | 12906 |
| 471 | Ga0265314_10007258 | 3300031711 | Bacteria | 9630 |
| 472 | Ga0265314_10024611 | 3300031711 | Bacteria | 4562 |
| 473 | Ga0265314_10036586 | 3300031711 | Bacteria | 3566 |
| 474 | Ga0265314_10090235 | 3300031711 | Bacteria | 1997 |
| 475 | Ga0265342_10000011 | 3300031712 | Bacteria | 208435 |
| 476 | Ga0316576_10107675 | 3300031727 | Bacteria | 2088 |
| 477 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 478 | Ga0307516_10248986 | 3300031730 | Bacteria | 1472 |
| 479 | Ga0307405_10045036 | 3300031731 | Bacteria | 2701 |
| 480 | Ga0307413_10137086 | 3300031824 | Bacteria | 1684 |
| 481 | Ga0307413_10219368 | 3300031824 | Bacteria | 1388 |
| 482 | Ga0307413_10260538 | 3300031824 | Bacteria | 1292 |
| 483 | Ga0307410_10106049 | 3300031852 | Bacteria | 2024 |
| 484 | Ga0307407_10199576 | 3300031903 | Bacteria | 1340 |
| 485 | Ga0307409_100229211 | 3300031995 | Bacteria | 1683 |
| 486 | Ga0307416_100497318 | 3300032002 | Bacteria | 1283 |
| 487 | Ga0307414_10091171 | 3300032004 | Bacteria | 2264 |
| 488 | Ga0307414_10416830 | 3300032004 | Bacteria | 1170 |
| 489 | Ga0307414_10456584 | 3300032004 | Bacteria | 1122 |
| 490 | Ga0307411_10131431 | 3300032005 | Bacteria | 1830 |
| 491 | Ga0307411_10157678 | 3300032005 | Bacteria | 1695 |
| 492 | Ga0307411_10339649 | 3300032005 | Bacteria | 1220 |
| 493 | Ga0316583_10000712 | 3300032133 | Bacteria | 10310 |
| 494 | Ga0316583_10046548 | 3300032133 | Bacteria | 1531 |
| 495 | Ga0307510_10056928 | 3300033180 | Bacteria | 4065 |
| 496 | Ga0373948_0044476 | 3300034817 | Bacteria | 939 |
| 497 | Ga0373958_0022235 | 3300034819 | Bacteria | 1183 |
| 498 | Ga0373928_0022630 | 3300035084 | Bacteria | 1334 |
| 499 | Ga0373928_0023704 | 3300035084 | Bacteria | 1311 |
| 500 | Ga0373940_0066669 | 3300035088 | Bacteria | 1040 |
| 501 | Ga0373944_0024197 | 3300035089 | Bacteria | 1778 |
| 502 | Ga0373949_0020589 | 3300035090 | Bacteria | 1511 |
| 503 | Ga0373951_0080872 | 3300035091 | Bacteria | 841 |
| 504 | Ga0373923_0145113 | 3300035111 | Bacteria | 1075 |
| 505 | Ga0373932_0010736 | 3300035112 | Bacteria | 2223 |
| 506 | Ga0373941_0103506 | 3300035115 | Bacteria | 994 |
| 507 | Ga0373945_0005510 | 3300035116 | Bacteria | 4053 |
| 508 | Ga0373956_0094151 | 3300035119 | Bacteria | 1384 |
| 509 | Ga0373943_0239082 | 3300035170 | Bacteria | 1017 |
| 510 | Ga0373946_0006872 | 3300035171 | Bacteria | 4143 |
| 511 | Ga0373946_0011339 | 3300035171 | Bacteria | 3323 |
| 512 | Ga0373955_0171615 | 3300035172 | Bacteria | 1284 |
| 513 | Ga0373955_0277100 | 3300035172 | Bacteria | 1009 |
| 514 | Ga0373931_0014133 | 3300035691 | Bacteria | 3898 |
| 515 | Ga0373931_0045000 | 3300035691 | Bacteria | 2329 |
| 516 | Ga0373931_0080049 | 3300035691 | Bacteria | 1801 |
| 517 | Ga0373935_0350407 | 3300035692 | Bacteria | 1052 |
| 518 | Ga0373927_0036738 | 3300035695 | Bacteria | 3184 |
| 519 | Ga0373927_0245304 | 3300035695 | Bacteria | 1177 |
| 520 | Ga0373947_0044945 | 3300035725 | Bacteria | 2642 |
| 521 | Ga0373947_0084690 | 3300035725 | Bacteria | 1968 |
| 522 | Ga0373947_0090790 | 3300035725 | Bacteria | 1905 |
| 523 | Ga0373937_0006315 | 3300036401 | Bacteria | 10219 |
| 524 | Ga0373937_0173087 | 3300036401 | Bacteria | 2026 |
| 525 | Ga0316584_0050930 | 3300036712 | Bacteria | 3096 |
| 526 | Ga0316584_0103663 | 3300036712 | Bacteria | 2129 |
| 527 | Ga0373925_0099950 | 3300037068 | Bacteria | 2228 |
| 528 | Ga0373925_0105806 | 3300037068 | Bacteria | 2168 |
| 529 | Ga0373925_0604110 | 3300037068 | Bacteria | 903 |
| 530 | Ga0395899_0000070 | 3300037312 | Bacteria | 189668 |
| 531 | Ga0395899_0121527 | 3300037312 | Bacteria | 1870 |
| 532 | Ga0395900_0000128 | 3300037418 | Bacteria | 127446 |
| 533 | Ga0395900_0034389 | 3300037418 | Bacteria | 5218 |
| 534 | Ga0395900_0177445 | 3300037418 | Bacteria | 2166 |
| 535 | Ga0395900_0235095 | 3300037418 | Bacteria | 1841 |
| 536 | Ga0395898_0185201 | 3300037466 | Bacteria | 1989 |
| 537 | Ga0395898_0675117 | 3300037466 | Bacteria | 975 |
| 538 | Ga0395905_0038497 | 3300037471 | Bacteria | 4488 |
| 539 | Ga0395905_0417347 | 3300037471 | Bacteria | 1238 |
| 540 | Ga0436364_0013783 | 3300037853 | Bacteria | 29941 |
| 541 | Ga0436364_0186560 | 3300037853 | Bacteria | 2805 |
| 542 | Ga0436364_0382668 | 3300037853 | Bacteria | 4228 |
| 543 | Ga0436364_0955256 | 3300037853 | Bacteria | 35556 |
| 544 | Ga0436364_1026771 | 3300037853 | Bacteria | 10513 |
| 545 | Ga0436364_1438211 | 3300037853 | Bacteria | 1326 |
| 546 | Ga0395901_0000225 | 3300038443 | Bacteria | 70878 |
| 547 | Ga0395901_0001835 | 3300038443 | Bacteria | 21949 |
| 548 | Ga0395901_0017625 | 3300038443 | Bacteria | 7292 |
| 549 | Ga0395901_0133080 | 3300038443 | Bacteria | 2613 |
| 550 | Ga0436365_0029939 | 3300039437 | Bacteria | 3270 |
| 551 | Ga0436365_0316565 | 3300039437 | Bacteria | 4011 |
| 552 | Ga0436365_0525757 | 3300039437 | Bacteria | 2335 |
| 553 | Ga0436365_0742782 | 3300039437 | Bacteria | 1270 |
| 554 | Ga0436365_1136540 | 3300039437 | Bacteria | 40433 |
| 555 | Ga0436365_1830840 | 3300039437 | Bacteria | 45078 |
| 556 | Ga0436360_0157856 | 3300039438 | Bacteria | 21123 |
| 557 | Ga0436360_1273015 | 3300039438 | Bacteria | 1851 |
| 558 | Ga0436361_0092439 | 3300039447 | Bacteria | 1517 |
| 559 | Ga0436361_0217171 | 3300039447 | Bacteria | 1775 |
| 560 | Ga0436361_0235144 | 3300039447 | Bacteria | 2839 |
| 561 | Ga0436361_0348195 | 3300039447 | Bacteria | 1485 |
| 562 | Ga0436361_0525734 | 3300039447 | Bacteria | 37715 |
| 563 | Ga0436361_0722234 | 3300039447 | Bacteria | 1205 |
| 564 | Ga0436361_0736152 | 3300039447 | Bacteria | 1222 |
| 565 | Ga0436361_0839114 | 3300039447 | Bacteria | 1258 |
| 566 | Ga0436363_0339486 | 3300039450 | Bacteria | 1456 |
| 567 | Ga0436363_0930428 | 3300039450 | Bacteria | 4099 |
| 568 | Ga0436363_1129020 | 3300039450 | Bacteria | 946 |
| 569 | Ga0436363_1143576 | 3300039450 | Bacteria | 4251 |
| 570 | Ga0436362_0302375 | 3300039453 | Bacteria | 12952 |
| 571 | Ga0436362_0694438 | 3300039453 | Bacteria | 2474 |
| 572 | Ga0436362_0697649 | 3300039453 | Bacteria | 1196 |
| 573 | Ga0436362_0900943 | 3300039453 | Bacteria | 2378 |
| 574 | Ga0436362_1201384 | 3300039453 | Bacteria | 1352 |
| 575 | Ga0439453_0017902 | 3300041408 | Bacteria | 1248 |
| 576 | Ga0439465_0016110 | 3300041413 | Bacteria | 2331 |
| 577 | Ga0439445_0008563 | 3300042004 | Bacteria | 2396 |
| 578 | Ga0439445_0016409 | 3300042004 | Bacteria | 1822 |
| 579 | Ga0439448_0096077 | 3300042005 | Bacteria | 1004 |
| 580 | Ga0451577_0053495 | 3300042876 | Bacteria | 3604 |
| 581 | Ga0451577_0355087 | 3300042876 | Bacteria | 1330 |
| 582 | Ga0453683_0506275 | 3300044673 | Bacteria | 784 |
| 583 | Ga0466966_0013591 | 3300044684 | Bacteria | 5385 |
| 584 | Ga0466966_0111882 | 3300044684 | Bacteria | 1683 |
| 585 | Ga0466963_0095857 | 3300044694 | Bacteria | 2026 |
| 586 | Ga0466963_0196059 | 3300044694 | Bacteria | 1412 |
| 587 | Ga0453684_0005311 | 3300044712 | Bacteria | 25685 |
| 588 | Ga0453684_0025337 | 3300044712 | Bacteria | 8617 |
| 589 | Ga0453684_0293152 | 3300044712 | Bacteria | 1852 |
| 590 | Ga0466960_0173997 | 3300044901 | Bacteria | 1163 |
| 591 | Ga0466959_0002189 | 3300045049 | Bacteria | 12429 |
| 592 | Ga0466959_0017658 | 3300045049 | Bacteria | 5232 |
| 593 | Ga0451576_0009668 | 3300045051 | Bacteria | 11155 |
| 594 | Ga0451576_0526043 | 3300045051 | Bacteria | 1242 |
| 595 | Ga0495617_151033 | 3300046452 | Bacteria | 739 |
| 596 | Ga0495603_0129734 | 3300046455 | Bacteria | 1468 |
| 597 | Ga0495629_0030687 | 3300046459 | Bacteria | 3809 |
| 598 | Ga0495651_0204340 | 3300046462 | Bacteria | 1380 |
| 599 | Ga0495580_0105332 | 3300046472 | Bacteria | 1960 |
| 600 | Ga0495582_0032586 | 3300046473 | Bacteria | 2865 |
| 601 | Ga0495605_0066289 | 3300046474 | Bacteria | 1716 |
| 602 | Ga0495662_0065385 | 3300046476 | Bacteria | 1758 |
| 603 | Ga0495664_0275482 | 3300046477 | Bacteria | 1017 |
| 604 | Ga0495584_0006976 | 3300046491 | Bacteria | 5900 |
| 605 | Ga0495584_0137124 | 3300046491 | Bacteria | 1242 |
| 606 | Ga0495594_0089846 | 3300046499 | Bacteria | 1721 |
| 607 | Ga0495607_0082480 | 3300046501 | Bacteria | 1764 |
| 608 | Ga0495583_0106877 | 3300046506 | Bacteria | 1189 |
| 609 | Ga0495606_0056869 | 3300046507 | Bacteria | 2522 |
| 610 | Ga0495616_0152338 | 3300046513 | Bacteria | 1045 |
| 611 | Ga0495618_0083823 | 3300046514 | Bacteria | 2036 |
| 612 | Ga0495620_0044994 | 3300046515 | Bacteria | 1915 |
| 613 | Ga0495630_0323263 | 3300046517 | Bacteria | 1179 |
| 614 | Ga0495631_0120716 | 3300046518 | Bacteria | 1127 |
| 615 | Ga0495637_0010029 | 3300046520 | Bacteria | 4601 |
| 616 | Ga0495637_0124954 | 3300046520 | Bacteria | 987 |
| 617 | Ga0495643_0036969 | 3300046522 | Bacteria | 2680 |
| 618 | Ga0495643_0117134 | 3300046522 | Bacteria | 1349 |
| 619 | Ga0495644_0029126 | 3300046523 | Bacteria | 2087 |
| 620 | Ga0495666_0009590 | 3300046526 | Bacteria | 4840 |
| 621 | Ga0495654_0031099 | 3300046530 | Bacteria | 2711 |
| 622 | Ga0495665_0030883 | 3300046531 | Bacteria | 2866 |
| 623 | Ga0495665_0058095 | 3300046531 | Bacteria | 2043 |
| 624 | Ga0495640_0047961 | 3300046533 | Bacteria | 2954 |
| 625 | Ga0495586_0149863 | 3300046535 | Bacteria | 1312 |
| 626 | Ga0495587_0191124 | 3300046536 | Bacteria | 1159 |
| 627 | Ga0495598_0000412 | 3300046537 | Bacteria | 7686 |
| 628 | Ga0495609_0147653 | 3300046538 | Bacteria | 1001 |
| 629 | Ga0495621_0022276 | 3300046539 | Bacteria | 2098 |
| 630 | Ga0495597_0003340 | 3300046542 | Bacteria | 9456 |
| 631 | Ga0495622_0002993 | 3300046557 | Bacteria | 8021 |
| 632 | Ga0495667_0085752 | 3300046559 | Bacteria | 2044 |
| 633 | Ga0495656_0003218 | 3300046615 | Bacteria | 5508 |
| 634 | Ga0495668_0033575 | 3300046616 | Bacteria | 2882 |
| 635 | Ga0495668_0118851 | 3300046616 | Bacteria | 1445 |
| 636 | Ga0495634_0078900 | 3300046642 | Bacteria | 2157 |
| 637 | Ga0495625_0370338 | 3300046660 | Bacteria | 901 |
| 638 | Ga0495659_0008319 | 3300046664 | Bacteria | 3303 |
| 639 | Ga0495661_0180792 | 3300046665 | Bacteria | 1118 |
| 640 | Ga0495588_0045800 | 3300046674 | Bacteria | 2243 |
| 641 | Ga0495657_0257678 | 3300046675 | Bacteria | 1049 |
| 642 | Ga0495658_0036189 | 3300046683 | Unclassified | 2722 |
| 643 | Ga0495658_0101707 | 3300046683 | Bacteria | 1716 |
| 644 | Ga0495658_0305393 | 3300046683 | Bacteria | 1007 |
| 645 | Ga0495658_0417816 | 3300046683 | Bacteria | 855 |
| 646 | Ga0495669_0000001 | 3300046684 | Bacteria | 291866 |
| 647 | Ga0495613_0171563 | 3300046689 | Bacteria | 1539 |
| 648 | Ga0495613_0248288 | 3300046689 | Bacteria | 1242 |
| 649 | Ga0495624_0011870 | 3300046690 | Bacteria | 5974 |
| 650 | Ga0495670_0010915 | 3300046691 | Bacteria | 4464 |
| 651 | Ga0495649_0060603 | 3300046694 | Bacteria | 2036 |
| 652 | Ga0495674_0291973 | 3300047319 | Bacteria | 1333 |
| 653 | Ga0495674_0334792 | 3300047319 | Bacteria | 1231 |
| 654 | Ga0495672_0000739 | 3300047320 | Bacteria | 35757 |
| 655 | Ga0495676_0211685 | 3300047321 | Bacteria | 1341 |
| 656 | Ga0495676_0333307 | 3300047321 | Unclassified | 1017 |
| 657 | Ga0495677_0046685 | 3300047445 | Bacteria | 1589 |
| 658 | Ga0495685_024034 | 3300047447 | Bacteria | 2098 |
| 659 | Ga0495684_0082641 | 3300047471 | Bacteria | 2436 |
| 660 | Ga0495686_0002708 | 3300047472 | Bacteria | 16223 |
| 661 | Ga0495686_0024345 | 3300047472 | Bacteria | 3980 |
| 662 | Ga0495593_0033310 | 3300047673 | Bacteria | 2806 |
| 663 | Ga0495593_0072136 | 3300047673 | Bacteria | 1793 |
| 664 | Ga0495602_0087653 | 3300048088 | Bacteria | 2594 |
| 665 | Ga0495614_0106855 | 3300048089 | Bacteria | 1227 |
| 666 | Ga0496101_0027324 | 3300048904 | Bacteria | 3975 |
| 667 | Ga0496101_0031882 | 3300048904 | Bacteria | 3707 |
| 668 | Ga0496101_0052513 | 3300048904 | Bacteria | 2939 |
| 669 | Ga0496101_0633755 | 3300048904 | Bacteria | 845 |
| 670 | Ga0496102_0055595 | 3300048905 | Bacteria | 3609 |
| 671 | Ga0496102_0274148 | 3300048905 | Bacteria | 1590 |
| 672 | Ga0496102_0404797 | 3300048905 | Bacteria | 1283 |
| 673 | Ga0496103_0001539 | 3300048906 | Bacteria | 15366 |
| 674 | Ga0496104_0003183 | 3300048907 | Bacteria | 14111 |
| 675 | Ga0496104_0006755 | 3300048907 | Bacteria | 10105 |
| 676 | Ga0496104_0079346 | 3300048907 | Bacteria | 3129 |
| 677 | Ga0496105_0000653 | 3300048908 | Bacteria | 23216 |
| 678 | Ga0496105_0003358 | 3300048908 | Bacteria | 11834 |
| 679 | Ga0496105_0019423 | 3300048908 | Bacteria | 5480 |
| 680 | Ga0496106_0004405 | 3300048909 | Bacteria | 10438 |
| 681 | Ga0496106_0051764 | 3300048909 | Bacteria | 3097 |
| 682 | Ga0496107_0021330 | 3300048910 | Bacteria | 4578 |
| 683 | Ga0496108_0004848 | 3300048911 | Bacteria | 10859 |
| 684 | Ga0496109_0001027 | 3300048912 | Bacteria | 23090 |
| 685 | Ga0496110_0011290 | 3300048913 | Bacteria | 7303 |
| 686 | Ga0496110_0018675 | 3300048913 | Bacteria | 5818 |
| 687 | Ga0496110_0030717 | 3300048913 | Bacteria | 4632 |
| 688 | Ga0496110_0090979 | 3300048913 | Bacteria | 2729 |
| 689 | Ga0496111_0076955 | 3300048914 | Bacteria | 2432 |
| 690 | Ga0496111_0389404 | 3300048914 | Bacteria | 1030 |
| 691 | Ga0496112_0000804 | 3300048915 | Bacteria | 22118 |
| 692 | Ga0496112_0059344 | 3300048915 | Bacteria | 3769 |
| 693 | Ga0496112_0465746 | 3300048915 | Bacteria | 1201 |
| 694 | Ga0496113_0001499 | 3300048916 | Bacteria | 13066 |
| 695 | Ga0496114_0021309 | 3300048917 | Bacteria | 5271 |
| 696 | Ga0496114_0030137 | 3300048917 | Bacteria | 4463 |
| 697 | Ga0496114_0211420 | 3300048917 | Bacteria | 1701 |
| 698 | Ga0496114_0383113 | 3300048917 | Bacteria | 1245 |
| 699 | Ga0496115_0004230 | 3300048918 | Bacteria | 10380 |
| 700 | Ga0496115_0088393 | 3300048918 | Bacteria | 2530 |
| 701 | Ga0496115_0263184 | 3300048918 | Bacteria | 1418 |
| 702 | Ga0496115_0407802 | 3300048918 | Bacteria | 1102 |
| 703 | Ga0496119_0002497 | 3300048922 | Bacteria | 20107 |
| 704 | Ga0496121_0254805 | 3300048924 | Bacteria | 1215 |
| 705 | Ga0496126_0010389 | 3300048929 | Bacteria | 9766 |
| 706 | Ga0496126_0278719 | 3300048929 | Bacteria | 1385 |
| 707 | Ga0496126_0569822 | 3300048929 | Bacteria | 896 |
| 708 | Ga0501031_0019630 | 3300049568 | Bacteria | 4402 |
| 709 | Ga0501031_0037957 | 3300049568 | Bacteria | 3144 |
| 710 | Ga0501032_0001016 | 3300049569 | Bacteria | 22671 |
| 711 | Ga0501032_0006036 | 3300049569 | Bacteria | 8938 |
| 712 | Ga0501032_0023092 | 3300049569 | Bacteria | 4305 |
| 713 | Ga0501032_0157399 | 3300049569 | Bacteria | 1492 |
| 714 | Ga0501033_0005237 | 3300049570 | Bacteria | 10295 |
| 715 | Ga0501033_0011204 | 3300049570 | Bacteria | 6868 |
| 716 | Ga0501033_0173782 | 3300049570 | Bacteria | 1547 |
| 717 | Ga0501033_0230645 | 3300049570 | Bacteria | 1315 |
| 718 | Ga0501034_0000244 | 3300049571 | Bacteria | 100222 |
| 719 | Ga0501034_0000623 | 3300049571 | Bacteria | 55353 |
| 720 | Ga0501034_0006211 | 3300049571 | Bacteria | 12862 |
| 721 | Ga0501034_0009574 | 3300049571 | Bacteria | 10139 |
| 722 | Ga0501034_0015930 | 3300049571 | Bacteria | 7715 |
| 723 | Ga0501034_0029889 | 3300049571 | Bacteria | 5538 |
| 724 | Ga0501034_0030592 | 3300049571 | Bacteria | 5472 |
| 725 | Ga0501034_0049229 | 3300049571 | Bacteria | 4252 |
| 726 | Ga0501034_0058001 | 3300049571 | Bacteria | 3892 |
| 727 | Ga0501034_0085320 | 3300049571 | Bacteria | 3159 |
| 728 | Ga0501034_0091153 | 3300049571 | Bacteria | 3046 |
| 729 | Ga0501034_0136565 | 3300049571 | Bacteria | 2433 |
| 730 | Ga0501034_0161820 | 3300049571 | Bacteria | 2209 |
| 731 | Ga0501034_0266304 | 3300049571 | Bacteria | 1655 |
| 732 | Ga0501034_0455552 | 3300049571 | Bacteria | 1197 |
| 733 | Ga0501034_0483485 | 3300049571 | Bacteria | 1153 |
| 734 | Ga0501034_0494303 | 3300049571 | Bacteria | 1137 |
| 735 | Ga0501034_0682207 | 3300049571 | Bacteria | 927 |
| 736 | Ga0501034_0689621 | 3300049571 | Bacteria | 920 |
| 737 | Ga0501036_0000402 | 3300049572 | Bacteria | 30483 |
| 738 | Ga0501036_0009704 | 3300049572 | Bacteria | 7923 |
| 739 | Ga0501036_0131876 | 3300049572 | Bacteria | 2109 |
| 740 | Ga0501036_0184419 | 3300049572 | Bacteria | 1756 |
| 741 | Ga0501036_0242745 | 3300049572 | Bacteria | 1510 |
| 742 | Ga0501036_0263206 | 3300049572 | Bacteria | 1444 |
| 743 | Ga0501036_0299640 | 3300049572 | Bacteria | 1345 |
| 744 | Ga0501036_0348569 | 3300049572 | Bacteria | 1236 |
| 745 | Ga0501037_0008825 | 3300049573 | Bacteria | 7386 |
| 746 | Ga0501037_0009635 | 3300049573 | Bacteria | 7087 |
| 747 | Ga0501037_0014018 | 3300049573 | Bacteria | 5905 |
| 748 | Ga0501037_0072271 | 3300049573 | Bacteria | 2509 |
| 749 | Ga0501037_0115814 | 3300049573 | Bacteria | 1929 |
| 750 | Ga0501037_0169540 | 3300049573 | Bacteria | 1552 |
| 751 | Ga0501037_0374783 | 3300049573 | Bacteria | 979 |
| 752 | Ga0501038_0004074 | 3300049574 | Bacteria | 13588 |
| 753 | Ga0501038_0012791 | 3300049574 | Bacteria | 7663 |
| 754 | Ga0501038_0021786 | 3300049574 | Bacteria | 5750 |
| 755 | Ga0501038_0035364 | 3300049574 | Bacteria | 4386 |
| 756 | Ga0501038_0100969 | 3300049574 | Bacteria | 2402 |
| 757 | Ga0501038_0151329 | 3300049574 | Bacteria | 1891 |
| 758 | Ga0501038_0481171 | 3300049574 | Bacteria | 951 |
| 759 | Ga0501038_0481291 | 3300049574 | Bacteria | 951 |
| 760 | Ga0501039_0107608 | 3300049575 | Bacteria | 2178 |
| 761 | Ga0501039_0306851 | 3300049575 | Bacteria | 1247 |
| 762 | Ga0501039_0320305 | 3300049575 | Bacteria | 1219 |
| 763 | Ga0501040_0004593 | 3300049576 | Bacteria | 8960 |
| 764 | Ga0501042_0022449 | 3300049578 | Bacteria | 4407 |
| 765 | Ga0501042_0185854 | 3300049578 | Bacteria | 1499 |
| 766 | Ga0501042_0198660 | 3300049578 | Bacteria | 1446 |
| 767 | Ga0501043_0001890 | 3300049579 | Bacteria | 17946 |
| 768 | Ga0501043_0032700 | 3300049579 | Bacteria | 4090 |
| 769 | Ga0501043_0076674 | 3300049579 | Bacteria | 2626 |
| 770 | Ga0501043_0179838 | 3300049579 | Bacteria | 1648 |
| 771 | Ga0501043_0365493 | 3300049579 | Bacteria | 1094 |
| 772 | Ga0501046_0035676 | 3300049580 | Bacteria | 4007 |
| 773 | Ga0501046_0081176 | 3300049580 | Bacteria | 2504 |
| 774 | Ga0501046_0170270 | 3300049580 | Bacteria | 1635 |
| 775 | Ga0501046_0256573 | 3300049580 | Bacteria | 1285 |
| 776 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 777 | Ga0501047_0006124 | 3300049581 | Bacteria | 11304 |
| 778 | Ga0501047_0008824 | 3300049581 | Bacteria | 9512 |
| 779 | Ga0501047_0009108 | 3300049581 | Bacteria | 9375 |
| 780 | Ga0501047_0019030 | 3300049581 | Bacteria | 6587 |
| 781 | Ga0501047_0020190 | 3300049581 | Bacteria | 6397 |
| 782 | Ga0501047_0048484 | 3300049581 | Bacteria | 4102 |
| 783 | Ga0501047_0121098 | 3300049581 | Bacteria | 2499 |
| 784 | Ga0501047_0288600 | 3300049581 | Bacteria | 1484 |
| 785 | Ga0501047_0636817 | 3300049581 | Bacteria | 886 |
| 786 | Ga0501048_0001467 | 3300049582 | Bacteria | 17883 |
| 787 | Ga0501048_0006405 | 3300049582 | Bacteria | 8948 |
| 788 | Ga0501048_0031281 | 3300049582 | Bacteria | 3850 |
| 789 | Ga0501067_0000137 | 3300049583 | Bacteria | 40123 |
| 790 | Ga0501067_0000637 | 3300049583 | Bacteria | 18857 |
| 791 | Ga0501067_0007532 | 3300049583 | Bacteria | 6050 |
| 792 | Ga0501067_0071752 | 3300049583 | Bacteria | 1918 |
| 793 | Ga0501067_0080972 | 3300049583 | Bacteria | 1800 |
| 794 | Ga0501067_0095780 | 3300049583 | Bacteria | 1648 |
| 795 | Ga0501067_0187574 | 3300049583 | Bacteria | 1151 |
| 796 | Ga0501068_0000436 | 3300049584 | Bacteria | 21206 |
| 797 | Ga0501068_0001773 | 3300049584 | Bacteria | 11475 |
| 798 | Ga0501068_0004997 | 3300049584 | Bacteria | 7221 |
| 799 | Ga0501068_0008618 | 3300049584 | Bacteria | 5682 |
| 800 | Ga0501068_0190503 | 3300049584 | Bacteria | 1299 |
| 801 | Ga0501068_0245350 | 3300049584 | Bacteria | 1140 |
| 802 | Ga0501070_0083324 | 3300049586 | Bacteria | 2647 |
| 803 | Ga0501070_0126211 | 3300049586 | Bacteria | 2115 |
| 804 | Ga0501070_0213504 | 3300049586 | Bacteria | 1583 |
| 805 | Ga0501070_0287230 | 3300049586 | Bacteria | 1341 |
| 806 | Ga0501070_0326225 | 3300049586 | Bacteria | 1248 |
| 807 | Ga0501071_0050273 | 3300049587 | Bacteria | 3003 |
| 808 | Ga0501071_0142607 | 3300049587 | Bacteria | 1784 |
| 809 | Ga0501071_0573494 | 3300049587 | Bacteria | 867 |
| 810 | Ga0501072_0013992 | 3300049588 | Bacteria | 6149 |
| 811 | Ga0501072_0042845 | 3300049588 | Bacteria | 3556 |
| 812 | Ga0501072_0116565 | 3300049588 | Bacteria | 2127 |
| 813 | Ga0501072_0371741 | 3300049588 | Bacteria | 1135 |
| 814 | Ga0501073_0000003 | 3300049589 | Bacteria | 294975 |
| 815 | Ga0501073_0000284 | 3300049589 | Bacteria | 33459 |
| 816 | Ga0501073_0003399 | 3300049589 | Bacteria | 11970 |
| 817 | Ga0501073_0019022 | 3300049589 | Bacteria | 4963 |
| 818 | Ga0501073_0047757 | 3300049589 | Bacteria | 3007 |
| 819 | Ga0501073_0098835 | 3300049589 | Bacteria | 2026 |
| 820 | Ga0501074_0015059 | 3300049590 | Bacteria | 5626 |
| 821 | Ga0501074_0083490 | 3300049590 | Bacteria | 2290 |
| 822 | Ga0501074_0264219 | 3300049590 | Bacteria | 1223 |
| 823 | Ga0501074_0383166 | 3300049590 | Bacteria | 997 |
| 824 | Ga0501075_0080363 | 3300049591 | Bacteria | 2468 |
| 825 | Ga0501076_0123319 | 3300049592 | Bacteria | 2098 |
| 826 | Ga0501076_0132604 | 3300049592 | Bacteria | 2021 |
| 827 | Ga0501077_0000016 | 3300049593 | Bacteria | 88500 |
| 828 | Ga0501077_0046830 | 3300049593 | Bacteria | 2747 |
| 829 | Ga0501077_0444866 | 3300049593 | Bacteria | 830 |
| 830 | Ga0501079_0007367 | 3300049741 | Bacteria | 8321 |
| 831 | Ga0501080_0000148 | 3300049742 | Bacteria | 50074 |
| 832 | Ga0501080_0000777 | 3300049742 | Bacteria | 25921 |
| 833 | Ga0501080_0000954 | 3300049742 | Bacteria | 23683 |
| 834 | Ga0501080_0012166 | 3300049742 | Bacteria | 7885 |
| 835 | Ga0501080_0036219 | 3300049742 | Bacteria | 4606 |
| 836 | Ga0501080_0402339 | 3300049742 | Bacteria | 1231 |
| 837 | Ga0501080_0405291 | 3300049742 | Bacteria | 1226 |
| 838 | Ga0501081_0039906 | 3300049743 | Bacteria | 3214 |
| 839 | Ga0501083_0001616 | 3300049744 | Bacteria | 15406 |
| 840 | Ga0501083_0005602 | 3300049744 | Bacteria | 8890 |
| 841 | Ga0501083_0006643 | 3300049744 | Bacteria | 8204 |
| 842 | Ga0501083_0021194 | 3300049744 | Bacteria | 4517 |
| 843 | Ga0501083_0221209 | 3300049744 | Bacteria | 1233 |
| 844 | Ga0501083_0270455 | 3300049744 | Bacteria | 1106 |
| 845 | Ga0501035_0000715 | 3300049822 | Bacteria | 35903 |
| 846 | Ga0501035_0053381 | 3300049822 | Bacteria | 3615 |
| 847 | Ga0501035_0054708 | 3300049822 | Bacteria | 3565 |
| 848 | Ga0501035_0150690 | 3300049822 | Bacteria | 2018 |
| 849 | Ga0501035_0238619 | 3300049822 | Bacteria | 1547 |
| 850 | Ga0501035_0337393 | 3300049822 | Bacteria | 1263 |
| 851 | Ga0501035_0396108 | 3300049822 | Bacteria | 1149 |
| 852 | Ga0501044_0001007 | 3300049823 | Bacteria | 33907 |
| 853 | Ga0501044_0002725 | 3300049823 | Bacteria | 20097 |
| 854 | Ga0501044_0003468 | 3300049823 | Bacteria | 17770 |
| 855 | Ga0501044_0045787 | 3300049823 | Bacteria | 4531 |
| 856 | Ga0501044_0105507 | 3300049823 | Bacteria | 2830 |
| 857 | Ga0501044_0173805 | 3300049823 | Bacteria | 2124 |
| 858 | Ga0501044_0187458 | 3300049823 | Bacteria | 2032 |
| 859 | Ga0501044_0269283 | 3300049823 | Bacteria | 1639 |
| 860 | Ga0501044_0279781 | 3300049823 | Bacteria | 1602 |
| 861 | Ga0501044_0360262 | 3300049823 | Bacteria | 1372 |
| 862 | Ga0501044_0399893 | 3300049823 | Bacteria | 1286 |
| 863 | Ga0501044_0573076 | 3300049823 | Bacteria | 1024 |
| 864 | Ga0501044_0788866 | 3300049823 | Bacteria | 830 |
| 865 | Ga0501045_0002871 | 3300049824 | Bacteria | 11773 |
| 866 | Ga0501045_0080562 | 3300049824 | Bacteria | 2401 |
| 867 | Ga0501045_0160963 | 3300049824 | Bacteria | 1671 |
| 868 | nmdc:mga03683_22577_c1 | 3300050489 | Bacteria | 2441 |
| 869 | nmdc:mga03n38_90280_c1 | 3300050490 | Bacteria | 1457 |
| 870 | nmdc:mga00v17_188552_c1 | 3300050491 | Bacteria | 1331 |
| 871 | nmdc:mga00v17_41055_c1 | 3300050491 | Bacteria | 2777 |
| 872 | nmdc:mga0yw44_275362_c1 | 3300050492 | Bacteria | 1124 |
| 873 | nmdc:mga0k408_11597_c2 | 3300050493 | Bacteria | 3488 |
| 874 | nmdc:mga0k408_66682_c1 | 3300050493 | Bacteria | 2097 |
| 875 | nmdc:mga06z11_255298_c1 | 3300050494 | Bacteria | 1033 |
| 876 | nmdc:mga06z11_56709_c1 | 3300050494 | Bacteria | 2027 |
| 877 | nmdc:mga07m45_29751_c1 | 3300050496 | Bacteria | 3023 |
| 878 | nmdc:mga05p37_1364_c1 | 3300050507 | Bacteria | 28406 |
| 879 | nmdc:mga05p37_1370_c1 | 3300050507 | Bacteria | 28331 |
| 880 | nmdc:mga05p37_415904_c1 | 3300050507 | Bacteria | 1566 |
| 881 | nmdc:mga05p37_43817_c1 | 3300050507 | Bacteria | 5505 |
| 882 | nmdc:mga05p37_59746_c1 | 3300050507 | Bacteria | 4694 |
| 883 | nmdc:mga05p37_726882_c1 | 3300050507 | Bacteria | 1098 |
| 884 | nmdc:mga09592_17705_c1 | 3300050508 | Bacteria | 5839 |
| 885 | nmdc:mga09592_17818_c1 | 3300050508 | Bacteria | 5819 |
| 886 | nmdc:mga09592_361626_c1 | 3300050508 | Bacteria | 1256 |
| 887 | nmdc:mga0qj67_123792_c1 | 3300050509 | Bacteria | 2092 |
| 888 | nmdc:mga0qj67_54837_c1 | 3300050509 | Bacteria | 3156 |
| 889 | nmdc:mga06r32_151_c1 | 3300050510 | Bacteria | 52848 |
| 890 | nmdc:mga06r32_23835_c1 | 3300050510 | Bacteria | 5670 |
| 891 | nmdc:mga06r32_50711_c1 | 3300050510 | Bacteria | 3969 |
| 892 | nmdc:mga08y16_170896_c1 | 3300050511 | Bacteria | 2258 |
| 893 | nmdc:mga08y16_194666_c1 | 3300050511 | Bacteria | 2102 |
| 894 | nmdc:mga08y16_207627_c1 | 3300050511 | Bacteria | 2029 |
| 895 | nmdc:mga08y16_86_c1 | 3300050511 | Bacteria | 78136 |
| 896 | nmdc:mga08y16_965277_c1 | 3300050511 | Bacteria | 834 |
| 897 | nmdc:mga0n895_127360_c1 | 3300050512 | Bacteria | 2570 |
| 898 | nmdc:mga0n895_160300_c1 | 3300050512 | Bacteria | 2281 |
| 899 | nmdc:mga0n895_98008_c1 | 3300050512 | Bacteria | 2938 |
| 900 | nmdc:mga0rr50_147851_c1 | 3300050513 | Bacteria | 1896 |
| 901 | nmdc:mga0rr50_56681_c1 | 3300050513 | Bacteria | 2928 |
| 902 | nmdc:mga0rr50_605984_c1 | 3300050513 | Bacteria | 934 |
| 903 | nmdc:mga08x19_4_c2 | 3300050514 | Bacteria | 202063 |
| 904 | nmdc:mga0a205_101195_c1 | 3300050515 | Bacteria | 2780 |
| 905 | nmdc:mga0a205_36209_c1 | 3300050515 | Bacteria | 4741 |
| 906 | nmdc:mga0a205_48308_c1 | 3300050515 | Bacteria | 4107 |
| 907 | nmdc:mga0a205_597394_c1 | 3300050515 | Bacteria | 957 |
| 908 | nmdc:mga0sz30_469_c1 | 3300050516 | Bacteria | 15301 |
| 909 | Ga0495612_0060917 | 3300053078 | Bacteria | 1563 |
| 910 | Ga0500635_0000080 | 3300053080 | Bacteria | 63214 |
| 911 | Ga0495595_0015517 | 3300053084 | Bacteria | 3250 |
| 912 | Ga0495619_0019642 | 3300053085 | Bacteria | 4297 |
| 913 | Ga0495619_0089895 | 3300053085 | Bacteria | 2078 |
| 914 | Ga0495619_0103208 | 3300053085 | Bacteria | 1942 |
| 915 | Ga0495619_0321850 | 3300053085 | Bacteria | 1070 |
| 916 | Ga0495619_0418340 | 3300053085 | Bacteria | 925 |
| 917 | Ga0500578_0119769 | 3300053086 | Bacteria | 1655 |
| 918 | Ga0500578_0154959 | 3300053086 | Bacteria | 1425 |
| 919 | Ga0500643_002563 | 3300053087 | Bacteria | 9261 |
| 920 | Ga0500643_009378 | 3300053087 | Bacteria | 3744 |
| 921 | Ga0500643_043611 | 3300053087 | Bacteria | 1307 |
| 922 | Ga0500646_0011647 | 3300053090 | Bacteria | 2263 |
| 923 | Ga0500647_0099551 | 3300053091 | Bacteria | 1388 |
| 924 | Ga0500583_0050564 | 3300053092 | Bacteria | 1928 |
| 925 | Ga0500651_0041785 | 3300053093 | Bacteria | 2890 |
| 926 | Ga0500651_0072450 | 3300053093 | Bacteria | 2142 |
| 927 | Ga0500566_0008660 | 3300053094 | Bacteria | 6017 |
| 928 | Ga0500566_0128903 | 3300053094 | Bacteria | 1356 |
| 929 | Ga0500641_0000281 | 3300053096 | Bacteria | 19016 |
| 930 | Ga0500641_0002911 | 3300053096 | Bacteria | 6073 |
| 931 | Ga0500641_0042425 | 3300053096 | Bacteria | 1843 |
| 932 | Ga0500654_072357 | 3300053099 | Bacteria | 1670 |
| 933 | Ga0500556_0061718 | 3300053104 | Bacteria | 1382 |
| 934 | Ga0500556_0099158 | 3300053104 | Bacteria | 1120 |
| 935 | Ga0500562_083394 | 3300053108 | Bacteria | 866 |
| 936 | Ga0500569_000298 | 3300053109 | Bacteria | 7944 |
| 937 | Ga0500595_002391 | 3300053119 | Bacteria | 9372 |
| 938 | Ga0500595_028795 | 3300053119 | Bacteria | 1891 |
| 939 | Ga0500607_132198 | 3300053121 | Bacteria | 1188 |
| 940 | Ga0500608_001366 | 3300053122 | Bacteria | 8732 |
| 941 | Ga0500614_007297 | 3300053123 | Bacteria | 2328 |
| 942 | Ga0500618_037128 | 3300053125 | Bacteria | 1127 |
| 943 | Ga0500628_044927 | 3300053129 | Bacteria | 1025 |
| 944 | Ga0500642_0171449 | 3300053130 | Bacteria | 1016 |
| 945 | Ga0500655_031147 | 3300053133 | Bacteria | 1028 |
| 946 | Ga0500658_0008025 | 3300053134 | Bacteria | 3902 |
| 947 | Ga0500658_0018884 | 3300053134 | Bacteria | 2590 |
| 948 | Ga0500559_0152059 | 3300053136 | Bacteria | 1087 |
| 949 | Ga0500573_0185731 | 3300053140 | Bacteria | 1114 |
| 950 | Ga0500590_008183 | 3300053148 | Bacteria | 5207 |
| 951 | Ga0500603_046359 | 3300053150 | Bacteria | 1176 |
| 952 | Ga0500604_0003297 | 3300053151 | Bacteria | 4346 |
| 953 | Ga0500604_0009823 | 3300053151 | Bacteria | 2551 |
| 954 | Ga0500604_0148306 | 3300053151 | Bacteria | 795 |
| 955 | Ga0500616_0013469 | 3300053153 | Bacteria | 4746 |
| 956 | Ga0500616_0034243 | 3300053153 | Bacteria | 2767 |
| 957 | Ga0500624_001445 | 3300053157 | Bacteria | 3852 |
| 958 | Ga0500634_0000087 | 3300053161 | Bacteria | 35438 |
| 959 | Ga0500638_058152 | 3300053162 | Bacteria | 1862 |
| 960 | Ga0500639_114379 | 3300053163 | Bacteria | 1307 |
| 961 | Ga0500636_0002254 | 3300053177 | Bacteria | 10696 |
| 962 | Ga0500637_0022327 | 3300053178 | Bacteria | 3446 |
| 963 | Ga0500637_0183722 | 3300053178 | Bacteria | 1197 |
| 964 | Ga0500576_019706 | 3300053725 | Bacteria | 3076 |
| 965 | Ga0500625_047661 | 3300053729 | Bacteria | 1992 |
| 966 | Ga0500609_000390 | 3300053731 | Bacteria | 6488 |
| 967 | Ga0500596_000190 | 3300053735 | Bacteria | 10041 |
| 968 | Ga0501084_0007012 | 3300054114 | Bacteria | 9288 |
| 969 | Ga0501084_0021772 | 3300054114 | Bacteria | 5346 |
| 970 | Ga0501084_0048484 | 3300054114 | Bacteria | 3556 |
| 971 | Ga0501084_0075497 | 3300054114 | Bacteria | 2824 |
| 972 | Ga0501084_0094788 | 3300054114 | Bacteria | 2506 |
| 973 | Ga0501084_0707123 | 3300054114 | Bacteria | 850 |
| 974 | Ga0587073_0031457 | 3300059492 | Bacteria | 1099 |
| 975 | Ga0501082_0004670 | 3300060353 | Bacteria | 11950 |
| 976 | Ga0501082_0006711 | 3300060353 | Bacteria | 9955 |
| 977 | Ga0501082_0195719 | 3300060353 | Bacteria | 1759 |
| 978 | Ga0501082_0492114 | 3300060353 | Bacteria | 1072 |
| 979 | Ga0501082_0496140 | 3300060353 | Bacteria | 1067 |
| 980 | Ga0501082_0657327 | 3300060353 | Bacteria | 917 |
| 981 | Ga0530510_0145921 | 3300061734 | Bacteria | 1745 |
| 982 | 2512033511 | 2511231221 | Bacteria | 6846400 |
| 983 | 2523470308 | 2523231067 | Bacteria | 5230452 |
| 984 | 2643756642 | 2643221547 | Bacteria | 4740017 |
| 985 | 2643911245 | 2643221580 | Bacteria | 3816678 |
| 986 | 2643964098 | 2643221591 | Bacteria | 4397626 |
| 987 | 2644001870 | 2643221598 | Bacteria | 4578346 |
| 988 | 2644085262 | 2643221614 | Bacteria | 4260023 |
| 989 | 2644342814 | 2643221661 | Bacteria | 4267604 |
| 990 | 2644366114 | 2643221666 | Bacteria | 4265935 |
| 991 | 2644410990 | 2643221674 | Bacteria | 3919126 |
| 992 | 2671692875 | 2671180139 | Bacteria | 4196045 |
| 993 | 2739350346 | 2738543031 | Bacteria | 5769731 |
| 994 | 2821449361 | 2821443989 | Bacteria | 7658172 |
| 995 | 2842333672 | 2842333319 | Bacteria | 8899485 |
| 996 | 2844533636 | 2844533157 | Bacteria | 7517899 |
| 997 | 2883578858 | 2883577096 | Bacteria | 4709178 |
| 998 | 2894777576 | 2894772417 | Bacteria | 5305674 |
| 999 | 2894819717 | 2894817345 | Bacteria | 4892941 |
| 1000 | 2897804328 | 2897803580 | Bacteria | 7000062 |
| 1001 | 2909401678 | 2909399089 | Bacteria | 3922598 |
| 1002 | 2929201504 | 2929199973 | Bacteria | 7260745 |
| 1003 | 2932403861 | 2932401849 | Bacteria | 4262978 |
| 1004 | 8054004926 | 8054002106 | Bacteria | 7987183 |
| 1005 | 8055915707 | 8055909800 | Bacteria | 7278581 |
| 1006 | Ga0075365_10165338 | |||
| 1007 | JGI25153J46596_10000054 | |||
| 1008 | JGI25153J46596_10005338 | |||
| 1009 | rootH1_10164059 | |||
| 1010 | rootH2_10052210 | |||
| 1011 | rootL2_10218209 | |||
| 1012 | rootH1_10219969 | |||
| 1013 | Ga0055530_10000135 | |||
| 1014 | Ga0055531_10040955 | |||
| 1015 | Ga0055531_10042648 | |||
| 1016 | JGI25405J52794_10026189 | |||
| 1017 | Ga0065165_1000563 | |||
| 1018 | Ga0065704_10171961 | |||
| 1019 | Ga0065704_10204155 | |||
| 1020 | Ga0065715_10166128 | |||
| 1021 | Ga0070658_10000059 | |||
| 1022 | Ga0070658_10008345 | |||
| 1023 | Ga0070658_10026519 | |||
| 1024 | Ga0070658_10185814 | |||
| 1025 | Ga0070676_10007291 | |||
| 1026 | Ga0070676_10016919 | |||
| 1027 | Ga0070683_100023828 | |||
| 1028 | Ga0070690_100150919 | |||
| 1029 | Ga0070670_100004475 | |||
| 1030 | Ga0070670_100151241 | |||
| 1031 | Ga0070677_10017189 | |||
| 1032 | Ga0068869_100009547 | |||
| 1033 | Ga0070666_10070550 | |||
| 1034 | Ga0070680_100012557 | |||
| 1035 | Ga0070680_100015196 | |||
| 1036 | Ga0070680_100054683 | |||
| 1037 | Ga0070680_100069381 | |||
| 1038 | Ga0070680_100085886 | |||
| 1039 | Ga0070682_100392218 | |||
| 1040 | Ga0068868_100803488 | |||
| 1041 | Ga0070660_100048416 | |||
| 1042 | Ga0070689_100021631 | |||
| 1043 | Ga0070689_100187038 | |||
| 1044 | Ga0070689_100310547 | |||
| 1045 | Ga0070691_10052485 | |||
| 1046 | Ga0070691_10333279 | |||
| 1047 | Ga0070661_100006288 | |||
| 1048 | Ga0070661_100075453 | |||
| 1049 | Ga0070668_100005964 | |||
| 1050 | Ga0070668_100064590 | |||
| 1051 | Ga0070668_100117910 | |||
| 1052 | Ga0070668_100219341 | |||
| 1053 | Ga0070668_100339965 | |||
| 1054 | Ga0070669_100010472 | |||
| 1055 | Ga0070669_100339713 | |||
| 1056 | Ga0070675_100203670 | |||
| 1057 | Ga0070671_100103151 | |||
| 1058 | Ga0070673_100344741 | |||
| 1059 | Ga0070688_100004472 | |||
| 1060 | Ga0070688_100048736 | |||
| 1061 | Ga0070688_100237137 | |||
| 1062 | Ga0070659_100053819 | |||
| 1063 | Ga0070659_100143047 | |||
| 1064 | Ga0070667_100226114 | |||
| 1065 | Ga0070709_10013740 | |||
| 1066 | Ga0070709_10068208 | |||
| 1067 | Ga0070714_100000490 | |||
| 1068 | Ga0070713_100000278 | |||
| 1069 | Ga0070713_100092449 | |||
| 1070 | Ga0070713_100461690 | |||
| 1071 | Ga0070710_10003676 | |||
| 1072 | Ga0070710_10004304 | |||
| 1073 | Ga0070701_10177097 | |||
| 1074 | Ga0070711_100003976 | |||
| 1075 | Ga0070711_100053143 | |||
| 1076 | Ga0070700_100451148 | |||
| 1077 | Ga0070678_100017547 | |||
| 1078 | Ga0070678_100021018 | |||
| 1079 | Ga0070678_100216832 | |||
| 1080 | Ga0070681_10006100 | |||
| 1081 | Ga0070681_10008082 | |||
| 1082 | Ga0070681_10044484 | |||
| 1083 | Ga0068867_100087828 | |||
| 1084 | Ga0070685_10004976 | |||
| 1085 | Ga0070685_10047083 | |||
| 1086 | Ga0070685_10129927 | |||
| 1087 | Ga0070699_100187786 | |||
| 1088 | Ga0070679_100032781 | |||
| 1089 | Ga0070684_100117049 | |||
| 1090 | Ga0070684_100266404 | |||
| 1091 | Ga0070697_100283296 | |||
| 1092 | Ga0068853_100005273 | |||
| 1093 | Ga0068853_100078999 | |||
| 1094 | Ga0068853_100341419 | |||
| 1095 | Ga0070672_100016229 | |||
| 1096 | Ga0070672_100153850 | |||
| 1097 | Ga0070672_100195947 | |||
| 1098 | Ga0070696_100069257 | |||
| 1099 | Ga0070696_100469248 | |||
| 1100 | Ga0070693_100003633 | |||
| 1101 | Ga0070665_100047432 | |||
| 1102 | Ga0070665_100318342 | |||
| 1103 | Ga0070665_100378526 | |||
| 1104 | Ga0070704_100346552 | |||
| 1105 | Ga0070704_100370403 | |||
| 1106 | Ga0070704_100446949 | |||
| 1107 | Ga0068855_100000009 | |||
| 1108 | Ga0068855_100000093 | |||
| 1109 | Ga0068855_100002770 | |||
| 1110 | Ga0068855_100079212 | |||
| 1111 | Ga0068855_100101153 | |||
| 1112 | Ga0068855_100214717 | |||
| 1113 | Ga0068855_100276319 | |||
| 1114 | Ga0070664_100671954 | |||
| 1115 | Ga0068857_100106220 | |||
| 1116 | Ga0068857_100585764 | |||
| 1117 | Ga0068857_100595835 | |||
| 1118 | Ga0068857_100942842 | |||
| 1119 | Ga0068854_100133504 | |||
| 1120 | Ga0068854_100290918 | |||
| 1121 | Ga0068854_100703289 | |||
| 1122 | Ga0068856_100014274 | |||
| 1123 | Ga0068856_100049571 | |||
| 1124 | Ga0068856_100081363 | |||
| 1125 | Ga0068856_100246423 | |||
| 1126 | Ga0070702_100429686 | |||
| 1127 | Ga0068852_100273793 | |||
| 1128 | Ga0068859_100021820 | |||
| 1129 | Ga0068859_100142510 | |||
| 1130 | Ga0068859_100206335 | |||
| 1131 | Ga0068864_100000154 | |||
| 1132 | Ga0068864_100041370 | |||
| 1133 | Ga0068861_100084612 | |||
| 1134 | Ga0068870_10102381 | |||
| 1135 | Ga0068863_100000172 | |||
| 1136 | Ga0068863_100254720 | |||
| 1137 | Ga0068858_100000639 | |||
| 1138 | Ga0068858_100166226 | |||
| 1139 | Ga0068858_100595772 | |||
| 1140 | Ga0068860_100000151 | |||
| 1141 | Ga0068860_100008879 | |||
| 1142 | Ga0068860_100011656 | |||
| 1143 | Ga0068860_100754858 | |||
| 1144 | Ga0068860_100902311 | |||
| 1145 | Ga0068862_100007610 | |||
| 1146 | Ga0068862_100014501 | |||
| 1147 | Ga0068862_100057627 | |||
| 1148 | Ga0068862_100263434 | |||
| 1149 | Ga0081455_10000347 | |||
| 1150 | Ga0081455_10000477 | |||
| 1151 | Ga0081455_10002412 | |||
| 1152 | Ga0081455_10012372 | |||
| 1153 | Ga0081455_10029489 | |||
| 1154 | Ga0081455_10046937 | |||
| 1155 | Ga0081455_10078322 | |||
| 1156 | Ga0081538_10001364 | |||
| 1157 | Ga0081540_1000015 | |||
| 1158 | Ga0081540_1004841 | |||
| 1159 | Ga0081540_1030763 | |||
| 1160 | Ga0081539_10005853 | |||
| 1161 | Ga0070717_10000297 | |||
| 1162 | Ga0070717_10124057 | |||
| 1163 | Ga0070717_10141223 | |||
| 1164 | Ga0070717_10420344 | |||
| 1165 | Ga0070717_10735450 | |||
| 1166 | Ga0075365_10030532 | |||
| 1167 | Ga0075363_100077948 | |||
| 1168 | Ga0075364_10157580 | |||
| 1169 | Ga0075364_10179402 | |||
| 1170 | Ga0070715_10005158 | |||
| 1171 | Ga0070712_100000896 | |||
| 1172 | Ga0070712_100015199 | |||
| 1173 | Ga0070712_100036096 | |||
| 1174 | Ga0075367_10026095 | |||
| 1175 | Ga0075367_10308272 | |||
| 1176 | Ga0075366_10027423 | |||
| 1177 | Ga0075366_10220123 | |||
| 1178 | Ga0097621_100397803 | |||
| 1179 | Ga0075370_10061817 | |||
| 1180 | Ga0075370_10062100 | |||
| 1181 | Ga0068871_100265200 | |||
| 1182 | Ga0075428_100000430 | |||
| 1183 | Ga0075428_100181493 | |||
| 1184 | Ga0075428_100214466 | |||
| 1185 | Ga0075428_100382111 | |||
| 1186 | Ga0075430_100128522 | |||
| 1187 | Ga0075431_100000086 | |||
| 1188 | Ga0075431_100019049 | |||
| 1189 | Ga0075431_100123707 | |||
| 1190 | Ga0075431_100360403 | |||
| 1191 | Ga0075433_10029411 | |||
| 1192 | Ga0075433_10071279 | |||
| 1193 | Ga0075433_10162923 | |||
| 1194 | Ga0075434_100018441 | |||
| 1195 | Ga0075434_100288912 | |||
| 1196 | Ga0075434_100788154 | |||
| 1197 | Ga0075429_100082076 | |||
| 1198 | Ga0075429_100326146 | |||
| 1199 | Ga0068865_100211830 | |||
| 1200 | Ga0097620_100021824 | |||
| 1201 | Ga0097620_100142526 | |||
| 1202 | Ga0097620_100206334 | |||
| 1203 | Ga0075435_100032914 | |||
| 1204 | Ga0075435_100213931 | |||
| 1205 | Ga0075435_100634722 | |||
| 1206 | Ga0099794_10000814 | |||
| 1207 | Ga0105240_10000094 | |||
| 1208 | Ga0105240_10001341 | |||
| 1209 | Ga0105240_10012709 | |||
| 1210 | Ga0105240_10091571 | |||
| 1211 | Ga0105240_10131409 | |||
| 1212 | Ga0105240_10299790 | |||
| 1213 | Ga0111539_10001374 | |||
| 1214 | Ga0111539_10019117 | |||
| 1215 | Ga0111539_10029219 | |||
| 1216 | Ga0111539_10054138 | |||
| 1217 | Ga0111539_10297775 | |||
| 1218 | Ga0111539_10779185 | |||
| 1219 | Ga0105245_10101542 | |||
| 1220 | Ga0114129_10000243 | |||
| 1221 | Ga0114129_10007283 | |||
| 1222 | Ga0114129_10013235 | |||
| 1223 | Ga0114129_10035725 | |||
| 1224 | Ga0114129_10184579 | |||
| 1225 | Ga0114129_10205921 | |||
| 1226 | Ga0105248_10024422 | |||
| 1227 | Ga0105248_10060900 | |||
| 1228 | Ga0105248_10065402 | |||
| 1229 | Ga0105237_10784813 | |||
| 1230 | Ga0105237_10972741 | |||
| 1231 | Ga0105238_10039621 | |||
| 1232 | Ga0105238_10118377 | |||
| 1233 | Ga0105238_10295610 | |||
| 1234 | Ga0105238_10822266 | |||
| 1235 | Ga0105238_11027720 | |||
| 1236 | Ga0105249_10109094 | |||
| 1237 | Ga0105249_10352395 | |||
| 1238 | Ga0105249_10383816 | |||
| 1239 | Ga0105249_10820214 | |||
| 1240 | Ga0105239_10243793 | |||
| 1241 | Ga0105239_11154845 | |||
| 1242 | Ga0105246_10296963 | |||
| 1243 | Ga0157371_10020758 | |||
| 1244 | Ga0157371_10223626 | |||
| 1245 | Ga0157370_10002875 | |||
| 1246 | Ga0157370_10011925 | |||
| 1247 | Ga0157370_10193886 | |||
| 1248 | Ga0157369_10196501 | |||
| 1249 | Ga0157369_10651347 | |||
| 1250 | Ga0157374_10006020 | |||
| 1251 | Ga0157374_11057301 | |||
| 1252 | Ga0157378_10113810 | |||
| 1253 | Ga0157378_10216303 | |||
| 1254 | Ga0157378_10242253 | |||
| 1255 | Ga0163162_10037368 | |||
| 1256 | Ga0163162_10385835 | |||
| 1257 | Ga0157372_10025787 | |||
| 1258 | Ga0157375_10053720 | |||
| 1259 | Ga0157375_11682575 | |||
| 1260 | Ga0163163_10019627 | |||
| 1261 | Ga0163163_10059375 | |||
| 1262 | Ga0163163_10918670 | |||
| 1263 | Ga0157380_10034981 | |||
| 1264 | Ga0157380_10096177 | |||
| 1265 | Ga0157380_10154705 | |||
| 1266 | Ga0157377_10024421 | |||
| 1267 | Ga0157377_10068405 | |||
| 1268 | Ga0157379_10427938 | |||
| 1269 | Ga0157376_10257362 | |||
| 1270 | Ga0157376_10359570 | |||
| 1271 | Ga0157376_10546622 | |||
| 1272 | Ga0163161_10091543 | |||
| 1273 | Ga0163161_10207866 | |||
| 1274 | Ga0213872_10003321 | |||
| 1275 | Ga0213872_10147704 | |||
| 1276 | Ga0213876_10000134 | |||
| 1277 | Ga0213876_10004326 | |||
| 1278 | Ga0213876_10112654 | |||
| 1279 | Ga0213875_10000007 | |||
| 1280 | Ga0213875_10002695 | |||
| 1281 | Ga0213875_10008291 | |||
| 1282 | Ga0213875_10086068 | |||
| 1283 | Ga0213875_10093515 | |||
| 1284 | Ga0213871_10001032 | |||
| 1285 | Ga0213871_10061498 | |||
| 1286 | Ga0209026_1001732 | |||
| 1287 | Ga0209026_1010008 | |||
| 1288 | Ga0209148_1009797 | |||
| 1289 | Ga0209758_1000119 | |||
| 1290 | Ga0209758_1000252 | |||
| 1291 | Ga0209758_1000682 | |||
| 1292 | Ga0209050_1000141 | |||
| 1293 | Ga0209050_1003817 | |||
| 1294 | Ga0207426_1026381 | |||
| 1295 | Ga0207426_1050950 | |||
| 1296 | Ga0207426_1053149 | |||
| 1297 | Ga0209257_1000190 | |||
| 1298 | Ga0209257_1000288 | |||
| 1299 | Ga0209257_1000562 | |||
| 1300 | Ga0207653_10010527 | |||
| 1301 | Ga0207682_10009231 | |||
| 1302 | Ga0207692_10001592 | |||
| 1303 | Ga0207642_10092372 | |||
| 1304 | Ga0207680_10095618 | |||
| 1305 | Ga0207680_10416950 | |||
| 1306 | Ga0207685_10002629 | |||
| 1307 | Ga0207699_10009773 | |||
| 1308 | Ga0207699_10035071 | |||
| 1309 | Ga0207645_10009341 | |||
| 1310 | Ga0207645_10281570 | |||
| 1311 | Ga0207643_10015054 | |||
| 1312 | Ga0207643_10152198 | |||
| 1313 | Ga0207705_10000195 | |||
| 1314 | Ga0207705_10144164 | |||
| 1315 | Ga0207705_10197352 | |||
| 1316 | Ga0207684_10022472 | |||
| 1317 | Ga0207707_10006763 | |||
| 1318 | Ga0207707_10049755 | |||
| 1319 | Ga0207707_10081952 | |||
| 1320 | Ga0207707_10093101 | |||
| 1321 | Ga0207707_10760750 | |||
| 1322 | Ga0207695_10000419 | |||
| 1323 | Ga0207695_10001861 | |||
| 1324 | Ga0207695_10385409 | |||
| 1325 | Ga0207695_10391725 | |||
| 1326 | Ga0207671_10356418 | |||
| 1327 | Ga0207693_10005248 | |||
| 1328 | Ga0207693_10045878 | |||
| 1329 | Ga0207663_10007163 | |||
| 1330 | Ga0207663_10242979 | |||
| 1331 | Ga0207663_10471939 | |||
| 1332 | Ga0207660_10043058 | |||
| 1333 | Ga0207660_10101300 | |||
| 1334 | Ga0207660_10124343 | |||
| 1335 | Ga0207660_10132914 | |||
| 1336 | Ga0207660_10185168 | |||
| 1337 | Ga0207657_10021183 | |||
| 1338 | Ga0207649_10397255 | |||
| 1339 | Ga0207652_10018761 | |||
| 1340 | Ga0207652_10281177 | |||
| 1341 | Ga0207646_10438762 | |||
| 1342 | Ga0207681_10040157 | |||
| 1343 | Ga0207681_10060574 | |||
| 1344 | Ga0207681_10306321 | |||
| 1345 | Ga0207694_10030714 | |||
| 1346 | Ga0207694_10120857 | |||
| 1347 | Ga0207650_10010512 | |||
| 1348 | Ga0207687_10182829 | |||
| 1349 | Ga0207700_10000380 | |||
| 1350 | Ga0207700_10121010 | |||
| 1351 | Ga0207700_10254317 | |||
| 1352 | Ga0207700_10679945 | |||
| 1353 | Ga0207664_10005464 | |||
| 1354 | Ga0207664_10008858 | |||
| 1355 | Ga0207664_10810576 | |||
| 1356 | Ga0207690_10379830 | |||
| 1357 | Ga0207706_10081394 | |||
| 1358 | Ga0207686_10150068 | |||
| 1359 | Ga0207670_10001178 | |||
| 1360 | Ga0207670_10002994 | |||
| 1361 | Ga0207670_10036512 | |||
| 1362 | Ga0207670_10161876 | |||
| 1363 | Ga0207670_10369997 | |||
| 1364 | Ga0207665_10034393 | |||
| 1365 | Ga0207665_10077328 | |||
| 1366 | Ga0207691_10079984 | |||
| 1367 | Ga0207691_10105100 | |||
| 1368 | Ga0207711_10021082 | |||
| 1369 | Ga0207711_10028623 | |||
| 1370 | Ga0207711_10073803 | |||
| 1371 | Ga0207689_10006787 | |||
| 1372 | Ga0207689_10309093 | |||
| 1373 | Ga0207679_10476363 | |||
| 1374 | Ga0207667_10000045 | |||
| 1375 | Ga0207667_10000588 | |||
| 1376 | Ga0207667_10005483 | |||
| 1377 | Ga0207667_10146786 | |||
| 1378 | Ga0207667_10177908 | |||
| 1379 | Ga0207667_10300231 | |||
| 1380 | Ga0207667_10304937 | |||
| 1381 | Ga0207667_10691039 | |||
| 1382 | Ga0207651_10004995 | |||
| 1383 | Ga0207651_10105642 | |||
| 1384 | Ga0207651_10113471 | |||
| 1385 | Ga0207712_10004918 | |||
| 1386 | Ga0207712_10172730 | |||
| 1387 | Ga0207712_10248547 | |||
| 1388 | Ga0207712_10332399 | |||
| 1389 | Ga0207668_10029854 | |||
| 1390 | Ga0207668_10459451 | |||
| 1391 | Ga0207668_10516854 | |||
| 1392 | Ga0207640_10110400 | |||
| 1393 | Ga0207658_10124226 | |||
| 1394 | Ga0207658_10178234 | |||
| 1395 | Ga0207677_10436448 | |||
| 1396 | Ga0207677_10497113 | |||
| 1397 | Ga0207703_10000289 | |||
| 1398 | Ga0207703_10444934 | |||
| 1399 | Ga0207703_10495861 | |||
| 1400 | Ga0207639_10236214 | |||
| 1401 | Ga0207678_10464079 | |||
| 1402 | Ga0207678_10790741 | |||
| 1403 | Ga0207708_10054966 | |||
| 1404 | Ga0207702_10062359 | |||
| 1405 | Ga0207702_10070400 | |||
| 1406 | Ga0207702_10117617 | |||
| 1407 | Ga0207702_10161501 | |||
| 1408 | Ga0207702_10196561 | |||
| 1409 | Ga0207641_10000160 | |||
| 1410 | Ga0207641_10200544 | |||
| 1411 | Ga0207641_10296121 | |||
| 1412 | Ga0207641_10481912 | |||
| 1413 | Ga0207648_10134622 | |||
| 1414 | Ga0207648_10157664 | |||
| 1415 | Ga0207676_10000375 | |||
| 1416 | Ga0207676_10385140 | |||
| 1417 | Ga0207674_10031884 | |||
| 1418 | Ga0207674_10049513 | |||
| 1419 | Ga0207674_10121839 | |||
| 1420 | Ga0207674_10386736 | |||
| 1421 | Ga0207674_10591405 | |||
| 1422 | Ga0207675_100008841 | |||
| 1423 | Ga0207675_100059146 | |||
| 1424 | Ga0207675_100444674 | |||
| 1425 | Ga0207683_10009099 | |||
| 1426 | Ga0207683_10027341 | |||
| 1427 | Ga0209981_1000501 | |||
| 1428 | Ga0207428_10007141 | |||
| 1429 | Ga0207428_10084960 | |||
| 1430 | Ga0207428_10264931 | |||
| 1431 | Ga0207428_10337781 | |||
| 1432 | Ga0268266_10331239 | |||
| 1433 | Ga0268265_10006267 | |||
| 1434 | Ga0268265_10011714 | |||
| 1435 | Ga0268265_10031043 | |||
| 1436 | Ga0268265_10067990 | |||
| 1437 | Ga0268265_10224239 | |||
| 1438 | Ga0268265_10374729 | |||
| 1439 | Ga0268264_10000046 | |||
| 1440 | Ga0268264_10195286 | |||
| 1441 | Ga0268264_10754189 | |||
| 1442 | Ga0265334_10006434 | |||
| 1443 | Ga0265334_10068347 | |||
| 1444 | Ga0265318_10025807 | |||
| 1445 | Ga0307517_10127623 | |||
| 1446 | Ga0307515_10286314 | |||
| 1447 | Ga0265338_10020456 | |||
| 1448 | Ga0265338_10021228 | |||
| 1449 | Ga0265338_10022862 | |||
| 1450 | Ga0265338_10044555 | |||
| 1451 | Ga0265338_10143331 | |||
| 1452 | Ga0307511_10025571 | |||
| 1453 | Ga0265332_10000535 | |||
| 1454 | Ga0265325_10002369 | |||
| 1455 | Ga0265329_10033233 | |||
| 1456 | Ga0265340_10003508 | |||
| 1457 | Ga0265340_10079674 | |||
| 1458 | Ga0265340_10167149 | |||
| 1459 | Ga0265339_10002291 | |||
| 1460 | Ga0265339_10005076 | |||
| 1461 | Ga0265339_10005282 | |||
| 1462 | Ga0265331_10015628 | |||
| 1463 | Ga0265327_10000054 | |||
| 1464 | Ga0265327_10000190 | |||
| 1465 | Ga0265327_10004615 | |||
| 1466 | Ga0265327_10071826 | |||
| 1467 | Ga0265327_10203634 | |||
| 1468 | Ga0265316_10013043 | |||
| 1469 | Ga0307513_10014691 | |||
| 1470 | Ga0307513_10155963 | |||
| 1471 | Ga0265313_10000116 | |||
| 1472 | Ga0265313_10000183 | |||
| 1473 | Ga0307508_10060187 | |||
| 1474 | Ga0307508_10100583 | |||
| 1475 | Ga0265314_10004504 | |||
| 1476 | Ga0265314_10007258 | |||
| 1477 | Ga0265314_10024611 | |||
| 1478 | Ga0265314_10036586 | |||
| 1479 | Ga0265314_10090235 | |||
| 1480 | Ga0265342_10000011 | |||
| 1481 | Ga0316576_10107675 | |||
| 1482 | Ga0307516_10000004 | |||
| 1483 | Ga0307516_10248986 | |||
| 1484 | Ga0307405_10045036 | |||
| 1485 | Ga0307413_10137086 | |||
| 1486 | Ga0307413_10219368 | |||
| 1487 | Ga0307413_10260538 | |||
| 1488 | Ga0307410_10106049 | |||
| 1489 | Ga0307407_10199576 | |||
| 1490 | Ga0307409_100229211 | |||
| 1491 | Ga0307416_100497318 | |||
| 1492 | Ga0307414_10091171 | |||
| 1493 | Ga0307414_10416830 | |||
| 1494 | Ga0307414_10456584 | |||
| 1495 | Ga0307411_10131431 | |||
| 1496 | Ga0307411_10157678 | |||
| 1497 | Ga0307411_10339649 | |||
| 1498 | Ga0316583_10000712 | |||
| 1499 | Ga0316583_10046548 | |||
| 1500 | Ga0307510_10056928 | |||
| 1501 | Ga0373948_0044476 | |||
| 1502 | Ga0373958_0022235 | |||
| 1503 | Ga0373928_0022630 | |||
| 1504 | Ga0373928_0023704 | |||
| 1505 | Ga0373940_0066669 | |||
| 1506 | Ga0373944_0024197 | |||
| 1507 | Ga0373949_0020589 | |||
| 1508 | Ga0373951_0080872 | |||
| 1509 | Ga0373923_0145113 | |||
| 1510 | Ga0373932_0010736 | |||
| 1511 | Ga0373941_0103506 | |||
| 1512 | Ga0373945_0005510 | |||
| 1513 | Ga0373956_0094151 | |||
| 1514 | Ga0373943_0239082 | |||
| 1515 | Ga0373946_0006872 | |||
| 1516 | Ga0373946_0011339 | |||
| 1517 | Ga0373955_0171615 | |||
| 1518 | Ga0373955_0277100 | |||
| 1519 | Ga0373931_0014133 | |||
| 1520 | Ga0373931_0045000 | |||
| 1521 | Ga0373931_0080049 | |||
| 1522 | Ga0373935_0350407 | |||
| 1523 | Ga0373927_0036738 | |||
| 1524 | Ga0373927_0245304 | |||
| 1525 | Ga0373947_0044945 | |||
| 1526 | Ga0373947_0084690 | |||
| 1527 | Ga0373947_0090790 | |||
| 1528 | Ga0373937_0006315 | |||
| 1529 | Ga0373937_0173087 | |||
| 1530 | Ga0316584_0050930 | |||
| 1531 | Ga0316584_0103663 | |||
| 1532 | Ga0373925_0099950 | |||
| 1533 | Ga0373925_0105806 | |||
| 1534 | Ga0373925_0604110 | |||
| 1535 | Ga0395899_0000070 | |||
| 1536 | Ga0395899_0121527 | |||
| 1537 | Ga0395900_0000128 | |||
| 1538 | Ga0395900_0034389 | |||
| 1539 | Ga0395900_0177445 | |||
| 1540 | Ga0395900_0235095 | |||
| 1541 | Ga0395898_0185201 | |||
| 1542 | Ga0395898_0675117 | |||
| 1543 | Ga0395905_0038497 | |||
| 1544 | Ga0395905_0417347 | |||
| 1545 | Ga0436364_0013783 | |||
| 1546 | Ga0436364_0186560 | |||
| 1547 | Ga0436364_0382668 | |||
| 1548 | Ga0436364_0955256 | |||
| 1549 | Ga0436364_1026771 | |||
| 1550 | Ga0436364_1438211 | |||
| 1551 | Ga0395901_0000225 | |||
| 1552 | Ga0395901_0001835 | |||
| 1553 | Ga0395901_0017625 | |||
| 1554 | Ga0395901_0133080 | |||
| 1555 | Ga0436365_0029939 | |||
| 1556 | Ga0436365_0316565 | |||
| 1557 | Ga0436365_0525757 | |||
| 1558 | Ga0436365_0742782 | |||
| 1559 | Ga0436365_1136540 | |||
| 1560 | Ga0436365_1830840 | |||
| 1561 | Ga0436360_0157856 | |||
| 1562 | Ga0436360_1273015 | |||
| 1563 | Ga0436361_0092439 | |||
| 1564 | Ga0436361_0217171 | |||
| 1565 | Ga0436361_0235144 | |||
| 1566 | Ga0436361_0348195 | |||
| 1567 | Ga0436361_0525734 | |||
| 1568 | Ga0436361_0722234 | |||
| 1569 | Ga0436361_0736152 | |||
| 1570 | Ga0436361_0839114 | |||
| 1571 | Ga0436363_0339486 | |||
| 1572 | Ga0436363_0930428 | |||
| 1573 | Ga0436363_1129020 | |||
| 1574 | Ga0436363_1143576 | |||
| 1575 | Ga0436362_0302375 | |||
| 1576 | Ga0436362_0694438 | |||
| 1577 | Ga0436362_0697649 | |||
| 1578 | Ga0436362_0900943 | |||
| 1579 | Ga0436362_1201384 | |||
| 1580 | Ga0439453_0017902 | |||
| 1581 | Ga0439465_0016110 | |||
| 1582 | Ga0439445_0008563 | |||
| 1583 | Ga0439445_0016409 | |||
| 1584 | Ga0439448_0096077 | |||
| 1585 | Ga0451577_0053495 | |||
| 1586 | Ga0451577_0355087 | |||
| 1587 | Ga0453683_0506275 | |||
| 1588 | Ga0466966_0013591 | |||
| 1589 | Ga0466966_0111882 | |||
| 1590 | Ga0466963_0095857 | |||
| 1591 | Ga0466963_0196059 | |||
| 1592 | Ga0453684_0005311 | |||
| 1593 | Ga0453684_0025337 | |||
| 1594 | Ga0453684_0293152 | |||
| 1595 | Ga0466960_0173997 | |||
| 1596 | Ga0466959_0002189 | |||
| 1597 | Ga0466959_0017658 | |||
| 1598 | Ga0451576_0009668 | |||
| 1599 | Ga0451576_0526043 | |||
| 1600 | Ga0495617_151033 | |||
| 1601 | Ga0495603_0129734 | |||
| 1602 | Ga0495629_0030687 | |||
| 1603 | Ga0495651_0204340 | |||
| 1604 | Ga0495580_0105332 | |||
| 1605 | Ga0495582_0032586 | |||
| 1606 | Ga0495605_0066289 | |||
| 1607 | Ga0495662_0065385 | |||
| 1608 | Ga0495664_0275482 | |||
| 1609 | Ga0495584_0006976 | |||
| 1610 | Ga0495584_0137124 | |||
| 1611 | Ga0495594_0089846 | |||
| 1612 | Ga0495607_0082480 | |||
| 1613 | Ga0495583_0106877 | |||
| 1614 | Ga0495606_0056869 | |||
| 1615 | Ga0495616_0152338 | |||
| 1616 | Ga0495618_0083823 | |||
| 1617 | Ga0495620_0044994 | |||
| 1618 | Ga0495630_0323263 | |||
| 1619 | Ga0495631_0120716 | |||
| 1620 | Ga0495637_0010029 | |||
| 1621 | Ga0495637_0124954 | |||
| 1622 | Ga0495643_0036969 | |||
| 1623 | Ga0495643_0117134 | |||
| 1624 | Ga0495644_0029126 | |||
| 1625 | Ga0495666_0009590 | |||
| 1626 | Ga0495654_0031099 | |||
| 1627 | Ga0495665_0030883 | |||
| 1628 | Ga0495665_0058095 | |||
| 1629 | Ga0495640_0047961 | |||
| 1630 | Ga0495586_0149863 | |||
| 1631 | Ga0495587_0191124 | |||
| 1632 | Ga0495598_0000412 | |||
| 1633 | Ga0495609_0147653 | |||
| 1634 | Ga0495621_0022276 | |||
| 1635 | Ga0495597_0003340 | |||
| 1636 | Ga0495622_0002993 | |||
| 1637 | Ga0495667_0085752 | |||
| 1638 | Ga0495656_0003218 | |||
| 1639 | Ga0495668_0033575 | |||
| 1640 | Ga0495668_0118851 | |||
| 1641 | Ga0495634_0078900 | |||
| 1642 | Ga0495625_0370338 | |||
| 1643 | Ga0495659_0008319 | |||
| 1644 | Ga0495661_0180792 | |||
| 1645 | Ga0495588_0045800 | |||
| 1646 | Ga0495657_0257678 | |||
| 1647 | Ga0495658_0036189 | |||
| 1648 | Ga0495658_0101707 | |||
| 1649 | Ga0495658_0305393 | |||
| 1650 | Ga0495658_0417816 | |||
| 1651 | Ga0495669_0000001 | |||
| 1652 | Ga0495613_0171563 | |||
| 1653 | Ga0495613_0248288 | |||
| 1654 | Ga0495624_0011870 | |||
| 1655 | Ga0495670_0010915 | |||
| 1656 | Ga0495649_0060603 | |||
| 1657 | Ga0495674_0291973 | |||
| 1658 | Ga0495674_0334792 | |||
| 1659 | Ga0495672_0000739 | |||
| 1660 | Ga0495676_0211685 | |||
| 1661 | Ga0495676_0333307 | |||
| 1662 | Ga0495677_0046685 | |||
| 1663 | Ga0495685_024034 | |||
| 1664 | Ga0495684_0082641 | |||
| 1665 | Ga0495686_0002708 | |||
| 1666 | Ga0495686_0024345 | |||
| 1667 | Ga0495593_0033310 | |||
| 1668 | Ga0495593_0072136 | |||
| 1669 | Ga0495602_0087653 | |||
| 1670 | Ga0495614_0106855 | |||
| 1671 | Ga0496101_0027324 | |||
| 1672 | Ga0496101_0031882 | |||
| 1673 | Ga0496101_0052513 | |||
| 1674 | Ga0496101_0633755 | |||
| 1675 | Ga0496102_0055595 | |||
| 1676 | Ga0496102_0274148 | |||
| 1677 | Ga0496102_0404797 | |||
| 1678 | Ga0496103_0001539 | |||
| 1679 | Ga0496104_0003183 | |||
| 1680 | Ga0496104_0006755 | |||
| 1681 | Ga0496104_0079346 | |||
| 1682 | Ga0496105_0000653 | |||
| 1683 | Ga0496105_0003358 | |||
| 1684 | Ga0496105_0019423 | |||
| 1685 | Ga0496106_0004405 | |||
| 1686 | Ga0496106_0051764 | |||
| 1687 | Ga0496107_0021330 | |||
| 1688 | Ga0496108_0004848 | |||
| 1689 | Ga0496109_0001027 | |||
| 1690 | Ga0496110_0011290 | |||
| 1691 | Ga0496110_0018675 | |||
| 1692 | Ga0496110_0030717 | |||
| 1693 | Ga0496110_0090979 | |||
| 1694 | Ga0496111_0076955 | |||
| 1695 | Ga0496111_0389404 | |||
| 1696 | Ga0496112_0000804 | |||
| 1697 | Ga0496112_0059344 | |||
| 1698 | Ga0496112_0465746 | |||
| 1699 | Ga0496113_0001499 | |||
| 1700 | Ga0496114_0021309 | |||
| 1701 | Ga0496114_0030137 | |||
| 1702 | Ga0496114_0211420 | |||
| 1703 | Ga0496114_0383113 | |||
| 1704 | Ga0496115_0004230 | |||
| 1705 | Ga0496115_0088393 | |||
| 1706 | Ga0496115_0263184 | |||
| 1707 | Ga0496115_0407802 | |||
| 1708 | Ga0496119_0002497 | |||
| 1709 | Ga0496121_0254805 | |||
| 1710 | Ga0496126_0010389 | |||
| 1711 | Ga0496126_0278719 | |||
| 1712 | Ga0496126_0569822 | |||
| 1713 | Ga0501031_0019630 | |||
| 1714 | Ga0501031_0037957 | |||
| 1715 | Ga0501032_0001016 | |||
| 1716 | Ga0501032_0006036 | |||
| 1717 | Ga0501032_0023092 | |||
| 1718 | Ga0501032_0157399 | |||
| 1719 | Ga0501033_0005237 | |||
| 1720 | Ga0501033_0011204 | |||
| 1721 | Ga0501033_0173782 | |||
| 1722 | Ga0501033_0230645 | |||
| 1723 | Ga0501034_0000244 | |||
| 1724 | Ga0501034_0000623 | |||
| 1725 | Ga0501034_0006211 | |||
| 1726 | Ga0501034_0009574 | |||
| 1727 | Ga0501034_0015930 | |||
| 1728 | Ga0501034_0029889 | |||
| 1729 | Ga0501034_0030592 | |||
| 1730 | Ga0501034_0049229 | |||
| 1731 | Ga0501034_0058001 | |||
| 1732 | Ga0501034_0085320 | |||
| 1733 | Ga0501034_0091153 | |||
| 1734 | Ga0501034_0136565 | |||
| 1735 | Ga0501034_0161820 | |||
| 1736 | Ga0501034_0266304 | |||
| 1737 | Ga0501034_0455552 | |||
| 1738 | Ga0501034_0483485 | |||
| 1739 | Ga0501034_0494303 | |||
| 1740 | Ga0501034_0682207 | |||
| 1741 | Ga0501034_0689621 | |||
| 1742 | Ga0501036_0000402 | |||
| 1743 | Ga0501036_0009704 | |||
| 1744 | Ga0501036_0131876 | |||
| 1745 | Ga0501036_0184419 | |||
| 1746 | Ga0501036_0242745 | |||
| 1747 | Ga0501036_0263206 | |||
| 1748 | Ga0501036_0299640 | |||
| 1749 | Ga0501036_0348569 | |||
| 1750 | Ga0501037_0008825 | |||
| 1751 | Ga0501037_0009635 | |||
| 1752 | Ga0501037_0014018 | |||
| 1753 | Ga0501037_0072271 | |||
| 1754 | Ga0501037_0115814 | |||
| 1755 | Ga0501037_0169540 | |||
| 1756 | Ga0501037_0374783 | |||
| 1757 | Ga0501038_0004074 | |||
| 1758 | Ga0501038_0012791 | |||
| 1759 | Ga0501038_0021786 | |||
| 1760 | Ga0501038_0035364 | |||
| 1761 | Ga0501038_0100969 | |||
| 1762 | Ga0501038_0151329 | |||
| 1763 | Ga0501038_0481171 | |||
| 1764 | Ga0501038_0481291 | |||
| 1765 | Ga0501039_0107608 | |||
| 1766 | Ga0501039_0306851 | |||
| 1767 | Ga0501039_0320305 | |||
| 1768 | Ga0501040_0004593 | |||
| 1769 | Ga0501042_0022449 | |||
| 1770 | Ga0501042_0185854 | |||
| 1771 | Ga0501042_0198660 | |||
| 1772 | Ga0501043_0001890 | |||
| 1773 | Ga0501043_0032700 | |||
| 1774 | Ga0501043_0076674 | |||
| 1775 | Ga0501043_0179838 | |||
| 1776 | Ga0501043_0365493 | |||
| 1777 | Ga0501046_0035676 | |||
| 1778 | Ga0501046_0081176 | |||
| 1779 | Ga0501046_0170270 | |||
| 1780 | Ga0501046_0256573 | |||
| 1781 | Ga0501047_0000010 | |||
| 1782 | Ga0501047_0006124 | |||
| 1783 | Ga0501047_0008824 | |||
| 1784 | Ga0501047_0009108 | |||
| 1785 | Ga0501047_0019030 | |||
| 1786 | Ga0501047_0020190 | |||
| 1787 | Ga0501047_0048484 | |||
| 1788 | Ga0501047_0121098 | |||
| 1789 | Ga0501047_0288600 | |||
| 1790 | Ga0501047_0636817 | |||
| 1791 | Ga0501048_0001467 | |||
| 1792 | Ga0501048_0006405 | |||
| 1793 | Ga0501048_0031281 | |||
| 1794 | Ga0501067_0000137 | |||
| 1795 | Ga0501067_0000637 | |||
| 1796 | Ga0501067_0007532 | |||
| 1797 | Ga0501067_0071752 | |||
| 1798 | Ga0501067_0080972 | |||
| 1799 | Ga0501067_0095780 | |||
| 1800 | Ga0501067_0187574 | |||
| 1801 | Ga0501068_0000436 | |||
| 1802 | Ga0501068_0001773 | |||
| 1803 | Ga0501068_0004997 | |||
| 1804 | Ga0501068_0008618 | |||
| 1805 | Ga0501068_0190503 | |||
| 1806 | Ga0501068_0245350 | |||
| 1807 | Ga0501070_0083324 | |||
| 1808 | Ga0501070_0126211 | |||
| 1809 | Ga0501070_0213504 | |||
| 1810 | Ga0501070_0287230 | |||
| 1811 | Ga0501070_0326225 | |||
| 1812 | Ga0501071_0050273 | |||
| 1813 | Ga0501071_0142607 | |||
| 1814 | Ga0501071_0573494 | |||
| 1815 | Ga0501072_0013992 | |||
| 1816 | Ga0501072_0042845 | |||
| 1817 | Ga0501072_0116565 | |||
| 1818 | Ga0501072_0371741 | |||
| 1819 | Ga0501073_0000003 | |||
| 1820 | Ga0501073_0000284 | |||
| 1821 | Ga0501073_0003399 | |||
| 1822 | Ga0501073_0019022 | |||
| 1823 | Ga0501073_0047757 | |||
| 1824 | Ga0501073_0098835 | |||
| 1825 | Ga0501074_0015059 | |||
| 1826 | Ga0501074_0083490 | |||
| 1827 | Ga0501074_0264219 | |||
| 1828 | Ga0501074_0383166 | |||
| 1829 | Ga0501075_0080363 | |||
| 1830 | Ga0501076_0123319 | |||
| 1831 | Ga0501076_0132604 | |||
| 1832 | Ga0501077_0000016 | |||
| 1833 | Ga0501077_0046830 | |||
| 1834 | Ga0501077_0444866 | |||
| 1835 | Ga0501079_0007367 | |||
| 1836 | Ga0501080_0000148 | |||
| 1837 | Ga0501080_0000777 | |||
| 1838 | Ga0501080_0000954 | |||
| 1839 | Ga0501080_0012166 | |||
| 1840 | Ga0501080_0036219 | |||
| 1841 | Ga0501080_0402339 | |||
| 1842 | Ga0501080_0405291 | |||
| 1843 | Ga0501081_0039906 | |||
| 1844 | Ga0501083_0001616 | |||
| 1845 | Ga0501083_0005602 | |||
| 1846 | Ga0501083_0006643 | |||
| 1847 | Ga0501083_0021194 | |||
| 1848 | Ga0501083_0221209 | |||
| 1849 | Ga0501083_0270455 | |||
| 1850 | Ga0501035_0000715 | |||
| 1851 | Ga0501035_0053381 | |||
| 1852 | Ga0501035_0054708 | |||
| 1853 | Ga0501035_0150690 | |||
| 1854 | Ga0501035_0238619 | |||
| 1855 | Ga0501035_0337393 | |||
| 1856 | Ga0501035_0396108 | |||
| 1857 | Ga0501044_0001007 | |||
| 1858 | Ga0501044_0002725 | |||
| 1859 | Ga0501044_0003468 | |||
| 1860 | Ga0501044_0045787 | |||
| 1861 | Ga0501044_0105507 | |||
| 1862 | Ga0501044_0173805 | |||
| 1863 | Ga0501044_0187458 | |||
| 1864 | Ga0501044_0269283 | |||
| 1865 | Ga0501044_0279781 | |||
| 1866 | Ga0501044_0360262 | |||
| 1867 | Ga0501044_0399893 | |||
| 1868 | Ga0501044_0573076 | |||
| 1869 | Ga0501044_0788866 | |||
| 1870 | Ga0501045_0002871 | |||
| 1871 | Ga0501045_0080562 | |||
| 1872 | Ga0501045_0160963 | |||
| 1873 | nmdc:mga03683_22577_c1 | |||
| 1874 | nmdc:mga03n38_90280_c1 | |||
| 1875 | nmdc:mga00v17_188552_c1 | |||
| 1876 | nmdc:mga00v17_41055_c1 | |||
| 1877 | nmdc:mga0yw44_275362_c1 | |||
| 1878 | nmdc:mga0k408_11597_c2 | |||
| 1879 | nmdc:mga0k408_66682_c1 | |||
| 1880 | nmdc:mga06z11_255298_c1 | |||
| 1881 | nmdc:mga06z11_56709_c1 | |||
| 1882 | nmdc:mga07m45_29751_c1 | |||
| 1883 | nmdc:mga05p37_1364_c1 | |||
| 1884 | nmdc:mga05p37_1370_c1 | |||
| 1885 | nmdc:mga05p37_415904_c1 | |||
| 1886 | nmdc:mga05p37_43817_c1 | |||
| 1887 | nmdc:mga05p37_59746_c1 | |||
| 1888 | nmdc:mga05p37_726882_c1 | |||
| 1889 | nmdc:mga09592_17705_c1 | |||
| 1890 | nmdc:mga09592_17818_c1 | |||
| 1891 | nmdc:mga09592_361626_c1 | |||
| 1892 | nmdc:mga0qj67_123792_c1 | |||
| 1893 | nmdc:mga0qj67_54837_c1 | |||
| 1894 | nmdc:mga06r32_151_c1 | |||
| 1895 | nmdc:mga06r32_23835_c1 | |||
| 1896 | nmdc:mga06r32_50711_c1 | |||
| 1897 | nmdc:mga08y16_170896_c1 | |||
| 1898 | nmdc:mga08y16_194666_c1 | |||
| 1899 | nmdc:mga08y16_207627_c1 | |||
| 1900 | nmdc:mga08y16_86_c1 | |||
| 1901 | nmdc:mga08y16_965277_c1 | |||
| 1902 | nmdc:mga0n895_127360_c1 | |||
| 1903 | nmdc:mga0n895_160300_c1 | |||
| 1904 | nmdc:mga0n895_98008_c1 | |||
| 1905 | nmdc:mga0rr50_147851_c1 | |||
| 1906 | nmdc:mga0rr50_56681_c1 | |||
| 1907 | nmdc:mga0rr50_605984_c1 | |||
| 1908 | nmdc:mga08x19_4_c2 | |||
| 1909 | nmdc:mga0a205_101195_c1 | |||
| 1910 | nmdc:mga0a205_36209_c1 | |||
| 1911 | nmdc:mga0a205_48308_c1 | |||
| 1912 | nmdc:mga0a205_597394_c1 | |||
| 1913 | nmdc:mga0sz30_469_c1 | |||
| 1914 | Ga0495612_0060917 | |||
| 1915 | Ga0500635_0000080 | |||
| 1916 | Ga0495595_0015517 | |||
| 1917 | Ga0495619_0019642 | |||
| 1918 | Ga0495619_0089895 | |||
| 1919 | Ga0495619_0103208 | |||
| 1920 | Ga0495619_0321850 | |||
| 1921 | Ga0495619_0418340 | |||
| 1922 | Ga0500578_0119769 | |||
| 1923 | Ga0500578_0154959 | |||
| 1924 | Ga0500643_002563 | |||
| 1925 | Ga0500643_009378 | |||
| 1926 | Ga0500643_043611 | |||
| 1927 | Ga0500646_0011647 | |||
| 1928 | Ga0500647_0099551 | |||
| 1929 | Ga0500583_0050564 | |||
| 1930 | Ga0500651_0041785 | |||
| 1931 | Ga0500651_0072450 | |||
| 1932 | Ga0500566_0008660 | |||
| 1933 | Ga0500566_0128903 | |||
| 1934 | Ga0500641_0000281 | |||
| 1935 | Ga0500641_0002911 | |||
| 1936 | Ga0500641_0042425 | |||
| 1937 | Ga0500654_072357 | |||
| 1938 | Ga0500556_0061718 | |||
| 1939 | Ga0500556_0099158 | |||
| 1940 | Ga0500562_083394 | |||
| 1941 | Ga0500569_000298 | |||
| 1942 | Ga0500595_002391 | |||
| 1943 | Ga0500595_028795 | |||
| 1944 | Ga0500607_132198 | |||
| 1945 | Ga0500608_001366 | |||
| 1946 | Ga0500614_007297 | |||
| 1947 | Ga0500618_037128 | |||
| 1948 | Ga0500628_044927 | |||
| 1949 | Ga0500642_0171449 | |||
| 1950 | Ga0500655_031147 | |||
| 1951 | Ga0500658_0008025 | |||
| 1952 | Ga0500658_0018884 | |||
| 1953 | Ga0500559_0152059 | |||
| 1954 | Ga0500573_0185731 | |||
| 1955 | Ga0500590_008183 | |||
| 1956 | Ga0500603_046359 | |||
| 1957 | Ga0500604_0003297 | |||
| 1958 | Ga0500604_0009823 | |||
| 1959 | Ga0500604_0148306 | |||
| 1960 | Ga0500616_0013469 | |||
| 1961 | Ga0500616_0034243 | |||
| 1962 | Ga0500624_001445 | |||
| 1963 | Ga0500634_0000087 | |||
| 1964 | Ga0500638_058152 | |||
| 1965 | Ga0500639_114379 | |||
| 1966 | Ga0500636_0002254 | |||
| 1967 | Ga0500637_0022327 | |||
| 1968 | Ga0500637_0183722 | |||
| 1969 | Ga0500576_019706 | |||
| 1970 | Ga0500625_047661 | |||
| 1971 | Ga0500609_000390 | |||
| 1972 | Ga0500596_000190 | |||
| 1973 | Ga0501084_0007012 | |||
| 1974 | Ga0501084_0021772 | |||
| 1975 | Ga0501084_0048484 | |||
| 1976 | Ga0501084_0075497 | |||
| 1977 | Ga0501084_0094788 | |||
| 1978 | Ga0501084_0707123 | |||
| 1979 | Ga0587073_0031457 | |||
| 1980 | Ga0501082_0004670 | |||
| 1981 | Ga0501082_0006711 | |||
| 1982 | Ga0501082_0195719 | |||
| 1983 | Ga0501082_0492114 | |||
| 1984 | Ga0501082_0496140 | |||
| 1985 | Ga0501082_0657327 | |||
| 1986 | Ga0530510_0145921 | |||
| 1987 | 2512033511 | |||
| 1988 | 2523470308 | |||
| 1989 | 2643756642 | |||
| 1990 | 2643911245 | |||
| 1991 | 2643964098 | |||
| 1992 | 2644001870 | |||
| 1993 | 2644085262 | |||
| 1994 | 2644342814 | |||
| 1995 | 2644366114 | |||
| 1996 | 2644410990 | |||
| 1997 | 2671692875 | |||
| 1998 | 2739350346 | |||
| 1999 | 2821449361 | |||
| 2000 | 2842333672 | |||
| 2001 | 2844533636 | |||
| 2002 | 2883578858 | |||
| 2003 | 2894777576 | |||
| 2004 | 2894819717 | |||
| 2005 | 2897804328 | |||
| 2006 | 2909401678 | |||
| 2007 | 2929201504 | |||
| 2008 | 2932403861 | |||
| 2009 | 8054004926 | |||
| 2010 | 8055915707 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3grp-assembly1.cif.gz_D | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9744 | 1 | 235 |
| 3grp-assembly1.cif.gz_C | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9721 | 1 | 235 |
| 4wjz-assembly1.cif.gz_A | crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(g141a) from vibrio cholerae | 0.9664 | 3 | 235 |
| 3grp-assembly1.cif.gz_D | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9653 | 1 | 235 |
| 1i01-assembly2.cif.gz_G | crystal structure of beta-ketoacyl [acyl carrier protein] reductase from e. coli. | 0.9651 | 3 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9721 | 1 | 235 | 3.40.50.720 |
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9632 | 1 | 235 | 3.40.50.720 |
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9546 | 79 | 236 | 3.40.50.720 |
| 4urfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9536 | 4 | 234 | 3.40.50.720 |
| 4lvuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9535 | 3 | 235 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2JN18-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9953 | 1 | 134 |
|
| AF-A0A348W864-F1-model_v4 | Beta-ketoacyl-ACP reductase | 0.983 | 1 | 169 |
GO:0016491
|
| AF-A0A7C4A247-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9786 | 1 | 210 |
GO:0016491
|
| AF-A0A849GKC7-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.978 | 1 | 161 |
GO:0016491
|
| AF-A0A7Y2JN18-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9735 | 1 | 134 |
|