F487983
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1005 | 559 | 2010 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10322914|Ga0105247_103229142 |
| Length | 272 |
| Sequence | MDTAMECETIATRPLRVKFRHLLSAVRHVTLTAGRLALDVALPTLCVSCREPVAGEGVCANCWSRMSFIAPPYCARLGIPFAYDPGPGLLSMEAIAAPPAYQRARAAVRYEETAKALVHGLKYQDRTDLAPIMGRWMARAGQEILDDADVLVPVPLHWRRGWSRRFNQSGALAKIIEKQTGVPVAGALRRVKPTLQQVGLSKSERARNVQGAFTVPHEKRAAIEGRHVVLIDDVLTSGATVDACARALLQARAGQVDVLVFARVVESFKSPI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 64 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 86 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 87 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 88 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 89 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 90 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 91 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 151 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 156 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 160 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 164 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 167 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 168 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 169 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 170 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 193 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 194 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 195 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 196 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 197 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 198 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 199 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 200 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 201 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 202 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 203 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 294 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 295 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 300 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 353 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 354 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 355 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 356 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 359 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 361 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 363 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 366 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 368 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 369 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 370 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 371 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 372 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 373 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 375 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 377 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 378 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 383 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 384 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 385 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 386 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 387 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 388 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 389 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 390 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 391 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 392 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 393 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 394 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 395 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 396 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 397 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 398 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 399 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 400 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 401 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 402 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 403 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 404 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 405 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 406 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 407 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 408 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 409 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 410 | 2791355199 | |||
| 411 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 412 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 413 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 414 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 415 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 416 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 417 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 418 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 419 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 420 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 421 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 422 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 423 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 424 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 425 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 426 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 427 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 428 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 429 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 430 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 431 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 432 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 433 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 434 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 435 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 436 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 437 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 438 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 439 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 440 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 441 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 442 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 443 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 444 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 445 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 446 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 447 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 448 | 2904699407 | |||
| 449 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 450 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 451 | 2906610324 | |||
| 452 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 453 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 454 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 455 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 456 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 457 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 458 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 459 | 2922368715 | |||
| 460 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 461 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 462 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 463 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 464 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 465 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 466 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 467 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 468 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 469 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 470 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 471 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 472 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 473 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 474 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 475 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 476 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 477 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 478 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 479 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 480 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 481 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 482 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 483 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 484 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 485 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 486 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 487 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 488 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 489 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 490 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 491 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 492 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 493 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 494 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 495 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 496 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 497 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 498 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 499 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 500 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 501 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 502 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 503 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 504 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 505 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 506 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 507 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 508 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 509 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 510 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 511 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 512 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 513 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 514 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 515 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 516 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 517 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 518 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 519 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 520 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 521 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 522 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 523 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 524 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 525 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 526 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 527 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 528 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 529 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 530 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 531 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 532 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 533 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 534 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 535 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 536 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 537 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 538 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 539 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 540 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 541 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 542 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 543 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 544 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 545 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 546 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 547 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 548 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 549 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 550 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 551 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 552 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 553 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 554 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 555 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 556 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 557 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 558 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 559 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.42 |
| Metatranscriptomes | 0.2 |
| Isolates | 17.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.85 |
| Nodule | 14.13 |
| Rhizoplane | 5.67 |
| Rhizosphere | 57.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105247_10322914 | 3300009101 | Bacteria | 1078 |
| 2 | JGI25153J46596_10003051 | 3300003215 | Bacteria | 9461 |
| 3 | JGI25153J46596_10004570 | 3300003215 | Bacteria | 7426 |
| 4 | JGI25153J46596_10006145 | 3300003215 | Bacteria | 6155 |
| 5 | JGI25153J46596_10011665 | 3300003215 | Bacteria | 3863 |
| 6 | JGI25153J46596_10027783 | 3300003215 | Bacteria | 1975 |
| 7 | JGI25160J50197_1001574 | 3300003354 | Bacteria | 11262 |
| 8 | JGI25160J50197_1001779 | 3300003354 | Bacteria | 10433 |
| 9 | JGI25404J52841_10007176 | 3300003659 | Bacteria | 2350 |
| 10 | Ga0055531_10005617 | 3300003794 | Bacteria | 7297 |
| 11 | Ga0055543_1025877 | 3300004625 | Bacteria | 1046 |
| 12 | Ga0065165_1010207 | 3300005262 | Bacteria | 4094 |
| 13 | Ga0070658_10085417 | 3300005327 | Bacteria | 2595 |
| 14 | Ga0070658_10103003 | 3300005327 | Bacteria | 2360 |
| 15 | Ga0070683_100024893 | 3300005329 | Bacteria | 5367 |
| 16 | Ga0070683_100045401 | 3300005329 | Bacteria | 4055 |
| 17 | Ga0070683_100053436 | 3300005329 | Bacteria | 3743 |
| 18 | Ga0070683_100170053 | 3300005329 | Bacteria | 2069 |
| 19 | Ga0070670_100162962 | 3300005331 | Bacteria | 1933 |
| 20 | Ga0070680_100013669 | 3300005336 | Bacteria | 6328 |
| 21 | Ga0068868_100098967 | 3300005338 | Bacteria | 2358 |
| 22 | Ga0070691_10009286 | 3300005341 | Bacteria | 4495 |
| 23 | Ga0070691_10040651 | 3300005341 | Bacteria | 2198 |
| 24 | Ga0070661_100040169 | 3300005344 | Bacteria | 3412 |
| 25 | Ga0070668_100030308 | 3300005347 | Bacteria | 4112 |
| 26 | Ga0070669_100625444 | 3300005353 | Bacteria | 904 |
| 27 | Ga0070675_100241631 | 3300005354 | Bacteria | 1578 |
| 28 | Ga0070671_100153087 | 3300005355 | Bacteria | 1948 |
| 29 | Ga0070659_100467565 | 3300005366 | Bacteria | 1072 |
| 30 | Ga0070659_100586793 | 3300005366 | Bacteria | 957 |
| 31 | Ga0070709_10001043 | 3300005434 | Bacteria | 15348 |
| 32 | Ga0070709_10307685 | 3300005434 | Bacteria | 1159 |
| 33 | Ga0070714_100056148 | 3300005435 | Bacteria | 3367 |
| 34 | Ga0070714_100274949 | 3300005435 | Bacteria | 1563 |
| 35 | Ga0070713_100014537 | 3300005436 | Bacteria | 5852 |
| 36 | Ga0070713_100018727 | 3300005436 | Bacteria | 5267 |
| 37 | Ga0070713_100030913 | 3300005436 | Bacteria | 4258 |
| 38 | Ga0070713_100228005 | 3300005436 | Bacteria | 1692 |
| 39 | Ga0070710_10038234 | 3300005437 | Bacteria | 2635 |
| 40 | Ga0070710_10085355 | 3300005437 | Bacteria | 1852 |
| 41 | Ga0070711_100069956 | 3300005439 | Bacteria | 2470 |
| 42 | Ga0070711_100159174 | 3300005439 | Bacteria | 1710 |
| 43 | Ga0070663_100013916 | 3300005455 | Bacteria | 5148 |
| 44 | Ga0070663_100152557 | 3300005455 | Bacteria | 1773 |
| 45 | Ga0070663_100171144 | 3300005455 | Bacteria | 1679 |
| 46 | Ga0070663_100206464 | 3300005455 | Bacteria | 1536 |
| 47 | Ga0070681_10058357 | 3300005458 | Bacteria | 3839 |
| 48 | Ga0070681_10115679 | 3300005458 | Bacteria | 2620 |
| 49 | Ga0070681_10154365 | 3300005458 | Bacteria | 2221 |
| 50 | Ga0070681_10168210 | 3300005458 | Bacteria | 2114 |
| 51 | Ga0068867_100510309 | 3300005459 | Bacteria | 1035 |
| 52 | Ga0070679_100016662 | 3300005530 | Bacteria | 7098 |
| 53 | Ga0070679_100116273 | 3300005530 | Bacteria | 2659 |
| 54 | Ga0070679_100306150 | 3300005530 | Bacteria | 1539 |
| 55 | Ga0070684_100006424 | 3300005535 | Bacteria | 9098 |
| 56 | Ga0070684_100019917 | 3300005535 | Bacteria | 5560 |
| 57 | Ga0070684_100035699 | 3300005535 | Bacteria | 4257 |
| 58 | Ga0070684_100551623 | 3300005535 | Bacteria | 1069 |
| 59 | Ga0070697_100319364 | 3300005536 | Bacteria | 1337 |
| 60 | Ga0068853_100163053 | 3300005539 | Bacteria | 2012 |
| 61 | Ga0068853_100392583 | 3300005539 | Bacteria | 1297 |
| 62 | Ga0070672_100628667 | 3300005543 | Bacteria | 937 |
| 63 | Ga0070693_100064310 | 3300005547 | Bacteria | 2141 |
| 64 | Ga0070665_100072156 | 3300005548 | Bacteria | 3460 |
| 65 | Ga0070665_100140122 | 3300005548 | Bacteria | 2422 |
| 66 | Ga0070665_100244250 | 3300005548 | Bacteria | 1796 |
| 67 | Ga0068855_100077179 | 3300005563 | Bacteria | 3865 |
| 68 | Ga0068855_100102183 | 3300005563 | Bacteria | 3299 |
| 69 | Ga0068855_100126380 | 3300005563 | Bacteria | 2923 |
| 70 | Ga0068855_100197760 | 3300005563 | Bacteria | 2264 |
| 71 | Ga0068855_100372445 | 3300005563 | Bacteria | 1569 |
| 72 | Ga0070664_100333807 | 3300005564 | Bacteria | 1376 |
| 73 | Ga0068857_100267796 | 3300005577 | Bacteria | 1570 |
| 74 | Ga0068854_100614152 | 3300005578 | Bacteria | 930 |
| 75 | Ga0068856_100185599 | 3300005614 | Bacteria | 2093 |
| 76 | Ga0068852_100100840 | 3300005616 | Bacteria | 2606 |
| 77 | Ga0068859_100097876 | 3300005617 | Bacteria | 2987 |
| 78 | Ga0068859_100153785 | 3300005617 | Bacteria | 2377 |
| 79 | Ga0068859_100491251 | 3300005617 | Bacteria | 1323 |
| 80 | Ga0068864_100023369 | 3300005618 | Bacteria | 5190 |
| 81 | Ga0068864_100118956 | 3300005618 | Bacteria | 2360 |
| 82 | Ga0068861_100278845 | 3300005719 | Bacteria | 1438 |
| 83 | Ga0068851_10013943 | 3300005834 | Bacteria | 3809 |
| 84 | Ga0068851_10091714 | 3300005834 | Bacteria | 1600 |
| 85 | Ga0068858_100027108 | 3300005842 | Bacteria | 5323 |
| 86 | Ga0068858_100148100 | 3300005842 | Bacteria | 2206 |
| 87 | Ga0068858_100216075 | 3300005842 | Bacteria | 1815 |
| 88 | Ga0068860_100002074 | 3300005843 | Bacteria | 21125 |
| 89 | Ga0068860_100277662 | 3300005843 | Bacteria | 1636 |
| 90 | Ga0081455_10005919 | 3300005937 | Bacteria | 13272 |
| 91 | Ga0081455_10061026 | 3300005937 | Bacteria | 3175 |
| 92 | Ga0081455_10172875 | 3300005937 | Bacteria | 1644 |
| 93 | Ga0081455_10193448 | 3300005937 | Bacteria | 1530 |
| 94 | Ga0081540_1004312 | 3300005983 | Bacteria | 10899 |
| 95 | Ga0081540_1014575 | 3300005983 | Bacteria | 5027 |
| 96 | Ga0081540_1018244 | 3300005983 | Bacteria | 4313 |
| 97 | Ga0081540_1044261 | 3300005983 | Bacteria | 2274 |
| 98 | Ga0081539_10000522 | 3300005985 | Bacteria | 79973 |
| 99 | Ga0081539_10029861 | 3300005985 | Bacteria | 3397 |
| 100 | Ga0070717_10001143 | 3300006028 | Bacteria | 17925 |
| 101 | Ga0070717_10004943 | 3300006028 | Bacteria | 9697 |
| 102 | Ga0070717_10153068 | 3300006028 | Bacteria | 1996 |
| 103 | Ga0070717_10222342 | 3300006028 | Bacteria | 1660 |
| 104 | Ga0075365_10113770 | 3300006038 | Bacteria | 1861 |
| 105 | Ga0075365_10245631 | 3300006038 | Bacteria | 1257 |
| 106 | Ga0075368_10007821 | 3300006042 | Bacteria | 3788 |
| 107 | Ga0075368_10048151 | 3300006042 | Bacteria | 1689 |
| 108 | Ga0075368_10062685 | 3300006042 | Bacteria | 1490 |
| 109 | Ga0075363_100105240 | 3300006048 | Bacteria | 1565 |
| 110 | Ga0070715_10002760 | 3300006163 | Bacteria | 5455 |
| 111 | Ga0070716_100007223 | 3300006173 | Bacteria | 5464 |
| 112 | Ga0070716_100026589 | 3300006173 | Bacteria | 3100 |
| 113 | Ga0070716_100218337 | 3300006173 | Bacteria | 1279 |
| 114 | Ga0070712_100039274 | 3300006175 | Bacteria | 3239 |
| 115 | Ga0070712_100088330 | 3300006175 | Bacteria | 2265 |
| 116 | Ga0070712_100512242 | 3300006175 | Bacteria | 1007 |
| 117 | Ga0075362_10032878 | 3300006177 | Bacteria | 2254 |
| 118 | Ga0075362_10108644 | 3300006177 | Bacteria | 1304 |
| 119 | Ga0075367_10033336 | 3300006178 | Bacteria | 2967 |
| 120 | Ga0075367_10081022 | 3300006178 | Bacteria | 1964 |
| 121 | Ga0075367_10266527 | 3300006178 | Bacteria | 1076 |
| 122 | Ga0075369_10040273 | 3300006186 | Bacteria | 1997 |
| 123 | Ga0075369_10077396 | 3300006186 | Bacteria | 1471 |
| 124 | Ga0075366_10002600 | 3300006195 | Bacteria | 9280 |
| 125 | Ga0075434_100194741 | 3300006871 | Bacteria | 2047 |
| 126 | Ga0097620_100097872 | 3300006931 | Bacteria | 2987 |
| 127 | Ga0097620_100153803 | 3300006931 | Bacteria | 2377 |
| 128 | Ga0097620_100491232 | 3300006931 | Bacteria | 1323 |
| 129 | Ga0099823_1032421 | 3300006944 | Bacteria | 4253 |
| 130 | Ga0099795_10072045 | 3300007788 | Bacteria | 1306 |
| 131 | Ga0105240_10005129 | 3300009093 | Bacteria | 19597 |
| 132 | Ga0105240_10025127 | 3300009093 | Bacteria | 7835 |
| 133 | Ga0105240_10035009 | 3300009093 | Bacteria | 6475 |
| 134 | Ga0105240_10035094 | 3300009093 | Bacteria | 6467 |
| 135 | Ga0105240_10089392 | 3300009093 | Bacteria | 3767 |
| 136 | Ga0105240_10836070 | 3300009093 | Bacteria | 995 |
| 137 | Ga0105240_10884923 | 3300009093 | Bacteria | 962 |
| 138 | Ga0111539_10099026 | 3300009094 | Bacteria | 3424 |
| 139 | Ga0105247_10129531 | 3300009101 | Bacteria | 1643 |
| 140 | Ga0105247_10188812 | 3300009101 | Bacteria | 1379 |
| 141 | Ga0105241_10026870 | 3300009174 | Bacteria | 4284 |
| 142 | Ga0105242_10159275 | 3300009176 | Bacteria | 1974 |
| 143 | Ga0105248_10893347 | 3300009177 | Bacteria | 1003 |
| 144 | Ga0105237_10013514 | 3300009545 | Bacteria | 8556 |
| 145 | Ga0105237_10022489 | 3300009545 | Bacteria | 6469 |
| 146 | Ga0105237_10041853 | 3300009545 | Bacteria | 4619 |
| 147 | Ga0105237_10059404 | 3300009545 | Bacteria | 3825 |
| 148 | Ga0105237_10132980 | 3300009545 | Bacteria | 2482 |
| 149 | Ga0105237_10170760 | 3300009545 | Bacteria | 2174 |
| 150 | Ga0105237_10991041 | 3300009545 | Bacteria | 847 |
| 151 | Ga0105238_10043880 | 3300009551 | Bacteria | 4523 |
| 152 | Ga0105238_10177105 | 3300009551 | Bacteria | 2109 |
| 153 | Ga0105238_10568187 | 3300009551 | Bacteria | 1139 |
| 154 | Ga0105239_10054122 | 3300010375 | Bacteria | 4401 |
| 155 | Ga0105239_10179264 | 3300010375 | Bacteria | 2370 |
| 156 | Ga0105239_10179798 | 3300010375 | Bacteria | 2367 |
| 157 | Ga0105239_10190685 | 3300010375 | Bacteria | 2294 |
| 158 | Ga0105239_10262639 | 3300010375 | Bacteria | 1941 |
| 159 | Ga0105239_10381127 | 3300010375 | Bacteria | 1594 |
| 160 | Ga0105239_11141667 | 3300010375 | Bacteria | 897 |
| 161 | Ga0105246_10142896 | 3300011119 | Bacteria | 1802 |
| 162 | Ga0105246_10147427 | 3300011119 | Bacteria | 1777 |
| 163 | Ga0157370_10109107 | 3300013104 | Bacteria | 2587 |
| 164 | Ga0157370_10170809 | 3300013104 | Bacteria | 2021 |
| 165 | Ga0157370_10248271 | 3300013104 | Bacteria | 1646 |
| 166 | Ga0157369_10013512 | 3300013105 | Bacteria | 9228 |
| 167 | Ga0157369_10016827 | 3300013105 | Bacteria | 8218 |
| 168 | Ga0157369_10030575 | 3300013105 | Bacteria | 5938 |
| 169 | Ga0157369_10201502 | 3300013105 | Bacteria | 2089 |
| 170 | Ga0157369_10231731 | 3300013105 | Bacteria | 1931 |
| 171 | Ga0157374_10222359 | 3300013296 | Bacteria | 1853 |
| 172 | Ga0157378_10012413 | 3300013297 | Bacteria | 7459 |
| 173 | Ga0157378_10826432 | 3300013297 | Bacteria | 954 |
| 174 | Ga0157372_10047471 | 3300013307 | Bacteria | 4772 |
| 175 | Ga0157372_10056329 | 3300013307 | Bacteria | 4392 |
| 176 | Ga0157372_10084744 | 3300013307 | Bacteria | 3593 |
| 177 | Ga0157372_10368562 | 3300013307 | Bacteria | 1673 |
| 178 | Ga0157375_10025269 | 3300013308 | Bacteria | 5515 |
| 179 | Ga0157375_10218421 | 3300013308 | Bacteria | 2064 |
| 180 | Ga0157375_10272113 | 3300013308 | Bacteria | 1856 |
| 181 | Ga0157375_10760660 | 3300013308 | Bacteria | 1120 |
| 182 | Ga0163163_10052116 | 3300014325 | Bacteria | 4036 |
| 183 | Ga0163163_10456670 | 3300014325 | Bacteria | 1338 |
| 184 | Ga0157377_10197224 | 3300014745 | Bacteria | 1276 |
| 185 | Ga0157379_10063365 | 3300014968 | Bacteria | 3306 |
| 186 | Ga0163161_10295464 | 3300017792 | Bacteria | 1274 |
| 187 | Ga0206356_11768113 | 3300020070 | Bacteria | 1609 |
| 188 | Ga0214544_1000087 | 3300021320 | Bacteria | 119600 |
| 189 | Ga0214542_1000018 | 3300021321 | Bacteria | 202226 |
| 190 | Ga0214545_1000009 | 3300021324 | Bacteria | 202915 |
| 191 | Ga0214543_1000037 | 3300021327 | Bacteria | 182113 |
| 192 | Ga0213873_10002059 | 3300021358 | Bacteria | 3442 |
| 193 | Ga0213872_10020082 | 3300021361 | Bacteria | 3078 |
| 194 | Ga0213874_10014111 | 3300021377 | Bacteria | 2083 |
| 195 | Ga0213876_10040205 | 3300021384 | Bacteria | 2470 |
| 196 | Ga0213876_10059215 | 3300021384 | Bacteria | 2021 |
| 197 | Ga0207425_1020605 | 3300025245 | Bacteria | 1408 |
| 198 | Ga0209677_107550 | 3300025253 | Bacteria | 2283 |
| 199 | Ga0209233_1003722 | 3300025261 | Bacteria | 5327 |
| 200 | Ga0209233_1005177 | 3300025261 | Bacteria | 4355 |
| 201 | Ga0209455_1008327 | 3300025272 | Bacteria | 2827 |
| 202 | Ga0209564_1007864 | 3300025295 | Bacteria | 5397 |
| 203 | Ga0209564_1033426 | 3300025295 | Bacteria | 1529 |
| 204 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 205 | Ga0209758_1000884 | 3300025297 | Bacteria | 41143 |
| 206 | Ga0209758_1000949 | 3300025297 | Bacteria | 39098 |
| 207 | Ga0209758_1006161 | 3300025297 | Bacteria | 8784 |
| 208 | Ga0209758_1010276 | 3300025297 | Bacteria | 5631 |
| 209 | Ga0209758_1011559 | 3300025297 | Bacteria | 5089 |
| 210 | Ga0209758_1017944 | 3300025297 | Bacteria | 3494 |
| 211 | Ga0209758_1022776 | 3300025297 | Bacteria | 2857 |
| 212 | Ga0209758_1083128 | 3300025297 | Bacteria | 961 |
| 213 | Ga0207426_1001522 | 3300025302 | Bacteria | 18884 |
| 214 | Ga0207426_1002837 | 3300025302 | Bacteria | 10314 |
| 215 | Ga0207426_1015480 | 3300025302 | Bacteria | 2762 |
| 216 | Ga0209257_1003355 | 3300025304 | Bacteria | 13856 |
| 217 | Ga0209257_1007964 | 3300025304 | Bacteria | 6203 |
| 218 | Ga0207697_10144279 | 3300025315 | Bacteria | 1034 |
| 219 | Ga0207656_10015006 | 3300025321 | Bacteria | 2994 |
| 220 | Ga0207682_10221586 | 3300025893 | Bacteria | 875 |
| 221 | Ga0207692_10004318 | 3300025898 | Bacteria | 5622 |
| 222 | Ga0207710_10176994 | 3300025900 | Bacteria | 1045 |
| 223 | Ga0207680_10076487 | 3300025903 | Bacteria | 2090 |
| 224 | Ga0207647_10019817 | 3300025904 | Bacteria | 4517 |
| 225 | Ga0207699_10000360 | 3300025906 | Bacteria | 24053 |
| 226 | Ga0207699_10007899 | 3300025906 | Bacteria | 5219 |
| 227 | Ga0207699_10137624 | 3300025906 | Bacteria | 1601 |
| 228 | Ga0207705_10095657 | 3300025909 | Bacteria | 2180 |
| 229 | Ga0207705_10103920 | 3300025909 | Bacteria | 2093 |
| 230 | Ga0207705_10200290 | 3300025909 | Bacteria | 1513 |
| 231 | Ga0207705_10215949 | 3300025909 | Bacteria | 1455 |
| 232 | Ga0207707_10001598 | 3300025912 | Bacteria | 20886 |
| 233 | Ga0207707_10003721 | 3300025912 | Bacteria | 13504 |
| 234 | Ga0207707_10007691 | 3300025912 | Bacteria | 9387 |
| 235 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 236 | Ga0207695_10211308 | 3300025913 | Bacteria | 1851 |
| 237 | Ga0207695_10743361 | 3300025913 | Bacteria | 861 |
| 238 | Ga0207671_10012029 | 3300025914 | Bacteria | 6990 |
| 239 | Ga0207671_10065139 | 3300025914 | Bacteria | 2710 |
| 240 | Ga0207671_10082197 | 3300025914 | Bacteria | 2417 |
| 241 | Ga0207671_10162696 | 3300025914 | Bacteria | 1729 |
| 242 | Ga0207671_10177279 | 3300025914 | Bacteria | 1657 |
| 243 | Ga0207693_10000073 | 3300025915 | Bacteria | 89380 |
| 244 | Ga0207693_10038422 | 3300025915 | Bacteria | 3770 |
| 245 | Ga0207663_10000861 | 3300025916 | Bacteria | 13793 |
| 246 | Ga0207663_10034150 | 3300025916 | Bacteria | 3039 |
| 247 | Ga0207663_10633233 | 3300025916 | Bacteria | 843 |
| 248 | Ga0207660_10013269 | 3300025917 | Bacteria | 5399 |
| 249 | Ga0207660_10021027 | 3300025917 | Bacteria | 4385 |
| 250 | Ga0207660_10277775 | 3300025917 | Bacteria | 1328 |
| 251 | Ga0207657_10004881 | 3300025919 | Bacteria | 14112 |
| 252 | Ga0207657_10008532 | 3300025919 | Bacteria | 10390 |
| 253 | Ga0207657_10069862 | 3300025919 | Bacteria | 2978 |
| 254 | Ga0207657_10199821 | 3300025919 | Bacteria | 1609 |
| 255 | Ga0207649_10274524 | 3300025920 | Bacteria | 1223 |
| 256 | Ga0207652_10001895 | 3300025921 | Bacteria | 18099 |
| 257 | Ga0207652_10038542 | 3300025921 | Bacteria | 4053 |
| 258 | Ga0207694_10306809 | 3300025924 | Bacteria | 1308 |
| 259 | Ga0207659_10162773 | 3300025926 | Bacteria | 1753 |
| 260 | Ga0207659_10497261 | 3300025926 | Bacteria | 1032 |
| 261 | Ga0207700_10034750 | 3300025928 | Bacteria | 3622 |
| 262 | Ga0207700_10040878 | 3300025928 | Bacteria | 3388 |
| 263 | Ga0207700_10085623 | 3300025928 | Bacteria | 2474 |
| 264 | Ga0207664_10023264 | 3300025929 | Bacteria | 4640 |
| 265 | Ga0207664_10043954 | 3300025929 | Bacteria | 3497 |
| 266 | Ga0207644_10027415 | 3300025931 | Bacteria | 3935 |
| 267 | Ga0207686_10232312 | 3300025934 | Bacteria | 1338 |
| 268 | Ga0207704_10524763 | 3300025938 | Bacteria | 958 |
| 269 | Ga0207665_10000629 | 3300025939 | Bacteria | 23661 |
| 270 | Ga0207665_10045899 | 3300025939 | Bacteria | 2926 |
| 271 | Ga0207711_10603390 | 3300025941 | Bacteria | 1024 |
| 272 | Ga0207661_10013649 | 3300025944 | Bacteria | 5931 |
| 273 | Ga0207661_10032589 | 3300025944 | Bacteria | 4037 |
| 274 | Ga0207661_10032820 | 3300025944 | Bacteria | 4026 |
| 275 | Ga0207679_10116724 | 3300025945 | Bacteria | 2117 |
| 276 | Ga0207679_10155767 | 3300025945 | Bacteria | 1865 |
| 277 | Ga0207667_10035735 | 3300025949 | Bacteria | 5329 |
| 278 | Ga0207667_10325037 | 3300025949 | Bacteria | 1571 |
| 279 | Ga0207667_10968245 | 3300025949 | Bacteria | 839 |
| 280 | Ga0207651_10209802 | 3300025960 | Bacteria | 1567 |
| 281 | Ga0207668_10034118 | 3300025972 | Bacteria | 3377 |
| 282 | Ga0207668_10112762 | 3300025972 | Bacteria | 2043 |
| 283 | Ga0207640_10041074 | 3300025981 | Bacteria | 2939 |
| 284 | Ga0207640_10228931 | 3300025981 | Bacteria | 1429 |
| 285 | Ga0207677_10119813 | 3300026023 | Bacteria | 1977 |
| 286 | Ga0207703_10017425 | 3300026035 | Bacteria | 5607 |
| 287 | Ga0207703_10203262 | 3300026035 | Bacteria | 1761 |
| 288 | Ga0207703_10596237 | 3300026035 | Bacteria | 1045 |
| 289 | Ga0207639_10135347 | 3300026041 | Bacteria | 2045 |
| 290 | Ga0207639_10259936 | 3300026041 | Bacteria | 1518 |
| 291 | Ga0207678_10029495 | 3300026067 | Bacteria | 4788 |
| 292 | Ga0207678_10031151 | 3300026067 | Bacteria | 4653 |
| 293 | Ga0207678_10038743 | 3300026067 | Bacteria | 4139 |
| 294 | Ga0207678_10041959 | 3300026067 | Bacteria | 3966 |
| 295 | Ga0207678_10151281 | 3300026067 | Bacteria | 1982 |
| 296 | Ga0207678_10170475 | 3300026067 | Bacteria | 1858 |
| 297 | Ga0207678_10175048 | 3300026067 | Bacteria | 1832 |
| 298 | Ga0207678_10229933 | 3300026067 | Bacteria | 1588 |
| 299 | Ga0207678_10308082 | 3300026067 | Bacteria | 1361 |
| 300 | Ga0207702_10140091 | 3300026078 | Bacteria | 2187 |
| 301 | Ga0207702_10285529 | 3300026078 | Bacteria | 1562 |
| 302 | Ga0207648_10342461 | 3300026089 | Bacteria | 1346 |
| 303 | Ga0207648_10489881 | 3300026089 | Bacteria | 1124 |
| 304 | Ga0207676_10032534 | 3300026095 | Bacteria | 3931 |
| 305 | Ga0207676_10147807 | 3300026095 | Bacteria | 2020 |
| 306 | Ga0207674_10032777 | 3300026116 | Bacteria | 5446 |
| 307 | Ga0207674_10073272 | 3300026116 | Bacteria | 3438 |
| 308 | Ga0207674_10601701 | 3300026116 | Bacteria | 1062 |
| 309 | Ga0207674_10629459 | 3300026116 | Bacteria | 1036 |
| 310 | Ga0207683_10174203 | 3300026121 | Bacteria | 1949 |
| 311 | Ga0207683_10255498 | 3300026121 | Bacteria | 1599 |
| 312 | Ga0207683_10438070 | 3300026121 | Bacteria | 1204 |
| 313 | Ga0207698_10093752 | 3300026142 | Bacteria | 2466 |
| 314 | Ga0207698_10438045 | 3300026142 | Bacteria | 1258 |
| 315 | Ga0209813_10049632 | 3300027866 | Bacteria | 1307 |
| 316 | Ga0209813_10064091 | 3300027866 | Bacteria | 1180 |
| 317 | Ga0268266_10011749 | 3300028379 | Bacteria | 7594 |
| 318 | Ga0268266_10020841 | 3300028379 | Bacteria | 5590 |
| 319 | Ga0268266_10090709 | 3300028379 | Bacteria | 2679 |
| 320 | Ga0268266_10143422 | 3300028379 | Bacteria | 2145 |
| 321 | Ga0268264_10000050 | 3300028381 | Bacteria | 323697 |
| 322 | Ga0268264_10164525 | 3300028381 | Bacteria | 2001 |
| 323 | Ga0268264_10376950 | 3300028381 | Bacteria | 1358 |
| 324 | Ga0265326_10009229 | 3300028558 | Bacteria | 2949 |
| 325 | Ga0265334_10001546 | 3300028573 | Bacteria | 11100 |
| 326 | Ga0265318_10026651 | 3300028577 | Bacteria | 2274 |
| 327 | Ga0265323_10001795 | 3300028653 | Bacteria | 10187 |
| 328 | Ga0265322_10015165 | 3300028654 | Bacteria | 2228 |
| 329 | Ga0265336_10002399 | 3300028666 | Bacteria | 7759 |
| 330 | Ga0307515_10012007 | 3300028794 | Bacteria | 16357 |
| 331 | Ga0265338_10000621 | 3300028800 | Bacteria | 61786 |
| 332 | Ga0307511_10068076 | 3300030521 | Bacteria | 2634 |
| 333 | Ga0307511_10102970 | 3300030521 | Bacteria | 1862 |
| 334 | Ga0265330_10024250 | 3300031235 | Bacteria | 2751 |
| 335 | Ga0265330_10075588 | 3300031235 | Bacteria | 1454 |
| 336 | Ga0265332_10015896 | 3300031238 | Bacteria | 3321 |
| 337 | Ga0265320_10066271 | 3300031240 | Bacteria | 1711 |
| 338 | Ga0265325_10034326 | 3300031241 | Bacteria | 2700 |
| 339 | Ga0265340_10019688 | 3300031247 | Bacteria | 3474 |
| 340 | Ga0265339_10020997 | 3300031249 | Bacteria | 3807 |
| 341 | Ga0265316_10069760 | 3300031344 | Bacteria | 2712 |
| 342 | Ga0307509_10016566 | 3300031507 | Bacteria | 8523 |
| 343 | Ga0307509_10094686 | 3300031507 | Bacteria | 3044 |
| 344 | Ga0307508_10000005 | 3300031616 | Bacteria | 286511 |
| 345 | Ga0265314_10014704 | 3300031711 | Bacteria | 6246 |
| 346 | Ga0265314_10111504 | 3300031711 | Bacteria | 1738 |
| 347 | Ga0307507_10014276 | 3300033179 | Bacteria | 9495 |
| 348 | Ga0307510_10032857 | 3300033180 | Bacteria | 5841 |
| 349 | Ga0307510_10035286 | 3300033180 | Bacteria | 5588 |
| 350 | Ga0316215_1001379 | 3300033544 | Bacteria | 2337 |
| 351 | Ga0316214_1007014 | 3300033545 | Bacteria | 1498 |
| 352 | Ga0373934_0006248 | 3300035086 | Bacteria | 4416 |
| 353 | Ga0373934_0025722 | 3300035086 | Bacteria | 2282 |
| 354 | Ga0373936_0020794 | 3300035113 | Bacteria | 2551 |
| 355 | Ga0373936_0050409 | 3300035113 | Bacteria | 1683 |
| 356 | Ga0373945_0035407 | 3300035116 | Bacteria | 1784 |
| 357 | Ga0373953_0000259 | 3300035117 | Bacteria | 14369 |
| 358 | Ga0373954_0000249 | 3300035118 | Bacteria | 19692 |
| 359 | Ga0373954_0020206 | 3300035118 | Bacteria | 3010 |
| 360 | Ga0373957_0003088 | 3300035120 | Bacteria | 4855 |
| 361 | Ga0373957_0019478 | 3300035120 | Bacteria | 2388 |
| 362 | Ga0373946_0014361 | 3300035171 | Bacteria | 2986 |
| 363 | Ga0373955_0009036 | 3300035172 | Bacteria | 4652 |
| 364 | Ga0373924_0003664 | 3300035410 | Bacteria | 5298 |
| 365 | Ga0373924_0023447 | 3300035410 | Bacteria | 2421 |
| 366 | Ga0373935_0035040 | 3300035692 | Bacteria | 3131 |
| 367 | Ga0373935_0077040 | 3300035692 | Bacteria | 2160 |
| 368 | Ga0373927_0017691 | 3300035695 | Bacteria | 4689 |
| 369 | Ga0373927_0018294 | 3300035695 | Bacteria | 4605 |
| 370 | Ga0373927_0166499 | 3300035695 | Bacteria | 1444 |
| 371 | Ga0373933_0000277 | 3300035724 | Bacteria | 33337 |
| 372 | Ga0373933_0001831 | 3300035724 | Bacteria | 12311 |
| 373 | Ga0373933_0034496 | 3300035724 | Bacteria | 2949 |
| 374 | Ga0373937_0012106 | 3300036401 | Bacteria | 7572 |
| 375 | Ga0373937_0212048 | 3300036401 | Bacteria | 1822 |
| 376 | Ga0373937_0434311 | 3300036401 | Bacteria | 1246 |
| 377 | Ga0372808_006515 | 3300036459 | Bacteria | 1574 |
| 378 | Ga0373925_0019700 | 3300037068 | Bacteria | 4910 |
| 379 | Ga0373925_0130624 | 3300037068 | Bacteria | 1958 |
| 380 | Ga0373925_0241645 | 3300037068 | Bacteria | 1446 |
| 381 | Ga0373925_0259964 | 3300037068 | Bacteria | 1394 |
| 382 | Ga0373925_0476193 | 3300037068 | Bacteria | 1024 |
| 383 | Ga0395899_0119667 | 3300037312 | Bacteria | 1887 |
| 384 | Ga0395899_0141974 | 3300037312 | Bacteria | 1708 |
| 385 | Ga0395899_0273644 | 3300037312 | Bacteria | 1151 |
| 386 | Ga0395899_0341613 | 3300037312 | Bacteria | 1004 |
| 387 | Ga0395900_0000696 | 3300037418 | Bacteria | 44867 |
| 388 | Ga0395900_0005919 | 3300037418 | Bacteria | 12766 |
| 389 | Ga0395900_0044414 | 3300037418 | Bacteria | 4579 |
| 390 | Ga0395900_0085479 | 3300037418 | Bacteria | 3242 |
| 391 | Ga0395900_0327807 | 3300037418 | Bacteria | 1510 |
| 392 | Ga0395898_0035004 | 3300037466 | Bacteria | 4998 |
| 393 | Ga0395898_0080592 | 3300037466 | Bacteria | 3139 |
| 394 | Ga0395898_0100417 | 3300037466 | Bacteria | 2779 |
| 395 | Ga0395898_0285639 | 3300037466 | Bacteria | 1574 |
| 396 | Ga0395905_0065185 | 3300037471 | Bacteria | 3410 |
| 397 | Ga0395905_0224486 | 3300037471 | Bacteria | 1758 |
| 398 | Ga0395905_0352707 | 3300037471 | Bacteria | 1363 |
| 399 | Ga0436364_0937506 | 3300037853 | Bacteria | 1707 |
| 400 | Ga0395901_0007227 | 3300038443 | Bacteria | 11200 |
| 401 | Ga0395901_0049784 | 3300038443 | Bacteria | 4354 |
| 402 | Ga0395901_0208767 | 3300038443 | Bacteria | 2045 |
| 403 | Ga0395901_0416948 | 3300038443 | Bacteria | 1377 |
| 404 | Ga0436365_0041738 | 3300039437 | Bacteria | 2541 |
| 405 | Ga0436365_1055090 | 3300039437 | Bacteria | 3155 |
| 406 | Ga0436365_1091064 | 3300039437 | Bacteria | 30337 |
| 407 | Ga0436365_1306764 | 3300039437 | Bacteria | 8027 |
| 408 | Ga0436365_1350910 | 3300039437 | Bacteria | 1066 |
| 409 | Ga0436360_0432834 | 3300039438 | Bacteria | 1822 |
| 410 | Ga0436361_0327284 | 3300039447 | Bacteria | 2481 |
| 411 | Ga0436361_0709968 | 3300039447 | Bacteria | 6904 |
| 412 | Ga0436363_1051465 | 3300039450 | Bacteria | 2402 |
| 413 | Ga0436362_0083551 | 3300039453 | Bacteria | 2288 |
| 414 | Ga0436362_1040324 | 3300039453 | Bacteria | 3583 |
| 415 | Ga0439465_0033745 | 3300041413 | Bacteria | 1637 |
| 416 | Ga0439448_0072561 | 3300042005 | Bacteria | 1148 |
| 417 | Ga0466969_0073593 | 3300044656 | Bacteria | 1640 |
| 418 | Ga0466969_0128176 | 3300044656 | Bacteria | 1177 |
| 419 | Ga0466972_0001053 | 3300044658 | Bacteria | 13231 |
| 420 | Ga0466965_0087015 | 3300044683 | Bacteria | 1585 |
| 421 | Ga0466966_0000137 | 3300044684 | Bacteria | 46695 |
| 422 | Ga0466961_0000039 | 3300044693 | Bacteria | 79787 |
| 423 | Ga0466963_0001672 | 3300044694 | Bacteria | 12090 |
| 424 | Ga0466971_0017754 | 3300044719 | Bacteria | 3151 |
| 425 | Ga0466971_0124618 | 3300044719 | Bacteria | 1194 |
| 426 | Ga0466968_0005199 | 3300044735 | Bacteria | 4872 |
| 427 | Ga0466957_0035960 | 3300044842 | Bacteria | 2975 |
| 428 | Ga0466957_0073144 | 3300044842 | Bacteria | 2124 |
| 429 | Ga0466960_0003772 | 3300044901 | Bacteria | 5865 |
| 430 | Ga0466960_0050304 | 3300044901 | Bacteria | 2009 |
| 431 | Ga0466959_0001594 | 3300045049 | Bacteria | 13987 |
| 432 | Ga0466958_0168634 | 3300045836 | Bacteria | 1386 |
| 433 | Ga0466967_0071213 | 3300045976 | Bacteria | 3112 |
| 434 | Ga0466967_0158757 | 3300045976 | Bacteria | 2121 |
| 435 | Ga0466967_0850226 | 3300045976 | Bacteria | 907 |
| 436 | Ga0495592_0011025 | 3300046454 | Bacteria | 6820 |
| 437 | Ga0495592_0022768 | 3300046454 | Bacteria | 4765 |
| 438 | Ga0495592_0040101 | 3300046454 | Bacteria | 3514 |
| 439 | Ga0495590_0064135 | 3300046457 | Bacteria | 1286 |
| 440 | Ga0495629_0001490 | 3300046459 | Bacteria | 18421 |
| 441 | Ga0495638_0013239 | 3300046460 | Bacteria | 5625 |
| 442 | Ga0495638_0019032 | 3300046460 | Bacteria | 4547 |
| 443 | Ga0495638_0069119 | 3300046460 | Bacteria | 2164 |
| 444 | Ga0495638_0102367 | 3300046460 | Bacteria | 1711 |
| 445 | Ga0495641_0025455 | 3300046461 | Bacteria | 2905 |
| 446 | Ga0495651_0011203 | 3300046462 | Bacteria | 6891 |
| 447 | Ga0495651_0028449 | 3300046462 | Bacteria | 4355 |
| 448 | Ga0495651_0062471 | 3300046462 | Bacteria | 2849 |
| 449 | Ga0495653_0000300 | 3300046463 | Bacteria | 40108 |
| 450 | Ga0495650_0080846 | 3300046471 | Bacteria | 1253 |
| 451 | Ga0495580_0019910 | 3300046472 | Bacteria | 4976 |
| 452 | Ga0495605_0035458 | 3300046474 | Bacteria | 2521 |
| 453 | Ga0495605_0057623 | 3300046474 | Bacteria | 1869 |
| 454 | Ga0495639_0031519 | 3300046475 | Bacteria | 2360 |
| 455 | Ga0495662_0022698 | 3300046476 | Bacteria | 3030 |
| 456 | Ga0495664_0020649 | 3300046477 | Bacteria | 3800 |
| 457 | Ga0495664_0021847 | 3300046477 | Bacteria | 3699 |
| 458 | Ga0495664_0034799 | 3300046477 | Bacteria | 2964 |
| 459 | Ga0495664_0070966 | 3300046477 | Bacteria | 2080 |
| 460 | Ga0495585_0023802 | 3300046492 | Bacteria | 3514 |
| 461 | Ga0495594_0026425 | 3300046499 | Bacteria | 3123 |
| 462 | Ga0495583_0030265 | 3300046506 | Bacteria | 2639 |
| 463 | Ga0495583_0038868 | 3300046506 | Bacteria | 2246 |
| 464 | Ga0495606_0000858 | 3300046507 | Bacteria | 45651 |
| 465 | Ga0495608_0040269 | 3300046511 | Bacteria | 3131 |
| 466 | Ga0495608_0052952 | 3300046511 | Bacteria | 2685 |
| 467 | Ga0495608_0109449 | 3300046511 | Bacteria | 1777 |
| 468 | Ga0495608_0118060 | 3300046511 | Bacteria | 1702 |
| 469 | Ga0495616_0060076 | 3300046513 | Bacteria | 1868 |
| 470 | Ga0495618_0099959 | 3300046514 | Bacteria | 1856 |
| 471 | Ga0495620_0025893 | 3300046515 | Bacteria | 2767 |
| 472 | Ga0495628_0139153 | 3300046516 | Bacteria | 1853 |
| 473 | Ga0495628_0143292 | 3300046516 | Bacteria | 1823 |
| 474 | Ga0495630_0200819 | 3300046517 | Bacteria | 1521 |
| 475 | Ga0495631_0039919 | 3300046518 | Bacteria | 2080 |
| 476 | Ga0495631_0085913 | 3300046518 | Bacteria | 1355 |
| 477 | Ga0495648_0000382 | 3300046524 | Bacteria | 48626 |
| 478 | Ga0495648_0050531 | 3300046524 | Bacteria | 2539 |
| 479 | Ga0495663_0038891 | 3300046525 | Bacteria | 1440 |
| 480 | Ga0495666_0048989 | 3300046526 | Bacteria | 2033 |
| 481 | Ga0495652_0007246 | 3300046529 | Bacteria | 10238 |
| 482 | Ga0495652_0048270 | 3300046529 | Bacteria | 3649 |
| 483 | Ga0495652_0106931 | 3300046529 | Bacteria | 2258 |
| 484 | Ga0495640_0012005 | 3300046533 | Bacteria | 6638 |
| 485 | Ga0495640_0051208 | 3300046533 | Bacteria | 2839 |
| 486 | Ga0495586_0065608 | 3300046535 | Bacteria | 1979 |
| 487 | Ga0495586_0102619 | 3300046535 | Bacteria | 1588 |
| 488 | Ga0495587_0013918 | 3300046536 | Bacteria | 5051 |
| 489 | Ga0495598_0008711 | 3300046537 | Bacteria | 2371 |
| 490 | Ga0495621_0003636 | 3300046539 | Bacteria | 4258 |
| 491 | Ga0495597_0025361 | 3300046542 | Bacteria | 2729 |
| 492 | Ga0495645_0002892 | 3300046543 | Bacteria | 11651 |
| 493 | Ga0495645_0017294 | 3300046543 | Bacteria | 5164 |
| 494 | Ga0495645_0106242 | 3300046543 | Bacteria | 1991 |
| 495 | Ga0495622_0008376 | 3300046557 | Bacteria | 4787 |
| 496 | Ga0495622_0019399 | 3300046557 | Bacteria | 3166 |
| 497 | Ga0495622_0025062 | 3300046557 | Bacteria | 2786 |
| 498 | Ga0495622_0074110 | 3300046557 | Bacteria | 1570 |
| 499 | Ga0495667_0000121 | 3300046559 | Bacteria | 56223 |
| 500 | Ga0495667_0089536 | 3300046559 | Bacteria | 1995 |
| 501 | Ga0495656_0036134 | 3300046615 | Bacteria | 2033 |
| 502 | Ga0495668_0014949 | 3300046616 | Bacteria | 4541 |
| 503 | Ga0495668_0130633 | 3300046616 | Bacteria | 1375 |
| 504 | Ga0495634_0003845 | 3300046642 | Bacteria | 11930 |
| 505 | Ga0495634_0005513 | 3300046642 | Bacteria | 9723 |
| 506 | Ga0495634_0033594 | 3300046642 | Bacteria | 3525 |
| 507 | Ga0495611_0042236 | 3300046648 | Bacteria | 2035 |
| 508 | Ga0495635_0000072 | 3300046663 | Bacteria | 62736 |
| 509 | Ga0495635_0050480 | 3300046663 | Bacteria | 2867 |
| 510 | Ga0495635_0106263 | 3300046663 | Bacteria | 1917 |
| 511 | Ga0495661_0029665 | 3300046665 | Bacteria | 3489 |
| 512 | Ga0495588_0002782 | 3300046674 | Bacteria | 7516 |
| 513 | Ga0495588_0046101 | 3300046674 | Bacteria | 2236 |
| 514 | Ga0495657_0004271 | 3300046675 | Bacteria | 11423 |
| 515 | Ga0495657_0081334 | 3300046675 | Bacteria | 2095 |
| 516 | Ga0495599_0007431 | 3300046678 | Bacteria | 6644 |
| 517 | Ga0495599_0087390 | 3300046678 | Bacteria | 1946 |
| 518 | Ga0495599_0190866 | 3300046678 | Bacteria | 1260 |
| 519 | Ga0495623_0010400 | 3300046679 | Bacteria | 6021 |
| 520 | Ga0495623_0025588 | 3300046679 | Bacteria | 3801 |
| 521 | Ga0495623_0191831 | 3300046679 | Bacteria | 1180 |
| 522 | Ga0495646_0007628 | 3300046680 | Bacteria | 6875 |
| 523 | Ga0495646_0008794 | 3300046680 | Bacteria | 6413 |
| 524 | Ga0495658_0005786 | 3300046683 | Bacteria | 6069 |
| 525 | Ga0495669_0034515 | 3300046684 | Bacteria | 2230 |
| 526 | Ga0495613_0055857 | 3300046689 | Bacteria | 2900 |
| 527 | Ga0495624_0027494 | 3300046690 | Bacteria | 3724 |
| 528 | Ga0495624_0298135 | 3300046690 | Bacteria | 972 |
| 529 | Ga0495624_0318924 | 3300046690 | Bacteria | 936 |
| 530 | Ga0495600_0001929 | 3300046809 | Bacteria | 11644 |
| 531 | Ga0495600_0014429 | 3300046809 | Bacteria | 4980 |
| 532 | Ga0495600_0019457 | 3300046809 | Bacteria | 4335 |
| 533 | Ga0495581_0217083 | 3300047315 | Bacteria | 1118 |
| 534 | Ga0495604_0002223 | 3300047317 | Bacteria | 15540 |
| 535 | Ga0495604_0061619 | 3300047317 | Bacteria | 2868 |
| 536 | Ga0495604_0101523 | 3300047317 | Bacteria | 2113 |
| 537 | Ga0495604_0107801 | 3300047317 | Bacteria | 2036 |
| 538 | Ga0495674_0019201 | 3300047319 | Bacteria | 6350 |
| 539 | Ga0495676_0076145 | 3300047321 | Bacteria | 2563 |
| 540 | Ga0495676_0126360 | 3300047321 | Bacteria | 1853 |
| 541 | Ga0495680_0004124 | 3300047322 | Bacteria | 13969 |
| 542 | Ga0495680_0005809 | 3300047322 | Bacteria | 11550 |
| 543 | Ga0495680_0213378 | 3300047322 | Bacteria | 1381 |
| 544 | Ga0495683_0034016 | 3300047323 | Bacteria | 2593 |
| 545 | Ga0495687_024727 | 3300047443 | Bacteria | 2851 |
| 546 | Ga0495675_0000796 | 3300047444 | Bacteria | 19452 |
| 547 | Ga0495673_0065492 | 3300047469 | Bacteria | 1543 |
| 548 | Ga0495684_0000594 | 3300047471 | Bacteria | 29100 |
| 549 | Ga0495684_0013378 | 3300047471 | Bacteria | 6316 |
| 550 | Ga0495686_0011720 | 3300047472 | Bacteria | 6174 |
| 551 | Ga0495686_0099424 | 3300047472 | Bacteria | 1756 |
| 552 | Ga0495686_0184267 | 3300047472 | Bacteria | 1208 |
| 553 | Ga0495593_0000109 | 3300047673 | Bacteria | 38355 |
| 554 | Ga0495593_0005454 | 3300047673 | Bacteria | 7514 |
| 555 | Ga0495602_0059252 | 3300048088 | Bacteria | 3343 |
| 556 | Ga0496100_0059271 | 3300048903 | Bacteria | 2515 |
| 557 | Ga0496100_0227387 | 3300048903 | Bacteria | 1371 |
| 558 | Ga0496100_0349089 | 3300048903 | Bacteria | 1117 |
| 559 | Ga0496101_0195107 | 3300048904 | Bacteria | 1564 |
| 560 | Ga0496102_0059510 | 3300048905 | Bacteria | 3493 |
| 561 | Ga0496102_0141472 | 3300048905 | Bacteria | 2256 |
| 562 | Ga0496102_0238524 | 3300048905 | Bacteria | 1715 |
| 563 | Ga0496103_0158823 | 3300048906 | Bacteria | 1450 |
| 564 | Ga0496103_0362844 | 3300048906 | Bacteria | 931 |
| 565 | Ga0496104_0022858 | 3300048907 | Bacteria | 5745 |
| 566 | Ga0496104_0025881 | 3300048907 | Bacteria | 5411 |
| 567 | Ga0496104_0119514 | 3300048907 | Bacteria | 2530 |
| 568 | Ga0496104_0136213 | 3300048907 | Bacteria | 2359 |
| 569 | Ga0496104_0322214 | 3300048907 | Bacteria | 1458 |
| 570 | Ga0496105_0016080 | 3300048908 | Bacteria | 5968 |
| 571 | Ga0496105_0018663 | 3300048908 | Bacteria | 5583 |
| 572 | Ga0496105_0200828 | 3300048908 | Bacteria | 1627 |
| 573 | Ga0496105_0457072 | 3300048908 | Bacteria | 1007 |
| 574 | Ga0496106_0000810 | 3300048909 | Bacteria | 22635 |
| 575 | Ga0496106_0003710 | 3300048909 | Bacteria | 11397 |
| 576 | Ga0496106_0005291 | 3300048909 | Bacteria | 9565 |
| 577 | Ga0496106_0020798 | 3300048909 | Bacteria | 4870 |
| 578 | Ga0496106_0050257 | 3300048909 | Bacteria | 3142 |
| 579 | Ga0496106_0147241 | 3300048909 | Bacteria | 1856 |
| 580 | Ga0496106_0186598 | 3300048909 | Bacteria | 1647 |
| 581 | Ga0496107_0019565 | 3300048910 | Bacteria | 4777 |
| 582 | Ga0496107_0088718 | 3300048910 | Bacteria | 2257 |
| 583 | Ga0496107_0189635 | 3300048910 | Bacteria | 1527 |
| 584 | Ga0496108_0000553 | 3300048911 | Bacteria | 29302 |
| 585 | Ga0496108_0021077 | 3300048911 | Bacteria | 5355 |
| 586 | Ga0496108_0036900 | 3300048911 | Bacteria | 4068 |
| 587 | Ga0496108_0085617 | 3300048911 | Bacteria | 2676 |
| 588 | Ga0496109_0000574 | 3300048912 | Bacteria | 30746 |
| 589 | Ga0496109_0024805 | 3300048912 | Bacteria | 5335 |
| 590 | Ga0496109_0064237 | 3300048912 | Bacteria | 3359 |
| 591 | Ga0496109_0067828 | 3300048912 | Bacteria | 3269 |
| 592 | Ga0496109_0241098 | 3300048912 | Bacteria | 1701 |
| 593 | Ga0496109_0473789 | 3300048912 | Bacteria | 1182 |
| 594 | Ga0496110_0005711 | 3300048913 | Bacteria | 9773 |
| 595 | Ga0496110_0026129 | 3300048913 | Bacteria | 4993 |
| 596 | Ga0496110_0029231 | 3300048913 | Bacteria | 4741 |
| 597 | Ga0496110_0137677 | 3300048913 | Bacteria | 2207 |
| 598 | Ga0496110_0237494 | 3300048913 | Bacteria | 1658 |
| 599 | Ga0496111_0039981 | 3300048914 | Bacteria | 3364 |
| 600 | Ga0496111_0059186 | 3300048914 | Bacteria | 2775 |
| 601 | Ga0496111_0265441 | 3300048914 | Bacteria | 1274 |
| 602 | Ga0496112_0000065 | 3300048915 | Bacteria | 70119 |
| 603 | Ga0496112_0063136 | 3300048915 | Bacteria | 3653 |
| 604 | Ga0496112_0218859 | 3300048915 | Bacteria | 1860 |
| 605 | Ga0496113_0013203 | 3300048916 | Bacteria | 5584 |
| 606 | Ga0496113_0063812 | 3300048916 | Bacteria | 2784 |
| 607 | Ga0496114_0013002 | 3300048917 | Bacteria | 6670 |
| 608 | Ga0496114_0024895 | 3300048917 | Bacteria | 4887 |
| 609 | Ga0496115_0030945 | 3300048918 | Bacteria | 4215 |
| 610 | Ga0496115_0314690 | 3300048918 | Bacteria | 1281 |
| 611 | Ga0496116_0011726 | 3300048919 | Bacteria | 7222 |
| 612 | Ga0496116_0060481 | 3300048919 | Bacteria | 2457 |
| 613 | Ga0496117_0016493 | 3300048920 | Bacteria | 6233 |
| 614 | Ga0496117_0023589 | 3300048920 | Bacteria | 4897 |
| 615 | Ga0496117_0078189 | 3300048920 | Bacteria | 2185 |
| 616 | Ga0496117_0146296 | 3300048920 | Bacteria | 1406 |
| 617 | Ga0496118_0003925 | 3300048921 | Bacteria | 18200 |
| 618 | Ga0496118_0021615 | 3300048921 | Bacteria | 5656 |
| 619 | Ga0496118_0063550 | 3300048921 | Bacteria | 2715 |
| 620 | Ga0496118_0091088 | 3300048921 | Bacteria | 2098 |
| 621 | Ga0496119_0022737 | 3300048922 | Bacteria | 4477 |
| 622 | Ga0496120_0016701 | 3300048923 | Bacteria | 4788 |
| 623 | Ga0496120_0023248 | 3300048923 | Bacteria | 3882 |
| 624 | Ga0496121_0000453 | 3300048924 | Bacteria | 80749 |
| 625 | Ga0496121_0008938 | 3300048924 | Bacteria | 11632 |
| 626 | Ga0496121_0016252 | 3300048924 | Bacteria | 7698 |
| 627 | Ga0496121_0033524 | 3300048924 | Bacteria | 4645 |
| 628 | Ga0496121_0061029 | 3300048924 | Bacteria | 3096 |
| 629 | Ga0496121_0064084 | 3300048924 | Bacteria | 2998 |
| 630 | Ga0496121_0065818 | 3300048924 | Bacteria | 2946 |
| 631 | Ga0496121_0082471 | 3300048924 | Bacteria | 2542 |
| 632 | Ga0496121_0090747 | 3300048924 | Bacteria | 2387 |
| 633 | Ga0496121_0123319 | 3300048924 | Bacteria | 1953 |
| 634 | Ga0496121_0138532 | 3300048924 | Bacteria | 1809 |
| 635 | Ga0496121_0142570 | 3300048924 | Bacteria | 1775 |
| 636 | Ga0496121_0183747 | 3300048924 | Bacteria | 1506 |
| 637 | Ga0496121_0209684 | 3300048924 | Bacteria | 1381 |
| 638 | Ga0496122_0036966 | 3300048925 | Bacteria | 3939 |
| 639 | Ga0496122_0197384 | 3300048925 | Bacteria | 1180 |
| 640 | Ga0496123_0020379 | 3300048926 | Bacteria | 5188 |
| 641 | Ga0496123_0102550 | 3300048926 | Bacteria | 1660 |
| 642 | Ga0496124_0000750 | 3300048927 | Bacteria | 53262 |
| 643 | Ga0496124_0016867 | 3300048927 | Bacteria | 6921 |
| 644 | Ga0496124_0166292 | 3300048927 | Bacteria | 1714 |
| 645 | Ga0496125_0000904 | 3300048928 | Bacteria | 46904 |
| 646 | Ga0496125_0004420 | 3300048928 | Bacteria | 16237 |
| 647 | Ga0496125_0022357 | 3300048928 | Bacteria | 5875 |
| 648 | Ga0496125_0038808 | 3300048928 | Bacteria | 4113 |
| 649 | Ga0496125_0046908 | 3300048928 | Bacteria | 3619 |
| 650 | Ga0496125_0085989 | 3300048928 | Bacteria | 2380 |
| 651 | Ga0496125_0093476 | 3300048928 | Bacteria | 2244 |
| 652 | Ga0496126_0003797 | 3300048929 | Bacteria | 18757 |
| 653 | Ga0496126_0009534 | 3300048929 | Bacteria | 10299 |
| 654 | Ga0496126_0009773 | 3300048929 | Bacteria | 10155 |
| 655 | Ga0496126_0018824 | 3300048929 | Bacteria | 6826 |
| 656 | Ga0496126_0036538 | 3300048929 | Bacteria | 4592 |
| 657 | Ga0496126_0059273 | 3300048929 | Bacteria | 3447 |
| 658 | Ga0496126_0070519 | 3300048929 | Bacteria | 3113 |
| 659 | Ga0496126_0086648 | 3300048929 | Bacteria | 2760 |
| 660 | Ga0496126_0131208 | 3300048929 | Bacteria | 2165 |
| 661 | Ga0496126_0134174 | 3300048929 | Bacteria | 2137 |
| 662 | Ga0496126_0145610 | 3300048929 | Bacteria | 2035 |
| 663 | Ga0496126_0174311 | 3300048929 | Bacteria | 1830 |
| 664 | Ga0496126_0184634 | 3300048929 | Bacteria | 1769 |
| 665 | Ga0496126_0202129 | 3300048929 | Bacteria | 1677 |
| 666 | Ga0496126_0250679 | 3300048929 | Bacteria | 1475 |
| 667 | Ga0495682_0100351 | 3300049460 | Bacteria | 1038 |
| 668 | Ga0501031_0065487 | 3300049568 | Bacteria | 2367 |
| 669 | Ga0501031_0110783 | 3300049568 | Bacteria | 1792 |
| 670 | Ga0501031_0153444 | 3300049568 | Bacteria | 1505 |
| 671 | Ga0501032_0000309 | 3300049569 | Bacteria | 41024 |
| 672 | Ga0501032_0012183 | 3300049569 | Bacteria | 6156 |
| 673 | Ga0501032_0057767 | 3300049569 | Bacteria | 2606 |
| 674 | Ga0501032_0113478 | 3300049569 | Bacteria | 1792 |
| 675 | Ga0501033_0001437 | 3300049570 | Bacteria | 21135 |
| 676 | Ga0501033_0001798 | 3300049570 | Bacteria | 18709 |
| 677 | Ga0501033_0066912 | 3300049570 | Bacteria | 2642 |
| 678 | Ga0501034_0000082 | 3300049571 | Bacteria | 170039 |
| 679 | Ga0501034_0471396 | 3300049571 | Bacteria | 1171 |
| 680 | Ga0501036_0000121 | 3300049572 | Bacteria | 48901 |
| 681 | Ga0501036_0033677 | 3300049572 | Bacteria | 4332 |
| 682 | Ga0501036_0089080 | 3300049572 | Bacteria | 2607 |
| 683 | Ga0501036_0281725 | 3300049572 | Bacteria | 1391 |
| 684 | Ga0501037_0000346 | 3300049573 | Bacteria | 39162 |
| 685 | Ga0501037_0004074 | 3300049573 | Bacteria | 10593 |
| 686 | Ga0501037_0072499 | 3300049573 | Bacteria | 2504 |
| 687 | Ga0501037_0185307 | 3300049573 | Bacteria | 1475 |
| 688 | Ga0501037_0260649 | 3300049573 | Bacteria | 1211 |
| 689 | Ga0501038_0001766 | 3300049574 | Bacteria | 20109 |
| 690 | Ga0501038_0002992 | 3300049574 | Bacteria | 15757 |
| 691 | Ga0501038_0025916 | 3300049574 | Bacteria | 5222 |
| 692 | Ga0501038_0050259 | 3300049574 | Bacteria | 3603 |
| 693 | Ga0501039_0009593 | 3300049575 | Bacteria | 7379 |
| 694 | Ga0501042_0119470 | 3300049578 | Bacteria | 1897 |
| 695 | Ga0501043_0000109 | 3300049579 | Bacteria | 77120 |
| 696 | Ga0501043_0002169 | 3300049579 | Bacteria | 16748 |
| 697 | Ga0501043_0035788 | 3300049579 | Bacteria | 3906 |
| 698 | Ga0501043_0182396 | 3300049579 | Bacteria | 1635 |
| 699 | Ga0501043_0185141 | 3300049579 | Bacteria | 1621 |
| 700 | Ga0501046_0000101 | 3300049580 | Bacteria | 91179 |
| 701 | Ga0501046_0016838 | 3300049580 | Bacteria | 6112 |
| 702 | Ga0501046_0035094 | 3300049580 | Bacteria | 4042 |
| 703 | Ga0501046_0046444 | 3300049580 | Bacteria | 3446 |
| 704 | Ga0501047_0000331 | 3300049581 | Bacteria | 54371 |
| 705 | Ga0501047_0185685 | 3300049581 | Bacteria | 1944 |
| 706 | Ga0501047_0233372 | 3300049581 | Bacteria | 1692 |
| 707 | Ga0501047_0327336 | 3300049581 | Bacteria | 1371 |
| 708 | Ga0501047_0419051 | 3300049581 | Bacteria | 1170 |
| 709 | Ga0501048_0002703 | 3300049582 | Bacteria | 13534 |
| 710 | Ga0501048_0039082 | 3300049582 | Bacteria | 3405 |
| 711 | Ga0501067_0000534 | 3300049583 | Bacteria | 20715 |
| 712 | Ga0501067_0022379 | 3300049583 | Bacteria | 3498 |
| 713 | Ga0501068_0000276 | 3300049584 | Bacteria | 25409 |
| 714 | Ga0501069_0013535 | 3300049585 | Bacteria | 4350 |
| 715 | Ga0501069_0014951 | 3300049585 | Bacteria | 4157 |
| 716 | Ga0501070_0024493 | 3300049586 | Bacteria | 5062 |
| 717 | Ga0501070_0026242 | 3300049586 | Bacteria | 4890 |
| 718 | Ga0501070_0338481 | 3300049586 | Bacteria | 1222 |
| 719 | Ga0501071_0120319 | 3300049587 | Bacteria | 1946 |
| 720 | Ga0501072_0004822 | 3300049588 | Bacteria | 10270 |
| 721 | Ga0501073_0000101 | 3300049589 | Bacteria | 54365 |
| 722 | Ga0501073_0041906 | 3300049589 | Bacteria | 3233 |
| 723 | Ga0501073_0072300 | 3300049589 | Bacteria | 2402 |
| 724 | Ga0501073_0075602 | 3300049589 | Bacteria | 2344 |
| 725 | Ga0501074_0000187 | 3300049590 | Bacteria | 33711 |
| 726 | Ga0501074_0043006 | 3300049590 | Bacteria | 3269 |
| 727 | Ga0501074_0107986 | 3300049590 | Bacteria | 1992 |
| 728 | Ga0501074_0268326 | 3300049590 | Bacteria | 1213 |
| 729 | Ga0501075_0311320 | 3300049591 | Bacteria | 1200 |
| 730 | Ga0501076_0074021 | 3300049592 | Bacteria | 2728 |
| 731 | Ga0501077_0175211 | 3300049593 | Bacteria | 1363 |
| 732 | Ga0501079_0001908 | 3300049741 | Bacteria | 14946 |
| 733 | Ga0501079_0151248 | 3300049741 | Bacteria | 1809 |
| 734 | Ga0501080_0000151 | 3300049742 | Bacteria | 49588 |
| 735 | Ga0501080_0021394 | 3300049742 | Bacteria | 5987 |
| 736 | Ga0501080_0109145 | 3300049742 | Bacteria | 2564 |
| 737 | Ga0501081_0520119 | 3300049743 | Bacteria | 888 |
| 738 | Ga0501083_0008996 | 3300049744 | Bacteria | 7049 |
| 739 | Ga0501035_0000150 | 3300049822 | Bacteria | 85450 |
| 740 | Ga0501035_0011129 | 3300049822 | Bacteria | 8332 |
| 741 | Ga0501035_0178343 | 3300049822 | Bacteria | 1831 |
| 742 | Ga0501035_0186263 | 3300049822 | Bacteria | 1786 |
| 743 | Ga0501044_0000247 | 3300049823 | Bacteria | 68674 |
| 744 | Ga0501044_0013306 | 3300049823 | Bacteria | 8905 |
| 745 | Ga0501044_0112903 | 3300049823 | Bacteria | 2724 |
| 746 | Ga0501044_0114019 | 3300049823 | Bacteria | 2709 |
| 747 | Ga0501044_0259203 | 3300049823 | Bacteria | 1677 |
| 748 | Ga0501045_0047178 | 3300049824 | Bacteria | 3137 |
| 749 | Ga0501045_0074857 | 3300049824 | Bacteria | 2493 |
| 750 | nmdc:mga03683_54403_c1 | 3300050489 | Bacteria | 1678 |
| 751 | nmdc:mga03683_66648_c2 | 3300050489 | Bacteria | 1242 |
| 752 | nmdc:mga0yw44_11582_c1 | 3300050492 | Bacteria | 4562 |
| 753 | nmdc:mga0yw44_14024_c1 | 3300050492 | Bacteria | 4240 |
| 754 | nmdc:mga06z11_301190_c1 | 3300050494 | Bacteria | 953 |
| 755 | nmdc:mga06z11_7575_c1 | 3300050494 | Bacteria | 4478 |
| 756 | nmdc:mga04h51_76390_c1 | 3300050495 | Bacteria | 1180 |
| 757 | nmdc:mga07m45_12889_c2 | 3300050496 | Bacteria | 2315 |
| 758 | nmdc:mga07m45_17137_c1 | 3300050496 | Bacteria | 3885 |
| 759 | nmdc:mga07m45_286619_c1 | 3300050496 | Bacteria | 958 |
| 760 | nmdc:mga08y16_30607_c1 | 3300050511 | Bacteria | 5663 |
| 761 | nmdc:mga0n895_182371_c1 | 3300050512 | Bacteria | 2131 |
| 762 | nmdc:mga0rr50_98258_c1 | 3300050513 | Bacteria | 2294 |
| 763 | nmdc:mga0sz30_125054_c1 | 3300050516 | Bacteria | 1131 |
| 764 | nmdc:mga0sz30_313341_c1 | 3300050516 | Bacteria | 700 |
| 765 | nmdc:mga0sz30_7570_c1 | 3300050516 | Bacteria | 4077 |
| 766 | Ga0495612_0011897 | 3300053078 | Bacteria | 3508 |
| 767 | Ga0500610_0136998 | 3300053079 | Bacteria | 1240 |
| 768 | Ga0500635_0005628 | 3300053080 | Bacteria | 3300 |
| 769 | Ga0495595_0011842 | 3300053084 | Bacteria | 3656 |
| 770 | Ga0495595_0036132 | 3300053084 | Bacteria | 2241 |
| 771 | Ga0495619_0010257 | 3300053085 | Bacteria | 5898 |
| 772 | Ga0495619_0042088 | 3300053085 | Bacteria | 2990 |
| 773 | Ga0495619_0148101 | 3300053085 | Bacteria | 1619 |
| 774 | Ga0495619_0339141 | 3300053085 | Bacteria | 1040 |
| 775 | Ga0500643_006068 | 3300053087 | Bacteria | 5105 |
| 776 | Ga0500644_0028928 | 3300053088 | Bacteria | 1737 |
| 777 | Ga0500647_0176463 | 3300053091 | Bacteria | 983 |
| 778 | Ga0500651_0024154 | 3300053093 | Bacteria | 3810 |
| 779 | Ga0500566_0000029 | 3300053094 | Bacteria | 75384 |
| 780 | Ga0500566_0000139 | 3300053094 | Bacteria | 37343 |
| 781 | Ga0500566_0036505 | 3300053094 | Bacteria | 2850 |
| 782 | Ga0500566_0092168 | 3300053094 | Bacteria | 1674 |
| 783 | Ga0500554_058443 | 3300053102 | Bacteria | 1231 |
| 784 | Ga0500555_003871 | 3300053103 | Bacteria | 4258 |
| 785 | Ga0500556_0000019 | 3300053104 | Bacteria | 186017 |
| 786 | Ga0500569_000864 | 3300053109 | Bacteria | 5377 |
| 787 | Ga0500572_000149 | 3300053111 | Bacteria | 24147 |
| 788 | Ga0500592_006645 | 3300053116 | Bacteria | 1841 |
| 789 | Ga0500595_001557 | 3300053119 | Bacteria | 12138 |
| 790 | Ga0500595_002157 | 3300053119 | Bacteria | 10008 |
| 791 | Ga0500595_002381 | 3300053119 | Bacteria | 9399 |
| 792 | Ga0500595_011704 | 3300053119 | Bacteria | 3419 |
| 793 | Ga0500608_035435 | 3300053122 | Bacteria | 2380 |
| 794 | Ga0500618_014388 | 3300053125 | Bacteria | 2022 |
| 795 | Ga0500642_0000039 | 3300053130 | Bacteria | 98235 |
| 796 | Ga0500642_0087538 | 3300053130 | Bacteria | 1437 |
| 797 | Ga0500559_0000749 | 3300053136 | Bacteria | 21314 |
| 798 | Ga0500559_0059150 | 3300053136 | Bacteria | 1705 |
| 799 | Ga0500568_0001467 | 3300053139 | Bacteria | 15123 |
| 800 | Ga0500568_0010187 | 3300053139 | Bacteria | 4417 |
| 801 | Ga0500577_0006079 | 3300053142 | Bacteria | 3301 |
| 802 | Ga0500603_001045 | 3300053150 | Bacteria | 6502 |
| 803 | Ga0500603_070198 | 3300053150 | Bacteria | 997 |
| 804 | Ga0500616_0000059 | 3300053153 | Bacteria | 259741 |
| 805 | Ga0500616_0015647 | 3300053153 | Bacteria | 4331 |
| 806 | Ga0500622_0015463 | 3300053156 | Bacteria | 4084 |
| 807 | Ga0500622_0020016 | 3300053156 | Bacteria | 3553 |
| 808 | Ga0500622_0036772 | 3300053156 | Bacteria | 2559 |
| 809 | Ga0500634_0062671 | 3300053161 | Bacteria | 1969 |
| 810 | Ga0500639_007050 | 3300053163 | Bacteria | 5827 |
| 811 | Ga0500639_024117 | 3300053163 | Bacteria | 3215 |
| 812 | Ga0500636_0016432 | 3300053177 | Bacteria | 4364 |
| 813 | Ga0500636_0023448 | 3300053177 | Bacteria | 3648 |
| 814 | Ga0500636_0024936 | 3300053177 | Bacteria | 3535 |
| 815 | Ga0500637_0139482 | 3300053178 | Bacteria | 1403 |
| 816 | Ga0500637_0288960 | 3300053178 | Bacteria | 899 |
| 817 | Ga0500645_015281 | 3300053730 | Bacteria | 2434 |
| 818 | Ga0500552_006345 | 3300053733 | Bacteria | 1324 |
| 819 | Ga0500596_009571 | 3300053735 | Bacteria | 1510 |
| 820 | Ga0500601_000189 | 3300053737 | Bacteria | 12584 |
| 821 | Ga0501084_0034045 | 3300054114 | Bacteria | 4260 |
| 822 | Ga0501084_0084687 | 3300054114 | Bacteria | 2661 |
| 823 | Ga0500661_001073 | 3300055283 | Bacteria | 5159 |
| 824 | Ga0501082_0000447 | 3300060353 | Bacteria | 36502 |
| 825 | Ga0501082_0000706 | 3300060353 | Bacteria | 29338 |
| 826 | Ga0501082_0005797 | 3300060353 | Bacteria | 10721 |
| 827 | Ga0466962_0137023 | 3300061719 | Bacteria | 1185 |
| 828 | 2507505606 | 2507262055 | Bacteria | 8048963 |
| 829 | 2508539499 | 2508501009 | Bacteria | 7784016 |
| 830 | 2508695867 | 2508501042 | Bacteria | 8719808 |
| 831 | 2509150130 | 2508501128 | Bacteria | 8613869 |
| 832 | 2511401127 | 2511231028 | Bacteria | 8046582 |
| 833 | 2513624732 | 2513237092 | Bacteria | 8341956 |
| 834 | 2513642280 | 2513237094 | Bacteria | 8789602 |
| 835 | 2513652783 | 2513237095 | Bacteria | 8976980 |
| 836 | 2513660717 | 2513237096 | Bacteria | 8722461 |
| 837 | 2513673922 | 2513237098 | Bacteria | 9902361 |
| 838 | 2513700409 | 2513237102 | Bacteria | 7703324 |
| 839 | 2513862515 | 2513237137 | Bacteria | 9558895 |
| 840 | 2513876953 | 2513237139 | Bacteria | 8737671 |
| 841 | 2513922513 | 2513237145 | Bacteria | 8979722 |
| 842 | 2517105904 | 2517093001 | Bacteria | 9002274 |
| 843 | 2517888454 | 2517572143 | Bacteria | 9484767 |
| 844 | 2524440059 | 2524023205 | Bacteria | 8918781 |
| 845 | 2524468372 | 2524023210 | Bacteria | 9029266 |
| 846 | 2524535244 | 2524023228 | Bacteria | 10118060 |
| 847 | 2528852093 | 2528768022 | Bacteria | 10457665 |
| 848 | 2603862312 | 2602042107 | Bacteria | 6226103 |
| 849 | 2617377275 | 2617270741 | Bacteria | 8201522 |
| 850 | 2671123607 | 2667528175 | Bacteria | 7532676 |
| 851 | 2728752042 | 2728368998 | Bacteria | 8720350 |
| 852 | 2745077829 | 2744054633 | Bacteria | 8678936 |
| 853 | 2793065619 | 2791355196 | Bacteria | 7323613 |
| 854 | 2793065940 | 2791355196 | Bacteria | 7323613 |
| 855 | 2793067268 | 2791355197 | Bacteria | 8420563 |
| 856 | 2793077095 | |||
| 857 | 2805921252 | 2802429603 | Bacteria | 8777136 |
| 858 | 2818239235 | 2816332527 | Bacteria | 8933356 |
| 859 | 2824631755 | 2824626560 | Bacteria | 8813858 |
| 860 | 2824750311 | 2824746037 | Bacteria | 7911610 |
| 861 | 2824762092 | 2824753945 | Bacteria | 9787441 |
| 862 | 2824772413 | 2824763712 | Bacteria | 9792355 |
| 863 | 2841965139 | 2841957949 | Bacteria | 8652217 |
| 864 | 2842041344 | 2842038055 | Bacteria | 8002051 |
| 865 | 2842049386 | 2842045827 | Bacteria | 8006841 |
| 866 | 2844315841 | 2844315083 | Bacteria | 8138177 |
| 867 | 2847930736 | 2847930680 | Bacteria | 9342022 |
| 868 | 2847942654 | 2847939898 | Bacteria | 8606328 |
| 869 | 2849083408 | 2849076700 | Bacteria | 7039503 |
| 870 | 2857515615 | 2857509624 | Bacteria | 7472071 |
| 871 | 2874591114 | 2874590934 | Bacteria | 8299676 |
| 872 | 2874617130 | 2874612657 | Bacteria | 8252029 |
| 873 | 2874621361 | 2874620515 | Bacteria | 8290088 |
| 874 | 2874636782 | 2874628541 | Bacteria | 8630250 |
| 875 | 2874647751 | 2874645413 | Bacteria | 8214782 |
| 876 | 2876764040 | 2876761206 | Bacteria | 10111113 |
| 877 | 2876772045 | 2876771140 | Bacteria | 8287509 |
| 878 | 2876819298 | 2876818435 | Bacteria | 8274608 |
| 879 | 2879074962 | 2879074833 | Bacteria | 8279565 |
| 880 | 2879089876 | 2879083081 | Bacteria | 8587928 |
| 881 | 2879106719 | 2879099564 | Bacteria | 10442239 |
| 882 | 2879112806 | 2879110137 | Bacteria | 8907982 |
| 883 | 2879135781 | 2879127579 | Bacteria | 8294491 |
| 884 | 2879150946 | 2879142872 | Bacteria | 8267021 |
| 885 | 2881367125 | 2881364244 | Bacteria | 7710352 |
| 886 | 2885368699 | 2885366525 | Bacteria | 8326213 |
| 887 | 2885377364 | 2885374607 | Bacteria | 8927485 |
| 888 | 2885411199 | 2885409591 | Bacteria | 9235467 |
| 889 | 2888379131 | 2888378607 | Bacteria | 9652610 |
| 890 | 2888390309 | 2888388044 | Bacteria | 7304136 |
| 891 | 2903730859 | 2903727486 | Bacteria | 8281579 |
| 892 | 2903775701 | 2903768456 | Bacteria | 9749579 |
| 893 | 2904668031 | 2904666416 | Bacteria | 8226587 |
| 894 | 2904707968 | |||
| 895 | 2904714162 | 2904711408 | Bacteria | 9771557 |
| 896 | 2906603682 | 2906602504 | Bacteria | 8295279 |
| 897 | 2906614184 | |||
| 898 | 2906639343 | 2906635258 | Bacteria | 8601019 |
| 899 | 2906648055 | 2906643746 | Bacteria | 8722424 |
| 900 | 2906668438 | 2906660503 | Bacteria | 8595048 |
| 901 | 2908746984 | 2908739725 | Bacteria | 8628932 |
| 902 | 2908775789 | 2908775508 | Bacteria | 8092255 |
| 903 | 2919074338 | 2919073203 | Bacteria | 6531949 |
| 904 | 2922364348 | 2922361189 | Bacteria | 7436256 |
| 905 | 2922369136 | |||
| 906 | 2932789032 | 2932784394 | Bacteria | 9704911 |
| 907 | 2932814331 | 2932809354 | Bacteria | 9135765 |
| 908 | 2932820457 | 2932818245 | Bacteria | 9955613 |
| 909 | 2932834489 | 2932828146 | Bacteria | 9745859 |
| 910 | 2933580300 | 2933577622 | Bacteria | 9116884 |
| 911 | 2935614661 | 2935608549 | Bacteria | 8203142 |
| 912 | 2935624472 | 2935616580 | Bacteria | 9032984 |
| 913 | 2935636636 | 2935630451 | Bacteria | 8169952 |
| 914 | 2935645862 | 2935638405 | Bacteria | 10015038 |
| 915 | 2935649051 | 2935648319 | Bacteria | 8801166 |
| 916 | 2935658177 | 2935656913 | Bacteria | 8965014 |
| 917 | 2935673429 | 2935665750 | Bacteria | 9571747 |
| 918 | 2935682606 | 2935675223 | Bacteria | 9928132 |
| 919 | 2935686780 | 2935684952 | Bacteria | 9590419 |
| 920 | 2935701540 | 2935694250 | Bacteria | 9291695 |
| 921 | 2935710485 | 2935703347 | Bacteria | 10242284 |
| 922 | 2935716468 | 2935713505 | Bacteria | 9608509 |
| 923 | 2935723407 | 2935722832 | Bacteria | 9608746 |
| 924 | 2935734963 | 2935732158 | Bacteria | 9706831 |
| 925 | 2935744246 | 2935741537 | Bacteria | 9707219 |
| 926 | 2935752746 | 2935750917 | Bacteria | 9590372 |
| 927 | 2935764707 | 2935760218 | Bacteria | 9817913 |
| 928 | 2935774127 | 2935769743 | Bacteria | 7878163 |
| 929 | 2935783739 | 2935777560 | Bacteria | 8077691 |
| 930 | 2935789156 | 2935785616 | Bacteria | 7962367 |
| 931 | 2935796905 | 2935793552 | Bacteria | 8012592 |
| 932 | 2935806182 | 2935801545 | Bacteria | 9301974 |
| 933 | 2935816948 | 2935810662 | Bacteria | 9401221 |
| 934 | 2935826298 | 2935819856 | Bacteria | 8261050 |
| 935 | 2935835237 | 2935827899 | Bacteria | 10038562 |
| 936 | 2935841381 | 2935837841 | Bacteria | 9454360 |
| 937 | 2935853794 | 2935847175 | Bacteria | 8228321 |
| 938 | 2935863051 | 2935855204 | Bacteria | 9035059 |
| 939 | 2935871861 | 2935864058 | Bacteria | 9784707 |
| 940 | 2935882248 | 2935873716 | Bacteria | 9632195 |
| 941 | 2935911015 | 2935908558 | Bacteria | 8568796 |
| 942 | 2935924176 | 2935916978 | Bacteria | 9113783 |
| 943 | 2935932771 | 2935926038 | Bacteria | 8601059 |
| 944 | 2935937334 | 2935934488 | Bacteria | 8602579 |
| 945 | 2935949465 | 2935942939 | Bacteria | 8599779 |
| 946 | 2935958136 | 2935951376 | Bacteria | 8602333 |
| 947 | 2935967226 | 2935959822 | Bacteria | 7869783 |
| 948 | 2935971209 | 2935967501 | Bacteria | 8603075 |
| 949 | 2935985335 | 2935984226 | Bacteria | 8302647 |
| 950 | 2936000181 | 2935992306 | Bacteria | 9802711 |
| 951 | 2936010095 | 2936002035 | Bacteria | 9362176 |
| 952 | 2936012396 | 2936011229 | Bacteria | 8801034 |
| 953 | 2936020523 | 2936019824 | Bacteria | 8804134 |
| 954 | 2936029689 | 2936028420 | Bacteria | 8965941 |
| 955 | 2936043939 | 2936037263 | Bacteria | 9446081 |
| 956 | 2936051846 | 2936046547 | Bacteria | 8903709 |
| 957 | 2936056901 | 2936055302 | Bacteria | 8785755 |
| 958 | 2940558659 | 2940556831 | Bacteria | 9590747 |
| 959 | 2941513272 | 2941507105 | Bacteria | 8166816 |
| 960 | 2941521235 | 2941515067 | Bacteria | 8166720 |
| 961 | 2941529053 | 2941523033 | Bacteria | 8169134 |
| 962 | 2941535692 | 2941531003 | Bacteria | 7653939 |
| 963 | 2941543607 | 2941538514 | Bacteria | 9402094 |
| 964 | 3005483538 | 3005474847 | Bacteria | 9259049 |
| 965 | 3005486392 | 3005483717 | Bacteria | 7877331 |
| 966 | 3005506266 | 3005506211 | Bacteria | 6943378 |
| 967 | 3005589047 | 3005587118 | Bacteria | 7794411 |
| 968 | 3005595425 | 3005594810 | Bacteria | 8716512 |
| 969 | 3005711385 | 3005710791 | Bacteria | 7622528 |
| 970 | 3005718659 | 3005718088 | Bacteria | 8283608 |
| 971 | 8006936711 | 8006933436 | Bacteria | 10410654 |
| 972 | 8006976681 | 8006973647 | Bacteria | 10679141 |
| 973 | 8006992446 | 8006984368 | Bacteria | 9651211 |
| 974 | 8016517770 | 8016511872 | Bacteria | 9921665 |
| 975 | 8016525831 | 8016522445 | Bacteria | 8156687 |
| 976 | 8016539434 | 8016530956 | Bacteria | 8155261 |
| 977 | 8016543723 | 8016539877 | Bacteria | 8155419 |
| 978 | 8016549571 | 8016548790 | Bacteria | 8155074 |
| 979 | 8016557991 | 8016557553 | Bacteria | 8154380 |
| 980 | 8016569124 | 8016566248 | Bacteria | 8158151 |
| 981 | 8016581761 | 8016575299 | Bacteria | 8154085 |
| 982 | 8016585943 | 8016583857 | Bacteria | 10421953 |
| 983 | 8016596007 | 8016595262 | Bacteria | 8149947 |
| 984 | 8016606881 | 8016603502 | Bacteria | 8731218 |
| 985 | 8016618788 | 8016613128 | Bacteria | 8794220 |
| 986 | 8016622746 | 8016622563 | Bacteria | 7999408 |
| 987 | 8017058860 | 8017057580 | Bacteria | 10023680 |
| 988 | 8019530714 | 8019530166 | Bacteria | 8155624 |
| 989 | 8019540871 | 8019538911 | Bacteria | 7872763 |
| 990 | 8019549744 | 8019547302 | Bacteria | 7996444 |
| 991 | 8019561999 | 8019555841 | Bacteria | 9642137 |
| 992 | 8019576791 | 8019576017 | Bacteria | 10049540 |
| 993 | 8019594847 | 8019586578 | Bacteria | 10212056 |
| 994 | 8019606892 | 8019597564 | Bacteria | 10041141 |
| 995 | 8019611616 | 8019608314 | Bacteria | 10042931 |
| 996 | 8019629751 | 8019629233 | Bacteria | 8687553 |
| 997 | 8019640865 | 8019638758 | Bacteria | 9062356 |
| 998 | 8019652962 | 8019648815 | Bacteria | 10014479 |
| 999 | 8019679664 | 8019678201 | Bacteria | 8863603 |
| 1000 | 8019695802 | 8019687851 | Bacteria | 8712826 |
| 1001 | 8055742839 | 8055742211 | Bacteria | 9226248 |
| 1002 | 8056676300 | 8056673599 | Bacteria | 7871253 |
| 1003 | 8056683032 | 8056681323 | Bacteria | 8472857 |
| 1004 | 8056693971 | 8056689827 | Bacteria | 6712655 |
| 1005 | 8056975627 | 8056967851 | Bacteria | 9038162 |
| 1006 | Ga0105247_10322914 | |||
| 1007 | JGI25153J46596_10003051 | |||
| 1008 | JGI25153J46596_10004570 | |||
| 1009 | JGI25153J46596_10006145 | |||
| 1010 | JGI25153J46596_10011665 | |||
| 1011 | JGI25153J46596_10027783 | |||
| 1012 | JGI25160J50197_1001574 | |||
| 1013 | JGI25160J50197_1001779 | |||
| 1014 | JGI25404J52841_10007176 | |||
| 1015 | Ga0055531_10005617 | |||
| 1016 | Ga0055543_1025877 | |||
| 1017 | Ga0065165_1010207 | |||
| 1018 | Ga0070658_10085417 | |||
| 1019 | Ga0070658_10103003 | |||
| 1020 | Ga0070683_100024893 | |||
| 1021 | Ga0070683_100045401 | |||
| 1022 | Ga0070683_100053436 | |||
| 1023 | Ga0070683_100170053 | |||
| 1024 | Ga0070670_100162962 | |||
| 1025 | Ga0070680_100013669 | |||
| 1026 | Ga0068868_100098967 | |||
| 1027 | Ga0070691_10009286 | |||
| 1028 | Ga0070691_10040651 | |||
| 1029 | Ga0070661_100040169 | |||
| 1030 | Ga0070668_100030308 | |||
| 1031 | Ga0070669_100625444 | |||
| 1032 | Ga0070675_100241631 | |||
| 1033 | Ga0070671_100153087 | |||
| 1034 | Ga0070659_100467565 | |||
| 1035 | Ga0070659_100586793 | |||
| 1036 | Ga0070709_10001043 | |||
| 1037 | Ga0070709_10307685 | |||
| 1038 | Ga0070714_100056148 | |||
| 1039 | Ga0070714_100274949 | |||
| 1040 | Ga0070713_100014537 | |||
| 1041 | Ga0070713_100018727 | |||
| 1042 | Ga0070713_100030913 | |||
| 1043 | Ga0070713_100228005 | |||
| 1044 | Ga0070710_10038234 | |||
| 1045 | Ga0070710_10085355 | |||
| 1046 | Ga0070711_100069956 | |||
| 1047 | Ga0070711_100159174 | |||
| 1048 | Ga0070663_100013916 | |||
| 1049 | Ga0070663_100152557 | |||
| 1050 | Ga0070663_100171144 | |||
| 1051 | Ga0070663_100206464 | |||
| 1052 | Ga0070681_10058357 | |||
| 1053 | Ga0070681_10115679 | |||
| 1054 | Ga0070681_10154365 | |||
| 1055 | Ga0070681_10168210 | |||
| 1056 | Ga0068867_100510309 | |||
| 1057 | Ga0070679_100016662 | |||
| 1058 | Ga0070679_100116273 | |||
| 1059 | Ga0070679_100306150 | |||
| 1060 | Ga0070684_100006424 | |||
| 1061 | Ga0070684_100019917 | |||
| 1062 | Ga0070684_100035699 | |||
| 1063 | Ga0070684_100551623 | |||
| 1064 | Ga0070697_100319364 | |||
| 1065 | Ga0068853_100163053 | |||
| 1066 | Ga0068853_100392583 | |||
| 1067 | Ga0070672_100628667 | |||
| 1068 | Ga0070693_100064310 | |||
| 1069 | Ga0070665_100072156 | |||
| 1070 | Ga0070665_100140122 | |||
| 1071 | Ga0070665_100244250 | |||
| 1072 | Ga0068855_100077179 | |||
| 1073 | Ga0068855_100102183 | |||
| 1074 | Ga0068855_100126380 | |||
| 1075 | Ga0068855_100197760 | |||
| 1076 | Ga0068855_100372445 | |||
| 1077 | Ga0070664_100333807 | |||
| 1078 | Ga0068857_100267796 | |||
| 1079 | Ga0068854_100614152 | |||
| 1080 | Ga0068856_100185599 | |||
| 1081 | Ga0068852_100100840 | |||
| 1082 | Ga0068859_100097876 | |||
| 1083 | Ga0068859_100153785 | |||
| 1084 | Ga0068859_100491251 | |||
| 1085 | Ga0068864_100023369 | |||
| 1086 | Ga0068864_100118956 | |||
| 1087 | Ga0068861_100278845 | |||
| 1088 | Ga0068851_10013943 | |||
| 1089 | Ga0068851_10091714 | |||
| 1090 | Ga0068858_100027108 | |||
| 1091 | Ga0068858_100148100 | |||
| 1092 | Ga0068858_100216075 | |||
| 1093 | Ga0068860_100002074 | |||
| 1094 | Ga0068860_100277662 | |||
| 1095 | Ga0081455_10005919 | |||
| 1096 | Ga0081455_10061026 | |||
| 1097 | Ga0081455_10172875 | |||
| 1098 | Ga0081455_10193448 | |||
| 1099 | Ga0081540_1004312 | |||
| 1100 | Ga0081540_1014575 | |||
| 1101 | Ga0081540_1018244 | |||
| 1102 | Ga0081540_1044261 | |||
| 1103 | Ga0081539_10000522 | |||
| 1104 | Ga0081539_10029861 | |||
| 1105 | Ga0070717_10001143 | |||
| 1106 | Ga0070717_10004943 | |||
| 1107 | Ga0070717_10153068 | |||
| 1108 | Ga0070717_10222342 | |||
| 1109 | Ga0075365_10113770 | |||
| 1110 | Ga0075365_10245631 | |||
| 1111 | Ga0075368_10007821 | |||
| 1112 | Ga0075368_10048151 | |||
| 1113 | Ga0075368_10062685 | |||
| 1114 | Ga0075363_100105240 | |||
| 1115 | Ga0070715_10002760 | |||
| 1116 | Ga0070716_100007223 | |||
| 1117 | Ga0070716_100026589 | |||
| 1118 | Ga0070716_100218337 | |||
| 1119 | Ga0070712_100039274 | |||
| 1120 | Ga0070712_100088330 | |||
| 1121 | Ga0070712_100512242 | |||
| 1122 | Ga0075362_10032878 | |||
| 1123 | Ga0075362_10108644 | |||
| 1124 | Ga0075367_10033336 | |||
| 1125 | Ga0075367_10081022 | |||
| 1126 | Ga0075367_10266527 | |||
| 1127 | Ga0075369_10040273 | |||
| 1128 | Ga0075369_10077396 | |||
| 1129 | Ga0075366_10002600 | |||
| 1130 | Ga0075434_100194741 | |||
| 1131 | Ga0097620_100097872 | |||
| 1132 | Ga0097620_100153803 | |||
| 1133 | Ga0097620_100491232 | |||
| 1134 | Ga0099823_1032421 | |||
| 1135 | Ga0099795_10072045 | |||
| 1136 | Ga0105240_10005129 | |||
| 1137 | Ga0105240_10025127 | |||
| 1138 | Ga0105240_10035009 | |||
| 1139 | Ga0105240_10035094 | |||
| 1140 | Ga0105240_10089392 | |||
| 1141 | Ga0105240_10836070 | |||
| 1142 | Ga0105240_10884923 | |||
| 1143 | Ga0111539_10099026 | |||
| 1144 | Ga0105247_10129531 | |||
| 1145 | Ga0105247_10188812 | |||
| 1146 | Ga0105241_10026870 | |||
| 1147 | Ga0105242_10159275 | |||
| 1148 | Ga0105248_10893347 | |||
| 1149 | Ga0105237_10013514 | |||
| 1150 | Ga0105237_10022489 | |||
| 1151 | Ga0105237_10041853 | |||
| 1152 | Ga0105237_10059404 | |||
| 1153 | Ga0105237_10132980 | |||
| 1154 | Ga0105237_10170760 | |||
| 1155 | Ga0105237_10991041 | |||
| 1156 | Ga0105238_10043880 | |||
| 1157 | Ga0105238_10177105 | |||
| 1158 | Ga0105238_10568187 | |||
| 1159 | Ga0105239_10054122 | |||
| 1160 | Ga0105239_10179264 | |||
| 1161 | Ga0105239_10179798 | |||
| 1162 | Ga0105239_10190685 | |||
| 1163 | Ga0105239_10262639 | |||
| 1164 | Ga0105239_10381127 | |||
| 1165 | Ga0105239_11141667 | |||
| 1166 | Ga0105246_10142896 | |||
| 1167 | Ga0105246_10147427 | |||
| 1168 | Ga0157370_10109107 | |||
| 1169 | Ga0157370_10170809 | |||
| 1170 | Ga0157370_10248271 | |||
| 1171 | Ga0157369_10013512 | |||
| 1172 | Ga0157369_10016827 | |||
| 1173 | Ga0157369_10030575 | |||
| 1174 | Ga0157369_10201502 | |||
| 1175 | Ga0157369_10231731 | |||
| 1176 | Ga0157374_10222359 | |||
| 1177 | Ga0157378_10012413 | |||
| 1178 | Ga0157378_10826432 | |||
| 1179 | Ga0157372_10047471 | |||
| 1180 | Ga0157372_10056329 | |||
| 1181 | Ga0157372_10084744 | |||
| 1182 | Ga0157372_10368562 | |||
| 1183 | Ga0157375_10025269 | |||
| 1184 | Ga0157375_10218421 | |||
| 1185 | Ga0157375_10272113 | |||
| 1186 | Ga0157375_10760660 | |||
| 1187 | Ga0163163_10052116 | |||
| 1188 | Ga0163163_10456670 | |||
| 1189 | Ga0157377_10197224 | |||
| 1190 | Ga0157379_10063365 | |||
| 1191 | Ga0163161_10295464 | |||
| 1192 | Ga0206356_11768113 | |||
| 1193 | Ga0214544_1000087 | |||
| 1194 | Ga0214542_1000018 | |||
| 1195 | Ga0214545_1000009 | |||
| 1196 | Ga0214543_1000037 | |||
| 1197 | Ga0213873_10002059 | |||
| 1198 | Ga0213872_10020082 | |||
| 1199 | Ga0213874_10014111 | |||
| 1200 | Ga0213876_10040205 | |||
| 1201 | Ga0213876_10059215 | |||
| 1202 | Ga0207425_1020605 | |||
| 1203 | Ga0209677_107550 | |||
| 1204 | Ga0209233_1003722 | |||
| 1205 | Ga0209233_1005177 | |||
| 1206 | Ga0209455_1008327 | |||
| 1207 | Ga0209564_1007864 | |||
| 1208 | Ga0209564_1033426 | |||
| 1209 | Ga0209758_1000030 | |||
| 1210 | Ga0209758_1000884 | |||
| 1211 | Ga0209758_1000949 | |||
| 1212 | Ga0209758_1006161 | |||
| 1213 | Ga0209758_1010276 | |||
| 1214 | Ga0209758_1011559 | |||
| 1215 | Ga0209758_1017944 | |||
| 1216 | Ga0209758_1022776 | |||
| 1217 | Ga0209758_1083128 | |||
| 1218 | Ga0207426_1001522 | |||
| 1219 | Ga0207426_1002837 | |||
| 1220 | Ga0207426_1015480 | |||
| 1221 | Ga0209257_1003355 | |||
| 1222 | Ga0209257_1007964 | |||
| 1223 | Ga0207697_10144279 | |||
| 1224 | Ga0207656_10015006 | |||
| 1225 | Ga0207682_10221586 | |||
| 1226 | Ga0207692_10004318 | |||
| 1227 | Ga0207710_10176994 | |||
| 1228 | Ga0207680_10076487 | |||
| 1229 | Ga0207647_10019817 | |||
| 1230 | Ga0207699_10000360 | |||
| 1231 | Ga0207699_10007899 | |||
| 1232 | Ga0207699_10137624 | |||
| 1233 | Ga0207705_10095657 | |||
| 1234 | Ga0207705_10103920 | |||
| 1235 | Ga0207705_10200290 | |||
| 1236 | Ga0207705_10215949 | |||
| 1237 | Ga0207707_10001598 | |||
| 1238 | Ga0207707_10003721 | |||
| 1239 | Ga0207707_10007691 | |||
| 1240 | Ga0207695_10000059 | |||
| 1241 | Ga0207695_10211308 | |||
| 1242 | Ga0207695_10743361 | |||
| 1243 | Ga0207671_10012029 | |||
| 1244 | Ga0207671_10065139 | |||
| 1245 | Ga0207671_10082197 | |||
| 1246 | Ga0207671_10162696 | |||
| 1247 | Ga0207671_10177279 | |||
| 1248 | Ga0207693_10000073 | |||
| 1249 | Ga0207693_10038422 | |||
| 1250 | Ga0207663_10000861 | |||
| 1251 | Ga0207663_10034150 | |||
| 1252 | Ga0207663_10633233 | |||
| 1253 | Ga0207660_10013269 | |||
| 1254 | Ga0207660_10021027 | |||
| 1255 | Ga0207660_10277775 | |||
| 1256 | Ga0207657_10004881 | |||
| 1257 | Ga0207657_10008532 | |||
| 1258 | Ga0207657_10069862 | |||
| 1259 | Ga0207657_10199821 | |||
| 1260 | Ga0207649_10274524 | |||
| 1261 | Ga0207652_10001895 | |||
| 1262 | Ga0207652_10038542 | |||
| 1263 | Ga0207694_10306809 | |||
| 1264 | Ga0207659_10162773 | |||
| 1265 | Ga0207659_10497261 | |||
| 1266 | Ga0207700_10034750 | |||
| 1267 | Ga0207700_10040878 | |||
| 1268 | Ga0207700_10085623 | |||
| 1269 | Ga0207664_10023264 | |||
| 1270 | Ga0207664_10043954 | |||
| 1271 | Ga0207644_10027415 | |||
| 1272 | Ga0207686_10232312 | |||
| 1273 | Ga0207704_10524763 | |||
| 1274 | Ga0207665_10000629 | |||
| 1275 | Ga0207665_10045899 | |||
| 1276 | Ga0207711_10603390 | |||
| 1277 | Ga0207661_10013649 | |||
| 1278 | Ga0207661_10032589 | |||
| 1279 | Ga0207661_10032820 | |||
| 1280 | Ga0207679_10116724 | |||
| 1281 | Ga0207679_10155767 | |||
| 1282 | Ga0207667_10035735 | |||
| 1283 | Ga0207667_10325037 | |||
| 1284 | Ga0207667_10968245 | |||
| 1285 | Ga0207651_10209802 | |||
| 1286 | Ga0207668_10034118 | |||
| 1287 | Ga0207668_10112762 | |||
| 1288 | Ga0207640_10041074 | |||
| 1289 | Ga0207640_10228931 | |||
| 1290 | Ga0207677_10119813 | |||
| 1291 | Ga0207703_10017425 | |||
| 1292 | Ga0207703_10203262 | |||
| 1293 | Ga0207703_10596237 | |||
| 1294 | Ga0207639_10135347 | |||
| 1295 | Ga0207639_10259936 | |||
| 1296 | Ga0207678_10029495 | |||
| 1297 | Ga0207678_10031151 | |||
| 1298 | Ga0207678_10038743 | |||
| 1299 | Ga0207678_10041959 | |||
| 1300 | Ga0207678_10151281 | |||
| 1301 | Ga0207678_10170475 | |||
| 1302 | Ga0207678_10175048 | |||
| 1303 | Ga0207678_10229933 | |||
| 1304 | Ga0207678_10308082 | |||
| 1305 | Ga0207702_10140091 | |||
| 1306 | Ga0207702_10285529 | |||
| 1307 | Ga0207648_10342461 | |||
| 1308 | Ga0207648_10489881 | |||
| 1309 | Ga0207676_10032534 | |||
| 1310 | Ga0207676_10147807 | |||
| 1311 | Ga0207674_10032777 | |||
| 1312 | Ga0207674_10073272 | |||
| 1313 | Ga0207674_10601701 | |||
| 1314 | Ga0207674_10629459 | |||
| 1315 | Ga0207683_10174203 | |||
| 1316 | Ga0207683_10255498 | |||
| 1317 | Ga0207683_10438070 | |||
| 1318 | Ga0207698_10093752 | |||
| 1319 | Ga0207698_10438045 | |||
| 1320 | Ga0209813_10049632 | |||
| 1321 | Ga0209813_10064091 | |||
| 1322 | Ga0268266_10011749 | |||
| 1323 | Ga0268266_10020841 | |||
| 1324 | Ga0268266_10090709 | |||
| 1325 | Ga0268266_10143422 | |||
| 1326 | Ga0268264_10000050 | |||
| 1327 | Ga0268264_10164525 | |||
| 1328 | Ga0268264_10376950 | |||
| 1329 | Ga0265326_10009229 | |||
| 1330 | Ga0265334_10001546 | |||
| 1331 | Ga0265318_10026651 | |||
| 1332 | Ga0265323_10001795 | |||
| 1333 | Ga0265322_10015165 | |||
| 1334 | Ga0265336_10002399 | |||
| 1335 | Ga0307515_10012007 | |||
| 1336 | Ga0265338_10000621 | |||
| 1337 | Ga0307511_10068076 | |||
| 1338 | Ga0307511_10102970 | |||
| 1339 | Ga0265330_10024250 | |||
| 1340 | Ga0265330_10075588 | |||
| 1341 | Ga0265332_10015896 | |||
| 1342 | Ga0265320_10066271 | |||
| 1343 | Ga0265325_10034326 | |||
| 1344 | Ga0265340_10019688 | |||
| 1345 | Ga0265339_10020997 | |||
| 1346 | Ga0265316_10069760 | |||
| 1347 | Ga0307509_10016566 | |||
| 1348 | Ga0307509_10094686 | |||
| 1349 | Ga0307508_10000005 | |||
| 1350 | Ga0265314_10014704 | |||
| 1351 | Ga0265314_10111504 | |||
| 1352 | Ga0307507_10014276 | |||
| 1353 | Ga0307510_10032857 | |||
| 1354 | Ga0307510_10035286 | |||
| 1355 | Ga0316215_1001379 | |||
| 1356 | Ga0316214_1007014 | |||
| 1357 | Ga0373934_0006248 | |||
| 1358 | Ga0373934_0025722 | |||
| 1359 | Ga0373936_0020794 | |||
| 1360 | Ga0373936_0050409 | |||
| 1361 | Ga0373945_0035407 | |||
| 1362 | Ga0373953_0000259 | |||
| 1363 | Ga0373954_0000249 | |||
| 1364 | Ga0373954_0020206 | |||
| 1365 | Ga0373957_0003088 | |||
| 1366 | Ga0373957_0019478 | |||
| 1367 | Ga0373946_0014361 | |||
| 1368 | Ga0373955_0009036 | |||
| 1369 | Ga0373924_0003664 | |||
| 1370 | Ga0373924_0023447 | |||
| 1371 | Ga0373935_0035040 | |||
| 1372 | Ga0373935_0077040 | |||
| 1373 | Ga0373927_0017691 | |||
| 1374 | Ga0373927_0018294 | |||
| 1375 | Ga0373927_0166499 | |||
| 1376 | Ga0373933_0000277 | |||
| 1377 | Ga0373933_0001831 | |||
| 1378 | Ga0373933_0034496 | |||
| 1379 | Ga0373937_0012106 | |||
| 1380 | Ga0373937_0212048 | |||
| 1381 | Ga0373937_0434311 | |||
| 1382 | Ga0372808_006515 | |||
| 1383 | Ga0373925_0019700 | |||
| 1384 | Ga0373925_0130624 | |||
| 1385 | Ga0373925_0241645 | |||
| 1386 | Ga0373925_0259964 | |||
| 1387 | Ga0373925_0476193 | |||
| 1388 | Ga0395899_0119667 | |||
| 1389 | Ga0395899_0141974 | |||
| 1390 | Ga0395899_0273644 | |||
| 1391 | Ga0395899_0341613 | |||
| 1392 | Ga0395900_0000696 | |||
| 1393 | Ga0395900_0005919 | |||
| 1394 | Ga0395900_0044414 | |||
| 1395 | Ga0395900_0085479 | |||
| 1396 | Ga0395900_0327807 | |||
| 1397 | Ga0395898_0035004 | |||
| 1398 | Ga0395898_0080592 | |||
| 1399 | Ga0395898_0100417 | |||
| 1400 | Ga0395898_0285639 | |||
| 1401 | Ga0395905_0065185 | |||
| 1402 | Ga0395905_0224486 | |||
| 1403 | Ga0395905_0352707 | |||
| 1404 | Ga0436364_0937506 | |||
| 1405 | Ga0395901_0007227 | |||
| 1406 | Ga0395901_0049784 | |||
| 1407 | Ga0395901_0208767 | |||
| 1408 | Ga0395901_0416948 | |||
| 1409 | Ga0436365_0041738 | |||
| 1410 | Ga0436365_1055090 | |||
| 1411 | Ga0436365_1091064 | |||
| 1412 | Ga0436365_1306764 | |||
| 1413 | Ga0436365_1350910 | |||
| 1414 | Ga0436360_0432834 | |||
| 1415 | Ga0436361_0327284 | |||
| 1416 | Ga0436361_0709968 | |||
| 1417 | Ga0436363_1051465 | |||
| 1418 | Ga0436362_0083551 | |||
| 1419 | Ga0436362_1040324 | |||
| 1420 | Ga0439465_0033745 | |||
| 1421 | Ga0439448_0072561 | |||
| 1422 | Ga0466969_0073593 | |||
| 1423 | Ga0466969_0128176 | |||
| 1424 | Ga0466972_0001053 | |||
| 1425 | Ga0466965_0087015 | |||
| 1426 | Ga0466966_0000137 | |||
| 1427 | Ga0466961_0000039 | |||
| 1428 | Ga0466963_0001672 | |||
| 1429 | Ga0466971_0017754 | |||
| 1430 | Ga0466971_0124618 | |||
| 1431 | Ga0466968_0005199 | |||
| 1432 | Ga0466957_0035960 | |||
| 1433 | Ga0466957_0073144 | |||
| 1434 | Ga0466960_0003772 | |||
| 1435 | Ga0466960_0050304 | |||
| 1436 | Ga0466959_0001594 | |||
| 1437 | Ga0466958_0168634 | |||
| 1438 | Ga0466967_0071213 | |||
| 1439 | Ga0466967_0158757 | |||
| 1440 | Ga0466967_0850226 | |||
| 1441 | Ga0495592_0011025 | |||
| 1442 | Ga0495592_0022768 | |||
| 1443 | Ga0495592_0040101 | |||
| 1444 | Ga0495590_0064135 | |||
| 1445 | Ga0495629_0001490 | |||
| 1446 | Ga0495638_0013239 | |||
| 1447 | Ga0495638_0019032 | |||
| 1448 | Ga0495638_0069119 | |||
| 1449 | Ga0495638_0102367 | |||
| 1450 | Ga0495641_0025455 | |||
| 1451 | Ga0495651_0011203 | |||
| 1452 | Ga0495651_0028449 | |||
| 1453 | Ga0495651_0062471 | |||
| 1454 | Ga0495653_0000300 | |||
| 1455 | Ga0495650_0080846 | |||
| 1456 | Ga0495580_0019910 | |||
| 1457 | Ga0495605_0035458 | |||
| 1458 | Ga0495605_0057623 | |||
| 1459 | Ga0495639_0031519 | |||
| 1460 | Ga0495662_0022698 | |||
| 1461 | Ga0495664_0020649 | |||
| 1462 | Ga0495664_0021847 | |||
| 1463 | Ga0495664_0034799 | |||
| 1464 | Ga0495664_0070966 | |||
| 1465 | Ga0495585_0023802 | |||
| 1466 | Ga0495594_0026425 | |||
| 1467 | Ga0495583_0030265 | |||
| 1468 | Ga0495583_0038868 | |||
| 1469 | Ga0495606_0000858 | |||
| 1470 | Ga0495608_0040269 | |||
| 1471 | Ga0495608_0052952 | |||
| 1472 | Ga0495608_0109449 | |||
| 1473 | Ga0495608_0118060 | |||
| 1474 | Ga0495616_0060076 | |||
| 1475 | Ga0495618_0099959 | |||
| 1476 | Ga0495620_0025893 | |||
| 1477 | Ga0495628_0139153 | |||
| 1478 | Ga0495628_0143292 | |||
| 1479 | Ga0495630_0200819 | |||
| 1480 | Ga0495631_0039919 | |||
| 1481 | Ga0495631_0085913 | |||
| 1482 | Ga0495648_0000382 | |||
| 1483 | Ga0495648_0050531 | |||
| 1484 | Ga0495663_0038891 | |||
| 1485 | Ga0495666_0048989 | |||
| 1486 | Ga0495652_0007246 | |||
| 1487 | Ga0495652_0048270 | |||
| 1488 | Ga0495652_0106931 | |||
| 1489 | Ga0495640_0012005 | |||
| 1490 | Ga0495640_0051208 | |||
| 1491 | Ga0495586_0065608 | |||
| 1492 | Ga0495586_0102619 | |||
| 1493 | Ga0495587_0013918 | |||
| 1494 | Ga0495598_0008711 | |||
| 1495 | Ga0495621_0003636 | |||
| 1496 | Ga0495597_0025361 | |||
| 1497 | Ga0495645_0002892 | |||
| 1498 | Ga0495645_0017294 | |||
| 1499 | Ga0495645_0106242 | |||
| 1500 | Ga0495622_0008376 | |||
| 1501 | Ga0495622_0019399 | |||
| 1502 | Ga0495622_0025062 | |||
| 1503 | Ga0495622_0074110 | |||
| 1504 | Ga0495667_0000121 | |||
| 1505 | Ga0495667_0089536 | |||
| 1506 | Ga0495656_0036134 | |||
| 1507 | Ga0495668_0014949 | |||
| 1508 | Ga0495668_0130633 | |||
| 1509 | Ga0495634_0003845 | |||
| 1510 | Ga0495634_0005513 | |||
| 1511 | Ga0495634_0033594 | |||
| 1512 | Ga0495611_0042236 | |||
| 1513 | Ga0495635_0000072 | |||
| 1514 | Ga0495635_0050480 | |||
| 1515 | Ga0495635_0106263 | |||
| 1516 | Ga0495661_0029665 | |||
| 1517 | Ga0495588_0002782 | |||
| 1518 | Ga0495588_0046101 | |||
| 1519 | Ga0495657_0004271 | |||
| 1520 | Ga0495657_0081334 | |||
| 1521 | Ga0495599_0007431 | |||
| 1522 | Ga0495599_0087390 | |||
| 1523 | Ga0495599_0190866 | |||
| 1524 | Ga0495623_0010400 | |||
| 1525 | Ga0495623_0025588 | |||
| 1526 | Ga0495623_0191831 | |||
| 1527 | Ga0495646_0007628 | |||
| 1528 | Ga0495646_0008794 | |||
| 1529 | Ga0495658_0005786 | |||
| 1530 | Ga0495669_0034515 | |||
| 1531 | Ga0495613_0055857 | |||
| 1532 | Ga0495624_0027494 | |||
| 1533 | Ga0495624_0298135 | |||
| 1534 | Ga0495624_0318924 | |||
| 1535 | Ga0495600_0001929 | |||
| 1536 | Ga0495600_0014429 | |||
| 1537 | Ga0495600_0019457 | |||
| 1538 | Ga0495581_0217083 | |||
| 1539 | Ga0495604_0002223 | |||
| 1540 | Ga0495604_0061619 | |||
| 1541 | Ga0495604_0101523 | |||
| 1542 | Ga0495604_0107801 | |||
| 1543 | Ga0495674_0019201 | |||
| 1544 | Ga0495676_0076145 | |||
| 1545 | Ga0495676_0126360 | |||
| 1546 | Ga0495680_0004124 | |||
| 1547 | Ga0495680_0005809 | |||
| 1548 | Ga0495680_0213378 | |||
| 1549 | Ga0495683_0034016 | |||
| 1550 | Ga0495687_024727 | |||
| 1551 | Ga0495675_0000796 | |||
| 1552 | Ga0495673_0065492 | |||
| 1553 | Ga0495684_0000594 | |||
| 1554 | Ga0495684_0013378 | |||
| 1555 | Ga0495686_0011720 | |||
| 1556 | Ga0495686_0099424 | |||
| 1557 | Ga0495686_0184267 | |||
| 1558 | Ga0495593_0000109 | |||
| 1559 | Ga0495593_0005454 | |||
| 1560 | Ga0495602_0059252 | |||
| 1561 | Ga0496100_0059271 | |||
| 1562 | Ga0496100_0227387 | |||
| 1563 | Ga0496100_0349089 | |||
| 1564 | Ga0496101_0195107 | |||
| 1565 | Ga0496102_0059510 | |||
| 1566 | Ga0496102_0141472 | |||
| 1567 | Ga0496102_0238524 | |||
| 1568 | Ga0496103_0158823 | |||
| 1569 | Ga0496103_0362844 | |||
| 1570 | Ga0496104_0022858 | |||
| 1571 | Ga0496104_0025881 | |||
| 1572 | Ga0496104_0119514 | |||
| 1573 | Ga0496104_0136213 | |||
| 1574 | Ga0496104_0322214 | |||
| 1575 | Ga0496105_0016080 | |||
| 1576 | Ga0496105_0018663 | |||
| 1577 | Ga0496105_0200828 | |||
| 1578 | Ga0496105_0457072 | |||
| 1579 | Ga0496106_0000810 | |||
| 1580 | Ga0496106_0003710 | |||
| 1581 | Ga0496106_0005291 | |||
| 1582 | Ga0496106_0020798 | |||
| 1583 | Ga0496106_0050257 | |||
| 1584 | Ga0496106_0147241 | |||
| 1585 | Ga0496106_0186598 | |||
| 1586 | Ga0496107_0019565 | |||
| 1587 | Ga0496107_0088718 | |||
| 1588 | Ga0496107_0189635 | |||
| 1589 | Ga0496108_0000553 | |||
| 1590 | Ga0496108_0021077 | |||
| 1591 | Ga0496108_0036900 | |||
| 1592 | Ga0496108_0085617 | |||
| 1593 | Ga0496109_0000574 | |||
| 1594 | Ga0496109_0024805 | |||
| 1595 | Ga0496109_0064237 | |||
| 1596 | Ga0496109_0067828 | |||
| 1597 | Ga0496109_0241098 | |||
| 1598 | Ga0496109_0473789 | |||
| 1599 | Ga0496110_0005711 | |||
| 1600 | Ga0496110_0026129 | |||
| 1601 | Ga0496110_0029231 | |||
| 1602 | Ga0496110_0137677 | |||
| 1603 | Ga0496110_0237494 | |||
| 1604 | Ga0496111_0039981 | |||
| 1605 | Ga0496111_0059186 | |||
| 1606 | Ga0496111_0265441 | |||
| 1607 | Ga0496112_0000065 | |||
| 1608 | Ga0496112_0063136 | |||
| 1609 | Ga0496112_0218859 | |||
| 1610 | Ga0496113_0013203 | |||
| 1611 | Ga0496113_0063812 | |||
| 1612 | Ga0496114_0013002 | |||
| 1613 | Ga0496114_0024895 | |||
| 1614 | Ga0496115_0030945 | |||
| 1615 | Ga0496115_0314690 | |||
| 1616 | Ga0496116_0011726 | |||
| 1617 | Ga0496116_0060481 | |||
| 1618 | Ga0496117_0016493 | |||
| 1619 | Ga0496117_0023589 | |||
| 1620 | Ga0496117_0078189 | |||
| 1621 | Ga0496117_0146296 | |||
| 1622 | Ga0496118_0003925 | |||
| 1623 | Ga0496118_0021615 | |||
| 1624 | Ga0496118_0063550 | |||
| 1625 | Ga0496118_0091088 | |||
| 1626 | Ga0496119_0022737 | |||
| 1627 | Ga0496120_0016701 | |||
| 1628 | Ga0496120_0023248 | |||
| 1629 | Ga0496121_0000453 | |||
| 1630 | Ga0496121_0008938 | |||
| 1631 | Ga0496121_0016252 | |||
| 1632 | Ga0496121_0033524 | |||
| 1633 | Ga0496121_0061029 | |||
| 1634 | Ga0496121_0064084 | |||
| 1635 | Ga0496121_0065818 | |||
| 1636 | Ga0496121_0082471 | |||
| 1637 | Ga0496121_0090747 | |||
| 1638 | Ga0496121_0123319 | |||
| 1639 | Ga0496121_0138532 | |||
| 1640 | Ga0496121_0142570 | |||
| 1641 | Ga0496121_0183747 | |||
| 1642 | Ga0496121_0209684 | |||
| 1643 | Ga0496122_0036966 | |||
| 1644 | Ga0496122_0197384 | |||
| 1645 | Ga0496123_0020379 | |||
| 1646 | Ga0496123_0102550 | |||
| 1647 | Ga0496124_0000750 | |||
| 1648 | Ga0496124_0016867 | |||
| 1649 | Ga0496124_0166292 | |||
| 1650 | Ga0496125_0000904 | |||
| 1651 | Ga0496125_0004420 | |||
| 1652 | Ga0496125_0022357 | |||
| 1653 | Ga0496125_0038808 | |||
| 1654 | Ga0496125_0046908 | |||
| 1655 | Ga0496125_0085989 | |||
| 1656 | Ga0496125_0093476 | |||
| 1657 | Ga0496126_0003797 | |||
| 1658 | Ga0496126_0009534 | |||
| 1659 | Ga0496126_0009773 | |||
| 1660 | Ga0496126_0018824 | |||
| 1661 | Ga0496126_0036538 | |||
| 1662 | Ga0496126_0059273 | |||
| 1663 | Ga0496126_0070519 | |||
| 1664 | Ga0496126_0086648 | |||
| 1665 | Ga0496126_0131208 | |||
| 1666 | Ga0496126_0134174 | |||
| 1667 | Ga0496126_0145610 | |||
| 1668 | Ga0496126_0174311 | |||
| 1669 | Ga0496126_0184634 | |||
| 1670 | Ga0496126_0202129 | |||
| 1671 | Ga0496126_0250679 | |||
| 1672 | Ga0495682_0100351 | |||
| 1673 | Ga0501031_0065487 | |||
| 1674 | Ga0501031_0110783 | |||
| 1675 | Ga0501031_0153444 | |||
| 1676 | Ga0501032_0000309 | |||
| 1677 | Ga0501032_0012183 | |||
| 1678 | Ga0501032_0057767 | |||
| 1679 | Ga0501032_0113478 | |||
| 1680 | Ga0501033_0001437 | |||
| 1681 | Ga0501033_0001798 | |||
| 1682 | Ga0501033_0066912 | |||
| 1683 | Ga0501034_0000082 | |||
| 1684 | Ga0501034_0471396 | |||
| 1685 | Ga0501036_0000121 | |||
| 1686 | Ga0501036_0033677 | |||
| 1687 | Ga0501036_0089080 | |||
| 1688 | Ga0501036_0281725 | |||
| 1689 | Ga0501037_0000346 | |||
| 1690 | Ga0501037_0004074 | |||
| 1691 | Ga0501037_0072499 | |||
| 1692 | Ga0501037_0185307 | |||
| 1693 | Ga0501037_0260649 | |||
| 1694 | Ga0501038_0001766 | |||
| 1695 | Ga0501038_0002992 | |||
| 1696 | Ga0501038_0025916 | |||
| 1697 | Ga0501038_0050259 | |||
| 1698 | Ga0501039_0009593 | |||
| 1699 | Ga0501042_0119470 | |||
| 1700 | Ga0501043_0000109 | |||
| 1701 | Ga0501043_0002169 | |||
| 1702 | Ga0501043_0035788 | |||
| 1703 | Ga0501043_0182396 | |||
| 1704 | Ga0501043_0185141 | |||
| 1705 | Ga0501046_0000101 | |||
| 1706 | Ga0501046_0016838 | |||
| 1707 | Ga0501046_0035094 | |||
| 1708 | Ga0501046_0046444 | |||
| 1709 | Ga0501047_0000331 | |||
| 1710 | Ga0501047_0185685 | |||
| 1711 | Ga0501047_0233372 | |||
| 1712 | Ga0501047_0327336 | |||
| 1713 | Ga0501047_0419051 | |||
| 1714 | Ga0501048_0002703 | |||
| 1715 | Ga0501048_0039082 | |||
| 1716 | Ga0501067_0000534 | |||
| 1717 | Ga0501067_0022379 | |||
| 1718 | Ga0501068_0000276 | |||
| 1719 | Ga0501069_0013535 | |||
| 1720 | Ga0501069_0014951 | |||
| 1721 | Ga0501070_0024493 | |||
| 1722 | Ga0501070_0026242 | |||
| 1723 | Ga0501070_0338481 | |||
| 1724 | Ga0501071_0120319 | |||
| 1725 | Ga0501072_0004822 | |||
| 1726 | Ga0501073_0000101 | |||
| 1727 | Ga0501073_0041906 | |||
| 1728 | Ga0501073_0072300 | |||
| 1729 | Ga0501073_0075602 | |||
| 1730 | Ga0501074_0000187 | |||
| 1731 | Ga0501074_0043006 | |||
| 1732 | Ga0501074_0107986 | |||
| 1733 | Ga0501074_0268326 | |||
| 1734 | Ga0501075_0311320 | |||
| 1735 | Ga0501076_0074021 | |||
| 1736 | Ga0501077_0175211 | |||
| 1737 | Ga0501079_0001908 | |||
| 1738 | Ga0501079_0151248 | |||
| 1739 | Ga0501080_0000151 | |||
| 1740 | Ga0501080_0021394 | |||
| 1741 | Ga0501080_0109145 | |||
| 1742 | Ga0501081_0520119 | |||
| 1743 | Ga0501083_0008996 | |||
| 1744 | Ga0501035_0000150 | |||
| 1745 | Ga0501035_0011129 | |||
| 1746 | Ga0501035_0178343 | |||
| 1747 | Ga0501035_0186263 | |||
| 1748 | Ga0501044_0000247 | |||
| 1749 | Ga0501044_0013306 | |||
| 1750 | Ga0501044_0112903 | |||
| 1751 | Ga0501044_0114019 | |||
| 1752 | Ga0501044_0259203 | |||
| 1753 | Ga0501045_0047178 | |||
| 1754 | Ga0501045_0074857 | |||
| 1755 | nmdc:mga03683_54403_c1 | |||
| 1756 | nmdc:mga03683_66648_c2 | |||
| 1757 | nmdc:mga0yw44_11582_c1 | |||
| 1758 | nmdc:mga0yw44_14024_c1 | |||
| 1759 | nmdc:mga06z11_301190_c1 | |||
| 1760 | nmdc:mga06z11_7575_c1 | |||
| 1761 | nmdc:mga04h51_76390_c1 | |||
| 1762 | nmdc:mga07m45_12889_c2 | |||
| 1763 | nmdc:mga07m45_17137_c1 | |||
| 1764 | nmdc:mga07m45_286619_c1 | |||
| 1765 | nmdc:mga08y16_30607_c1 | |||
| 1766 | nmdc:mga0n895_182371_c1 | |||
| 1767 | nmdc:mga0rr50_98258_c1 | |||
| 1768 | nmdc:mga0sz30_125054_c1 | |||
| 1769 | nmdc:mga0sz30_313341_c1 | |||
| 1770 | nmdc:mga0sz30_7570_c1 | |||
| 1771 | Ga0495612_0011897 | |||
| 1772 | Ga0500610_0136998 | |||
| 1773 | Ga0500635_0005628 | |||
| 1774 | Ga0495595_0011842 | |||
| 1775 | Ga0495595_0036132 | |||
| 1776 | Ga0495619_0010257 | |||
| 1777 | Ga0495619_0042088 | |||
| 1778 | Ga0495619_0148101 | |||
| 1779 | Ga0495619_0339141 | |||
| 1780 | Ga0500643_006068 | |||
| 1781 | Ga0500644_0028928 | |||
| 1782 | Ga0500647_0176463 | |||
| 1783 | Ga0500651_0024154 | |||
| 1784 | Ga0500566_0000029 | |||
| 1785 | Ga0500566_0000139 | |||
| 1786 | Ga0500566_0036505 | |||
| 1787 | Ga0500566_0092168 | |||
| 1788 | Ga0500554_058443 | |||
| 1789 | Ga0500555_003871 | |||
| 1790 | Ga0500556_0000019 | |||
| 1791 | Ga0500569_000864 | |||
| 1792 | Ga0500572_000149 | |||
| 1793 | Ga0500592_006645 | |||
| 1794 | Ga0500595_001557 | |||
| 1795 | Ga0500595_002157 | |||
| 1796 | Ga0500595_002381 | |||
| 1797 | Ga0500595_011704 | |||
| 1798 | Ga0500608_035435 | |||
| 1799 | Ga0500618_014388 | |||
| 1800 | Ga0500642_0000039 | |||
| 1801 | Ga0500642_0087538 | |||
| 1802 | Ga0500559_0000749 | |||
| 1803 | Ga0500559_0059150 | |||
| 1804 | Ga0500568_0001467 | |||
| 1805 | Ga0500568_0010187 | |||
| 1806 | Ga0500577_0006079 | |||
| 1807 | Ga0500603_001045 | |||
| 1808 | Ga0500603_070198 | |||
| 1809 | Ga0500616_0000059 | |||
| 1810 | Ga0500616_0015647 | |||
| 1811 | Ga0500622_0015463 | |||
| 1812 | Ga0500622_0020016 | |||
| 1813 | Ga0500622_0036772 | |||
| 1814 | Ga0500634_0062671 | |||
| 1815 | Ga0500639_007050 | |||
| 1816 | Ga0500639_024117 | |||
| 1817 | Ga0500636_0016432 | |||
| 1818 | Ga0500636_0023448 | |||
| 1819 | Ga0500636_0024936 | |||
| 1820 | Ga0500637_0139482 | |||
| 1821 | Ga0500637_0288960 | |||
| 1822 | Ga0500645_015281 | |||
| 1823 | Ga0500552_006345 | |||
| 1824 | Ga0500596_009571 | |||
| 1825 | Ga0500601_000189 | |||
| 1826 | Ga0501084_0034045 | |||
| 1827 | Ga0501084_0084687 | |||
| 1828 | Ga0500661_001073 | |||
| 1829 | Ga0501082_0000447 | |||
| 1830 | Ga0501082_0000706 | |||
| 1831 | Ga0501082_0005797 | |||
| 1832 | Ga0466962_0137023 | |||
| 1833 | 2507505606 | |||
| 1834 | 2508539499 | |||
| 1835 | 2508695867 | |||
| 1836 | 2509150130 | |||
| 1837 | 2511401127 | |||
| 1838 | 2513624732 | |||
| 1839 | 2513642280 | |||
| 1840 | 2513652783 | |||
| 1841 | 2513660717 | |||
| 1842 | 2513673922 | |||
| 1843 | 2513700409 | |||
| 1844 | 2513862515 | |||
| 1845 | 2513876953 | |||
| 1846 | 2513922513 | |||
| 1847 | 2517105904 | |||
| 1848 | 2517888454 | |||
| 1849 | 2524440059 | |||
| 1850 | 2524468372 | |||
| 1851 | 2524535244 | |||
| 1852 | 2528852093 | |||
| 1853 | 2603862312 | |||
| 1854 | 2617377275 | |||
| 1855 | 2671123607 | |||
| 1856 | 2728752042 | |||
| 1857 | 2745077829 | |||
| 1858 | 2793065619 | |||
| 1859 | 2793065940 | |||
| 1860 | 2793067268 | |||
| 1861 | 2793077095 | |||
| 1862 | 2805921252 | |||
| 1863 | 2818239235 | |||
| 1864 | 2824631755 | |||
| 1865 | 2824750311 | |||
| 1866 | 2824762092 | |||
| 1867 | 2824772413 | |||
| 1868 | 2841965139 | |||
| 1869 | 2842041344 | |||
| 1870 | 2842049386 | |||
| 1871 | 2844315841 | |||
| 1872 | 2847930736 | |||
| 1873 | 2847942654 | |||
| 1874 | 2849083408 | |||
| 1875 | 2857515615 | |||
| 1876 | 2874591114 | |||
| 1877 | 2874617130 | |||
| 1878 | 2874621361 | |||
| 1879 | 2874636782 | |||
| 1880 | 2874647751 | |||
| 1881 | 2876764040 | |||
| 1882 | 2876772045 | |||
| 1883 | 2876819298 | |||
| 1884 | 2879074962 | |||
| 1885 | 2879089876 | |||
| 1886 | 2879106719 | |||
| 1887 | 2879112806 | |||
| 1888 | 2879135781 | |||
| 1889 | 2879150946 | |||
| 1890 | 2881367125 | |||
| 1891 | 2885368699 | |||
| 1892 | 2885377364 | |||
| 1893 | 2885411199 | |||
| 1894 | 2888379131 | |||
| 1895 | 2888390309 | |||
| 1896 | 2903730859 | |||
| 1897 | 2903775701 | |||
| 1898 | 2904668031 | |||
| 1899 | 2904707968 | |||
| 1900 | 2904714162 | |||
| 1901 | 2906603682 | |||
| 1902 | 2906614184 | |||
| 1903 | 2906639343 | |||
| 1904 | 2906648055 | |||
| 1905 | 2906668438 | |||
| 1906 | 2908746984 | |||
| 1907 | 2908775789 | |||
| 1908 | 2919074338 | |||
| 1909 | 2922364348 | |||
| 1910 | 2922369136 | |||
| 1911 | 2932789032 | |||
| 1912 | 2932814331 | |||
| 1913 | 2932820457 | |||
| 1914 | 2932834489 | |||
| 1915 | 2933580300 | |||
| 1916 | 2935614661 | |||
| 1917 | 2935624472 | |||
| 1918 | 2935636636 | |||
| 1919 | 2935645862 | |||
| 1920 | 2935649051 | |||
| 1921 | 2935658177 | |||
| 1922 | 2935673429 | |||
| 1923 | 2935682606 | |||
| 1924 | 2935686780 | |||
| 1925 | 2935701540 | |||
| 1926 | 2935710485 | |||
| 1927 | 2935716468 | |||
| 1928 | 2935723407 | |||
| 1929 | 2935734963 | |||
| 1930 | 2935744246 | |||
| 1931 | 2935752746 | |||
| 1932 | 2935764707 | |||
| 1933 | 2935774127 | |||
| 1934 | 2935783739 | |||
| 1935 | 2935789156 | |||
| 1936 | 2935796905 | |||
| 1937 | 2935806182 | |||
| 1938 | 2935816948 | |||
| 1939 | 2935826298 | |||
| 1940 | 2935835237 | |||
| 1941 | 2935841381 | |||
| 1942 | 2935853794 | |||
| 1943 | 2935863051 | |||
| 1944 | 2935871861 | |||
| 1945 | 2935882248 | |||
| 1946 | 2935911015 | |||
| 1947 | 2935924176 | |||
| 1948 | 2935932771 | |||
| 1949 | 2935937334 | |||
| 1950 | 2935949465 | |||
| 1951 | 2935958136 | |||
| 1952 | 2935967226 | |||
| 1953 | 2935971209 | |||
| 1954 | 2935985335 | |||
| 1955 | 2936000181 | |||
| 1956 | 2936010095 | |||
| 1957 | 2936012396 | |||
| 1958 | 2936020523 | |||
| 1959 | 2936029689 | |||
| 1960 | 2936043939 | |||
| 1961 | 2936051846 | |||
| 1962 | 2936056901 | |||
| 1963 | 2940558659 | |||
| 1964 | 2941513272 | |||
| 1965 | 2941521235 | |||
| 1966 | 2941529053 | |||
| 1967 | 2941535692 | |||
| 1968 | 2941543607 | |||
| 1969 | 3005483538 | |||
| 1970 | 3005486392 | |||
| 1971 | 3005506266 | |||
| 1972 | 3005589047 | |||
| 1973 | 3005595425 | |||
| 1974 | 3005711385 | |||
| 1975 | 3005718659 | |||
| 1976 | 8006936711 | |||
| 1977 | 8006976681 | |||
| 1978 | 8006992446 | |||
| 1979 | 8016517770 | |||
| 1980 | 8016525831 | |||
| 1981 | 8016539434 | |||
| 1982 | 8016543723 | |||
| 1983 | 8016549571 | |||
| 1984 | 8016557991 | |||
| 1985 | 8016569124 | |||
| 1986 | 8016581761 | |||
| 1987 | 8016585943 | |||
| 1988 | 8016596007 | |||
| 1989 | 8016606881 | |||
| 1990 | 8016618788 | |||
| 1991 | 8016622746 | |||
| 1992 | 8017058860 | |||
| 1993 | 8019530714 | |||
| 1994 | 8019540871 | |||
| 1995 | 8019549744 | |||
| 1996 | 8019561999 | |||
| 1997 | 8019576791 | |||
| 1998 | 8019594847 | |||
| 1999 | 8019606892 | |||
| 2000 | 8019611616 | |||
| 2001 | 8019629751 | |||
| 2002 | 8019640865 | |||
| 2003 | 8019652962 | |||
| 2004 | 8019679664 | |||
| 2005 | 8019695802 | |||
| 2006 | 8055742839 | |||
| 2007 | 8056676300 | |||
| 2008 | 8056683032 | |||
| 2009 | 8056693971 | |||
| 2010 | 8056975627 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nfe-assembly1.cif.gz_A | crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate | 0.8029 | 133 | 260 |
| 7xmu-assembly1.cif.gz_A | e.coli phosphoribosylpyrophosphate (prpp) synthetase type a filament bound with adp, pi and r5p | 0.7849 | 138 | 260 |
| 3lpn-assembly1.cif.gz_B | crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). | 0.7828 | 130 | 265 |
| 6nfe-assembly1.cif.gz_B | crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate | 0.777 | 133 | 260 |
| 2ji4-assembly1.cif.gz_A | human phosphoribosylpyrophosphate synthetase - associated protein 41 (pap41) | 0.7641 | 133 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P38620_200_307_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9779 | 219 | 260 | 3.40.50.2020 |
| af_P0A717_198_307_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.972 | 219 | 260 | 3.40.50.2020 |
| af_Q2G0S2_201_314_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9621 | 220 | 255 | 3.40.50.2020 |
| af_P46846_104_226_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9382 | 144 | 260 | 3.40.50.2020 |
| af_P87171_221_328_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9327 | 220 | 264 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C3XRL3-F1-model_v4 | Phosphoribosyl transferase domain-containing protein | 0.9949 | 185 | 265 |
GO:0016740
|
| AF-A0A528JZ66-F1-model_v4 | ComF family protein | 0.9851 | 172 | 263 |
|
| AF-A0A531L7Q3-F1-model_v4 | ComF family protein | 0.983 | 186 | 263 |
|
| AF-A0A4R1Y518-F1-model_v4 | Phosphoribosyl transferase-like protein | 0.9703 | 187 | 265 |
GO:0016740
|
| AF-A0A259BH87-F1-model_v4 | Phosphoribosyltransferase domain-containing protein | 0.9677 | 130 | 265 |
|