F487984
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1005 | 528 | 2008 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10693242|Ga0105248_106932422 |
| Length | 154 |
| Sequence | MSVTIYHNPACGTSRNTLAMIRQSGEEPEVIEYLKTPPGRARLVELIAALGLSPRELLREKGTPYAELGLADPKWSDDELIDFMMAHPILINRPIVVTPKGVRLCRPSELVLDLLDNPIESFVKVDGEAIARGRLPSCTIARHNSVWNLRPACA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 210 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 232 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 234 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 336 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 337 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 338 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 339 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 340 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 341 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 342 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 343 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 366 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 380 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 381 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 382 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 383 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 386 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 387 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 388 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 389 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 391 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 392 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 393 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 394 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 396 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 397 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 398 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 399 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 402 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 403 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 405 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 406 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 408 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 410 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 412 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 413 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 414 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 415 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 416 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 417 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 418 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 419 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 420 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 421 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 422 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 423 | 2791355199 | |||
| 424 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 425 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 426 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 427 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 428 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 429 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 430 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 431 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 432 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 433 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 434 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 435 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 436 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 437 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 438 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 439 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 440 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 441 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 442 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 443 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 444 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 445 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 446 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 447 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 448 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 449 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 450 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 451 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 452 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 453 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 454 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 455 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 456 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 457 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 458 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 459 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 460 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 461 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 462 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 463 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 464 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 465 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 466 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 467 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 468 | 2922425934 | |||
| 469 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 470 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 471 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 472 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 473 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 474 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 475 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 476 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 477 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 478 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 479 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 480 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 481 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 482 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 483 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 484 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 485 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 486 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 487 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 488 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 489 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 490 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 491 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 492 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 493 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 494 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 495 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 496 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 497 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 498 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 499 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 500 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 501 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 502 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 503 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 504 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 505 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 506 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 507 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 508 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 509 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 510 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 511 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 512 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 513 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 514 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 515 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 516 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 517 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 518 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 519 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 520 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 521 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 522 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 523 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 524 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 525 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 526 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 527 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 528 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.14 |
| Metatranscriptomes | 0.2 |
| Isolates | 11.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.25 |
| Nodule | 10.25 |
| Rhizoplane | 3.38 |
| Rhizosphere | 71.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_10693242 | 3300009177 | Bacteria | 1149 |
| 2 | JGI24740J21852_10039356 | 3300001979 | Bacteria | 1443 |
| 3 | JGI24739J22299_10025701 | 3300001989 | Bacteria | 2070 |
| 4 | JGI24737J22298_10032210 | 3300001990 | Bacteria | 1634 |
| 5 | JGI24735J21928_10096102 | 3300002067 | Bacteria | 850 |
| 6 | JGI24738J21930_10055845 | 3300002075 | Bacteria | 807 |
| 7 | JGI25404J52841_10028295 | 3300003659 | Bacteria | 1203 |
| 8 | Ga0070658_10502921 | 3300005327 | Bacteria | 1047 |
| 9 | Ga0070658_11234264 | 3300005327 | Bacteria | 650 |
| 10 | Ga0070676_10392278 | 3300005328 | Bacteria | 964 |
| 11 | Ga0070683_101070301 | 3300005329 | Bacteria | 775 |
| 12 | Ga0070683_101080154 | 3300005329 | Bacteria | 771 |
| 13 | Ga0070690_100063676 | 3300005330 | Bacteria | 2380 |
| 14 | Ga0068869_100015866 | 3300005334 | Bacteria | 5066 |
| 15 | Ga0068869_100150162 | 3300005334 | Bacteria | 1806 |
| 16 | Ga0068869_100525783 | 3300005334 | Bacteria | 991 |
| 17 | Ga0070680_100085528 | 3300005336 | Bacteria | 2605 |
| 18 | Ga0070680_100174899 | 3300005336 | Bacteria | 1807 |
| 19 | Ga0070680_100394192 | 3300005336 | Bacteria | 1180 |
| 20 | Ga0070682_101469809 | 3300005337 | Bacteria | 585 |
| 21 | Ga0068868_100133434 | 3300005338 | Bacteria | 2034 |
| 22 | Ga0068868_100401660 | 3300005338 | Bacteria | 1183 |
| 23 | Ga0068868_100541615 | 3300005338 | Bacteria | 1025 |
| 24 | Ga0070660_100061272 | 3300005339 | Bacteria | 2921 |
| 25 | Ga0070660_100086099 | 3300005339 | Bacteria | 2472 |
| 26 | Ga0070660_100116666 | 3300005339 | Bacteria | 2129 |
| 27 | Ga0070660_100222100 | 3300005339 | Bacteria | 1536 |
| 28 | Ga0070660_100225123 | 3300005339 | Bacteria | 1525 |
| 29 | Ga0070691_10880330 | 3300005341 | Bacteria | 551 |
| 30 | Ga0070687_100113193 | 3300005343 | Bacteria | 1539 |
| 31 | Ga0070661_100082671 | 3300005344 | Bacteria | 2372 |
| 32 | Ga0070661_100188537 | 3300005344 | Bacteria | 1572 |
| 33 | Ga0070668_100044770 | 3300005347 | Bacteria | 3395 |
| 34 | Ga0070668_100406470 | 3300005347 | Bacteria | 1163 |
| 35 | Ga0070668_100519621 | 3300005347 | Bacteria | 1033 |
| 36 | Ga0070675_100202571 | 3300005354 | Bacteria | 1723 |
| 37 | Ga0070675_100789664 | 3300005354 | Bacteria | 867 |
| 38 | Ga0070671_100644649 | 3300005355 | Bacteria | 917 |
| 39 | Ga0070671_101352222 | 3300005355 | Bacteria | 629 |
| 40 | Ga0070674_100030526 | 3300005356 | Bacteria | 3563 |
| 41 | Ga0070674_100489911 | 3300005356 | Bacteria | 1022 |
| 42 | Ga0070673_100064592 | 3300005364 | Bacteria | 2917 |
| 43 | Ga0070673_100389664 | 3300005364 | Bacteria | 1244 |
| 44 | Ga0070688_100220007 | 3300005365 | Bacteria | 1338 |
| 45 | Ga0070659_100467564 | 3300005366 | Bacteria | 1072 |
| 46 | Ga0070659_100877986 | 3300005366 | Bacteria | 783 |
| 47 | Ga0070714_100038907 | 3300005435 | Bacteria | 4001 |
| 48 | Ga0070714_100951059 | 3300005435 | Bacteria | 835 |
| 49 | Ga0070713_100008997 | 3300005436 | Bacteria | 7119 |
| 50 | Ga0070713_100025614 | 3300005436 | Bacteria | 4615 |
| 51 | Ga0070710_10001323 | 3300005437 | Bacteria | 11692 |
| 52 | Ga0070701_10016381 | 3300005438 | Bacteria | 3445 |
| 53 | Ga0070711_100040022 | 3300005439 | Bacteria | 3159 |
| 54 | Ga0070711_100073013 | 3300005439 | Bacteria | 2422 |
| 55 | Ga0070711_100965594 | 3300005439 | Bacteria | 730 |
| 56 | Ga0070705_100580887 | 3300005440 | Bacteria | 864 |
| 57 | Ga0070700_100159450 | 3300005441 | Bacteria | 1551 |
| 58 | Ga0070700_100209452 | 3300005441 | Bacteria | 1375 |
| 59 | Ga0070700_101574484 | 3300005441 | Bacteria | 561 |
| 60 | Ga0070663_100004927 | 3300005455 | Bacteria | 7882 |
| 61 | Ga0070663_100123312 | 3300005455 | Bacteria | 1960 |
| 62 | Ga0070678_100021934 | 3300005456 | Bacteria | 4221 |
| 63 | Ga0070662_100033210 | 3300005457 | Bacteria | 3631 |
| 64 | Ga0070662_100055790 | 3300005457 | Bacteria | 2867 |
| 65 | Ga0070681_10126301 | 3300005458 | Bacteria | 2490 |
| 66 | Ga0070681_10412005 | 3300005458 | Bacteria | 1263 |
| 67 | Ga0070681_10507344 | 3300005458 | Bacteria | 1119 |
| 68 | Ga0070681_10688752 | 3300005458 | Bacteria | 938 |
| 69 | Ga0068867_100038760 | 3300005459 | Bacteria | 3470 |
| 70 | Ga0068867_100794163 | 3300005459 | Bacteria | 843 |
| 71 | Ga0070698_100549219 | 3300005471 | Bacteria | 1095 |
| 72 | Ga0070679_100040704 | 3300005530 | Bacteria | 4623 |
| 73 | Ga0070679_100266373 | 3300005530 | Bacteria | 1668 |
| 74 | Ga0070679_101419413 | 3300005530 | Bacteria | 641 |
| 75 | Ga0070684_100213388 | 3300005535 | Bacteria | 1759 |
| 76 | Ga0070697_100632260 | 3300005536 | Bacteria | 942 |
| 77 | Ga0068853_100014558 | 3300005539 | Bacteria | 6448 |
| 78 | Ga0068853_100066019 | 3300005539 | Bacteria | 3141 |
| 79 | Ga0068853_100141321 | 3300005539 | Bacteria | 2161 |
| 80 | Ga0068853_100160826 | 3300005539 | Bacteria | 2026 |
| 81 | Ga0068853_100216451 | 3300005539 | Bacteria | 1748 |
| 82 | Ga0068853_100342322 | 3300005539 | Bacteria | 1390 |
| 83 | Ga0068853_100750060 | 3300005539 | Bacteria | 933 |
| 84 | Ga0070672_100013720 | 3300005543 | Bacteria | 5729 |
| 85 | Ga0070695_100303691 | 3300005545 | Bacteria | 1181 |
| 86 | Ga0070695_100856482 | 3300005545 | Bacteria | 732 |
| 87 | Ga0070693_100180431 | 3300005547 | Bacteria | 1359 |
| 88 | Ga0070693_100246710 | 3300005547 | Bacteria | 1182 |
| 89 | Ga0070665_100071088 | 3300005548 | Bacteria | 3486 |
| 90 | Ga0070665_100134870 | 3300005548 | Bacteria | 2471 |
| 91 | Ga0070665_100367902 | 3300005548 | Bacteria | 1444 |
| 92 | Ga0070704_100226455 | 3300005549 | Bacteria | 1523 |
| 93 | Ga0068855_100066543 | 3300005563 | Bacteria | 4201 |
| 94 | Ga0068855_100097944 | 3300005563 | Bacteria | 3378 |
| 95 | Ga0068855_100163435 | 3300005563 | Bacteria | 2525 |
| 96 | Ga0068855_100277969 | 3300005563 | Bacteria | 1860 |
| 97 | Ga0068855_102180026 | 3300005563 | Bacteria | 557 |
| 98 | Ga0068857_100010083 | 3300005577 | Bacteria | 8207 |
| 99 | Ga0068857_100016903 | 3300005577 | Bacteria | 6392 |
| 100 | Ga0068857_100180444 | 3300005577 | Bacteria | 1921 |
| 101 | Ga0068857_100568753 | 3300005577 | Bacteria | 1069 |
| 102 | Ga0068854_100009252 | 3300005578 | Bacteria | 6357 |
| 103 | Ga0068854_100011841 | 3300005578 | Bacteria | 5695 |
| 104 | Ga0068854_100198165 | 3300005578 | Bacteria | 1577 |
| 105 | Ga0068856_100005753 | 3300005614 | Bacteria | 12215 |
| 106 | Ga0068856_100006749 | 3300005614 | Bacteria | 11239 |
| 107 | Ga0068856_100037307 | 3300005614 | Bacteria | 4769 |
| 108 | Ga0068856_100244928 | 3300005614 | Bacteria | 1808 |
| 109 | Ga0070702_100347086 | 3300005615 | Bacteria | 1044 |
| 110 | Ga0068852_100088878 | 3300005616 | Bacteria | 2760 |
| 111 | Ga0068852_100190699 | 3300005616 | Bacteria | 1934 |
| 112 | Ga0068852_100382459 | 3300005616 | Bacteria | 1381 |
| 113 | Ga0068859_100801071 | 3300005617 | Bacteria | 1030 |
| 114 | Ga0068859_100873993 | 3300005617 | Bacteria | 984 |
| 115 | Ga0068866_10061021 | 3300005718 | Bacteria | 1957 |
| 116 | Ga0068866_10429840 | 3300005718 | Bacteria | 858 |
| 117 | Ga0068861_100060839 | 3300005719 | Bacteria | 2896 |
| 118 | Ga0068861_100271472 | 3300005719 | Bacteria | 1456 |
| 119 | Ga0068851_10016691 | 3300005834 | Bacteria | 3518 |
| 120 | Ga0068851_10071614 | 3300005834 | Bacteria | 1794 |
| 121 | Ga0068863_100142543 | 3300005841 | Bacteria | 2291 |
| 122 | Ga0068863_100337552 | 3300005841 | Bacteria | 1465 |
| 123 | Ga0068863_100361190 | 3300005841 | Bacteria | 1416 |
| 124 | Ga0068858_100064822 | 3300005842 | Bacteria | 3381 |
| 125 | Ga0068858_100805092 | 3300005842 | Bacteria | 917 |
| 126 | Ga0068858_101441449 | 3300005842 | Bacteria | 679 |
| 127 | Ga0068860_100124217 | 3300005843 | Bacteria | 2474 |
| 128 | Ga0068860_100238253 | 3300005843 | Bacteria | 1769 |
| 129 | Ga0068860_100530726 | 3300005843 | Bacteria | 1177 |
| 130 | Ga0068862_100137129 | 3300005844 | Bacteria | 2169 |
| 131 | Ga0068862_100224621 | 3300005844 | Bacteria | 1701 |
| 132 | Ga0068862_100957387 | 3300005844 | Bacteria | 844 |
| 133 | Ga0068862_101645670 | 3300005844 | Bacteria | 649 |
| 134 | Ga0081455_10003355 | 3300005937 | Bacteria | 18462 |
| 135 | Ga0081455_10007167 | 3300005937 | Bacteria | 11786 |
| 136 | Ga0081455_10021699 | 3300005937 | Bacteria | 6016 |
| 137 | Ga0081538_10115446 | 3300005981 | Bacteria | 1305 |
| 138 | Ga0081538_10142378 | 3300005981 | Bacteria | 1103 |
| 139 | Ga0081540_1001032 | 3300005983 | Bacteria | 24938 |
| 140 | Ga0081540_1002786 | 3300005983 | Bacteria | 14181 |
| 141 | Ga0081540_1002954 | 3300005983 | Bacteria | 13645 |
| 142 | Ga0081540_1007525 | 3300005983 | Bacteria | 7753 |
| 143 | Ga0081540_1007738 | 3300005983 | Bacteria | 7609 |
| 144 | Ga0081540_1014291 | 3300005983 | Bacteria | 5096 |
| 145 | Ga0081540_1016193 | 3300005983 | Bacteria | 4680 |
| 146 | Ga0081540_1137261 | 3300005983 | Bacteria | 988 |
| 147 | Ga0081540_1192691 | 3300005983 | Bacteria | 750 |
| 148 | Ga0081540_1318452 | 3300005983 | Bacteria | 534 |
| 149 | Ga0081539_10018493 | 3300005985 | Bacteria | 4832 |
| 150 | Ga0081539_10023497 | 3300005985 | Bacteria | 4038 |
| 151 | Ga0070717_10017140 | 3300006028 | Bacteria | 5628 |
| 152 | Ga0070717_11434177 | 3300006028 | Bacteria | 627 |
| 153 | Ga0075365_10003538 | 3300006038 | Bacteria | 8080 |
| 154 | Ga0075365_10022932 | 3300006038 | Bacteria | 3919 |
| 155 | Ga0075365_10057275 | 3300006038 | Bacteria | 2593 |
| 156 | Ga0075365_10274031 | 3300006038 | Bacteria | 1187 |
| 157 | Ga0075368_10164869 | 3300006042 | Bacteria | 930 |
| 158 | Ga0075363_100001158 | 3300006048 | Bacteria | 9673 |
| 159 | Ga0075363_100637246 | 3300006048 | Bacteria | 641 |
| 160 | Ga0075364_10096159 | 3300006051 | Bacteria | 1969 |
| 161 | Ga0075364_10115052 | 3300006051 | Bacteria | 1797 |
| 162 | Ga0075364_11199133 | 3300006051 | Bacteria | 515 |
| 163 | Ga0070715_10007268 | 3300006163 | Bacteria | 3807 |
| 164 | Ga0070716_100181083 | 3300006173 | Bacteria | 1383 |
| 165 | Ga0070716_100181223 | 3300006173 | Bacteria | 1383 |
| 166 | Ga0070716_100193743 | 3300006173 | Bacteria | 1345 |
| 167 | Ga0070712_100094123 | 3300006175 | Bacteria | 2201 |
| 168 | Ga0070712_100215277 | 3300006175 | Bacteria | 1517 |
| 169 | Ga0070712_100293346 | 3300006175 | Bacteria | 1314 |
| 170 | Ga0075362_10038749 | 3300006177 | Bacteria | 2094 |
| 171 | Ga0075362_10045644 | 3300006177 | Bacteria | 1946 |
| 172 | Ga0075362_10471014 | 3300006177 | Bacteria | 640 |
| 173 | Ga0075367_10101088 | 3300006178 | Bacteria | 1763 |
| 174 | Ga0075367_10174758 | 3300006178 | Bacteria | 1338 |
| 175 | Ga0075367_10187400 | 3300006178 | Bacteria | 1290 |
| 176 | Ga0075367_10196244 | 3300006178 | Bacteria | 1260 |
| 177 | Ga0075367_10613399 | 3300006178 | Bacteria | 691 |
| 178 | Ga0075369_10047677 | 3300006186 | Bacteria | 1847 |
| 179 | Ga0075369_10098844 | 3300006186 | Bacteria | 1308 |
| 180 | Ga0075369_10309963 | 3300006186 | Bacteria | 738 |
| 181 | Ga0075369_10321822 | 3300006186 | Bacteria | 723 |
| 182 | Ga0075366_10339278 | 3300006195 | Bacteria | 921 |
| 183 | Ga0075366_10368691 | 3300006195 | Bacteria | 882 |
| 184 | Ga0097621_100358989 | 3300006237 | Bacteria | 1297 |
| 185 | Ga0097621_102085031 | 3300006237 | Bacteria | 542 |
| 186 | Ga0075370_10729755 | 3300006353 | Bacteria | 603 |
| 187 | Ga0068871_100389943 | 3300006358 | Bacteria | 1239 |
| 188 | Ga0068871_101152032 | 3300006358 | Bacteria | 726 |
| 189 | Ga0068871_102110222 | 3300006358 | Bacteria | 537 |
| 190 | Ga0075428_100192302 | 3300006844 | Bacteria | 2207 |
| 191 | Ga0075428_100441443 | 3300006844 | Bacteria | 1394 |
| 192 | Ga0075431_100499532 | 3300006847 | Bacteria | 1208 |
| 193 | Ga0075431_101190209 | 3300006847 | Bacteria | 725 |
| 194 | Ga0075434_101486478 | 3300006871 | Bacteria | 687 |
| 195 | Ga0068865_100091161 | 3300006881 | Bacteria | 2211 |
| 196 | Ga0097620_100801105 | 3300006931 | Bacteria | 1030 |
| 197 | Ga0097620_100873973 | 3300006931 | Bacteria | 984 |
| 198 | Ga0099794_10030428 | 3300007265 | Bacteria | 2521 |
| 199 | Ga0099795_10023693 | 3300007788 | Bacteria | 2039 |
| 200 | Ga0099795_10093986 | 3300007788 | Bacteria | 1167 |
| 201 | Ga0099795_10127485 | 3300007788 | Bacteria | 1024 |
| 202 | Ga0105251_10590333 | 3300009011 | Bacteria | 526 |
| 203 | Ga0105250_10160153 | 3300009092 | Bacteria | 939 |
| 204 | Ga0105240_10002409 | 3300009093 | Bacteria | 30057 |
| 205 | Ga0105240_10053294 | 3300009093 | Bacteria | 5078 |
| 206 | Ga0105240_10328284 | 3300009093 | Bacteria | 1742 |
| 207 | Ga0111539_10650228 | 3300009094 | Bacteria | 1228 |
| 208 | Ga0111539_13149324 | 3300009094 | Bacteria | 532 |
| 209 | Ga0105245_10220241 | 3300009098 | Bacteria | 1831 |
| 210 | Ga0105245_10713389 | 3300009098 | Bacteria | 1037 |
| 211 | Ga0105245_11837056 | 3300009098 | Bacteria | 659 |
| 212 | Ga0105245_11908235 | 3300009098 | Bacteria | 647 |
| 213 | Ga0105247_10449358 | 3300009101 | Bacteria | 929 |
| 214 | Ga0105247_10544544 | 3300009101 | Bacteria | 852 |
| 215 | Ga0114129_10103659 | 3300009147 | Bacteria | 3933 |
| 216 | Ga0114129_11289216 | 3300009147 | Bacteria | 906 |
| 217 | Ga0105243_10067114 | 3300009148 | Bacteria | 2887 |
| 218 | Ga0105241_10000269 | 3300009174 | Bacteria | 38808 |
| 219 | Ga0105241_10162189 | 3300009174 | Bacteria | 1839 |
| 220 | Ga0105241_10339732 | 3300009174 | Bacteria | 1301 |
| 221 | Ga0105242_10347345 | 3300009176 | Bacteria | 1369 |
| 222 | Ga0105242_10937885 | 3300009176 | Bacteria | 869 |
| 223 | Ga0105242_11430405 | 3300009176 | Bacteria | 720 |
| 224 | Ga0105242_12469319 | 3300009176 | Bacteria | 568 |
| 225 | Ga0105248_10025744 | 3300009177 | Bacteria | 6544 |
| 226 | Ga0105248_10956650 | 3300009177 | Bacteria | 967 |
| 227 | Ga0105237_10059189 | 3300009545 | Bacteria | 3832 |
| 228 | Ga0105237_10090547 | 3300009545 | Bacteria | 3048 |
| 229 | Ga0105237_10154856 | 3300009545 | Bacteria | 2288 |
| 230 | Ga0105237_10160768 | 3300009545 | Bacteria | 2244 |
| 231 | Ga0105237_10746115 | 3300009545 | Bacteria | 985 |
| 232 | Ga0105237_11158257 | 3300009545 | Bacteria | 780 |
| 233 | Ga0105238_10010406 | 3300009551 | Bacteria | 9336 |
| 234 | Ga0105238_10103450 | 3300009551 | Bacteria | 2829 |
| 235 | Ga0105238_10133209 | 3300009551 | Bacteria | 2463 |
| 236 | Ga0105238_10201611 | 3300009551 | Bacteria | 1965 |
| 237 | Ga0105249_10302364 | 3300009553 | Bacteria | 1605 |
| 238 | Ga0105249_10685830 | 3300009553 | Bacteria | 1084 |
| 239 | Ga0099796_10123283 | 3300010159 | Bacteria | 998 |
| 240 | Ga0105239_10044037 | 3300010375 | Bacteria | 4893 |
| 241 | Ga0105239_10054941 | 3300010375 | Bacteria | 4368 |
| 242 | Ga0105239_10102818 | 3300010375 | Bacteria | 3162 |
| 243 | Ga0105239_10319121 | 3300010375 | Bacteria | 1752 |
| 244 | Ga0105239_10402831 | 3300010375 | Bacteria | 1548 |
| 245 | Ga0105239_10532559 | 3300010375 | Bacteria | 1337 |
| 246 | Ga0105239_11065269 | 3300010375 | Bacteria | 930 |
| 247 | Ga0105239_11823925 | 3300010375 | Bacteria | 705 |
| 248 | Ga0105246_10045143 | 3300011119 | Bacteria | 2999 |
| 249 | Ga0105246_10413571 | 3300011119 | Bacteria | 1123 |
| 250 | Ga0157315_1025224 | 3300012508 | Bacteria | 659 |
| 251 | Ga0157370_10093663 | 3300013104 | Bacteria | 2819 |
| 252 | Ga0157370_10097046 | 3300013104 | Bacteria | 2765 |
| 253 | Ga0157369_10124140 | 3300013105 | Bacteria | 2739 |
| 254 | Ga0157374_12068387 | 3300013296 | Bacteria | 596 |
| 255 | Ga0157378_10010051 | 3300013297 | Bacteria | 8246 |
| 256 | Ga0157378_10303715 | 3300013297 | Bacteria | 1545 |
| 257 | Ga0157378_10429977 | 3300013297 | Bacteria | 1306 |
| 258 | Ga0157372_12238683 | 3300013307 | Bacteria | 628 |
| 259 | Ga0157375_10607109 | 3300013308 | Bacteria | 1253 |
| 260 | Ga0163163_10270859 | 3300014325 | Bacteria | 1749 |
| 261 | Ga0163163_10305046 | 3300014325 | Bacteria | 1645 |
| 262 | Ga0157380_10113233 | 3300014326 | Bacteria | 2284 |
| 263 | Ga0157377_10383155 | 3300014745 | Bacteria | 953 |
| 264 | Ga0157379_10479951 | 3300014968 | Bacteria | 1150 |
| 265 | Ga0157379_11054582 | 3300014968 | Bacteria | 777 |
| 266 | Ga0157379_11373587 | 3300014968 | Unclassified | 684 |
| 267 | Ga0157379_11453851 | 3300014968 | Bacteria | 666 |
| 268 | Ga0157376_10390515 | 3300014969 | Bacteria | 1343 |
| 269 | Ga0157376_10827621 | 3300014969 | Bacteria | 940 |
| 270 | Ga0163161_10049232 | 3300017792 | Bacteria | 3045 |
| 271 | Ga0209233_1008120 | 3300025261 | Bacteria | 3276 |
| 272 | Ga0209130_1016398 | 3300025284 | Bacteria | 1795 |
| 273 | Ga0209025_1141824 | 3300025294 | Bacteria | 679 |
| 274 | Ga0209758_1007398 | 3300025297 | Bacteria | 7495 |
| 275 | Ga0209758_1017972 | 3300025297 | Bacteria | 3491 |
| 276 | Ga0207656_10040888 | 3300025321 | Bacteria | 1967 |
| 277 | Ga0207696_1039036 | 3300025711 | Bacteria | 1399 |
| 278 | Ga0207692_10004070 | 3300025898 | Bacteria | 5764 |
| 279 | Ga0207692_10558515 | 3300025898 | Bacteria | 732 |
| 280 | Ga0207710_10466672 | 3300025900 | Bacteria | 653 |
| 281 | Ga0207647_10001356 | 3300025904 | Bacteria | 18803 |
| 282 | Ga0207685_10031395 | 3300025905 | Bacteria | 1902 |
| 283 | Ga0207685_10117865 | 3300025905 | Bacteria | 1161 |
| 284 | Ga0207685_10817564 | 3300025905 | Bacteria | 514 |
| 285 | Ga0207699_10699720 | 3300025906 | Bacteria | 742 |
| 286 | Ga0207645_10327453 | 3300025907 | Bacteria | 1023 |
| 287 | Ga0207645_10366252 | 3300025907 | Bacteria | 966 |
| 288 | Ga0207643_10028299 | 3300025908 | Bacteria | 3112 |
| 289 | Ga0207705_10141242 | 3300025909 | Bacteria | 1799 |
| 290 | Ga0207705_10244138 | 3300025909 | Bacteria | 1368 |
| 291 | Ga0207684_10726795 | 3300025910 | Bacteria | 842 |
| 292 | Ga0207654_10000939 | 3300025911 | Bacteria | 16013 |
| 293 | Ga0207654_10046765 | 3300025911 | Bacteria | 2469 |
| 294 | Ga0207654_10191788 | 3300025911 | Bacteria | 1340 |
| 295 | Ga0207707_10050546 | 3300025912 | Bacteria | 3620 |
| 296 | Ga0207707_10083424 | 3300025912 | Bacteria | 2790 |
| 297 | Ga0207707_10167047 | 3300025912 | Bacteria | 1923 |
| 298 | Ga0207695_10002086 | 3300025913 | Bacteria | 30425 |
| 299 | Ga0207695_10043865 | 3300025913 | Bacteria | 4761 |
| 300 | Ga0207695_10135037 | 3300025913 | Bacteria | 2421 |
| 301 | Ga0207695_10331588 | 3300025913 | Bacteria | 1410 |
| 302 | Ga0207695_10479059 | 3300025913 | Bacteria | 1127 |
| 303 | Ga0207671_10219619 | 3300025914 | Bacteria | 1489 |
| 304 | Ga0207671_10311669 | 3300025914 | Bacteria | 1244 |
| 305 | Ga0207671_10461312 | 3300025914 | Bacteria | 1012 |
| 306 | Ga0207671_10500052 | 3300025914 | Bacteria | 969 |
| 307 | Ga0207671_10521926 | 3300025914 | Bacteria | 947 |
| 308 | Ga0207693_10000606 | 3300025915 | Bacteria | 32081 |
| 309 | Ga0207693_10036058 | 3300025915 | Bacteria | 3897 |
| 310 | Ga0207693_10280141 | 3300025915 | Bacteria | 1306 |
| 311 | Ga0207693_10690195 | 3300025915 | Bacteria | 791 |
| 312 | Ga0207663_10002328 | 3300025916 | Bacteria | 9118 |
| 313 | Ga0207663_10476393 | 3300025916 | Bacteria | 966 |
| 314 | Ga0207663_11341508 | 3300025916 | Bacteria | 576 |
| 315 | Ga0207660_10193176 | 3300025917 | Bacteria | 1586 |
| 316 | Ga0207660_10214610 | 3300025917 | Bacteria | 1508 |
| 317 | Ga0207660_10705187 | 3300025917 | Bacteria | 823 |
| 318 | Ga0207657_10004938 | 3300025919 | Bacteria | 14027 |
| 319 | Ga0207657_10074968 | 3300025919 | Bacteria | 2856 |
| 320 | Ga0207657_10312593 | 3300025919 | Bacteria | 1243 |
| 321 | Ga0207649_10057376 | 3300025920 | Bacteria | 2434 |
| 322 | Ga0207649_10312202 | 3300025920 | Bacteria | 1153 |
| 323 | Ga0207652_10070088 | 3300025921 | Bacteria | 3044 |
| 324 | Ga0207652_10094481 | 3300025921 | Bacteria | 2633 |
| 325 | Ga0207652_10254030 | 3300025921 | Bacteria | 1585 |
| 326 | Ga0207652_10570276 | 3300025921 | Bacteria | 1016 |
| 327 | Ga0207681_10412901 | 3300025923 | Bacteria | 1092 |
| 328 | Ga0207681_10734383 | 3300025923 | Bacteria | 822 |
| 329 | Ga0207681_11559212 | 3300025923 | Bacteria | 553 |
| 330 | Ga0207694_10000787 | 3300025924 | Bacteria | 28518 |
| 331 | Ga0207694_10006017 | 3300025924 | Bacteria | 9281 |
| 332 | Ga0207694_10353373 | 3300025924 | Bacteria | 1217 |
| 333 | Ga0207694_10426042 | 3300025924 | Bacteria | 1106 |
| 334 | Ga0207694_10897978 | 3300025924 | Bacteria | 749 |
| 335 | Ga0207659_10520616 | 3300025926 | Bacteria | 1008 |
| 336 | Ga0207687_10032210 | 3300025927 | Bacteria | 3549 |
| 337 | Ga0207687_10056507 | 3300025927 | Bacteria | 2754 |
| 338 | Ga0207687_10815856 | 3300025927 | Bacteria | 796 |
| 339 | Ga0207700_10031994 | 3300025928 | Bacteria | 3745 |
| 340 | Ga0207700_10163092 | 3300025928 | Bacteria | 1853 |
| 341 | Ga0207664_10095218 | 3300025929 | Bacteria | 2449 |
| 342 | Ga0207644_10799177 | 3300025931 | Bacteria | 789 |
| 343 | Ga0207644_11532845 | 3300025931 | Bacteria | 559 |
| 344 | Ga0207690_10164100 | 3300025932 | Bacteria | 1658 |
| 345 | Ga0207690_10676852 | 3300025932 | Bacteria | 847 |
| 346 | Ga0207706_10448498 | 3300025933 | Bacteria | 1116 |
| 347 | Ga0207686_10449407 | 3300025934 | Bacteria | 991 |
| 348 | Ga0207686_10554599 | 3300025934 | Bacteria | 899 |
| 349 | Ga0207686_10557231 | 3300025934 | Bacteria | 897 |
| 350 | Ga0207709_10030165 | 3300025935 | Bacteria | 3152 |
| 351 | Ga0207709_10781365 | 3300025935 | Bacteria | 770 |
| 352 | Ga0207670_10302307 | 3300025936 | Bacteria | 1253 |
| 353 | Ga0207669_11785916 | 3300025937 | Bacteria | 525 |
| 354 | Ga0207704_10398232 | 3300025938 | Bacteria | 1086 |
| 355 | Ga0207704_11921229 | 3300025938 | Bacteria | 509 |
| 356 | Ga0207665_10123226 | 3300025939 | Bacteria | 1833 |
| 357 | Ga0207665_10240072 | 3300025939 | Bacteria | 1335 |
| 358 | Ga0207665_10690951 | 3300025939 | Bacteria | 802 |
| 359 | Ga0207691_10099702 | 3300025940 | Bacteria | 2593 |
| 360 | Ga0207711_10039722 | 3300025941 | Bacteria | 4003 |
| 361 | Ga0207689_10084226 | 3300025942 | Bacteria | 2614 |
| 362 | Ga0207689_10162653 | 3300025942 | Bacteria | 1839 |
| 363 | Ga0207689_10195132 | 3300025942 | Bacteria | 1671 |
| 364 | Ga0207689_10333873 | 3300025942 | Bacteria | 1259 |
| 365 | Ga0207661_10660984 | 3300025944 | Bacteria | 961 |
| 366 | Ga0207679_11099542 | 3300025945 | Bacteria | 729 |
| 367 | Ga0207667_10022739 | 3300025949 | Bacteria | 6916 |
| 368 | Ga0207667_10042826 | 3300025949 | Bacteria | 4809 |
| 369 | Ga0207667_10063877 | 3300025949 | Bacteria | 3846 |
| 370 | Ga0207667_10121508 | 3300025949 | Bacteria | 2691 |
| 371 | Ga0207667_10150794 | 3300025949 | Bacteria | 2393 |
| 372 | Ga0207667_11765857 | 3300025949 | Bacteria | 583 |
| 373 | Ga0207651_10254224 | 3300025960 | Bacteria | 1439 |
| 374 | Ga0207712_10218668 | 3300025961 | Bacteria | 1522 |
| 375 | Ga0207712_11003775 | 3300025961 | Bacteria | 741 |
| 376 | Ga0207712_11565211 | 3300025961 | Bacteria | 591 |
| 377 | Ga0207712_11692182 | 3300025961 | Bacteria | 567 |
| 378 | Ga0207668_10089610 | 3300025972 | Bacteria | 2255 |
| 379 | Ga0207668_10491171 | 3300025972 | Bacteria | 1054 |
| 380 | Ga0207640_10287731 | 3300025981 | Bacteria | 1294 |
| 381 | Ga0207640_10551976 | 3300025981 | Bacteria | 968 |
| 382 | Ga0207640_10762162 | 3300025981 | Bacteria | 835 |
| 383 | Ga0207658_10310580 | 3300025986 | Bacteria | 1362 |
| 384 | Ga0207677_10167755 | 3300026023 | Bacteria | 1713 |
| 385 | Ga0207677_10810989 | 3300026023 | Bacteria | 838 |
| 386 | Ga0207677_11702432 | 3300026023 | Bacteria | 585 |
| 387 | Ga0207703_10060442 | 3300026035 | Bacteria | 3099 |
| 388 | Ga0207703_10999509 | 3300026035 | Bacteria | 802 |
| 389 | Ga0207639_10014324 | 3300026041 | Bacteria | 5574 |
| 390 | Ga0207639_10110463 | 3300026041 | Bacteria | 2240 |
| 391 | Ga0207639_10160502 | 3300026041 | Bacteria | 1894 |
| 392 | Ga0207639_10191860 | 3300026041 | Bacteria | 1746 |
| 393 | Ga0207639_10461700 | 3300026041 | Bacteria | 1154 |
| 394 | Ga0207639_10864525 | 3300026041 | Bacteria | 844 |
| 395 | Ga0207639_11701219 | 3300026041 | Bacteria | 591 |
| 396 | Ga0207639_12206645 | 3300026041 | Bacteria | 512 |
| 397 | Ga0207678_10005558 | 3300026067 | Bacteria | 11266 |
| 398 | Ga0207678_10036066 | 3300026067 | Bacteria | 4304 |
| 399 | Ga0207678_10062772 | 3300026067 | Bacteria | 3193 |
| 400 | Ga0207678_10089061 | 3300026067 | Bacteria | 2638 |
| 401 | Ga0207678_10128449 | 3300026067 | Bacteria | 2162 |
| 402 | Ga0207708_10096720 | 3300026075 | Bacteria | 2282 |
| 403 | Ga0207708_10214763 | 3300026075 | Bacteria | 1539 |
| 404 | Ga0207708_10672006 | 3300026075 | Bacteria | 883 |
| 405 | Ga0207708_10778587 | 3300026075 | Bacteria | 822 |
| 406 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 407 | Ga0207702_10031505 | 3300026078 | Bacteria | 4419 |
| 408 | Ga0207702_10127557 | 3300026078 | Bacteria | 2286 |
| 409 | Ga0207702_10512867 | 3300026078 | Bacteria | 1170 |
| 410 | Ga0207641_10105754 | 3300026088 | Bacteria | 2486 |
| 411 | Ga0207641_10275382 | 3300026088 | Bacteria | 1581 |
| 412 | Ga0207641_10484064 | 3300026088 | Bacteria | 1200 |
| 413 | Ga0207641_11585182 | 3300026088 | Bacteria | 657 |
| 414 | Ga0207648_10032444 | 3300026089 | Bacteria | 4611 |
| 415 | Ga0207648_10207585 | 3300026089 | Bacteria | 1738 |
| 416 | Ga0207648_10211914 | 3300026089 | Bacteria | 1720 |
| 417 | Ga0207676_10883131 | 3300026095 | Bacteria | 876 |
| 418 | Ga0207674_10003061 | 3300026116 | Bacteria | 20686 |
| 419 | Ga0207674_10003961 | 3300026116 | Bacteria | 18004 |
| 420 | Ga0207674_10160125 | 3300026116 | Bacteria | 2205 |
| 421 | Ga0207674_10569803 | 3300026116 | Bacteria | 1094 |
| 422 | Ga0207675_100161351 | 3300026118 | Bacteria | 2138 |
| 423 | Ga0207675_100191005 | 3300026118 | Bacteria | 1964 |
| 424 | Ga0207675_100231314 | 3300026118 | Bacteria | 1784 |
| 425 | Ga0207675_100465667 | 3300026118 | Bacteria | 1254 |
| 426 | Ga0207675_100987564 | 3300026118 | Bacteria | 860 |
| 427 | Ga0207683_10270371 | 3300026121 | Bacteria | 1552 |
| 428 | Ga0207683_10405285 | 3300026121 | Bacteria | 1255 |
| 429 | Ga0207683_10462526 | 3300026121 | Bacteria | 1170 |
| 430 | Ga0207698_10314657 | 3300026142 | Bacteria | 1463 |
| 431 | Ga0207698_10805407 | 3300026142 | Bacteria | 942 |
| 432 | Ga0207698_11106538 | 3300026142 | Bacteria | 805 |
| 433 | Ga0209179_1009585 | 3300027512 | Bacteria | 1665 |
| 434 | Ga0209179_1018187 | 3300027512 | Bacteria | 1340 |
| 435 | Ga0209179_1123476 | 3300027512 | Bacteria | 578 |
| 436 | Ga0209588_1001806 | 3300027671 | Bacteria | 5690 |
| 437 | Ga0209813_10031797 | 3300027866 | Bacteria | 1560 |
| 438 | Ga0268266_10001654 | 3300028379 | Bacteria | 25772 |
| 439 | Ga0268266_10016919 | 3300028379 | Bacteria | 6230 |
| 440 | Ga0268266_10027234 | 3300028379 | Bacteria | 4862 |
| 441 | Ga0268266_10223640 | 3300028379 | Bacteria | 1731 |
| 442 | Ga0268265_10017287 | 3300028380 | Bacteria | 4973 |
| 443 | Ga0268265_10197398 | 3300028380 | Bacteria | 1742 |
| 444 | Ga0268265_10402679 | 3300028380 | Bacteria | 1265 |
| 445 | Ga0268265_10598452 | 3300028380 | Bacteria | 1053 |
| 446 | Ga0268265_10754747 | 3300028380 | Bacteria | 944 |
| 447 | Ga0268264_10288745 | 3300028381 | Bacteria | 1540 |
| 448 | Ga0268264_10704182 | 3300028381 | Bacteria | 1003 |
| 449 | Ga0268264_10946004 | 3300028381 | Bacteria | 866 |
| 450 | Ga0307515_10012760 | 3300028794 | Bacteria | 15775 |
| 451 | Ga0265773_1020391 | 3300031018 | Bacteria | 649 |
| 452 | Ga0265330_10160351 | 3300031235 | Bacteria | 955 |
| 453 | Ga0265330_10251092 | 3300031235 | Bacteria | 745 |
| 454 | Ga0265332_10063963 | 3300031238 | Bacteria | 1571 |
| 455 | Ga0265325_10019623 | 3300031241 | Bacteria | 3734 |
| 456 | Ga0265339_10020279 | 3300031249 | Bacteria | 3886 |
| 457 | Ga0265316_10359021 | 3300031344 | Bacteria | 1054 |
| 458 | Ga0265316_10580821 | 3300031344 | Bacteria | 796 |
| 459 | Ga0307509_10031263 | 3300031507 | Bacteria | 5880 |
| 460 | Ga0307408_101130381 | 3300031548 | Bacteria | 728 |
| 461 | Ga0265313_10288400 | 3300031595 | Bacteria | 662 |
| 462 | Ga0307508_10000010 | 3300031616 | Bacteria | 255747 |
| 463 | Ga0307516_10649299 | 3300031730 | Bacteria | 710 |
| 464 | Ga0307405_10914521 | 3300031731 | Bacteria | 743 |
| 465 | Ga0307410_11631805 | 3300031852 | Bacteria | 570 |
| 466 | Ga0307406_10948202 | 3300031901 | Bacteria | 735 |
| 467 | Ga0307412_10401618 | 3300031911 | Bacteria | 1116 |
| 468 | Ga0307416_100183653 | 3300032002 | Bacteria | 1963 |
| 469 | Ga0307416_100301559 | 3300032002 | Bacteria | 1593 |
| 470 | Ga0307416_101077458 | 3300032002 | Bacteria | 908 |
| 471 | Ga0307411_10259134 | 3300032005 | Bacteria | 1372 |
| 472 | Ga0307415_100259304 | 3300032126 | Bacteria | 1417 |
| 473 | Ga0316593_10171051 | 3300032168 | Bacteria | 796 |
| 474 | Ga0307510_10046716 | 3300033180 | Bacteria | 4651 |
| 475 | Ga0307510_10093090 | 3300033180 | Bacteria | 2847 |
| 476 | Ga0307510_10098623 | 3300033180 | Bacteria | 2725 |
| 477 | Ga0307510_10166514 | 3300033180 | Bacteria | 1791 |
| 478 | Ga0307510_10357640 | 3300033180 | Bacteria | 909 |
| 479 | Ga0373926_0181052 | 3300035083 | Bacteria | 808 |
| 480 | Ga0373951_0211713 | 3300035091 | Bacteria | 569 |
| 481 | Ga0373923_0045638 | 3300035111 | Bacteria | 1820 |
| 482 | Ga0373923_0275751 | 3300035111 | Bacteria | 792 |
| 483 | Ga0373936_0011900 | 3300035113 | Bacteria | 3301 |
| 484 | Ga0373936_0191091 | 3300035113 | Bacteria | 901 |
| 485 | Ga0373945_0070598 | 3300035116 | Bacteria | 1321 |
| 486 | Ga0373953_0012681 | 3300035117 | Bacteria | 2992 |
| 487 | Ga0373953_0014657 | 3300035117 | Bacteria | 2825 |
| 488 | Ga0373953_0048566 | 3300035117 | Bacteria | 1710 |
| 489 | Ga0373954_0005242 | 3300035118 | Bacteria | 5600 |
| 490 | Ga0373954_0024546 | 3300035118 | Bacteria | 2749 |
| 491 | Ga0373954_0037892 | 3300035118 | Bacteria | 2241 |
| 492 | Ga0373956_0031781 | 3300035119 | Bacteria | 2315 |
| 493 | Ga0373956_0119763 | 3300035119 | Bacteria | 1229 |
| 494 | Ga0373957_0006606 | 3300035120 | Bacteria | 3664 |
| 495 | Ga0373957_0189047 | 3300035120 | Bacteria | 855 |
| 496 | Ga0373957_0217889 | 3300035120 | Bacteria | 798 |
| 497 | Ga0373957_0368905 | 3300035120 | Bacteria | 615 |
| 498 | Ga0373943_0011889 | 3300035170 | Bacteria | 3918 |
| 499 | Ga0373943_0114082 | 3300035170 | Bacteria | 1429 |
| 500 | Ga0373943_0557411 | 3300035170 | Bacteria | 673 |
| 501 | Ga0373946_0048934 | 3300035171 | Bacteria | 1761 |
| 502 | Ga0373955_0000832 | 3300035172 | Bacteria | 13226 |
| 503 | Ga0373955_0004930 | 3300035172 | Bacteria | 5956 |
| 504 | Ga0373955_0106746 | 3300035172 | Bacteria | 1614 |
| 505 | Ga0373955_0208411 | 3300035172 | Bacteria | 1165 |
| 506 | Ga0316574_0425879 | 3300035398 | Bacteria | 834 |
| 507 | Ga0373924_0013131 | 3300035410 | Bacteria | 3108 |
| 508 | Ga0373935_0021078 | 3300035692 | Bacteria | 3988 |
| 509 | Ga0373935_0147869 | 3300035692 | Bacteria | 1592 |
| 510 | Ga0373927_0003926 | 3300035695 | Bacteria | 10542 |
| 511 | Ga0373927_0016694 | 3300035695 | Bacteria | 4843 |
| 512 | Ga0373927_0034763 | 3300035695 | Bacteria | 3278 |
| 513 | Ga0373927_0307434 | 3300035695 | Bacteria | 1044 |
| 514 | Ga0373933_0010086 | 3300035724 | Bacteria | 5170 |
| 515 | Ga0373933_0105608 | 3300035724 | Bacteria | 1752 |
| 516 | Ga0373933_0150299 | 3300035724 | Bacteria | 1474 |
| 517 | Ga0373933_0169990 | 3300035724 | Bacteria | 1387 |
| 518 | Ga0373947_0037519 | 3300035725 | Bacteria | 2876 |
| 519 | Ga0373947_0176306 | 3300035725 | Bacteria | 1389 |
| 520 | Ga0373947_0380379 | 3300035725 | Bacteria | 950 |
| 521 | Ga0373937_0018236 | 3300036401 | Bacteria | 6263 |
| 522 | Ga0373937_0050091 | 3300036401 | Bacteria | 3824 |
| 523 | Ga0373937_0063209 | 3300036401 | Bacteria | 3404 |
| 524 | Ga0373937_0243475 | 3300036401 | Bacteria | 1694 |
| 525 | Ga0373925_0016994 | 3300037068 | Bacteria | 5266 |
| 526 | Ga0373925_0266880 | 3300037068 | Bacteria | 1376 |
| 527 | Ga0373925_1348682 | 3300037068 | Bacteria | 585 |
| 528 | Ga0395905_0392844 | 3300037471 | Bacteria | 1282 |
| 529 | Ga0436363_0272408 | 3300039450 | Bacteria | 889 |
| 530 | Ga0439465_0143183 | 3300041413 | Bacteria | 850 |
| 531 | Ga0439465_0297463 | 3300041413 | Bacteria | 604 |
| 532 | Ga0451807_1470248 | 3300041486 | Bacteria | 606 |
| 533 | Ga0451849_0602933 | 3300041505 | Bacteria | 773 |
| 534 | Ga0439458_0041325 | 3300042157 | Bacteria | 1120 |
| 535 | Ga0466969_0208002 | 3300044656 | Bacteria | 892 |
| 536 | Ga0466966_0613919 | 3300044684 | Bacteria | 655 |
| 537 | Ga0495617_272558 | 3300046452 | Bacteria | 519 |
| 538 | Ga0495592_0035763 | 3300046454 | Bacteria | 3742 |
| 539 | Ga0495592_0040324 | 3300046454 | Bacteria | 3504 |
| 540 | Ga0495592_0094913 | 3300046454 | Bacteria | 2134 |
| 541 | Ga0495592_0216970 | 3300046454 | Bacteria | 1281 |
| 542 | Ga0495603_0000268 | 3300046455 | Bacteria | 27511 |
| 543 | Ga0495603_0180142 | 3300046455 | Bacteria | 1223 |
| 544 | Ga0495603_0277437 | 3300046455 | Bacteria | 963 |
| 545 | Ga0495590_0059740 | 3300046457 | Bacteria | 1334 |
| 546 | Ga0495629_0007385 | 3300046459 | Bacteria | 8103 |
| 547 | Ga0495629_0028347 | 3300046459 | Bacteria | 3976 |
| 548 | Ga0495629_0070005 | 3300046459 | Bacteria | 2448 |
| 549 | Ga0495638_0066555 | 3300046460 | Bacteria | 2214 |
| 550 | Ga0495638_0145621 | 3300046460 | Bacteria | 1378 |
| 551 | Ga0495638_0575385 | 3300046460 | Bacteria | 556 |
| 552 | Ga0495641_0009139 | 3300046461 | Bacteria | 5932 |
| 553 | Ga0495651_0003335 | 3300046462 | Bacteria | 12336 |
| 554 | Ga0495651_0102482 | 3300046462 | Bacteria | 2128 |
| 555 | Ga0495653_0027255 | 3300046463 | Bacteria | 4574 |
| 556 | Ga0495653_0091279 | 3300046463 | Bacteria | 2227 |
| 557 | Ga0495653_0097006 | 3300046463 | Bacteria | 2142 |
| 558 | Ga0495653_0136900 | 3300046463 | Bacteria | 1726 |
| 559 | Ga0495580_0005773 | 3300046472 | Bacteria | 10159 |
| 560 | Ga0495580_0082544 | 3300046472 | Bacteria | 2240 |
| 561 | Ga0495582_0000859 | 3300046473 | Bacteria | 16886 |
| 562 | Ga0495605_0036223 | 3300046474 | Bacteria | 2489 |
| 563 | Ga0495605_0224290 | 3300046474 | Bacteria | 811 |
| 564 | Ga0495605_0259888 | 3300046474 | Bacteria | 741 |
| 565 | Ga0495605_0405758 | 3300046474 | Bacteria | 566 |
| 566 | Ga0495639_0003304 | 3300046475 | Bacteria | 6996 |
| 567 | Ga0495639_0051940 | 3300046475 | Bacteria | 1865 |
| 568 | Ga0495662_0000532 | 3300046476 | Bacteria | 17442 |
| 569 | Ga0495664_0094081 | 3300046477 | Bacteria | 1803 |
| 570 | Ga0495664_0288813 | 3300046477 | Bacteria | 991 |
| 571 | Ga0495584_0082493 | 3300046491 | Bacteria | 1618 |
| 572 | Ga0495584_0214199 | 3300046491 | Bacteria | 979 |
| 573 | Ga0495584_0492730 | 3300046491 | Bacteria | 624 |
| 574 | Ga0495584_0552713 | 3300046491 | Bacteria | 587 |
| 575 | Ga0495585_0064209 | 3300046492 | Bacteria | 2013 |
| 576 | Ga0495585_0098221 | 3300046492 | Bacteria | 1569 |
| 577 | Ga0495585_0130179 | 3300046492 | Bacteria | 1325 |
| 578 | Ga0495585_0329469 | 3300046492 | Bacteria | 745 |
| 579 | Ga0495594_0005520 | 3300046499 | Bacteria | 6494 |
| 580 | Ga0495594_0024294 | 3300046499 | Bacteria | 3254 |
| 581 | Ga0495583_0419130 | 3300046506 | Bacteria | 525 |
| 582 | Ga0495606_0222278 | 3300046507 | Bacteria | 1063 |
| 583 | Ga0495608_0003075 | 3300046511 | Bacteria | 11924 |
| 584 | Ga0495608_0026213 | 3300046511 | Bacteria | 3975 |
| 585 | Ga0495608_0182392 | 3300046511 | Bacteria | 1327 |
| 586 | Ga0495608_0682077 | 3300046511 | Bacteria | 612 |
| 587 | Ga0495610_0055856 | 3300046512 | Bacteria | 1901 |
| 588 | Ga0495610_0097071 | 3300046512 | Bacteria | 1326 |
| 589 | Ga0495616_0047702 | 3300046513 | Bacteria | 2156 |
| 590 | Ga0495616_0283387 | 3300046513 | Bacteria | 704 |
| 591 | Ga0495618_0123442 | 3300046514 | Bacteria | 1658 |
| 592 | Ga0495618_0358892 | 3300046514 | Bacteria | 897 |
| 593 | Ga0495620_0164270 | 3300046515 | Bacteria | 862 |
| 594 | Ga0495620_0404592 | 3300046515 | Bacteria | 517 |
| 595 | Ga0495628_0010946 | 3300046516 | Bacteria | 7681 |
| 596 | Ga0495628_0024219 | 3300046516 | Bacteria | 4970 |
| 597 | Ga0495628_0094075 | 3300046516 | Bacteria | 2317 |
| 598 | Ga0495628_0146896 | 3300046516 | Bacteria | 1797 |
| 599 | Ga0495630_0074406 | 3300046517 | Bacteria | 2558 |
| 600 | Ga0495630_0078147 | 3300046517 | Bacteria | 2495 |
| 601 | Ga0495631_0133650 | 3300046518 | Bacteria | 1066 |
| 602 | Ga0495632_0002414 | 3300046519 | Bacteria | 14236 |
| 603 | Ga0495632_0019960 | 3300046519 | Bacteria | 3640 |
| 604 | Ga0495632_0097927 | 3300046519 | Bacteria | 1384 |
| 605 | Ga0495632_0197435 | 3300046519 | Bacteria | 917 |
| 606 | Ga0495643_0307842 | 3300046522 | Bacteria | 720 |
| 607 | Ga0495648_0364864 | 3300046524 | Bacteria | 655 |
| 608 | Ga0495663_0204514 | 3300046525 | Bacteria | 690 |
| 609 | Ga0495666_0020759 | 3300046526 | Bacteria | 3252 |
| 610 | Ga0495666_0114864 | 3300046526 | Bacteria | 1263 |
| 611 | Ga0495642_0259619 | 3300046528 | Bacteria | 760 |
| 612 | Ga0495652_0018734 | 3300046529 | Bacteria | 6169 |
| 613 | Ga0495652_0037745 | 3300046529 | Bacteria | 4188 |
| 614 | Ga0495652_0132317 | 3300046529 | Bacteria | 1973 |
| 615 | Ga0495665_0000767 | 3300046531 | Bacteria | 16713 |
| 616 | Ga0495640_0031306 | 3300046533 | Bacteria | 3798 |
| 617 | Ga0495640_0032585 | 3300046533 | Bacteria | 3711 |
| 618 | Ga0495640_0133148 | 3300046533 | Bacteria | 1607 |
| 619 | Ga0495587_0006327 | 3300046536 | Bacteria | 7723 |
| 620 | Ga0495587_0012511 | 3300046536 | Bacteria | 5336 |
| 621 | Ga0495598_0016628 | 3300046537 | Bacteria | 1881 |
| 622 | Ga0495598_0123010 | 3300046537 | Bacteria | 882 |
| 623 | Ga0495609_0206935 | 3300046538 | Bacteria | 818 |
| 624 | Ga0495621_0083181 | 3300046539 | Bacteria | 1196 |
| 625 | Ga0495621_0380724 | 3300046539 | Bacteria | 596 |
| 626 | Ga0495597_0249008 | 3300046542 | Bacteria | 699 |
| 627 | Ga0495645_0107473 | 3300046543 | Bacteria | 1977 |
| 628 | Ga0495622_0022695 | 3300046557 | Bacteria | 2924 |
| 629 | Ga0495622_0067684 | 3300046557 | Bacteria | 1650 |
| 630 | Ga0495633_0056720 | 3300046558 | Bacteria | 1840 |
| 631 | Ga0495667_0007813 | 3300046559 | Bacteria | 7245 |
| 632 | Ga0495667_0024399 | 3300046559 | Bacteria | 4072 |
| 633 | Ga0495667_0047636 | 3300046559 | Bacteria | 2831 |
| 634 | Ga0495667_0049238 | 3300046559 | Bacteria | 2781 |
| 635 | Ga0495656_0027781 | 3300046615 | Bacteria | 2263 |
| 636 | Ga0495656_0057578 | 3300046615 | Bacteria | 1683 |
| 637 | Ga0495668_0100762 | 3300046616 | Bacteria | 1580 |
| 638 | Ga0495668_0115598 | 3300046616 | Bacteria | 1467 |
| 639 | Ga0495668_0297796 | 3300046616 | Bacteria | 884 |
| 640 | Ga0495668_0551605 | 3300046616 | Bacteria | 636 |
| 641 | Ga0495634_0002413 | 3300046642 | Bacteria | 15555 |
| 642 | Ga0495634_0221303 | 3300046642 | Bacteria | 1168 |
| 643 | Ga0495611_0094648 | 3300046648 | Bacteria | 1382 |
| 644 | Ga0495625_0120457 | 3300046660 | Bacteria | 1786 |
| 645 | Ga0495625_0217238 | 3300046660 | Bacteria | 1254 |
| 646 | Ga0495625_0529063 | 3300046660 | Bacteria | 717 |
| 647 | Ga0495625_0698981 | 3300046660 | Bacteria | 599 |
| 648 | Ga0495625_0865922 | 3300046660 | Bacteria | 520 |
| 649 | Ga0495635_0004552 | 3300046663 | Bacteria | 9613 |
| 650 | Ga0495635_0006411 | 3300046663 | Bacteria | 8203 |
| 651 | Ga0495635_0193994 | 3300046663 | Bacteria | 1378 |
| 652 | Ga0495635_0616865 | 3300046663 | Bacteria | 707 |
| 653 | Ga0495659_0048856 | 3300046664 | Bacteria | 1534 |
| 654 | Ga0495657_0016091 | 3300046675 | Bacteria | 5456 |
| 655 | Ga0495657_0056812 | 3300046675 | Bacteria | 2604 |
| 656 | Ga0495657_0097906 | 3300046675 | Bacteria | 1873 |
| 657 | Ga0495657_0132611 | 3300046675 | Bacteria | 1559 |
| 658 | Ga0495599_0003165 | 3300046678 | Bacteria | 9586 |
| 659 | Ga0495599_0043317 | 3300046678 | Bacteria | 2824 |
| 660 | Ga0495599_0121300 | 3300046678 | Bacteria | 1625 |
| 661 | Ga0495623_0004325 | 3300046679 | Bacteria | 9344 |
| 662 | Ga0495623_0068738 | 3300046679 | Bacteria | 2208 |
| 663 | Ga0495623_0101208 | 3300046679 | Bacteria | 1755 |
| 664 | Ga0495646_0046766 | 3300046680 | Bacteria | 2636 |
| 665 | Ga0495646_0050281 | 3300046680 | Bacteria | 2527 |
| 666 | Ga0495646_0052340 | 3300046680 | Bacteria | 2467 |
| 667 | Ga0495647_0013145 | 3300046681 | Bacteria | 2863 |
| 668 | Ga0495658_0000767 | 3300046683 | Bacteria | 17344 |
| 669 | Ga0495669_0045236 | 3300046684 | Bacteria | 1962 |
| 670 | Ga0495669_0117430 | 3300046684 | Bacteria | 1245 |
| 671 | Ga0495613_0010961 | 3300046689 | Bacteria | 6729 |
| 672 | Ga0495624_0001338 | 3300046690 | Bacteria | 19256 |
| 673 | Ga0495624_0144662 | 3300046690 | Bacteria | 1455 |
| 674 | Ga0495670_0018097 | 3300046691 | Bacteria | 3470 |
| 675 | Ga0495671_0380404 | 3300046692 | Bacteria | 676 |
| 676 | Ga0495649_0001498 | 3300046694 | Bacteria | 17517 |
| 677 | Ga0495649_0275004 | 3300046694 | Bacteria | 861 |
| 678 | Ga0495649_0337183 | 3300046694 | Bacteria | 763 |
| 679 | Ga0495589_0218019 | 3300046794 | Bacteria | 897 |
| 680 | Ga0495600_0012913 | 3300046809 | Bacteria | 5234 |
| 681 | Ga0495600_0108236 | 3300046809 | Bacteria | 1810 |
| 682 | Ga0495660_0414413 | 3300046810 | Bacteria | 588 |
| 683 | Ga0495581_0003234 | 3300047315 | Bacteria | 9339 |
| 684 | Ga0495604_0007942 | 3300047317 | Bacteria | 8404 |
| 685 | Ga0495604_0019868 | 3300047317 | Bacteria | 5374 |
| 686 | Ga0495604_0025065 | 3300047317 | Bacteria | 4754 |
| 687 | Ga0495604_0233069 | 3300047317 | Bacteria | 1262 |
| 688 | Ga0495674_0012712 | 3300047319 | Bacteria | 7932 |
| 689 | Ga0495674_0032060 | 3300047319 | Bacteria | 4770 |
| 690 | Ga0495674_0399883 | 3300047319 | Bacteria | 1109 |
| 691 | Ga0495672_0024775 | 3300047320 | Bacteria | 3859 |
| 692 | Ga0495676_0014180 | 3300047321 | Bacteria | 7135 |
| 693 | Ga0495676_0040532 | 3300047321 | Bacteria | 3842 |
| 694 | Ga0495676_0419906 | 3300047321 | Bacteria | 885 |
| 695 | Ga0495680_0003133 | 3300047322 | Bacteria | 16485 |
| 696 | Ga0495680_0013071 | 3300047322 | Bacteria | 7260 |
| 697 | Ga0495680_0128980 | 3300047322 | Bacteria | 1860 |
| 698 | Ga0495680_0437219 | 3300047322 | Bacteria | 897 |
| 699 | Ga0495683_0145403 | 3300047323 | Bacteria | 1108 |
| 700 | Ga0495683_0182629 | 3300047323 | Bacteria | 957 |
| 701 | Ga0495675_0001752 | 3300047444 | Bacteria | 12990 |
| 702 | Ga0495675_0235905 | 3300047444 | Bacteria | 1102 |
| 703 | Ga0495677_0159219 | 3300047445 | Bacteria | 871 |
| 704 | Ga0495685_289365 | 3300047447 | Bacteria | 516 |
| 705 | Ga0495673_0041572 | 3300047469 | Bacteria | 2069 |
| 706 | Ga0495681_0122820 | 3300047470 | Bacteria | 1113 |
| 707 | Ga0495684_0016251 | 3300047471 | Bacteria | 5730 |
| 708 | Ga0495684_0097622 | 3300047471 | Bacteria | 2222 |
| 709 | Ga0495686_0305714 | 3300047472 | Bacteria | 876 |
| 710 | Ga0495686_0308391 | 3300047472 | Bacteria | 871 |
| 711 | Ga0495686_0538970 | 3300047472 | Bacteria | 610 |
| 712 | Ga0495593_0000895 | 3300047673 | Bacteria | 17309 |
| 713 | Ga0495593_0024499 | 3300047673 | Bacteria | 3344 |
| 714 | Ga0495602_0028085 | 3300048088 | Bacteria | 5392 |
| 715 | Ga0495602_0044259 | 3300048088 | Bacteria | 4040 |
| 716 | Ga0495602_0201565 | 3300048088 | Bacteria | 1518 |
| 717 | Ga0495602_0211698 | 3300048088 | Bacteria | 1470 |
| 718 | Ga0495615_0100106 | 3300048090 | Bacteria | 818 |
| 719 | Ga0495626_0037084 | 3300048091 | Bacteria | 2319 |
| 720 | Ga0496100_0327158 | 3300048903 | Bacteria | 1153 |
| 721 | Ga0496101_0116047 | 3300048904 | Bacteria | 2020 |
| 722 | Ga0496101_0201888 | 3300048904 | Bacteria | 1537 |
| 723 | Ga0496101_0919581 | 3300048904 | Bacteria | 689 |
| 724 | Ga0496102_0117237 | 3300048905 | Bacteria | 2485 |
| 725 | Ga0496102_0141606 | 3300048905 | Bacteria | 2255 |
| 726 | Ga0496102_0159894 | 3300048905 | Bacteria | 2119 |
| 727 | Ga0496102_0584356 | 3300048905 | Bacteria | 1040 |
| 728 | Ga0496102_1224779 | 3300048905 | Bacteria | 670 |
| 729 | Ga0496103_0340209 | 3300048906 | Bacteria | 965 |
| 730 | Ga0496103_0606787 | 3300048906 | Bacteria | 697 |
| 731 | Ga0496104_0309352 | 3300048907 | Bacteria | 1493 |
| 732 | Ga0496104_0549781 | 3300048907 | Bacteria | 1065 |
| 733 | Ga0496106_0031798 | 3300048909 | Bacteria | 3933 |
| 734 | Ga0496106_0128742 | 3300048909 | Bacteria | 1984 |
| 735 | Ga0496106_0302429 | 3300048909 | Bacteria | 1283 |
| 736 | Ga0496107_0118103 | 3300048910 | Bacteria | 1953 |
| 737 | Ga0496107_0189234 | 3300048910 | Bacteria | 1529 |
| 738 | Ga0496107_0697923 | 3300048910 | Bacteria | 746 |
| 739 | Ga0496107_0736496 | 3300048910 | Bacteria | 724 |
| 740 | Ga0496108_0012011 | 3300048911 | Bacteria | 7045 |
| 741 | Ga0496108_1170925 | 3300048911 | Bacteria | 651 |
| 742 | Ga0496109_0130718 | 3300048912 | Bacteria | 2343 |
| 743 | Ga0496109_0623238 | 3300048912 | Bacteria | 1015 |
| 744 | Ga0496110_0302033 | 3300048913 | Bacteria | 1458 |
| 745 | Ga0496111_0239967 | 3300048914 | Bacteria | 1346 |
| 746 | Ga0496112_0381580 | 3300048915 | Bacteria | 1350 |
| 747 | Ga0496114_0057676 | 3300048917 | Bacteria | 3242 |
| 748 | Ga0496114_0511281 | 3300048917 | Bacteria | 1062 |
| 749 | Ga0496114_0795974 | 3300048917 | Bacteria | 824 |
| 750 | Ga0496114_1311492 | 3300048917 | Bacteria | 611 |
| 751 | Ga0496115_0114630 | 3300048918 | Bacteria | 2215 |
| 752 | Ga0496115_0324781 | 3300048918 | Bacteria | 1258 |
| 753 | Ga0496116_0507073 | 3300048919 | Bacteria | 500 |
| 754 | Ga0496118_0113989 | 3300048921 | Bacteria | 1784 |
| 755 | Ga0496119_0216375 | 3300048922 | Bacteria | 983 |
| 756 | Ga0496119_0342549 | 3300048922 | Bacteria | 726 |
| 757 | Ga0496120_0526299 | 3300048923 | Bacteria | 505 |
| 758 | Ga0496121_0053802 | 3300048924 | Bacteria | 3369 |
| 759 | Ga0496121_0092789 | 3300048924 | Bacteria | 2353 |
| 760 | Ga0496121_0114308 | 3300048924 | Bacteria | 2052 |
| 761 | Ga0496121_0244925 | 3300048924 | Bacteria | 1247 |
| 762 | Ga0496121_0299343 | 3300048924 | Bacteria | 1092 |
| 763 | Ga0496121_0594884 | 3300048924 | Bacteria | 684 |
| 764 | Ga0496121_0835977 | 3300048924 | Bacteria | 537 |
| 765 | Ga0496124_0066593 | 3300048927 | Bacteria | 2999 |
| 766 | Ga0496124_0196854 | 3300048927 | Bacteria | 1536 |
| 767 | Ga0496124_0248340 | 3300048927 | Bacteria | 1318 |
| 768 | Ga0496124_0269971 | 3300048927 | Bacteria | 1246 |
| 769 | Ga0496125_0075993 | 3300048928 | Bacteria | 2596 |
| 770 | Ga0496125_0346126 | 3300048928 | Bacteria | 890 |
| 771 | Ga0496126_0004492 | 3300048929 | Bacteria | 16641 |
| 772 | Ga0496126_0168207 | 3300048929 | Bacteria | 1869 |
| 773 | Ga0496126_1170224 | 3300048929 | Bacteria | 567 |
| 774 | Ga0495682_0167319 | 3300049460 | Bacteria | 783 |
| 775 | Ga0501034_0000008 | 3300049571 | Bacteria | 354712 |
| 776 | Ga0501036_0085643 | 3300049572 | Bacteria | 2664 |
| 777 | Ga0501037_0116845 | 3300049573 | Bacteria | 1919 |
| 778 | Ga0501040_0909939 | 3300049576 | Bacteria | 637 |
| 779 | Ga0501043_0204329 | 3300049579 | Bacteria | 1532 |
| 780 | Ga0501046_0690777 | 3300049580 | Bacteria | 719 |
| 781 | Ga0501047_0022031 | 3300049581 | Bacteria | 6120 |
| 782 | Ga0501048_0000873 | 3300049582 | Bacteria | 22261 |
| 783 | Ga0501067_0058463 | 3300049583 | Bacteria | 2135 |
| 784 | Ga0501067_0069336 | 3300049583 | Bacteria | 1952 |
| 785 | Ga0501067_0751787 | 3300049583 | Bacteria | 549 |
| 786 | Ga0501069_0201618 | 3300049585 | Bacteria | 1153 |
| 787 | Ga0501073_0255321 | 3300049589 | Bacteria | 1210 |
| 788 | Ga0501076_0672184 | 3300049592 | Bacteria | 855 |
| 789 | Ga0501080_0957542 | 3300049742 | Bacteria | 744 |
| 790 | Ga0501035_0023233 | 3300049822 | Bacteria | 5687 |
| 791 | Ga0501044_0000004 | 3300049823 | Bacteria | 327475 |
| 792 | Ga0501044_0043557 | 3300049823 | Bacteria | 4662 |
| 793 | nmdc:mga03683_11827_c1 | 3300050489 | Bacteria | 3172 |
| 794 | nmdc:mga03683_9498_c1 | 3300050489 | Bacteria | 3462 |
| 795 | nmdc:mga03n38_5472_c1 | 3300050490 | Bacteria | 4328 |
| 796 | nmdc:mga00v17_128557_c1 | 3300050491 | Bacteria | 1618 |
| 797 | nmdc:mga00v17_354330_c1 | 3300050491 | Bacteria | 954 |
| 798 | nmdc:mga0yw44_277686_c1 | 3300050492 | Bacteria | 1119 |
| 799 | nmdc:mga0yw44_313242_c1 | 3300050492 | Bacteria | 1053 |
| 800 | nmdc:mga0yw44_388730_c1 | 3300050492 | Bacteria | 942 |
| 801 | nmdc:mga0yw44_43537_c1 | 3300050492 | Bacteria | 2328 |
| 802 | nmdc:mga0yw44_522883_c1 | 3300050492 | Bacteria | 805 |
| 803 | nmdc:mga0yw44_90618_c1 | 3300050492 | Bacteria | 1932 |
| 804 | nmdc:mga0yw44_92292_c1 | 3300050492 | Bacteria | 1916 |
| 805 | nmdc:mga0k408_466705_c1 | 3300050493 | Bacteria | 749 |
| 806 | nmdc:mga0k408_90781_c2 | 3300050493 | Bacteria | 752 |
| 807 | nmdc:mga06z11_155256_c1 | 3300050494 | Bacteria | 1304 |
| 808 | nmdc:mga06z11_162328_c1 | 3300050494 | Bacteria | 1278 |
| 809 | nmdc:mga06z11_246974_c1 | 3300050494 | Bacteria | 1050 |
| 810 | nmdc:mga06z11_516882_c1 | 3300050494 | Bacteria | 724 |
| 811 | nmdc:mga06z11_945793_c1 | 3300050494 | Bacteria | 525 |
| 812 | nmdc:mga04h51_37804_c1 | 3300050495 | Bacteria | 1560 |
| 813 | nmdc:mga04h51_506498_c1 | 3300050495 | Bacteria | 516 |
| 814 | nmdc:mga07m45_16924_c1 | 3300050496 | Bacteria | 3908 |
| 815 | nmdc:mga07m45_388601_c1 | 3300050496 | Bacteria | 810 |
| 816 | nmdc:mga07m45_400531_c1 | 3300050496 | Bacteria | 797 |
| 817 | nmdc:mga07m45_47787_c1 | 3300050496 | Bacteria | 2406 |
| 818 | nmdc:mga07m45_53539_c1 | 3300050496 | Bacteria | 2280 |
| 819 | nmdc:mga07m45_693764_c1 | 3300050496 | Bacteria | 586 |
| 820 | nmdc:mga07m45_743336_c1 | 3300050496 | Bacteria | 563 |
| 821 | nmdc:mga05p37_367396_c1 | 3300050507 | Bacteria | 1689 |
| 822 | nmdc:mga05p37_703574_c1 | 3300050507 | Bacteria | 1122 |
| 823 | nmdc:mga05p37_99136_c1 | 3300050507 | Bacteria | 3589 |
| 824 | nmdc:mga09592_1065497_c1 | 3300050508 | Bacteria | 673 |
| 825 | nmdc:mga09592_178764_c1 | 3300050508 | Bacteria | 1835 |
| 826 | nmdc:mga06r32_318358_c1 | 3300050510 | Bacteria | 1541 |
| 827 | nmdc:mga08y16_274932_c1 | 3300050511 | Bacteria | 1738 |
| 828 | nmdc:mga0sz30_269877_c1 | 3300050516 | Bacteria | 758 |
| 829 | nmdc:mga0sz30_505717_c1 | 3300050516 | Bacteria | 544 |
| 830 | nmdc:mga0sz30_8886_c1 | 3300050516 | Bacteria | 3490 |
| 831 | Ga0495601_0018737 | 3300053077 | Bacteria | 4213 |
| 832 | Ga0495601_0225651 | 3300053077 | Bacteria | 1224 |
| 833 | Ga0495612_0024685 | 3300053078 | Bacteria | 2413 |
| 834 | Ga0495612_0355342 | 3300053078 | Bacteria | 662 |
| 835 | Ga0500635_0015025 | 3300053080 | Bacteria | 2279 |
| 836 | Ga0500635_0085202 | 3300053080 | Bacteria | 1141 |
| 837 | Ga0495595_0002948 | 3300053084 | Bacteria | 6717 |
| 838 | Ga0495595_0002987 | 3300053084 | Bacteria | 6681 |
| 839 | Ga0495595_0337851 | 3300053084 | Bacteria | 759 |
| 840 | Ga0495595_0455923 | 3300053084 | Bacteria | 650 |
| 841 | Ga0495619_0002940 | 3300053085 | Bacteria | 11071 |
| 842 | Ga0495619_0031393 | 3300053085 | Bacteria | 3443 |
| 843 | Ga0495619_0066330 | 3300053085 | Bacteria | 2408 |
| 844 | Ga0500643_031303 | 3300053087 | Bacteria | 1624 |
| 845 | Ga0500646_0132656 | 3300053090 | Bacteria | 811 |
| 846 | Ga0500583_0537438 | 3300053092 | Bacteria | 545 |
| 847 | Ga0500651_0177192 | 3300053093 | Bacteria | 1268 |
| 848 | Ga0500651_0261944 | 3300053093 | Bacteria | 1002 |
| 849 | Ga0500566_0013769 | 3300053094 | Bacteria | 4758 |
| 850 | Ga0500566_0311371 | 3300053094 | Bacteria | 737 |
| 851 | Ga0500641_0018278 | 3300053096 | Bacteria | 2635 |
| 852 | Ga0500554_049285 | 3300053102 | Bacteria | 1320 |
| 853 | Ga0500555_055218 | 3300053103 | Bacteria | 1079 |
| 854 | Ga0500593_286131 | 3300053117 | Bacteria | 536 |
| 855 | Ga0500594_0134765 | 3300053118 | Bacteria | 785 |
| 856 | Ga0500595_001972 | 3300053119 | Bacteria | 10531 |
| 857 | Ga0500595_012703 | 3300053119 | Bacteria | 3247 |
| 858 | Ga0500608_020498 | 3300053122 | Bacteria | 3041 |
| 859 | Ga0500621_232020 | 3300053126 | Bacteria | 632 |
| 860 | Ga0500642_0056899 | 3300053130 | Bacteria | 1744 |
| 861 | Ga0500655_018441 | 3300053133 | Bacteria | 1296 |
| 862 | Ga0500655_122012 | 3300053133 | Bacteria | 553 |
| 863 | Ga0500658_0242962 | 3300053134 | Bacteria | 827 |
| 864 | Ga0500568_0008843 | 3300053139 | Bacteria | 4824 |
| 865 | Ga0500568_0177363 | 3300053139 | Bacteria | 784 |
| 866 | Ga0500577_0543442 | 3300053142 | Bacteria | 507 |
| 867 | Ga0500588_0077131 | 3300053146 | Bacteria | 1107 |
| 868 | Ga0500589_108820 | 3300053147 | Bacteria | 1192 |
| 869 | Ga0500589_141912 | 3300053147 | Bacteria | 989 |
| 870 | Ga0500603_000823 | 3300053150 | Bacteria | 7417 |
| 871 | Ga0500604_0018278 | 3300053151 | Bacteria | 1952 |
| 872 | Ga0500622_0197267 | 3300053156 | Bacteria | 918 |
| 873 | Ga0500638_000097 | 3300053162 | Bacteria | 16132 |
| 874 | Ga0500636_0035467 | 3300053177 | Bacteria | 2952 |
| 875 | Ga0500636_0137106 | 3300053177 | Bacteria | 1358 |
| 876 | Ga0500636_0547882 | 3300053177 | Bacteria | 501 |
| 877 | Ga0500637_0001475 | 3300053178 | Bacteria | 10029 |
| 878 | Ga0500611_178227 | 3300053727 | Bacteria | 595 |
| 879 | Ga0500645_115051 | 3300053730 | Bacteria | 753 |
| 880 | Ga0500609_012998 | 3300053731 | Bacteria | 1127 |
| 881 | Ga0501084_0099316 | 3300054114 | Bacteria | 2444 |
| 882 | Ga0500661_000409 | 3300055283 | Bacteria | 7932 |
| 883 | Ga0501082_0001489 | 3300060353 | Bacteria | 20609 |
| 884 | Ga0501082_0074783 | 3300060353 | Bacteria | 2918 |
| 885 | Ga0501082_1633533 | 3300060353 | Bacteria | 563 |
| 886 | 2509368212 | 2509276018 | Bacteria | 6910194 |
| 887 | 2513659655 | 2513237096 | Bacteria | 8722461 |
| 888 | 2513691721 | 2513237101 | Bacteria | 7952346 |
| 889 | 2513862682 | 2513237137 | Bacteria | 9558895 |
| 890 | 2513921625 | 2513237145 | Bacteria | 8979722 |
| 891 | 2644004643 | 2643221599 | Bacteria | 6292121 |
| 892 | 2644196846 | 2643221634 | Bacteria | 6705461 |
| 893 | 2644237448 | 2643221643 | Bacteria | 5749658 |
| 894 | 2644305073 | 2643221654 | Bacteria | 5273570 |
| 895 | 2688598064 | 2687453392 | Bacteria | 6880454 |
| 896 | 2723845867 | 2721755755 | Bacteria | 8322773 |
| 897 | 2793073765 | 2791355197 | Bacteria | 8420563 |
| 898 | 2793081829 | |||
| 899 | 2856333776 | 2856328259 | Bacteria | 6528202 |
| 900 | 2856338166 | 2856334872 | Bacteria | 7037011 |
| 901 | 2857369642 | 2857367948 | Bacteria | 6965560 |
| 902 | 2869169473 | 2869169390 | Bacteria | 6659796 |
| 903 | 2869237095 | 2869234852 | Bacteria | 6654993 |
| 904 | 2869246261 | 2869242130 | Bacteria | 6609239 |
| 905 | 2869250392 | 2869249662 | Bacteria | 6868783 |
| 906 | 2869268771 | 2869264136 | Bacteria | 6880765 |
| 907 | 2869272273 | 2869271264 | Bacteria | 6908218 |
| 908 | 2871465113 | 2871459585 | Bacteria | 6866887 |
| 909 | 2871486251 | 2871481445 | Bacteria | 6700002 |
| 910 | 2874114071 | 2874109183 | Bacteria | 6517025 |
| 911 | 2874117421 | 2874116593 | Bacteria | 6674494 |
| 912 | 2874132583 | 2874131515 | Bacteria | 6820270 |
| 913 | 2874165158 | 2874162495 | Bacteria | 6174670 |
| 914 | 2874609488 | 2874604998 | Bacteria | 7834745 |
| 915 | 2876390562 | 2876386047 | Bacteria | 6698674 |
| 916 | 2876404901 | 2876399893 | Bacteria | 6927900 |
| 917 | 2876411577 | 2876406927 | Bacteria | 6191900 |
| 918 | 2876421353 | 2876420981 | Bacteria | 6687741 |
| 919 | 2876808934 | 2876808645 | Bacteria | 8824342 |
| 920 | 2878737416 | 2878730984 | Bacteria | 6380721 |
| 921 | 2878779448 | 2878774303 | Bacteria | 6108671 |
| 922 | 2878782899 | 2878781027 | Bacteria | 6834456 |
| 923 | 2879110276 | 2879110137 | Bacteria | 8907982 |
| 924 | 2889040711 | 2889033259 | Bacteria | 9099371 |
| 925 | 2894818196 | 2894817345 | Bacteria | 4892941 |
| 926 | 2894820040 | 2894817345 | Bacteria | 4892941 |
| 927 | 2903515211 | 2903513507 | Bacteria | 6344008 |
| 928 | 2903754837 | 2903748898 | Bacteria | 9972761 |
| 929 | 2906367609 | 2906363423 | Bacteria | 6856682 |
| 930 | 2906370930 | 2906370794 | Bacteria | 6881062 |
| 931 | 2906391357 | 2906386501 | Bacteria | 5977019 |
| 932 | 2906398592 | 2906393657 | Bacteria | 6790866 |
| 933 | 2906407181 | 2906401398 | Bacteria | 6693206 |
| 934 | 2906413577 | 2906408224 | Bacteria | 6162342 |
| 935 | 2906429025 | 2906427513 | Bacteria | 6375796 |
| 936 | 2906636084 | 2906635258 | Bacteria | 8601019 |
| 937 | 2906665781 | 2906660503 | Bacteria | 8595048 |
| 938 | 2908743742 | 2908739725 | Bacteria | 8628932 |
| 939 | 2922157829 | 2922151315 | Bacteria | 6902399 |
| 940 | 2922176726 | 2922172374 | Bacteria | 6167644 |
| 941 | 2922179133 | 2922178524 | Bacteria | 6025201 |
| 942 | 2922367810 | 2922361189 | Bacteria | 7436256 |
| 943 | 2922392288 | 2922386360 | Bacteria | 7017218 |
| 944 | 2922429128 | |||
| 945 | 2924717825 | 2924710171 | Bacteria | 6752351 |
| 946 | 2924747335 | 2924741084 | Bacteria | 6661321 |
| 947 | 2924752276 | 2924748358 | Bacteria | 6154725 |
| 948 | 2935634280 | 2935630451 | Bacteria | 8169952 |
| 949 | 2937862409 | 2937861824 | Bacteria | 6660327 |
| 950 | 2937876008 | 2937868953 | Bacteria | 6639878 |
| 951 | 2941511170 | 2941507105 | Bacteria | 8166816 |
| 952 | 2941518554 | 2941515067 | Bacteria | 8166720 |
| 953 | 2941527183 | 2941523033 | Bacteria | 8169134 |
| 954 | 2941531065 | 2941531003 | Bacteria | 7653939 |
| 955 | 2958127488 | 2958122699 | Bacteria | 7280457 |
| 956 | 2958138767 | 2958137437 | Bacteria | 6050276 |
| 957 | 2958162232 | 2958158011 | Bacteria | 6058449 |
| 958 | 2961141978 | 2961136820 | Bacteria | 6775228 |
| 959 | 2961172181 | 2961170736 | Bacteria | 7072258 |
| 960 | 2961187455 | 2961183825 | Bacteria | 6688536 |
| 961 | 2965026069 | 2965025482 | Bacteria | 6532201 |
| 962 | 2965040009 | 2965032056 | Bacteria | 6887443 |
| 963 | 2965041457 | 2965040258 | Bacteria | 6855979 |
| 964 | 2965052579 | 2965047637 | Bacteria | 6623551 |
| 965 | 2965090063 | 2965089291 | Bacteria | 6866420 |
| 966 | 2965104587 | 2965102966 | Bacteria | 6800987 |
| 967 | 2965115690 | 2965110997 | Bacteria | 6693150 |
| 968 | 2970504779 | 2970503327 | Bacteria | 7099517 |
| 969 | 2970513673 | 2970510686 | Bacteria | 7006402 |
| 970 | 2970538701 | 2970532167 | Bacteria | 6553173 |
| 971 | 2970551763 | 2970547951 | Bacteria | 6931819 |
| 972 | 2970627490 | 2970627176 | Bacteria | 6680862 |
| 973 | 2977857345 | 2977851361 | Bacteria | 6694324 |
| 974 | 2977877827 | 2977872689 | Bacteria | 7270173 |
| 975 | 2977903830 | 2977898635 | Bacteria | 6675551 |
| 976 | 2977907646 | 2977907340 | Bacteria | 6577984 |
| 977 | 2977918859 | 2977915119 | Bacteria | 6829656 |
| 978 | 2977936653 | 2977935797 | Bacteria | 6252826 |
| 979 | 2977951084 | 2977950692 | Bacteria | 6893264 |
| 980 | 2977959914 | 2977957713 | Bacteria | 6877875 |
| 981 | 2979771244 | 2979764755 | Bacteria | 6610066 |
| 982 | 2979773414 | 2979772303 | Bacteria | 6618277 |
| 983 | 2979793230 | 2979793036 | Bacteria | 6808957 |
| 984 | 2979809416 | 2979808191 | Bacteria | 7179355 |
| 985 | 2987646241 | 2987645492 | Bacteria | 6117018 |
| 986 | 2987674685 | 2987673487 | Bacteria | 6884027 |
| 987 | 3004168376 | 3004167301 | Bacteria | 8330599 |
| 988 | 3004199385 | 3004195979 | Bacteria | 6776956 |
| 989 | 3004239447 | 3004232784 | Bacteria | 6662140 |
| 990 | 3004240030 | 3004239961 | Bacteria | 6892290 |
| 991 | 3005456599 | 3005452660 | Bacteria | 5889319 |
| 992 | 3005479298 | 3005474847 | Bacteria | 9259049 |
| 993 | 649872599 | 649633066 | Bacteria | 6690028 |
| 994 | 8004304068 | 8004300914 | Bacteria | 6132239 |
| 995 | 8004315650 | 8004312739 | Bacteria | 7444653 |
| 996 | 8004365172 | 8004361976 | Bacteria | 6858373 |
| 997 | 8004701601 | 8004695233 | Bacteria | 6731676 |
| 998 | 8004733241 | 8004727605 | Bacteria | 6643904 |
| 999 | 8006968649 | 8006964411 | Bacteria | 8966052 |
| 1000 | 8006990409 | 8006984368 | Bacteria | 9651211 |
| 1001 | 8006996371 | 8006994254 | Bacteria | 8309700 |
| 1002 | 8019557762 | 8019555841 | Bacteria | 9642137 |
| 1003 | 8056674688 | 8056673599 | Bacteria | 7871253 |
| 1004 | 8056690539 | 8056689827 | Bacteria | 6712655 |
| 1005 | Ga0105248_10693242 | |||
| 1006 | JGI24740J21852_10039356 | |||
| 1007 | JGI24739J22299_10025701 | |||
| 1008 | JGI24737J22298_10032210 | |||
| 1009 | JGI24735J21928_10096102 | |||
| 1010 | JGI24738J21930_10055845 | |||
| 1011 | JGI25404J52841_10028295 | |||
| 1012 | Ga0070658_10502921 | |||
| 1013 | Ga0070658_11234264 | |||
| 1014 | Ga0070676_10392278 | |||
| 1015 | Ga0070683_101070301 | |||
| 1016 | Ga0070683_101080154 | |||
| 1017 | Ga0070690_100063676 | |||
| 1018 | Ga0068869_100015866 | |||
| 1019 | Ga0068869_100150162 | |||
| 1020 | Ga0068869_100525783 | |||
| 1021 | Ga0070680_100085528 | |||
| 1022 | Ga0070680_100174899 | |||
| 1023 | Ga0070680_100394192 | |||
| 1024 | Ga0070682_101469809 | |||
| 1025 | Ga0068868_100133434 | |||
| 1026 | Ga0068868_100401660 | |||
| 1027 | Ga0068868_100541615 | |||
| 1028 | Ga0070660_100061272 | |||
| 1029 | Ga0070660_100086099 | |||
| 1030 | Ga0070660_100116666 | |||
| 1031 | Ga0070660_100222100 | |||
| 1032 | Ga0070660_100225123 | |||
| 1033 | Ga0070691_10880330 | |||
| 1034 | Ga0070687_100113193 | |||
| 1035 | Ga0070661_100082671 | |||
| 1036 | Ga0070661_100188537 | |||
| 1037 | Ga0070668_100044770 | |||
| 1038 | Ga0070668_100406470 | |||
| 1039 | Ga0070668_100519621 | |||
| 1040 | Ga0070675_100202571 | |||
| 1041 | Ga0070675_100789664 | |||
| 1042 | Ga0070671_100644649 | |||
| 1043 | Ga0070671_101352222 | |||
| 1044 | Ga0070674_100030526 | |||
| 1045 | Ga0070674_100489911 | |||
| 1046 | Ga0070673_100064592 | |||
| 1047 | Ga0070673_100389664 | |||
| 1048 | Ga0070688_100220007 | |||
| 1049 | Ga0070659_100467564 | |||
| 1050 | Ga0070659_100877986 | |||
| 1051 | Ga0070714_100038907 | |||
| 1052 | Ga0070714_100951059 | |||
| 1053 | Ga0070713_100008997 | |||
| 1054 | Ga0070713_100025614 | |||
| 1055 | Ga0070710_10001323 | |||
| 1056 | Ga0070701_10016381 | |||
| 1057 | Ga0070711_100040022 | |||
| 1058 | Ga0070711_100073013 | |||
| 1059 | Ga0070711_100965594 | |||
| 1060 | Ga0070705_100580887 | |||
| 1061 | Ga0070700_100159450 | |||
| 1062 | Ga0070700_100209452 | |||
| 1063 | Ga0070700_101574484 | |||
| 1064 | Ga0070663_100004927 | |||
| 1065 | Ga0070663_100123312 | |||
| 1066 | Ga0070678_100021934 | |||
| 1067 | Ga0070662_100033210 | |||
| 1068 | Ga0070662_100055790 | |||
| 1069 | Ga0070681_10126301 | |||
| 1070 | Ga0070681_10412005 | |||
| 1071 | Ga0070681_10507344 | |||
| 1072 | Ga0070681_10688752 | |||
| 1073 | Ga0068867_100038760 | |||
| 1074 | Ga0068867_100794163 | |||
| 1075 | Ga0070698_100549219 | |||
| 1076 | Ga0070679_100040704 | |||
| 1077 | Ga0070679_100266373 | |||
| 1078 | Ga0070679_101419413 | |||
| 1079 | Ga0070684_100213388 | |||
| 1080 | Ga0070697_100632260 | |||
| 1081 | Ga0068853_100014558 | |||
| 1082 | Ga0068853_100066019 | |||
| 1083 | Ga0068853_100141321 | |||
| 1084 | Ga0068853_100160826 | |||
| 1085 | Ga0068853_100216451 | |||
| 1086 | Ga0068853_100342322 | |||
| 1087 | Ga0068853_100750060 | |||
| 1088 | Ga0070672_100013720 | |||
| 1089 | Ga0070695_100303691 | |||
| 1090 | Ga0070695_100856482 | |||
| 1091 | Ga0070693_100180431 | |||
| 1092 | Ga0070693_100246710 | |||
| 1093 | Ga0070665_100071088 | |||
| 1094 | Ga0070665_100134870 | |||
| 1095 | Ga0070665_100367902 | |||
| 1096 | Ga0070704_100226455 | |||
| 1097 | Ga0068855_100066543 | |||
| 1098 | Ga0068855_100097944 | |||
| 1099 | Ga0068855_100163435 | |||
| 1100 | Ga0068855_100277969 | |||
| 1101 | Ga0068855_102180026 | |||
| 1102 | Ga0068857_100010083 | |||
| 1103 | Ga0068857_100016903 | |||
| 1104 | Ga0068857_100180444 | |||
| 1105 | Ga0068857_100568753 | |||
| 1106 | Ga0068854_100009252 | |||
| 1107 | Ga0068854_100011841 | |||
| 1108 | Ga0068854_100198165 | |||
| 1109 | Ga0068856_100005753 | |||
| 1110 | Ga0068856_100006749 | |||
| 1111 | Ga0068856_100037307 | |||
| 1112 | Ga0068856_100244928 | |||
| 1113 | Ga0070702_100347086 | |||
| 1114 | Ga0068852_100088878 | |||
| 1115 | Ga0068852_100190699 | |||
| 1116 | Ga0068852_100382459 | |||
| 1117 | Ga0068859_100801071 | |||
| 1118 | Ga0068859_100873993 | |||
| 1119 | Ga0068866_10061021 | |||
| 1120 | Ga0068866_10429840 | |||
| 1121 | Ga0068861_100060839 | |||
| 1122 | Ga0068861_100271472 | |||
| 1123 | Ga0068851_10016691 | |||
| 1124 | Ga0068851_10071614 | |||
| 1125 | Ga0068863_100142543 | |||
| 1126 | Ga0068863_100337552 | |||
| 1127 | Ga0068863_100361190 | |||
| 1128 | Ga0068858_100064822 | |||
| 1129 | Ga0068858_100805092 | |||
| 1130 | Ga0068858_101441449 | |||
| 1131 | Ga0068860_100124217 | |||
| 1132 | Ga0068860_100238253 | |||
| 1133 | Ga0068860_100530726 | |||
| 1134 | Ga0068862_100137129 | |||
| 1135 | Ga0068862_100224621 | |||
| 1136 | Ga0068862_100957387 | |||
| 1137 | Ga0068862_101645670 | |||
| 1138 | Ga0081455_10003355 | |||
| 1139 | Ga0081455_10007167 | |||
| 1140 | Ga0081455_10021699 | |||
| 1141 | Ga0081538_10115446 | |||
| 1142 | Ga0081538_10142378 | |||
| 1143 | Ga0081540_1001032 | |||
| 1144 | Ga0081540_1002786 | |||
| 1145 | Ga0081540_1002954 | |||
| 1146 | Ga0081540_1007525 | |||
| 1147 | Ga0081540_1007738 | |||
| 1148 | Ga0081540_1014291 | |||
| 1149 | Ga0081540_1016193 | |||
| 1150 | Ga0081540_1137261 | |||
| 1151 | Ga0081540_1192691 | |||
| 1152 | Ga0081540_1318452 | |||
| 1153 | Ga0081539_10018493 | |||
| 1154 | Ga0081539_10023497 | |||
| 1155 | Ga0070717_10017140 | |||
| 1156 | Ga0070717_11434177 | |||
| 1157 | Ga0075365_10003538 | |||
| 1158 | Ga0075365_10022932 | |||
| 1159 | Ga0075365_10057275 | |||
| 1160 | Ga0075365_10274031 | |||
| 1161 | Ga0075368_10164869 | |||
| 1162 | Ga0075363_100001158 | |||
| 1163 | Ga0075363_100637246 | |||
| 1164 | Ga0075364_10096159 | |||
| 1165 | Ga0075364_10115052 | |||
| 1166 | Ga0075364_11199133 | |||
| 1167 | Ga0070715_10007268 | |||
| 1168 | Ga0070716_100181083 | |||
| 1169 | Ga0070716_100181223 | |||
| 1170 | Ga0070716_100193743 | |||
| 1171 | Ga0070712_100094123 | |||
| 1172 | Ga0070712_100215277 | |||
| 1173 | Ga0070712_100293346 | |||
| 1174 | Ga0075362_10038749 | |||
| 1175 | Ga0075362_10045644 | |||
| 1176 | Ga0075362_10471014 | |||
| 1177 | Ga0075367_10101088 | |||
| 1178 | Ga0075367_10174758 | |||
| 1179 | Ga0075367_10187400 | |||
| 1180 | Ga0075367_10196244 | |||
| 1181 | Ga0075367_10613399 | |||
| 1182 | Ga0075369_10047677 | |||
| 1183 | Ga0075369_10098844 | |||
| 1184 | Ga0075369_10309963 | |||
| 1185 | Ga0075369_10321822 | |||
| 1186 | Ga0075366_10339278 | |||
| 1187 | Ga0075366_10368691 | |||
| 1188 | Ga0097621_100358989 | |||
| 1189 | Ga0097621_102085031 | |||
| 1190 | Ga0075370_10729755 | |||
| 1191 | Ga0068871_100389943 | |||
| 1192 | Ga0068871_101152032 | |||
| 1193 | Ga0068871_102110222 | |||
| 1194 | Ga0075428_100192302 | |||
| 1195 | Ga0075428_100441443 | |||
| 1196 | Ga0075431_100499532 | |||
| 1197 | Ga0075431_101190209 | |||
| 1198 | Ga0075434_101486478 | |||
| 1199 | Ga0068865_100091161 | |||
| 1200 | Ga0097620_100801105 | |||
| 1201 | Ga0097620_100873973 | |||
| 1202 | Ga0099794_10030428 | |||
| 1203 | Ga0099795_10023693 | |||
| 1204 | Ga0099795_10093986 | |||
| 1205 | Ga0099795_10127485 | |||
| 1206 | Ga0105251_10590333 | |||
| 1207 | Ga0105250_10160153 | |||
| 1208 | Ga0105240_10002409 | |||
| 1209 | Ga0105240_10053294 | |||
| 1210 | Ga0105240_10328284 | |||
| 1211 | Ga0111539_10650228 | |||
| 1212 | Ga0111539_13149324 | |||
| 1213 | Ga0105245_10220241 | |||
| 1214 | Ga0105245_10713389 | |||
| 1215 | Ga0105245_11837056 | |||
| 1216 | Ga0105245_11908235 | |||
| 1217 | Ga0105247_10449358 | |||
| 1218 | Ga0105247_10544544 | |||
| 1219 | Ga0114129_10103659 | |||
| 1220 | Ga0114129_11289216 | |||
| 1221 | Ga0105243_10067114 | |||
| 1222 | Ga0105241_10000269 | |||
| 1223 | Ga0105241_10162189 | |||
| 1224 | Ga0105241_10339732 | |||
| 1225 | Ga0105242_10347345 | |||
| 1226 | Ga0105242_10937885 | |||
| 1227 | Ga0105242_11430405 | |||
| 1228 | Ga0105242_12469319 | |||
| 1229 | Ga0105248_10025744 | |||
| 1230 | Ga0105248_10956650 | |||
| 1231 | Ga0105237_10059189 | |||
| 1232 | Ga0105237_10090547 | |||
| 1233 | Ga0105237_10154856 | |||
| 1234 | Ga0105237_10160768 | |||
| 1235 | Ga0105237_10746115 | |||
| 1236 | Ga0105237_11158257 | |||
| 1237 | Ga0105238_10010406 | |||
| 1238 | Ga0105238_10103450 | |||
| 1239 | Ga0105238_10133209 | |||
| 1240 | Ga0105238_10201611 | |||
| 1241 | Ga0105249_10302364 | |||
| 1242 | Ga0105249_10685830 | |||
| 1243 | Ga0099796_10123283 | |||
| 1244 | Ga0105239_10044037 | |||
| 1245 | Ga0105239_10054941 | |||
| 1246 | Ga0105239_10102818 | |||
| 1247 | Ga0105239_10319121 | |||
| 1248 | Ga0105239_10402831 | |||
| 1249 | Ga0105239_10532559 | |||
| 1250 | Ga0105239_11065269 | |||
| 1251 | Ga0105239_11823925 | |||
| 1252 | Ga0105246_10045143 | |||
| 1253 | Ga0105246_10413571 | |||
| 1254 | Ga0157315_1025224 | |||
| 1255 | Ga0157370_10093663 | |||
| 1256 | Ga0157370_10097046 | |||
| 1257 | Ga0157369_10124140 | |||
| 1258 | Ga0157374_12068387 | |||
| 1259 | Ga0157378_10010051 | |||
| 1260 | Ga0157378_10303715 | |||
| 1261 | Ga0157378_10429977 | |||
| 1262 | Ga0157372_12238683 | |||
| 1263 | Ga0157375_10607109 | |||
| 1264 | Ga0163163_10270859 | |||
| 1265 | Ga0163163_10305046 | |||
| 1266 | Ga0157380_10113233 | |||
| 1267 | Ga0157377_10383155 | |||
| 1268 | Ga0157379_10479951 | |||
| 1269 | Ga0157379_11054582 | |||
| 1270 | Ga0157379_11373587 | |||
| 1271 | Ga0157379_11453851 | |||
| 1272 | Ga0157376_10390515 | |||
| 1273 | Ga0157376_10827621 | |||
| 1274 | Ga0163161_10049232 | |||
| 1275 | Ga0209233_1008120 | |||
| 1276 | Ga0209130_1016398 | |||
| 1277 | Ga0209025_1141824 | |||
| 1278 | Ga0209758_1007398 | |||
| 1279 | Ga0209758_1017972 | |||
| 1280 | Ga0207656_10040888 | |||
| 1281 | Ga0207696_1039036 | |||
| 1282 | Ga0207692_10004070 | |||
| 1283 | Ga0207692_10558515 | |||
| 1284 | Ga0207710_10466672 | |||
| 1285 | Ga0207647_10001356 | |||
| 1286 | Ga0207685_10031395 | |||
| 1287 | Ga0207685_10117865 | |||
| 1288 | Ga0207685_10817564 | |||
| 1289 | Ga0207699_10699720 | |||
| 1290 | Ga0207645_10327453 | |||
| 1291 | Ga0207645_10366252 | |||
| 1292 | Ga0207643_10028299 | |||
| 1293 | Ga0207705_10141242 | |||
| 1294 | Ga0207705_10244138 | |||
| 1295 | Ga0207684_10726795 | |||
| 1296 | Ga0207654_10000939 | |||
| 1297 | Ga0207654_10046765 | |||
| 1298 | Ga0207654_10191788 | |||
| 1299 | Ga0207707_10050546 | |||
| 1300 | Ga0207707_10083424 | |||
| 1301 | Ga0207707_10167047 | |||
| 1302 | Ga0207695_10002086 | |||
| 1303 | Ga0207695_10043865 | |||
| 1304 | Ga0207695_10135037 | |||
| 1305 | Ga0207695_10331588 | |||
| 1306 | Ga0207695_10479059 | |||
| 1307 | Ga0207671_10219619 | |||
| 1308 | Ga0207671_10311669 | |||
| 1309 | Ga0207671_10461312 | |||
| 1310 | Ga0207671_10500052 | |||
| 1311 | Ga0207671_10521926 | |||
| 1312 | Ga0207693_10000606 | |||
| 1313 | Ga0207693_10036058 | |||
| 1314 | Ga0207693_10280141 | |||
| 1315 | Ga0207693_10690195 | |||
| 1316 | Ga0207663_10002328 | |||
| 1317 | Ga0207663_10476393 | |||
| 1318 | Ga0207663_11341508 | |||
| 1319 | Ga0207660_10193176 | |||
| 1320 | Ga0207660_10214610 | |||
| 1321 | Ga0207660_10705187 | |||
| 1322 | Ga0207657_10004938 | |||
| 1323 | Ga0207657_10074968 | |||
| 1324 | Ga0207657_10312593 | |||
| 1325 | Ga0207649_10057376 | |||
| 1326 | Ga0207649_10312202 | |||
| 1327 | Ga0207652_10070088 | |||
| 1328 | Ga0207652_10094481 | |||
| 1329 | Ga0207652_10254030 | |||
| 1330 | Ga0207652_10570276 | |||
| 1331 | Ga0207681_10412901 | |||
| 1332 | Ga0207681_10734383 | |||
| 1333 | Ga0207681_11559212 | |||
| 1334 | Ga0207694_10000787 | |||
| 1335 | Ga0207694_10006017 | |||
| 1336 | Ga0207694_10353373 | |||
| 1337 | Ga0207694_10426042 | |||
| 1338 | Ga0207694_10897978 | |||
| 1339 | Ga0207659_10520616 | |||
| 1340 | Ga0207687_10032210 | |||
| 1341 | Ga0207687_10056507 | |||
| 1342 | Ga0207687_10815856 | |||
| 1343 | Ga0207700_10031994 | |||
| 1344 | Ga0207700_10163092 | |||
| 1345 | Ga0207664_10095218 | |||
| 1346 | Ga0207644_10799177 | |||
| 1347 | Ga0207644_11532845 | |||
| 1348 | Ga0207690_10164100 | |||
| 1349 | Ga0207690_10676852 | |||
| 1350 | Ga0207706_10448498 | |||
| 1351 | Ga0207686_10449407 | |||
| 1352 | Ga0207686_10554599 | |||
| 1353 | Ga0207686_10557231 | |||
| 1354 | Ga0207709_10030165 | |||
| 1355 | Ga0207709_10781365 | |||
| 1356 | Ga0207670_10302307 | |||
| 1357 | Ga0207669_11785916 | |||
| 1358 | Ga0207704_10398232 | |||
| 1359 | Ga0207704_11921229 | |||
| 1360 | Ga0207665_10123226 | |||
| 1361 | Ga0207665_10240072 | |||
| 1362 | Ga0207665_10690951 | |||
| 1363 | Ga0207691_10099702 | |||
| 1364 | Ga0207711_10039722 | |||
| 1365 | Ga0207689_10084226 | |||
| 1366 | Ga0207689_10162653 | |||
| 1367 | Ga0207689_10195132 | |||
| 1368 | Ga0207689_10333873 | |||
| 1369 | Ga0207661_10660984 | |||
| 1370 | Ga0207679_11099542 | |||
| 1371 | Ga0207667_10022739 | |||
| 1372 | Ga0207667_10042826 | |||
| 1373 | Ga0207667_10063877 | |||
| 1374 | Ga0207667_10121508 | |||
| 1375 | Ga0207667_10150794 | |||
| 1376 | Ga0207667_11765857 | |||
| 1377 | Ga0207651_10254224 | |||
| 1378 | Ga0207712_10218668 | |||
| 1379 | Ga0207712_11003775 | |||
| 1380 | Ga0207712_11565211 | |||
| 1381 | Ga0207712_11692182 | |||
| 1382 | Ga0207668_10089610 | |||
| 1383 | Ga0207668_10491171 | |||
| 1384 | Ga0207640_10287731 | |||
| 1385 | Ga0207640_10551976 | |||
| 1386 | Ga0207640_10762162 | |||
| 1387 | Ga0207658_10310580 | |||
| 1388 | Ga0207677_10167755 | |||
| 1389 | Ga0207677_10810989 | |||
| 1390 | Ga0207677_11702432 | |||
| 1391 | Ga0207703_10060442 | |||
| 1392 | Ga0207703_10999509 | |||
| 1393 | Ga0207639_10014324 | |||
| 1394 | Ga0207639_10110463 | |||
| 1395 | Ga0207639_10160502 | |||
| 1396 | Ga0207639_10191860 | |||
| 1397 | Ga0207639_10461700 | |||
| 1398 | Ga0207639_10864525 | |||
| 1399 | Ga0207639_11701219 | |||
| 1400 | Ga0207639_12206645 | |||
| 1401 | Ga0207678_10005558 | |||
| 1402 | Ga0207678_10036066 | |||
| 1403 | Ga0207678_10062772 | |||
| 1404 | Ga0207678_10089061 | |||
| 1405 | Ga0207678_10128449 | |||
| 1406 | Ga0207708_10096720 | |||
| 1407 | Ga0207708_10214763 | |||
| 1408 | Ga0207708_10672006 | |||
| 1409 | Ga0207708_10778587 | |||
| 1410 | Ga0207702_10000005 | |||
| 1411 | Ga0207702_10031505 | |||
| 1412 | Ga0207702_10127557 | |||
| 1413 | Ga0207702_10512867 | |||
| 1414 | Ga0207641_10105754 | |||
| 1415 | Ga0207641_10275382 | |||
| 1416 | Ga0207641_10484064 | |||
| 1417 | Ga0207641_11585182 | |||
| 1418 | Ga0207648_10032444 | |||
| 1419 | Ga0207648_10207585 | |||
| 1420 | Ga0207648_10211914 | |||
| 1421 | Ga0207676_10883131 | |||
| 1422 | Ga0207674_10003061 | |||
| 1423 | Ga0207674_10003961 | |||
| 1424 | Ga0207674_10160125 | |||
| 1425 | Ga0207674_10569803 | |||
| 1426 | Ga0207675_100161351 | |||
| 1427 | Ga0207675_100191005 | |||
| 1428 | Ga0207675_100231314 | |||
| 1429 | Ga0207675_100465667 | |||
| 1430 | Ga0207675_100987564 | |||
| 1431 | Ga0207683_10270371 | |||
| 1432 | Ga0207683_10405285 | |||
| 1433 | Ga0207683_10462526 | |||
| 1434 | Ga0207698_10314657 | |||
| 1435 | Ga0207698_10805407 | |||
| 1436 | Ga0207698_11106538 | |||
| 1437 | Ga0209179_1009585 | |||
| 1438 | Ga0209179_1018187 | |||
| 1439 | Ga0209179_1123476 | |||
| 1440 | Ga0209588_1001806 | |||
| 1441 | Ga0209813_10031797 | |||
| 1442 | Ga0268266_10001654 | |||
| 1443 | Ga0268266_10016919 | |||
| 1444 | Ga0268266_10027234 | |||
| 1445 | Ga0268266_10223640 | |||
| 1446 | Ga0268265_10017287 | |||
| 1447 | Ga0268265_10197398 | |||
| 1448 | Ga0268265_10402679 | |||
| 1449 | Ga0268265_10598452 | |||
| 1450 | Ga0268265_10754747 | |||
| 1451 | Ga0268264_10288745 | |||
| 1452 | Ga0268264_10704182 | |||
| 1453 | Ga0268264_10946004 | |||
| 1454 | Ga0307515_10012760 | |||
| 1455 | Ga0265773_1020391 | |||
| 1456 | Ga0265330_10160351 | |||
| 1457 | Ga0265330_10251092 | |||
| 1458 | Ga0265332_10063963 | |||
| 1459 | Ga0265325_10019623 | |||
| 1460 | Ga0265339_10020279 | |||
| 1461 | Ga0265316_10359021 | |||
| 1462 | Ga0265316_10580821 | |||
| 1463 | Ga0307509_10031263 | |||
| 1464 | Ga0307408_101130381 | |||
| 1465 | Ga0265313_10288400 | |||
| 1466 | Ga0307508_10000010 | |||
| 1467 | Ga0307516_10649299 | |||
| 1468 | Ga0307405_10914521 | |||
| 1469 | Ga0307410_11631805 | |||
| 1470 | Ga0307406_10948202 | |||
| 1471 | Ga0307412_10401618 | |||
| 1472 | Ga0307416_100183653 | |||
| 1473 | Ga0307416_100301559 | |||
| 1474 | Ga0307416_101077458 | |||
| 1475 | Ga0307411_10259134 | |||
| 1476 | Ga0307415_100259304 | |||
| 1477 | Ga0316593_10171051 | |||
| 1478 | Ga0307510_10046716 | |||
| 1479 | Ga0307510_10093090 | |||
| 1480 | Ga0307510_10098623 | |||
| 1481 | Ga0307510_10166514 | |||
| 1482 | Ga0307510_10357640 | |||
| 1483 | Ga0373926_0181052 | |||
| 1484 | Ga0373951_0211713 | |||
| 1485 | Ga0373923_0045638 | |||
| 1486 | Ga0373923_0275751 | |||
| 1487 | Ga0373936_0011900 | |||
| 1488 | Ga0373936_0191091 | |||
| 1489 | Ga0373945_0070598 | |||
| 1490 | Ga0373953_0012681 | |||
| 1491 | Ga0373953_0014657 | |||
| 1492 | Ga0373953_0048566 | |||
| 1493 | Ga0373954_0005242 | |||
| 1494 | Ga0373954_0024546 | |||
| 1495 | Ga0373954_0037892 | |||
| 1496 | Ga0373956_0031781 | |||
| 1497 | Ga0373956_0119763 | |||
| 1498 | Ga0373957_0006606 | |||
| 1499 | Ga0373957_0189047 | |||
| 1500 | Ga0373957_0217889 | |||
| 1501 | Ga0373957_0368905 | |||
| 1502 | Ga0373943_0011889 | |||
| 1503 | Ga0373943_0114082 | |||
| 1504 | Ga0373943_0557411 | |||
| 1505 | Ga0373946_0048934 | |||
| 1506 | Ga0373955_0000832 | |||
| 1507 | Ga0373955_0004930 | |||
| 1508 | Ga0373955_0106746 | |||
| 1509 | Ga0373955_0208411 | |||
| 1510 | Ga0316574_0425879 | |||
| 1511 | Ga0373924_0013131 | |||
| 1512 | Ga0373935_0021078 | |||
| 1513 | Ga0373935_0147869 | |||
| 1514 | Ga0373927_0003926 | |||
| 1515 | Ga0373927_0016694 | |||
| 1516 | Ga0373927_0034763 | |||
| 1517 | Ga0373927_0307434 | |||
| 1518 | Ga0373933_0010086 | |||
| 1519 | Ga0373933_0105608 | |||
| 1520 | Ga0373933_0150299 | |||
| 1521 | Ga0373933_0169990 | |||
| 1522 | Ga0373947_0037519 | |||
| 1523 | Ga0373947_0176306 | |||
| 1524 | Ga0373947_0380379 | |||
| 1525 | Ga0373937_0018236 | |||
| 1526 | Ga0373937_0050091 | |||
| 1527 | Ga0373937_0063209 | |||
| 1528 | Ga0373937_0243475 | |||
| 1529 | Ga0373925_0016994 | |||
| 1530 | Ga0373925_0266880 | |||
| 1531 | Ga0373925_1348682 | |||
| 1532 | Ga0395905_0392844 | |||
| 1533 | Ga0436363_0272408 | |||
| 1534 | Ga0439465_0143183 | |||
| 1535 | Ga0439465_0297463 | |||
| 1536 | Ga0451807_1470248 | |||
| 1537 | Ga0451849_0602933 | |||
| 1538 | Ga0439458_0041325 | |||
| 1539 | Ga0466969_0208002 | |||
| 1540 | Ga0466966_0613919 | |||
| 1541 | Ga0495617_272558 | |||
| 1542 | Ga0495592_0035763 | |||
| 1543 | Ga0495592_0040324 | |||
| 1544 | Ga0495592_0094913 | |||
| 1545 | Ga0495592_0216970 | |||
| 1546 | Ga0495603_0000268 | |||
| 1547 | Ga0495603_0180142 | |||
| 1548 | Ga0495603_0277437 | |||
| 1549 | Ga0495590_0059740 | |||
| 1550 | Ga0495629_0007385 | |||
| 1551 | Ga0495629_0028347 | |||
| 1552 | Ga0495629_0070005 | |||
| 1553 | Ga0495638_0066555 | |||
| 1554 | Ga0495638_0145621 | |||
| 1555 | Ga0495638_0575385 | |||
| 1556 | Ga0495641_0009139 | |||
| 1557 | Ga0495651_0003335 | |||
| 1558 | Ga0495651_0102482 | |||
| 1559 | Ga0495653_0027255 | |||
| 1560 | Ga0495653_0091279 | |||
| 1561 | Ga0495653_0097006 | |||
| 1562 | Ga0495653_0136900 | |||
| 1563 | Ga0495580_0005773 | |||
| 1564 | Ga0495580_0082544 | |||
| 1565 | Ga0495582_0000859 | |||
| 1566 | Ga0495605_0036223 | |||
| 1567 | Ga0495605_0224290 | |||
| 1568 | Ga0495605_0259888 | |||
| 1569 | Ga0495605_0405758 | |||
| 1570 | Ga0495639_0003304 | |||
| 1571 | Ga0495639_0051940 | |||
| 1572 | Ga0495662_0000532 | |||
| 1573 | Ga0495664_0094081 | |||
| 1574 | Ga0495664_0288813 | |||
| 1575 | Ga0495584_0082493 | |||
| 1576 | Ga0495584_0214199 | |||
| 1577 | Ga0495584_0492730 | |||
| 1578 | Ga0495584_0552713 | |||
| 1579 | Ga0495585_0064209 | |||
| 1580 | Ga0495585_0098221 | |||
| 1581 | Ga0495585_0130179 | |||
| 1582 | Ga0495585_0329469 | |||
| 1583 | Ga0495594_0005520 | |||
| 1584 | Ga0495594_0024294 | |||
| 1585 | Ga0495583_0419130 | |||
| 1586 | Ga0495606_0222278 | |||
| 1587 | Ga0495608_0003075 | |||
| 1588 | Ga0495608_0026213 | |||
| 1589 | Ga0495608_0182392 | |||
| 1590 | Ga0495608_0682077 | |||
| 1591 | Ga0495610_0055856 | |||
| 1592 | Ga0495610_0097071 | |||
| 1593 | Ga0495616_0047702 | |||
| 1594 | Ga0495616_0283387 | |||
| 1595 | Ga0495618_0123442 | |||
| 1596 | Ga0495618_0358892 | |||
| 1597 | Ga0495620_0164270 | |||
| 1598 | Ga0495620_0404592 | |||
| 1599 | Ga0495628_0010946 | |||
| 1600 | Ga0495628_0024219 | |||
| 1601 | Ga0495628_0094075 | |||
| 1602 | Ga0495628_0146896 | |||
| 1603 | Ga0495630_0074406 | |||
| 1604 | Ga0495630_0078147 | |||
| 1605 | Ga0495631_0133650 | |||
| 1606 | Ga0495632_0002414 | |||
| 1607 | Ga0495632_0019960 | |||
| 1608 | Ga0495632_0097927 | |||
| 1609 | Ga0495632_0197435 | |||
| 1610 | Ga0495643_0307842 | |||
| 1611 | Ga0495648_0364864 | |||
| 1612 | Ga0495663_0204514 | |||
| 1613 | Ga0495666_0020759 | |||
| 1614 | Ga0495666_0114864 | |||
| 1615 | Ga0495642_0259619 | |||
| 1616 | Ga0495652_0018734 | |||
| 1617 | Ga0495652_0037745 | |||
| 1618 | Ga0495652_0132317 | |||
| 1619 | Ga0495665_0000767 | |||
| 1620 | Ga0495640_0031306 | |||
| 1621 | Ga0495640_0032585 | |||
| 1622 | Ga0495640_0133148 | |||
| 1623 | Ga0495587_0006327 | |||
| 1624 | Ga0495587_0012511 | |||
| 1625 | Ga0495598_0016628 | |||
| 1626 | Ga0495598_0123010 | |||
| 1627 | Ga0495609_0206935 | |||
| 1628 | Ga0495621_0083181 | |||
| 1629 | Ga0495621_0380724 | |||
| 1630 | Ga0495597_0249008 | |||
| 1631 | Ga0495645_0107473 | |||
| 1632 | Ga0495622_0022695 | |||
| 1633 | Ga0495622_0067684 | |||
| 1634 | Ga0495633_0056720 | |||
| 1635 | Ga0495667_0007813 | |||
| 1636 | Ga0495667_0024399 | |||
| 1637 | Ga0495667_0047636 | |||
| 1638 | Ga0495667_0049238 | |||
| 1639 | Ga0495656_0027781 | |||
| 1640 | Ga0495656_0057578 | |||
| 1641 | Ga0495668_0100762 | |||
| 1642 | Ga0495668_0115598 | |||
| 1643 | Ga0495668_0297796 | |||
| 1644 | Ga0495668_0551605 | |||
| 1645 | Ga0495634_0002413 | |||
| 1646 | Ga0495634_0221303 | |||
| 1647 | Ga0495611_0094648 | |||
| 1648 | Ga0495625_0120457 | |||
| 1649 | Ga0495625_0217238 | |||
| 1650 | Ga0495625_0529063 | |||
| 1651 | Ga0495625_0698981 | |||
| 1652 | Ga0495625_0865922 | |||
| 1653 | Ga0495635_0004552 | |||
| 1654 | Ga0495635_0006411 | |||
| 1655 | Ga0495635_0193994 | |||
| 1656 | Ga0495635_0616865 | |||
| 1657 | Ga0495659_0048856 | |||
| 1658 | Ga0495657_0016091 | |||
| 1659 | Ga0495657_0056812 | |||
| 1660 | Ga0495657_0097906 | |||
| 1661 | Ga0495657_0132611 | |||
| 1662 | Ga0495599_0003165 | |||
| 1663 | Ga0495599_0043317 | |||
| 1664 | Ga0495599_0121300 | |||
| 1665 | Ga0495623_0004325 | |||
| 1666 | Ga0495623_0068738 | |||
| 1667 | Ga0495623_0101208 | |||
| 1668 | Ga0495646_0046766 | |||
| 1669 | Ga0495646_0050281 | |||
| 1670 | Ga0495646_0052340 | |||
| 1671 | Ga0495647_0013145 | |||
| 1672 | Ga0495658_0000767 | |||
| 1673 | Ga0495669_0045236 | |||
| 1674 | Ga0495669_0117430 | |||
| 1675 | Ga0495613_0010961 | |||
| 1676 | Ga0495624_0001338 | |||
| 1677 | Ga0495624_0144662 | |||
| 1678 | Ga0495670_0018097 | |||
| 1679 | Ga0495671_0380404 | |||
| 1680 | Ga0495649_0001498 | |||
| 1681 | Ga0495649_0275004 | |||
| 1682 | Ga0495649_0337183 | |||
| 1683 | Ga0495589_0218019 | |||
| 1684 | Ga0495600_0012913 | |||
| 1685 | Ga0495600_0108236 | |||
| 1686 | Ga0495660_0414413 | |||
| 1687 | Ga0495581_0003234 | |||
| 1688 | Ga0495604_0007942 | |||
| 1689 | Ga0495604_0019868 | |||
| 1690 | Ga0495604_0025065 | |||
| 1691 | Ga0495604_0233069 | |||
| 1692 | Ga0495674_0012712 | |||
| 1693 | Ga0495674_0032060 | |||
| 1694 | Ga0495674_0399883 | |||
| 1695 | Ga0495672_0024775 | |||
| 1696 | Ga0495676_0014180 | |||
| 1697 | Ga0495676_0040532 | |||
| 1698 | Ga0495676_0419906 | |||
| 1699 | Ga0495680_0003133 | |||
| 1700 | Ga0495680_0013071 | |||
| 1701 | Ga0495680_0128980 | |||
| 1702 | Ga0495680_0437219 | |||
| 1703 | Ga0495683_0145403 | |||
| 1704 | Ga0495683_0182629 | |||
| 1705 | Ga0495675_0001752 | |||
| 1706 | Ga0495675_0235905 | |||
| 1707 | Ga0495677_0159219 | |||
| 1708 | Ga0495685_289365 | |||
| 1709 | Ga0495673_0041572 | |||
| 1710 | Ga0495681_0122820 | |||
| 1711 | Ga0495684_0016251 | |||
| 1712 | Ga0495684_0097622 | |||
| 1713 | Ga0495686_0305714 | |||
| 1714 | Ga0495686_0308391 | |||
| 1715 | Ga0495686_0538970 | |||
| 1716 | Ga0495593_0000895 | |||
| 1717 | Ga0495593_0024499 | |||
| 1718 | Ga0495602_0028085 | |||
| 1719 | Ga0495602_0044259 | |||
| 1720 | Ga0495602_0201565 | |||
| 1721 | Ga0495602_0211698 | |||
| 1722 | Ga0495615_0100106 | |||
| 1723 | Ga0495626_0037084 | |||
| 1724 | Ga0496100_0327158 | |||
| 1725 | Ga0496101_0116047 | |||
| 1726 | Ga0496101_0201888 | |||
| 1727 | Ga0496101_0919581 | |||
| 1728 | Ga0496102_0117237 | |||
| 1729 | Ga0496102_0141606 | |||
| 1730 | Ga0496102_0159894 | |||
| 1731 | Ga0496102_0584356 | |||
| 1732 | Ga0496102_1224779 | |||
| 1733 | Ga0496103_0340209 | |||
| 1734 | Ga0496103_0606787 | |||
| 1735 | Ga0496104_0309352 | |||
| 1736 | Ga0496104_0549781 | |||
| 1737 | Ga0496106_0031798 | |||
| 1738 | Ga0496106_0128742 | |||
| 1739 | Ga0496106_0302429 | |||
| 1740 | Ga0496107_0118103 | |||
| 1741 | Ga0496107_0189234 | |||
| 1742 | Ga0496107_0697923 | |||
| 1743 | Ga0496107_0736496 | |||
| 1744 | Ga0496108_0012011 | |||
| 1745 | Ga0496108_1170925 | |||
| 1746 | Ga0496109_0130718 | |||
| 1747 | Ga0496109_0623238 | |||
| 1748 | Ga0496110_0302033 | |||
| 1749 | Ga0496111_0239967 | |||
| 1750 | Ga0496112_0381580 | |||
| 1751 | Ga0496114_0057676 | |||
| 1752 | Ga0496114_0511281 | |||
| 1753 | Ga0496114_0795974 | |||
| 1754 | Ga0496114_1311492 | |||
| 1755 | Ga0496115_0114630 | |||
| 1756 | Ga0496115_0324781 | |||
| 1757 | Ga0496116_0507073 | |||
| 1758 | Ga0496118_0113989 | |||
| 1759 | Ga0496119_0216375 | |||
| 1760 | Ga0496119_0342549 | |||
| 1761 | Ga0496120_0526299 | |||
| 1762 | Ga0496121_0053802 | |||
| 1763 | Ga0496121_0092789 | |||
| 1764 | Ga0496121_0114308 | |||
| 1765 | Ga0496121_0244925 | |||
| 1766 | Ga0496121_0299343 | |||
| 1767 | Ga0496121_0594884 | |||
| 1768 | Ga0496121_0835977 | |||
| 1769 | Ga0496124_0066593 | |||
| 1770 | Ga0496124_0196854 | |||
| 1771 | Ga0496124_0248340 | |||
| 1772 | Ga0496124_0269971 | |||
| 1773 | Ga0496125_0075993 | |||
| 1774 | Ga0496125_0346126 | |||
| 1775 | Ga0496126_0004492 | |||
| 1776 | Ga0496126_0168207 | |||
| 1777 | Ga0496126_1170224 | |||
| 1778 | Ga0495682_0167319 | |||
| 1779 | Ga0501034_0000008 | |||
| 1780 | Ga0501036_0085643 | |||
| 1781 | Ga0501037_0116845 | |||
| 1782 | Ga0501040_0909939 | |||
| 1783 | Ga0501043_0204329 | |||
| 1784 | Ga0501046_0690777 | |||
| 1785 | Ga0501047_0022031 | |||
| 1786 | Ga0501048_0000873 | |||
| 1787 | Ga0501067_0058463 | |||
| 1788 | Ga0501067_0069336 | |||
| 1789 | Ga0501067_0751787 | |||
| 1790 | Ga0501069_0201618 | |||
| 1791 | Ga0501073_0255321 | |||
| 1792 | Ga0501076_0672184 | |||
| 1793 | Ga0501080_0957542 | |||
| 1794 | Ga0501035_0023233 | |||
| 1795 | Ga0501044_0000004 | |||
| 1796 | Ga0501044_0043557 | |||
| 1797 | nmdc:mga03683_11827_c1 | |||
| 1798 | nmdc:mga03683_9498_c1 | |||
| 1799 | nmdc:mga03n38_5472_c1 | |||
| 1800 | nmdc:mga00v17_128557_c1 | |||
| 1801 | nmdc:mga00v17_354330_c1 | |||
| 1802 | nmdc:mga0yw44_277686_c1 | |||
| 1803 | nmdc:mga0yw44_313242_c1 | |||
| 1804 | nmdc:mga0yw44_388730_c1 | |||
| 1805 | nmdc:mga0yw44_43537_c1 | |||
| 1806 | nmdc:mga0yw44_522883_c1 | |||
| 1807 | nmdc:mga0yw44_90618_c1 | |||
| 1808 | nmdc:mga0yw44_92292_c1 | |||
| 1809 | nmdc:mga0k408_466705_c1 | |||
| 1810 | nmdc:mga0k408_90781_c2 | |||
| 1811 | nmdc:mga06z11_155256_c1 | |||
| 1812 | nmdc:mga06z11_162328_c1 | |||
| 1813 | nmdc:mga06z11_246974_c1 | |||
| 1814 | nmdc:mga06z11_516882_c1 | |||
| 1815 | nmdc:mga06z11_945793_c1 | |||
| 1816 | nmdc:mga04h51_37804_c1 | |||
| 1817 | nmdc:mga04h51_506498_c1 | |||
| 1818 | nmdc:mga07m45_16924_c1 | |||
| 1819 | nmdc:mga07m45_388601_c1 | |||
| 1820 | nmdc:mga07m45_400531_c1 | |||
| 1821 | nmdc:mga07m45_47787_c1 | |||
| 1822 | nmdc:mga07m45_53539_c1 | |||
| 1823 | nmdc:mga07m45_693764_c1 | |||
| 1824 | nmdc:mga07m45_743336_c1 | |||
| 1825 | nmdc:mga05p37_367396_c1 | |||
| 1826 | nmdc:mga05p37_703574_c1 | |||
| 1827 | nmdc:mga05p37_99136_c1 | |||
| 1828 | nmdc:mga09592_1065497_c1 | |||
| 1829 | nmdc:mga09592_178764_c1 | |||
| 1830 | nmdc:mga06r32_318358_c1 | |||
| 1831 | nmdc:mga08y16_274932_c1 | |||
| 1832 | nmdc:mga0sz30_269877_c1 | |||
| 1833 | nmdc:mga0sz30_505717_c1 | |||
| 1834 | nmdc:mga0sz30_8886_c1 | |||
| 1835 | Ga0495601_0018737 | |||
| 1836 | Ga0495601_0225651 | |||
| 1837 | Ga0495612_0024685 | |||
| 1838 | Ga0495612_0355342 | |||
| 1839 | Ga0500635_0015025 | |||
| 1840 | Ga0500635_0085202 | |||
| 1841 | Ga0495595_0002948 | |||
| 1842 | Ga0495595_0002987 | |||
| 1843 | Ga0495595_0337851 | |||
| 1844 | Ga0495595_0455923 | |||
| 1845 | Ga0495619_0002940 | |||
| 1846 | Ga0495619_0031393 | |||
| 1847 | Ga0495619_0066330 | |||
| 1848 | Ga0500643_031303 | |||
| 1849 | Ga0500646_0132656 | |||
| 1850 | Ga0500583_0537438 | |||
| 1851 | Ga0500651_0177192 | |||
| 1852 | Ga0500651_0261944 | |||
| 1853 | Ga0500566_0013769 | |||
| 1854 | Ga0500566_0311371 | |||
| 1855 | Ga0500641_0018278 | |||
| 1856 | Ga0500554_049285 | |||
| 1857 | Ga0500555_055218 | |||
| 1858 | Ga0500593_286131 | |||
| 1859 | Ga0500594_0134765 | |||
| 1860 | Ga0500595_001972 | |||
| 1861 | Ga0500595_012703 | |||
| 1862 | Ga0500608_020498 | |||
| 1863 | Ga0500621_232020 | |||
| 1864 | Ga0500642_0056899 | |||
| 1865 | Ga0500655_018441 | |||
| 1866 | Ga0500655_122012 | |||
| 1867 | Ga0500658_0242962 | |||
| 1868 | Ga0500568_0008843 | |||
| 1869 | Ga0500568_0177363 | |||
| 1870 | Ga0500577_0543442 | |||
| 1871 | Ga0500588_0077131 | |||
| 1872 | Ga0500589_108820 | |||
| 1873 | Ga0500589_141912 | |||
| 1874 | Ga0500603_000823 | |||
| 1875 | Ga0500604_0018278 | |||
| 1876 | Ga0500622_0197267 | |||
| 1877 | Ga0500638_000097 | |||
| 1878 | Ga0500636_0035467 | |||
| 1879 | Ga0500636_0137106 | |||
| 1880 | Ga0500636_0547882 | |||
| 1881 | Ga0500637_0001475 | |||
| 1882 | Ga0500611_178227 | |||
| 1883 | Ga0500645_115051 | |||
| 1884 | Ga0500609_012998 | |||
| 1885 | Ga0501084_0099316 | |||
| 1886 | Ga0500661_000409 | |||
| 1887 | Ga0501082_0001489 | |||
| 1888 | Ga0501082_0074783 | |||
| 1889 | Ga0501082_1633533 | |||
| 1890 | 2509368212 | |||
| 1891 | 2513659655 | |||
| 1892 | 2513691721 | |||
| 1893 | 2513862682 | |||
| 1894 | 2513921625 | |||
| 1895 | 2644004643 | |||
| 1896 | 2644196846 | |||
| 1897 | 2644237448 | |||
| 1898 | 2644305073 | |||
| 1899 | 2688598064 | |||
| 1900 | 2723845867 | |||
| 1901 | 2793073765 | |||
| 1902 | 2793081829 | |||
| 1903 | 2856333776 | |||
| 1904 | 2856338166 | |||
| 1905 | 2857369642 | |||
| 1906 | 2869169473 | |||
| 1907 | 2869237095 | |||
| 1908 | 2869246261 | |||
| 1909 | 2869250392 | |||
| 1910 | 2869268771 | |||
| 1911 | 2869272273 | |||
| 1912 | 2871465113 | |||
| 1913 | 2871486251 | |||
| 1914 | 2874114071 | |||
| 1915 | 2874117421 | |||
| 1916 | 2874132583 | |||
| 1917 | 2874165158 | |||
| 1918 | 2874609488 | |||
| 1919 | 2876390562 | |||
| 1920 | 2876404901 | |||
| 1921 | 2876411577 | |||
| 1922 | 2876421353 | |||
| 1923 | 2876808934 | |||
| 1924 | 2878737416 | |||
| 1925 | 2878779448 | |||
| 1926 | 2878782899 | |||
| 1927 | 2879110276 | |||
| 1928 | 2889040711 | |||
| 1929 | 2894818196 | |||
| 1930 | 2894820040 | |||
| 1931 | 2903515211 | |||
| 1932 | 2903754837 | |||
| 1933 | 2906367609 | |||
| 1934 | 2906370930 | |||
| 1935 | 2906391357 | |||
| 1936 | 2906398592 | |||
| 1937 | 2906407181 | |||
| 1938 | 2906413577 | |||
| 1939 | 2906429025 | |||
| 1940 | 2906636084 | |||
| 1941 | 2906665781 | |||
| 1942 | 2908743742 | |||
| 1943 | 2922157829 | |||
| 1944 | 2922176726 | |||
| 1945 | 2922179133 | |||
| 1946 | 2922367810 | |||
| 1947 | 2922392288 | |||
| 1948 | 2922429128 | |||
| 1949 | 2924717825 | |||
| 1950 | 2924747335 | |||
| 1951 | 2924752276 | |||
| 1952 | 2935634280 | |||
| 1953 | 2937862409 | |||
| 1954 | 2937876008 | |||
| 1955 | 2941511170 | |||
| 1956 | 2941518554 | |||
| 1957 | 2941527183 | |||
| 1958 | 2941531065 | |||
| 1959 | 2958127488 | |||
| 1960 | 2958138767 | |||
| 1961 | 2958162232 | |||
| 1962 | 2961141978 | |||
| 1963 | 2961172181 | |||
| 1964 | 2961187455 | |||
| 1965 | 2965026069 | |||
| 1966 | 2965040009 | |||
| 1967 | 2965041457 | |||
| 1968 | 2965052579 | |||
| 1969 | 2965090063 | |||
| 1970 | 2965104587 | |||
| 1971 | 2965115690 | |||
| 1972 | 2970504779 | |||
| 1973 | 2970513673 | |||
| 1974 | 2970538701 | |||
| 1975 | 2970551763 | |||
| 1976 | 2970627490 | |||
| 1977 | 2977857345 | |||
| 1978 | 2977877827 | |||
| 1979 | 2977903830 | |||
| 1980 | 2977907646 | |||
| 1981 | 2977918859 | |||
| 1982 | 2977936653 | |||
| 1983 | 2977951084 | |||
| 1984 | 2977959914 | |||
| 1985 | 2979771244 | |||
| 1986 | 2979773414 | |||
| 1987 | 2979793230 | |||
| 1988 | 2979809416 | |||
| 1989 | 2987646241 | |||
| 1990 | 2987674685 | |||
| 1991 | 3004168376 | |||
| 1992 | 3004199385 | |||
| 1993 | 3004239447 | |||
| 1994 | 3004240030 | |||
| 1995 | 3005456599 | |||
| 1996 | 3005479298 | |||
| 1997 | 649872599 | |||
| 1998 | 8004304068 | |||
| 1999 | 8004315650 | |||
| 2000 | 8004365172 | |||
| 2001 | 8004701601 | |||
| 2002 | 8004733241 | |||
| 2003 | 8006968649 | |||
| 2004 | 8006990409 | |||
| 2005 | 8006996371 | |||
| 2006 | 8019557762 | |||
| 2007 | 8056674688 | |||
| 2008 | 8056690539 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s3d-assembly1.cif.gz_A | arsenate reductase r60a mutant from e. coli | 0.9712 | 3 | 130 |
| 1i9d-assembly1.cif.gz_A | arsenate reductase from e. coli | 0.9712 | 3 | 130 |
| 1s3c-assembly1.cif.gz_A | arsenate reductase c12s mutant from e. coli | 0.9704 | 3 | 130 |
| 1sd8-assembly1.cif.gz_A | arsenate reductase r60k mutant from e. coli | 0.9699 | 3 | 130 |
| 1j9b-assembly1.cif.gz_A | arsenate reductase+0.4m arsenite from e. coli | 0.9641 | 3 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j9bA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9641 | 3 | 130 | 3.40.30.10 |
| 3rdwB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9499 | 3 | 113 | 3.40.30.10 |
| 1j9bA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9286 | 3 | 130 | 3.40.30.10 |
| 3rdwB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.918 | 3 | 113 | 3.40.30.10 |
| af_D7SFI3_9_110_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8994 | 2 | 31 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A4GVS0-F1-model_v4 | ArsC | 0.9942 | 28 | 106 |
GO:0046685
|
| AF-A0A659UVR1-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 0.993 | 1 | 118 |
GO:0008794
GO:0046685 |
| AF-A0A0A7KNS5-F1-model_v4 | arsenate reductase (glutathione/glutaredoxin) (EC 1.20.4.1) | 0.9923 | 14 | 130 |
GO:0008794
GO:0046685 |
| AF-A0A1X1D7F2-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 0.9917 | 2 | 117 |
GO:0008794
GO:0046685 |
| AF-A0A2S9Q4E8-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 0.9916 | 1 | 132 |
GO:0008794
GO:0046685 |