F487984

General Info

Members Datasets Scaffolds Average Seq Length
1005 528 2008 135

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10693242|Ga0105248_106932422
Length 154
Sequence MSVTIYHNPACGTSRNTLAMIRQSGEEPEVIEYLKTPPGRARLVELIAALGLSPRELLREKGTPYAELGLADPKWSDDELIDFMMAHPILINRPIVVTPKGVRLCRPSELVLDLLDNPIESFVKVDGEAIARGRLPSCTIARHNSVWNLRPACA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
233 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
234 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
276 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
281 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
300 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
301 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
302 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
322 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
337 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
338 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
339 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
340 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
341 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
362 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
368 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
377 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
380 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
381 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
382 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
383 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
384 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
385 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
386 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
387 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
388 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
389 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
390 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
391 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
392 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
393 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
394 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
395 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
396 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
397 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
398 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
399 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
400 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
401 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
402 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
403 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
404 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
405 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
406 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
407 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
412 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
413 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
414 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
415 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
416 2643221599 Rhizobium sp. Root708 Isolate Unclassified
417 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
418 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
419 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
420 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
421 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
422 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
423 2791355199
424 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
425 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
426 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
427 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
428 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
429 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
430 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
431 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
432 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
433 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
434 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
435 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
436 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
437 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
438 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
439 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
440 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
441 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
442 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
443 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
444 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
445 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
446 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
447 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
448 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
449 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
450 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
451 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
452 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
453 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
454 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
455 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
456 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
457 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
458 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
459 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
460 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
461 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
462 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
463 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
464 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
465 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
466 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
467 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
468 2922425934
469 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
470 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
471 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
472 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
473 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
474 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
475 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
476 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
477 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
478 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
479 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
480 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
481 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
482 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
483 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
484 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
485 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
486 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
487 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
488 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
489 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
490 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
491 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
492 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
493 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
494 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
495 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
496 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
497 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
498 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
499 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
500 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
501 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
502 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
503 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
504 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
505 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
506 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
507 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
508 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
509 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
510 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
511 3004167301 Mesorhizobium loti 582 Isolate Unclassified
512 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
513 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
514 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
515 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
516 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
517 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
518 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
519 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
520 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
521 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
522 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
523 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
524 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
525 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
526 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
527 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
528 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.14
Metatranscriptomes 0.2
Isolates 11.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.25
Nodule 10.25
Rhizoplane 3.38
Rhizosphere 71.34
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10693242 3300009177 Bacteria 1149
2 JGI24740J21852_10039356 3300001979 Bacteria 1443
3 JGI24739J22299_10025701 3300001989 Bacteria 2070
4 JGI24737J22298_10032210 3300001990 Bacteria 1634
5 JGI24735J21928_10096102 3300002067 Bacteria 850
6 JGI24738J21930_10055845 3300002075 Bacteria 807
7 JGI25404J52841_10028295 3300003659 Bacteria 1203
8 Ga0070658_10502921 3300005327 Bacteria 1047
9 Ga0070658_11234264 3300005327 Bacteria 650
10 Ga0070676_10392278 3300005328 Bacteria 964
11 Ga0070683_101070301 3300005329 Bacteria 775
12 Ga0070683_101080154 3300005329 Bacteria 771
13 Ga0070690_100063676 3300005330 Bacteria 2380
14 Ga0068869_100015866 3300005334 Bacteria 5066
15 Ga0068869_100150162 3300005334 Bacteria 1806
16 Ga0068869_100525783 3300005334 Bacteria 991
17 Ga0070680_100085528 3300005336 Bacteria 2605
18 Ga0070680_100174899 3300005336 Bacteria 1807
19 Ga0070680_100394192 3300005336 Bacteria 1180
20 Ga0070682_101469809 3300005337 Bacteria 585
21 Ga0068868_100133434 3300005338 Bacteria 2034
22 Ga0068868_100401660 3300005338 Bacteria 1183
23 Ga0068868_100541615 3300005338 Bacteria 1025
24 Ga0070660_100061272 3300005339 Bacteria 2921
25 Ga0070660_100086099 3300005339 Bacteria 2472
26 Ga0070660_100116666 3300005339 Bacteria 2129
27 Ga0070660_100222100 3300005339 Bacteria 1536
28 Ga0070660_100225123 3300005339 Bacteria 1525
29 Ga0070691_10880330 3300005341 Bacteria 551
30 Ga0070687_100113193 3300005343 Bacteria 1539
31 Ga0070661_100082671 3300005344 Bacteria 2372
32 Ga0070661_100188537 3300005344 Bacteria 1572
33 Ga0070668_100044770 3300005347 Bacteria 3395
34 Ga0070668_100406470 3300005347 Bacteria 1163
35 Ga0070668_100519621 3300005347 Bacteria 1033
36 Ga0070675_100202571 3300005354 Bacteria 1723
37 Ga0070675_100789664 3300005354 Bacteria 867
38 Ga0070671_100644649 3300005355 Bacteria 917
39 Ga0070671_101352222 3300005355 Bacteria 629
40 Ga0070674_100030526 3300005356 Bacteria 3563
41 Ga0070674_100489911 3300005356 Bacteria 1022
42 Ga0070673_100064592 3300005364 Bacteria 2917
43 Ga0070673_100389664 3300005364 Bacteria 1244
44 Ga0070688_100220007 3300005365 Bacteria 1338
45 Ga0070659_100467564 3300005366 Bacteria 1072
46 Ga0070659_100877986 3300005366 Bacteria 783
47 Ga0070714_100038907 3300005435 Bacteria 4001
48 Ga0070714_100951059 3300005435 Bacteria 835
49 Ga0070713_100008997 3300005436 Bacteria 7119
50 Ga0070713_100025614 3300005436 Bacteria 4615
51 Ga0070710_10001323 3300005437 Bacteria 11692
52 Ga0070701_10016381 3300005438 Bacteria 3445
53 Ga0070711_100040022 3300005439 Bacteria 3159
54 Ga0070711_100073013 3300005439 Bacteria 2422
55 Ga0070711_100965594 3300005439 Bacteria 730
56 Ga0070705_100580887 3300005440 Bacteria 864
57 Ga0070700_100159450 3300005441 Bacteria 1551
58 Ga0070700_100209452 3300005441 Bacteria 1375
59 Ga0070700_101574484 3300005441 Bacteria 561
60 Ga0070663_100004927 3300005455 Bacteria 7882
61 Ga0070663_100123312 3300005455 Bacteria 1960
62 Ga0070678_100021934 3300005456 Bacteria 4221
63 Ga0070662_100033210 3300005457 Bacteria 3631
64 Ga0070662_100055790 3300005457 Bacteria 2867
65 Ga0070681_10126301 3300005458 Bacteria 2490
66 Ga0070681_10412005 3300005458 Bacteria 1263
67 Ga0070681_10507344 3300005458 Bacteria 1119
68 Ga0070681_10688752 3300005458 Bacteria 938
69 Ga0068867_100038760 3300005459 Bacteria 3470
70 Ga0068867_100794163 3300005459 Bacteria 843
71 Ga0070698_100549219 3300005471 Bacteria 1095
72 Ga0070679_100040704 3300005530 Bacteria 4623
73 Ga0070679_100266373 3300005530 Bacteria 1668
74 Ga0070679_101419413 3300005530 Bacteria 641
75 Ga0070684_100213388 3300005535 Bacteria 1759
76 Ga0070697_100632260 3300005536 Bacteria 942
77 Ga0068853_100014558 3300005539 Bacteria 6448
78 Ga0068853_100066019 3300005539 Bacteria 3141
79 Ga0068853_100141321 3300005539 Bacteria 2161
80 Ga0068853_100160826 3300005539 Bacteria 2026
81 Ga0068853_100216451 3300005539 Bacteria 1748
82 Ga0068853_100342322 3300005539 Bacteria 1390
83 Ga0068853_100750060 3300005539 Bacteria 933
84 Ga0070672_100013720 3300005543 Bacteria 5729
85 Ga0070695_100303691 3300005545 Bacteria 1181
86 Ga0070695_100856482 3300005545 Bacteria 732
87 Ga0070693_100180431 3300005547 Bacteria 1359
88 Ga0070693_100246710 3300005547 Bacteria 1182
89 Ga0070665_100071088 3300005548 Bacteria 3486
90 Ga0070665_100134870 3300005548 Bacteria 2471
91 Ga0070665_100367902 3300005548 Bacteria 1444
92 Ga0070704_100226455 3300005549 Bacteria 1523
93 Ga0068855_100066543 3300005563 Bacteria 4201
94 Ga0068855_100097944 3300005563 Bacteria 3378
95 Ga0068855_100163435 3300005563 Bacteria 2525
96 Ga0068855_100277969 3300005563 Bacteria 1860
97 Ga0068855_102180026 3300005563 Bacteria 557
98 Ga0068857_100010083 3300005577 Bacteria 8207
99 Ga0068857_100016903 3300005577 Bacteria 6392
100 Ga0068857_100180444 3300005577 Bacteria 1921
101 Ga0068857_100568753 3300005577 Bacteria 1069
102 Ga0068854_100009252 3300005578 Bacteria 6357
103 Ga0068854_100011841 3300005578 Bacteria 5695
104 Ga0068854_100198165 3300005578 Bacteria 1577
105 Ga0068856_100005753 3300005614 Bacteria 12215
106 Ga0068856_100006749 3300005614 Bacteria 11239
107 Ga0068856_100037307 3300005614 Bacteria 4769
108 Ga0068856_100244928 3300005614 Bacteria 1808
109 Ga0070702_100347086 3300005615 Bacteria 1044
110 Ga0068852_100088878 3300005616 Bacteria 2760
111 Ga0068852_100190699 3300005616 Bacteria 1934
112 Ga0068852_100382459 3300005616 Bacteria 1381
113 Ga0068859_100801071 3300005617 Bacteria 1030
114 Ga0068859_100873993 3300005617 Bacteria 984
115 Ga0068866_10061021 3300005718 Bacteria 1957
116 Ga0068866_10429840 3300005718 Bacteria 858
117 Ga0068861_100060839 3300005719 Bacteria 2896
118 Ga0068861_100271472 3300005719 Bacteria 1456
119 Ga0068851_10016691 3300005834 Bacteria 3518
120 Ga0068851_10071614 3300005834 Bacteria 1794
121 Ga0068863_100142543 3300005841 Bacteria 2291
122 Ga0068863_100337552 3300005841 Bacteria 1465
123 Ga0068863_100361190 3300005841 Bacteria 1416
124 Ga0068858_100064822 3300005842 Bacteria 3381
125 Ga0068858_100805092 3300005842 Bacteria 917
126 Ga0068858_101441449 3300005842 Bacteria 679
127 Ga0068860_100124217 3300005843 Bacteria 2474
128 Ga0068860_100238253 3300005843 Bacteria 1769
129 Ga0068860_100530726 3300005843 Bacteria 1177
130 Ga0068862_100137129 3300005844 Bacteria 2169
131 Ga0068862_100224621 3300005844 Bacteria 1701
132 Ga0068862_100957387 3300005844 Bacteria 844
133 Ga0068862_101645670 3300005844 Bacteria 649
134 Ga0081455_10003355 3300005937 Bacteria 18462
135 Ga0081455_10007167 3300005937 Bacteria 11786
136 Ga0081455_10021699 3300005937 Bacteria 6016
137 Ga0081538_10115446 3300005981 Bacteria 1305
138 Ga0081538_10142378 3300005981 Bacteria 1103
139 Ga0081540_1001032 3300005983 Bacteria 24938
140 Ga0081540_1002786 3300005983 Bacteria 14181
141 Ga0081540_1002954 3300005983 Bacteria 13645
142 Ga0081540_1007525 3300005983 Bacteria 7753
143 Ga0081540_1007738 3300005983 Bacteria 7609
144 Ga0081540_1014291 3300005983 Bacteria 5096
145 Ga0081540_1016193 3300005983 Bacteria 4680
146 Ga0081540_1137261 3300005983 Bacteria 988
147 Ga0081540_1192691 3300005983 Bacteria 750
148 Ga0081540_1318452 3300005983 Bacteria 534
149 Ga0081539_10018493 3300005985 Bacteria 4832
150 Ga0081539_10023497 3300005985 Bacteria 4038
151 Ga0070717_10017140 3300006028 Bacteria 5628
152 Ga0070717_11434177 3300006028 Bacteria 627
153 Ga0075365_10003538 3300006038 Bacteria 8080
154 Ga0075365_10022932 3300006038 Bacteria 3919
155 Ga0075365_10057275 3300006038 Bacteria 2593
156 Ga0075365_10274031 3300006038 Bacteria 1187
157 Ga0075368_10164869 3300006042 Bacteria 930
158 Ga0075363_100001158 3300006048 Bacteria 9673
159 Ga0075363_100637246 3300006048 Bacteria 641
160 Ga0075364_10096159 3300006051 Bacteria 1969
161 Ga0075364_10115052 3300006051 Bacteria 1797
162 Ga0075364_11199133 3300006051 Bacteria 515
163 Ga0070715_10007268 3300006163 Bacteria 3807
164 Ga0070716_100181083 3300006173 Bacteria 1383
165 Ga0070716_100181223 3300006173 Bacteria 1383
166 Ga0070716_100193743 3300006173 Bacteria 1345
167 Ga0070712_100094123 3300006175 Bacteria 2201
168 Ga0070712_100215277 3300006175 Bacteria 1517
169 Ga0070712_100293346 3300006175 Bacteria 1314
170 Ga0075362_10038749 3300006177 Bacteria 2094
171 Ga0075362_10045644 3300006177 Bacteria 1946
172 Ga0075362_10471014 3300006177 Bacteria 640
173 Ga0075367_10101088 3300006178 Bacteria 1763
174 Ga0075367_10174758 3300006178 Bacteria 1338
175 Ga0075367_10187400 3300006178 Bacteria 1290
176 Ga0075367_10196244 3300006178 Bacteria 1260
177 Ga0075367_10613399 3300006178 Bacteria 691
178 Ga0075369_10047677 3300006186 Bacteria 1847
179 Ga0075369_10098844 3300006186 Bacteria 1308
180 Ga0075369_10309963 3300006186 Bacteria 738
181 Ga0075369_10321822 3300006186 Bacteria 723
182 Ga0075366_10339278 3300006195 Bacteria 921
183 Ga0075366_10368691 3300006195 Bacteria 882
184 Ga0097621_100358989 3300006237 Bacteria 1297
185 Ga0097621_102085031 3300006237 Bacteria 542
186 Ga0075370_10729755 3300006353 Bacteria 603
187 Ga0068871_100389943 3300006358 Bacteria 1239
188 Ga0068871_101152032 3300006358 Bacteria 726
189 Ga0068871_102110222 3300006358 Bacteria 537
190 Ga0075428_100192302 3300006844 Bacteria 2207
191 Ga0075428_100441443 3300006844 Bacteria 1394
192 Ga0075431_100499532 3300006847 Bacteria 1208
193 Ga0075431_101190209 3300006847 Bacteria 725
194 Ga0075434_101486478 3300006871 Bacteria 687
195 Ga0068865_100091161 3300006881 Bacteria 2211
196 Ga0097620_100801105 3300006931 Bacteria 1030
197 Ga0097620_100873973 3300006931 Bacteria 984
198 Ga0099794_10030428 3300007265 Bacteria 2521
199 Ga0099795_10023693 3300007788 Bacteria 2039
200 Ga0099795_10093986 3300007788 Bacteria 1167
201 Ga0099795_10127485 3300007788 Bacteria 1024
202 Ga0105251_10590333 3300009011 Bacteria 526
203 Ga0105250_10160153 3300009092 Bacteria 939
204 Ga0105240_10002409 3300009093 Bacteria 30057
205 Ga0105240_10053294 3300009093 Bacteria 5078
206 Ga0105240_10328284 3300009093 Bacteria 1742
207 Ga0111539_10650228 3300009094 Bacteria 1228
208 Ga0111539_13149324 3300009094 Bacteria 532
209 Ga0105245_10220241 3300009098 Bacteria 1831
210 Ga0105245_10713389 3300009098 Bacteria 1037
211 Ga0105245_11837056 3300009098 Bacteria 659
212 Ga0105245_11908235 3300009098 Bacteria 647
213 Ga0105247_10449358 3300009101 Bacteria 929
214 Ga0105247_10544544 3300009101 Bacteria 852
215 Ga0114129_10103659 3300009147 Bacteria 3933
216 Ga0114129_11289216 3300009147 Bacteria 906
217 Ga0105243_10067114 3300009148 Bacteria 2887
218 Ga0105241_10000269 3300009174 Bacteria 38808
219 Ga0105241_10162189 3300009174 Bacteria 1839
220 Ga0105241_10339732 3300009174 Bacteria 1301
221 Ga0105242_10347345 3300009176 Bacteria 1369
222 Ga0105242_10937885 3300009176 Bacteria 869
223 Ga0105242_11430405 3300009176 Bacteria 720
224 Ga0105242_12469319 3300009176 Bacteria 568
225 Ga0105248_10025744 3300009177 Bacteria 6544
226 Ga0105248_10956650 3300009177 Bacteria 967
227 Ga0105237_10059189 3300009545 Bacteria 3832
228 Ga0105237_10090547 3300009545 Bacteria 3048
229 Ga0105237_10154856 3300009545 Bacteria 2288
230 Ga0105237_10160768 3300009545 Bacteria 2244
231 Ga0105237_10746115 3300009545 Bacteria 985
232 Ga0105237_11158257 3300009545 Bacteria 780
233 Ga0105238_10010406 3300009551 Bacteria 9336
234 Ga0105238_10103450 3300009551 Bacteria 2829
235 Ga0105238_10133209 3300009551 Bacteria 2463
236 Ga0105238_10201611 3300009551 Bacteria 1965
237 Ga0105249_10302364 3300009553 Bacteria 1605
238 Ga0105249_10685830 3300009553 Bacteria 1084
239 Ga0099796_10123283 3300010159 Bacteria 998
240 Ga0105239_10044037 3300010375 Bacteria 4893
241 Ga0105239_10054941 3300010375 Bacteria 4368
242 Ga0105239_10102818 3300010375 Bacteria 3162
243 Ga0105239_10319121 3300010375 Bacteria 1752
244 Ga0105239_10402831 3300010375 Bacteria 1548
245 Ga0105239_10532559 3300010375 Bacteria 1337
246 Ga0105239_11065269 3300010375 Bacteria 930
247 Ga0105239_11823925 3300010375 Bacteria 705
248 Ga0105246_10045143 3300011119 Bacteria 2999
249 Ga0105246_10413571 3300011119 Bacteria 1123
250 Ga0157315_1025224 3300012508 Bacteria 659
251 Ga0157370_10093663 3300013104 Bacteria 2819
252 Ga0157370_10097046 3300013104 Bacteria 2765
253 Ga0157369_10124140 3300013105 Bacteria 2739
254 Ga0157374_12068387 3300013296 Bacteria 596
255 Ga0157378_10010051 3300013297 Bacteria 8246
256 Ga0157378_10303715 3300013297 Bacteria 1545
257 Ga0157378_10429977 3300013297 Bacteria 1306
258 Ga0157372_12238683 3300013307 Bacteria 628
259 Ga0157375_10607109 3300013308 Bacteria 1253
260 Ga0163163_10270859 3300014325 Bacteria 1749
261 Ga0163163_10305046 3300014325 Bacteria 1645
262 Ga0157380_10113233 3300014326 Bacteria 2284
263 Ga0157377_10383155 3300014745 Bacteria 953
264 Ga0157379_10479951 3300014968 Bacteria 1150
265 Ga0157379_11054582 3300014968 Bacteria 777
266 Ga0157379_11373587 3300014968 Unclassified 684
267 Ga0157379_11453851 3300014968 Bacteria 666
268 Ga0157376_10390515 3300014969 Bacteria 1343
269 Ga0157376_10827621 3300014969 Bacteria 940
270 Ga0163161_10049232 3300017792 Bacteria 3045
271 Ga0209233_1008120 3300025261 Bacteria 3276
272 Ga0209130_1016398 3300025284 Bacteria 1795
273 Ga0209025_1141824 3300025294 Bacteria 679
274 Ga0209758_1007398 3300025297 Bacteria 7495
275 Ga0209758_1017972 3300025297 Bacteria 3491
276 Ga0207656_10040888 3300025321 Bacteria 1967
277 Ga0207696_1039036 3300025711 Bacteria 1399
278 Ga0207692_10004070 3300025898 Bacteria 5764
279 Ga0207692_10558515 3300025898 Bacteria 732
280 Ga0207710_10466672 3300025900 Bacteria 653
281 Ga0207647_10001356 3300025904 Bacteria 18803
282 Ga0207685_10031395 3300025905 Bacteria 1902
283 Ga0207685_10117865 3300025905 Bacteria 1161
284 Ga0207685_10817564 3300025905 Bacteria 514
285 Ga0207699_10699720 3300025906 Bacteria 742
286 Ga0207645_10327453 3300025907 Bacteria 1023
287 Ga0207645_10366252 3300025907 Bacteria 966
288 Ga0207643_10028299 3300025908 Bacteria 3112
289 Ga0207705_10141242 3300025909 Bacteria 1799
290 Ga0207705_10244138 3300025909 Bacteria 1368
291 Ga0207684_10726795 3300025910 Bacteria 842
292 Ga0207654_10000939 3300025911 Bacteria 16013
293 Ga0207654_10046765 3300025911 Bacteria 2469
294 Ga0207654_10191788 3300025911 Bacteria 1340
295 Ga0207707_10050546 3300025912 Bacteria 3620
296 Ga0207707_10083424 3300025912 Bacteria 2790
297 Ga0207707_10167047 3300025912 Bacteria 1923
298 Ga0207695_10002086 3300025913 Bacteria 30425
299 Ga0207695_10043865 3300025913 Bacteria 4761
300 Ga0207695_10135037 3300025913 Bacteria 2421
301 Ga0207695_10331588 3300025913 Bacteria 1410
302 Ga0207695_10479059 3300025913 Bacteria 1127
303 Ga0207671_10219619 3300025914 Bacteria 1489
304 Ga0207671_10311669 3300025914 Bacteria 1244
305 Ga0207671_10461312 3300025914 Bacteria 1012
306 Ga0207671_10500052 3300025914 Bacteria 969
307 Ga0207671_10521926 3300025914 Bacteria 947
308 Ga0207693_10000606 3300025915 Bacteria 32081
309 Ga0207693_10036058 3300025915 Bacteria 3897
310 Ga0207693_10280141 3300025915 Bacteria 1306
311 Ga0207693_10690195 3300025915 Bacteria 791
312 Ga0207663_10002328 3300025916 Bacteria 9118
313 Ga0207663_10476393 3300025916 Bacteria 966
314 Ga0207663_11341508 3300025916 Bacteria 576
315 Ga0207660_10193176 3300025917 Bacteria 1586
316 Ga0207660_10214610 3300025917 Bacteria 1508
317 Ga0207660_10705187 3300025917 Bacteria 823
318 Ga0207657_10004938 3300025919 Bacteria 14027
319 Ga0207657_10074968 3300025919 Bacteria 2856
320 Ga0207657_10312593 3300025919 Bacteria 1243
321 Ga0207649_10057376 3300025920 Bacteria 2434
322 Ga0207649_10312202 3300025920 Bacteria 1153
323 Ga0207652_10070088 3300025921 Bacteria 3044
324 Ga0207652_10094481 3300025921 Bacteria 2633
325 Ga0207652_10254030 3300025921 Bacteria 1585
326 Ga0207652_10570276 3300025921 Bacteria 1016
327 Ga0207681_10412901 3300025923 Bacteria 1092
328 Ga0207681_10734383 3300025923 Bacteria 822
329 Ga0207681_11559212 3300025923 Bacteria 553
330 Ga0207694_10000787 3300025924 Bacteria 28518
331 Ga0207694_10006017 3300025924 Bacteria 9281
332 Ga0207694_10353373 3300025924 Bacteria 1217
333 Ga0207694_10426042 3300025924 Bacteria 1106
334 Ga0207694_10897978 3300025924 Bacteria 749
335 Ga0207659_10520616 3300025926 Bacteria 1008
336 Ga0207687_10032210 3300025927 Bacteria 3549
337 Ga0207687_10056507 3300025927 Bacteria 2754
338 Ga0207687_10815856 3300025927 Bacteria 796
339 Ga0207700_10031994 3300025928 Bacteria 3745
340 Ga0207700_10163092 3300025928 Bacteria 1853
341 Ga0207664_10095218 3300025929 Bacteria 2449
342 Ga0207644_10799177 3300025931 Bacteria 789
343 Ga0207644_11532845 3300025931 Bacteria 559
344 Ga0207690_10164100 3300025932 Bacteria 1658
345 Ga0207690_10676852 3300025932 Bacteria 847
346 Ga0207706_10448498 3300025933 Bacteria 1116
347 Ga0207686_10449407 3300025934 Bacteria 991
348 Ga0207686_10554599 3300025934 Bacteria 899
349 Ga0207686_10557231 3300025934 Bacteria 897
350 Ga0207709_10030165 3300025935 Bacteria 3152
351 Ga0207709_10781365 3300025935 Bacteria 770
352 Ga0207670_10302307 3300025936 Bacteria 1253
353 Ga0207669_11785916 3300025937 Bacteria 525
354 Ga0207704_10398232 3300025938 Bacteria 1086
355 Ga0207704_11921229 3300025938 Bacteria 509
356 Ga0207665_10123226 3300025939 Bacteria 1833
357 Ga0207665_10240072 3300025939 Bacteria 1335
358 Ga0207665_10690951 3300025939 Bacteria 802
359 Ga0207691_10099702 3300025940 Bacteria 2593
360 Ga0207711_10039722 3300025941 Bacteria 4003
361 Ga0207689_10084226 3300025942 Bacteria 2614
362 Ga0207689_10162653 3300025942 Bacteria 1839
363 Ga0207689_10195132 3300025942 Bacteria 1671
364 Ga0207689_10333873 3300025942 Bacteria 1259
365 Ga0207661_10660984 3300025944 Bacteria 961
366 Ga0207679_11099542 3300025945 Bacteria 729
367 Ga0207667_10022739 3300025949 Bacteria 6916
368 Ga0207667_10042826 3300025949 Bacteria 4809
369 Ga0207667_10063877 3300025949 Bacteria 3846
370 Ga0207667_10121508 3300025949 Bacteria 2691
371 Ga0207667_10150794 3300025949 Bacteria 2393
372 Ga0207667_11765857 3300025949 Bacteria 583
373 Ga0207651_10254224 3300025960 Bacteria 1439
374 Ga0207712_10218668 3300025961 Bacteria 1522
375 Ga0207712_11003775 3300025961 Bacteria 741
376 Ga0207712_11565211 3300025961 Bacteria 591
377 Ga0207712_11692182 3300025961 Bacteria 567
378 Ga0207668_10089610 3300025972 Bacteria 2255
379 Ga0207668_10491171 3300025972 Bacteria 1054
380 Ga0207640_10287731 3300025981 Bacteria 1294
381 Ga0207640_10551976 3300025981 Bacteria 968
382 Ga0207640_10762162 3300025981 Bacteria 835
383 Ga0207658_10310580 3300025986 Bacteria 1362
384 Ga0207677_10167755 3300026023 Bacteria 1713
385 Ga0207677_10810989 3300026023 Bacteria 838
386 Ga0207677_11702432 3300026023 Bacteria 585
387 Ga0207703_10060442 3300026035 Bacteria 3099
388 Ga0207703_10999509 3300026035 Bacteria 802
389 Ga0207639_10014324 3300026041 Bacteria 5574
390 Ga0207639_10110463 3300026041 Bacteria 2240
391 Ga0207639_10160502 3300026041 Bacteria 1894
392 Ga0207639_10191860 3300026041 Bacteria 1746
393 Ga0207639_10461700 3300026041 Bacteria 1154
394 Ga0207639_10864525 3300026041 Bacteria 844
395 Ga0207639_11701219 3300026041 Bacteria 591
396 Ga0207639_12206645 3300026041 Bacteria 512
397 Ga0207678_10005558 3300026067 Bacteria 11266
398 Ga0207678_10036066 3300026067 Bacteria 4304
399 Ga0207678_10062772 3300026067 Bacteria 3193
400 Ga0207678_10089061 3300026067 Bacteria 2638
401 Ga0207678_10128449 3300026067 Bacteria 2162
402 Ga0207708_10096720 3300026075 Bacteria 2282
403 Ga0207708_10214763 3300026075 Bacteria 1539
404 Ga0207708_10672006 3300026075 Bacteria 883
405 Ga0207708_10778587 3300026075 Bacteria 822
406 Ga0207702_10000005 3300026078 Bacteria 420296
407 Ga0207702_10031505 3300026078 Bacteria 4419
408 Ga0207702_10127557 3300026078 Bacteria 2286
409 Ga0207702_10512867 3300026078 Bacteria 1170
410 Ga0207641_10105754 3300026088 Bacteria 2486
411 Ga0207641_10275382 3300026088 Bacteria 1581
412 Ga0207641_10484064 3300026088 Bacteria 1200
413 Ga0207641_11585182 3300026088 Bacteria 657
414 Ga0207648_10032444 3300026089 Bacteria 4611
415 Ga0207648_10207585 3300026089 Bacteria 1738
416 Ga0207648_10211914 3300026089 Bacteria 1720
417 Ga0207676_10883131 3300026095 Bacteria 876
418 Ga0207674_10003061 3300026116 Bacteria 20686
419 Ga0207674_10003961 3300026116 Bacteria 18004
420 Ga0207674_10160125 3300026116 Bacteria 2205
421 Ga0207674_10569803 3300026116 Bacteria 1094
422 Ga0207675_100161351 3300026118 Bacteria 2138
423 Ga0207675_100191005 3300026118 Bacteria 1964
424 Ga0207675_100231314 3300026118 Bacteria 1784
425 Ga0207675_100465667 3300026118 Bacteria 1254
426 Ga0207675_100987564 3300026118 Bacteria 860
427 Ga0207683_10270371 3300026121 Bacteria 1552
428 Ga0207683_10405285 3300026121 Bacteria 1255
429 Ga0207683_10462526 3300026121 Bacteria 1170
430 Ga0207698_10314657 3300026142 Bacteria 1463
431 Ga0207698_10805407 3300026142 Bacteria 942
432 Ga0207698_11106538 3300026142 Bacteria 805
433 Ga0209179_1009585 3300027512 Bacteria 1665
434 Ga0209179_1018187 3300027512 Bacteria 1340
435 Ga0209179_1123476 3300027512 Bacteria 578
436 Ga0209588_1001806 3300027671 Bacteria 5690
437 Ga0209813_10031797 3300027866 Bacteria 1560
438 Ga0268266_10001654 3300028379 Bacteria 25772
439 Ga0268266_10016919 3300028379 Bacteria 6230
440 Ga0268266_10027234 3300028379 Bacteria 4862
441 Ga0268266_10223640 3300028379 Bacteria 1731
442 Ga0268265_10017287 3300028380 Bacteria 4973
443 Ga0268265_10197398 3300028380 Bacteria 1742
444 Ga0268265_10402679 3300028380 Bacteria 1265
445 Ga0268265_10598452 3300028380 Bacteria 1053
446 Ga0268265_10754747 3300028380 Bacteria 944
447 Ga0268264_10288745 3300028381 Bacteria 1540
448 Ga0268264_10704182 3300028381 Bacteria 1003
449 Ga0268264_10946004 3300028381 Bacteria 866
450 Ga0307515_10012760 3300028794 Bacteria 15775
451 Ga0265773_1020391 3300031018 Bacteria 649
452 Ga0265330_10160351 3300031235 Bacteria 955
453 Ga0265330_10251092 3300031235 Bacteria 745
454 Ga0265332_10063963 3300031238 Bacteria 1571
455 Ga0265325_10019623 3300031241 Bacteria 3734
456 Ga0265339_10020279 3300031249 Bacteria 3886
457 Ga0265316_10359021 3300031344 Bacteria 1054
458 Ga0265316_10580821 3300031344 Bacteria 796
459 Ga0307509_10031263 3300031507 Bacteria 5880
460 Ga0307408_101130381 3300031548 Bacteria 728
461 Ga0265313_10288400 3300031595 Bacteria 662
462 Ga0307508_10000010 3300031616 Bacteria 255747
463 Ga0307516_10649299 3300031730 Bacteria 710
464 Ga0307405_10914521 3300031731 Bacteria 743
465 Ga0307410_11631805 3300031852 Bacteria 570
466 Ga0307406_10948202 3300031901 Bacteria 735
467 Ga0307412_10401618 3300031911 Bacteria 1116
468 Ga0307416_100183653 3300032002 Bacteria 1963
469 Ga0307416_100301559 3300032002 Bacteria 1593
470 Ga0307416_101077458 3300032002 Bacteria 908
471 Ga0307411_10259134 3300032005 Bacteria 1372
472 Ga0307415_100259304 3300032126 Bacteria 1417
473 Ga0316593_10171051 3300032168 Bacteria 796
474 Ga0307510_10046716 3300033180 Bacteria 4651
475 Ga0307510_10093090 3300033180 Bacteria 2847
476 Ga0307510_10098623 3300033180 Bacteria 2725
477 Ga0307510_10166514 3300033180 Bacteria 1791
478 Ga0307510_10357640 3300033180 Bacteria 909
479 Ga0373926_0181052 3300035083 Bacteria 808
480 Ga0373951_0211713 3300035091 Bacteria 569
481 Ga0373923_0045638 3300035111 Bacteria 1820
482 Ga0373923_0275751 3300035111 Bacteria 792
483 Ga0373936_0011900 3300035113 Bacteria 3301
484 Ga0373936_0191091 3300035113 Bacteria 901
485 Ga0373945_0070598 3300035116 Bacteria 1321
486 Ga0373953_0012681 3300035117 Bacteria 2992
487 Ga0373953_0014657 3300035117 Bacteria 2825
488 Ga0373953_0048566 3300035117 Bacteria 1710
489 Ga0373954_0005242 3300035118 Bacteria 5600
490 Ga0373954_0024546 3300035118 Bacteria 2749
491 Ga0373954_0037892 3300035118 Bacteria 2241
492 Ga0373956_0031781 3300035119 Bacteria 2315
493 Ga0373956_0119763 3300035119 Bacteria 1229
494 Ga0373957_0006606 3300035120 Bacteria 3664
495 Ga0373957_0189047 3300035120 Bacteria 855
496 Ga0373957_0217889 3300035120 Bacteria 798
497 Ga0373957_0368905 3300035120 Bacteria 615
498 Ga0373943_0011889 3300035170 Bacteria 3918
499 Ga0373943_0114082 3300035170 Bacteria 1429
500 Ga0373943_0557411 3300035170 Bacteria 673
501 Ga0373946_0048934 3300035171 Bacteria 1761
502 Ga0373955_0000832 3300035172 Bacteria 13226
503 Ga0373955_0004930 3300035172 Bacteria 5956
504 Ga0373955_0106746 3300035172 Bacteria 1614
505 Ga0373955_0208411 3300035172 Bacteria 1165
506 Ga0316574_0425879 3300035398 Bacteria 834
507 Ga0373924_0013131 3300035410 Bacteria 3108
508 Ga0373935_0021078 3300035692 Bacteria 3988
509 Ga0373935_0147869 3300035692 Bacteria 1592
510 Ga0373927_0003926 3300035695 Bacteria 10542
511 Ga0373927_0016694 3300035695 Bacteria 4843
512 Ga0373927_0034763 3300035695 Bacteria 3278
513 Ga0373927_0307434 3300035695 Bacteria 1044
514 Ga0373933_0010086 3300035724 Bacteria 5170
515 Ga0373933_0105608 3300035724 Bacteria 1752
516 Ga0373933_0150299 3300035724 Bacteria 1474
517 Ga0373933_0169990 3300035724 Bacteria 1387
518 Ga0373947_0037519 3300035725 Bacteria 2876
519 Ga0373947_0176306 3300035725 Bacteria 1389
520 Ga0373947_0380379 3300035725 Bacteria 950
521 Ga0373937_0018236 3300036401 Bacteria 6263
522 Ga0373937_0050091 3300036401 Bacteria 3824
523 Ga0373937_0063209 3300036401 Bacteria 3404
524 Ga0373937_0243475 3300036401 Bacteria 1694
525 Ga0373925_0016994 3300037068 Bacteria 5266
526 Ga0373925_0266880 3300037068 Bacteria 1376
527 Ga0373925_1348682 3300037068 Bacteria 585
528 Ga0395905_0392844 3300037471 Bacteria 1282
529 Ga0436363_0272408 3300039450 Bacteria 889
530 Ga0439465_0143183 3300041413 Bacteria 850
531 Ga0439465_0297463 3300041413 Bacteria 604
532 Ga0451807_1470248 3300041486 Bacteria 606
533 Ga0451849_0602933 3300041505 Bacteria 773
534 Ga0439458_0041325 3300042157 Bacteria 1120
535 Ga0466969_0208002 3300044656 Bacteria 892
536 Ga0466966_0613919 3300044684 Bacteria 655
537 Ga0495617_272558 3300046452 Bacteria 519
538 Ga0495592_0035763 3300046454 Bacteria 3742
539 Ga0495592_0040324 3300046454 Bacteria 3504
540 Ga0495592_0094913 3300046454 Bacteria 2134
541 Ga0495592_0216970 3300046454 Bacteria 1281
542 Ga0495603_0000268 3300046455 Bacteria 27511
543 Ga0495603_0180142 3300046455 Bacteria 1223
544 Ga0495603_0277437 3300046455 Bacteria 963
545 Ga0495590_0059740 3300046457 Bacteria 1334
546 Ga0495629_0007385 3300046459 Bacteria 8103
547 Ga0495629_0028347 3300046459 Bacteria 3976
548 Ga0495629_0070005 3300046459 Bacteria 2448
549 Ga0495638_0066555 3300046460 Bacteria 2214
550 Ga0495638_0145621 3300046460 Bacteria 1378
551 Ga0495638_0575385 3300046460 Bacteria 556
552 Ga0495641_0009139 3300046461 Bacteria 5932
553 Ga0495651_0003335 3300046462 Bacteria 12336
554 Ga0495651_0102482 3300046462 Bacteria 2128
555 Ga0495653_0027255 3300046463 Bacteria 4574
556 Ga0495653_0091279 3300046463 Bacteria 2227
557 Ga0495653_0097006 3300046463 Bacteria 2142
558 Ga0495653_0136900 3300046463 Bacteria 1726
559 Ga0495580_0005773 3300046472 Bacteria 10159
560 Ga0495580_0082544 3300046472 Bacteria 2240
561 Ga0495582_0000859 3300046473 Bacteria 16886
562 Ga0495605_0036223 3300046474 Bacteria 2489
563 Ga0495605_0224290 3300046474 Bacteria 811
564 Ga0495605_0259888 3300046474 Bacteria 741
565 Ga0495605_0405758 3300046474 Bacteria 566
566 Ga0495639_0003304 3300046475 Bacteria 6996
567 Ga0495639_0051940 3300046475 Bacteria 1865
568 Ga0495662_0000532 3300046476 Bacteria 17442
569 Ga0495664_0094081 3300046477 Bacteria 1803
570 Ga0495664_0288813 3300046477 Bacteria 991
571 Ga0495584_0082493 3300046491 Bacteria 1618
572 Ga0495584_0214199 3300046491 Bacteria 979
573 Ga0495584_0492730 3300046491 Bacteria 624
574 Ga0495584_0552713 3300046491 Bacteria 587
575 Ga0495585_0064209 3300046492 Bacteria 2013
576 Ga0495585_0098221 3300046492 Bacteria 1569
577 Ga0495585_0130179 3300046492 Bacteria 1325
578 Ga0495585_0329469 3300046492 Bacteria 745
579 Ga0495594_0005520 3300046499 Bacteria 6494
580 Ga0495594_0024294 3300046499 Bacteria 3254
581 Ga0495583_0419130 3300046506 Bacteria 525
582 Ga0495606_0222278 3300046507 Bacteria 1063
583 Ga0495608_0003075 3300046511 Bacteria 11924
584 Ga0495608_0026213 3300046511 Bacteria 3975
585 Ga0495608_0182392 3300046511 Bacteria 1327
586 Ga0495608_0682077 3300046511 Bacteria 612
587 Ga0495610_0055856 3300046512 Bacteria 1901
588 Ga0495610_0097071 3300046512 Bacteria 1326
589 Ga0495616_0047702 3300046513 Bacteria 2156
590 Ga0495616_0283387 3300046513 Bacteria 704
591 Ga0495618_0123442 3300046514 Bacteria 1658
592 Ga0495618_0358892 3300046514 Bacteria 897
593 Ga0495620_0164270 3300046515 Bacteria 862
594 Ga0495620_0404592 3300046515 Bacteria 517
595 Ga0495628_0010946 3300046516 Bacteria 7681
596 Ga0495628_0024219 3300046516 Bacteria 4970
597 Ga0495628_0094075 3300046516 Bacteria 2317
598 Ga0495628_0146896 3300046516 Bacteria 1797
599 Ga0495630_0074406 3300046517 Bacteria 2558
600 Ga0495630_0078147 3300046517 Bacteria 2495
601 Ga0495631_0133650 3300046518 Bacteria 1066
602 Ga0495632_0002414 3300046519 Bacteria 14236
603 Ga0495632_0019960 3300046519 Bacteria 3640
604 Ga0495632_0097927 3300046519 Bacteria 1384
605 Ga0495632_0197435 3300046519 Bacteria 917
606 Ga0495643_0307842 3300046522 Bacteria 720
607 Ga0495648_0364864 3300046524 Bacteria 655
608 Ga0495663_0204514 3300046525 Bacteria 690
609 Ga0495666_0020759 3300046526 Bacteria 3252
610 Ga0495666_0114864 3300046526 Bacteria 1263
611 Ga0495642_0259619 3300046528 Bacteria 760
612 Ga0495652_0018734 3300046529 Bacteria 6169
613 Ga0495652_0037745 3300046529 Bacteria 4188
614 Ga0495652_0132317 3300046529 Bacteria 1973
615 Ga0495665_0000767 3300046531 Bacteria 16713
616 Ga0495640_0031306 3300046533 Bacteria 3798
617 Ga0495640_0032585 3300046533 Bacteria 3711
618 Ga0495640_0133148 3300046533 Bacteria 1607
619 Ga0495587_0006327 3300046536 Bacteria 7723
620 Ga0495587_0012511 3300046536 Bacteria 5336
621 Ga0495598_0016628 3300046537 Bacteria 1881
622 Ga0495598_0123010 3300046537 Bacteria 882
623 Ga0495609_0206935 3300046538 Bacteria 818
624 Ga0495621_0083181 3300046539 Bacteria 1196
625 Ga0495621_0380724 3300046539 Bacteria 596
626 Ga0495597_0249008 3300046542 Bacteria 699
627 Ga0495645_0107473 3300046543 Bacteria 1977
628 Ga0495622_0022695 3300046557 Bacteria 2924
629 Ga0495622_0067684 3300046557 Bacteria 1650
630 Ga0495633_0056720 3300046558 Bacteria 1840
631 Ga0495667_0007813 3300046559 Bacteria 7245
632 Ga0495667_0024399 3300046559 Bacteria 4072
633 Ga0495667_0047636 3300046559 Bacteria 2831
634 Ga0495667_0049238 3300046559 Bacteria 2781
635 Ga0495656_0027781 3300046615 Bacteria 2263
636 Ga0495656_0057578 3300046615 Bacteria 1683
637 Ga0495668_0100762 3300046616 Bacteria 1580
638 Ga0495668_0115598 3300046616 Bacteria 1467
639 Ga0495668_0297796 3300046616 Bacteria 884
640 Ga0495668_0551605 3300046616 Bacteria 636
641 Ga0495634_0002413 3300046642 Bacteria 15555
642 Ga0495634_0221303 3300046642 Bacteria 1168
643 Ga0495611_0094648 3300046648 Bacteria 1382
644 Ga0495625_0120457 3300046660 Bacteria 1786
645 Ga0495625_0217238 3300046660 Bacteria 1254
646 Ga0495625_0529063 3300046660 Bacteria 717
647 Ga0495625_0698981 3300046660 Bacteria 599
648 Ga0495625_0865922 3300046660 Bacteria 520
649 Ga0495635_0004552 3300046663 Bacteria 9613
650 Ga0495635_0006411 3300046663 Bacteria 8203
651 Ga0495635_0193994 3300046663 Bacteria 1378
652 Ga0495635_0616865 3300046663 Bacteria 707
653 Ga0495659_0048856 3300046664 Bacteria 1534
654 Ga0495657_0016091 3300046675 Bacteria 5456
655 Ga0495657_0056812 3300046675 Bacteria 2604
656 Ga0495657_0097906 3300046675 Bacteria 1873
657 Ga0495657_0132611 3300046675 Bacteria 1559
658 Ga0495599_0003165 3300046678 Bacteria 9586
659 Ga0495599_0043317 3300046678 Bacteria 2824
660 Ga0495599_0121300 3300046678 Bacteria 1625
661 Ga0495623_0004325 3300046679 Bacteria 9344
662 Ga0495623_0068738 3300046679 Bacteria 2208
663 Ga0495623_0101208 3300046679 Bacteria 1755
664 Ga0495646_0046766 3300046680 Bacteria 2636
665 Ga0495646_0050281 3300046680 Bacteria 2527
666 Ga0495646_0052340 3300046680 Bacteria 2467
667 Ga0495647_0013145 3300046681 Bacteria 2863
668 Ga0495658_0000767 3300046683 Bacteria 17344
669 Ga0495669_0045236 3300046684 Bacteria 1962
670 Ga0495669_0117430 3300046684 Bacteria 1245
671 Ga0495613_0010961 3300046689 Bacteria 6729
672 Ga0495624_0001338 3300046690 Bacteria 19256
673 Ga0495624_0144662 3300046690 Bacteria 1455
674 Ga0495670_0018097 3300046691 Bacteria 3470
675 Ga0495671_0380404 3300046692 Bacteria 676
676 Ga0495649_0001498 3300046694 Bacteria 17517
677 Ga0495649_0275004 3300046694 Bacteria 861
678 Ga0495649_0337183 3300046694 Bacteria 763
679 Ga0495589_0218019 3300046794 Bacteria 897
680 Ga0495600_0012913 3300046809 Bacteria 5234
681 Ga0495600_0108236 3300046809 Bacteria 1810
682 Ga0495660_0414413 3300046810 Bacteria 588
683 Ga0495581_0003234 3300047315 Bacteria 9339
684 Ga0495604_0007942 3300047317 Bacteria 8404
685 Ga0495604_0019868 3300047317 Bacteria 5374
686 Ga0495604_0025065 3300047317 Bacteria 4754
687 Ga0495604_0233069 3300047317 Bacteria 1262
688 Ga0495674_0012712 3300047319 Bacteria 7932
689 Ga0495674_0032060 3300047319 Bacteria 4770
690 Ga0495674_0399883 3300047319 Bacteria 1109
691 Ga0495672_0024775 3300047320 Bacteria 3859
692 Ga0495676_0014180 3300047321 Bacteria 7135
693 Ga0495676_0040532 3300047321 Bacteria 3842
694 Ga0495676_0419906 3300047321 Bacteria 885
695 Ga0495680_0003133 3300047322 Bacteria 16485
696 Ga0495680_0013071 3300047322 Bacteria 7260
697 Ga0495680_0128980 3300047322 Bacteria 1860
698 Ga0495680_0437219 3300047322 Bacteria 897
699 Ga0495683_0145403 3300047323 Bacteria 1108
700 Ga0495683_0182629 3300047323 Bacteria 957
701 Ga0495675_0001752 3300047444 Bacteria 12990
702 Ga0495675_0235905 3300047444 Bacteria 1102
703 Ga0495677_0159219 3300047445 Bacteria 871
704 Ga0495685_289365 3300047447 Bacteria 516
705 Ga0495673_0041572 3300047469 Bacteria 2069
706 Ga0495681_0122820 3300047470 Bacteria 1113
707 Ga0495684_0016251 3300047471 Bacteria 5730
708 Ga0495684_0097622 3300047471 Bacteria 2222
709 Ga0495686_0305714 3300047472 Bacteria 876
710 Ga0495686_0308391 3300047472 Bacteria 871
711 Ga0495686_0538970 3300047472 Bacteria 610
712 Ga0495593_0000895 3300047673 Bacteria 17309
713 Ga0495593_0024499 3300047673 Bacteria 3344
714 Ga0495602_0028085 3300048088 Bacteria 5392
715 Ga0495602_0044259 3300048088 Bacteria 4040
716 Ga0495602_0201565 3300048088 Bacteria 1518
717 Ga0495602_0211698 3300048088 Bacteria 1470
718 Ga0495615_0100106 3300048090 Bacteria 818
719 Ga0495626_0037084 3300048091 Bacteria 2319
720 Ga0496100_0327158 3300048903 Bacteria 1153
721 Ga0496101_0116047 3300048904 Bacteria 2020
722 Ga0496101_0201888 3300048904 Bacteria 1537
723 Ga0496101_0919581 3300048904 Bacteria 689
724 Ga0496102_0117237 3300048905 Bacteria 2485
725 Ga0496102_0141606 3300048905 Bacteria 2255
726 Ga0496102_0159894 3300048905 Bacteria 2119
727 Ga0496102_0584356 3300048905 Bacteria 1040
728 Ga0496102_1224779 3300048905 Bacteria 670
729 Ga0496103_0340209 3300048906 Bacteria 965
730 Ga0496103_0606787 3300048906 Bacteria 697
731 Ga0496104_0309352 3300048907 Bacteria 1493
732 Ga0496104_0549781 3300048907 Bacteria 1065
733 Ga0496106_0031798 3300048909 Bacteria 3933
734 Ga0496106_0128742 3300048909 Bacteria 1984
735 Ga0496106_0302429 3300048909 Bacteria 1283
736 Ga0496107_0118103 3300048910 Bacteria 1953
737 Ga0496107_0189234 3300048910 Bacteria 1529
738 Ga0496107_0697923 3300048910 Bacteria 746
739 Ga0496107_0736496 3300048910 Bacteria 724
740 Ga0496108_0012011 3300048911 Bacteria 7045
741 Ga0496108_1170925 3300048911 Bacteria 651
742 Ga0496109_0130718 3300048912 Bacteria 2343
743 Ga0496109_0623238 3300048912 Bacteria 1015
744 Ga0496110_0302033 3300048913 Bacteria 1458
745 Ga0496111_0239967 3300048914 Bacteria 1346
746 Ga0496112_0381580 3300048915 Bacteria 1350
747 Ga0496114_0057676 3300048917 Bacteria 3242
748 Ga0496114_0511281 3300048917 Bacteria 1062
749 Ga0496114_0795974 3300048917 Bacteria 824
750 Ga0496114_1311492 3300048917 Bacteria 611
751 Ga0496115_0114630 3300048918 Bacteria 2215
752 Ga0496115_0324781 3300048918 Bacteria 1258
753 Ga0496116_0507073 3300048919 Bacteria 500
754 Ga0496118_0113989 3300048921 Bacteria 1784
755 Ga0496119_0216375 3300048922 Bacteria 983
756 Ga0496119_0342549 3300048922 Bacteria 726
757 Ga0496120_0526299 3300048923 Bacteria 505
758 Ga0496121_0053802 3300048924 Bacteria 3369
759 Ga0496121_0092789 3300048924 Bacteria 2353
760 Ga0496121_0114308 3300048924 Bacteria 2052
761 Ga0496121_0244925 3300048924 Bacteria 1247
762 Ga0496121_0299343 3300048924 Bacteria 1092
763 Ga0496121_0594884 3300048924 Bacteria 684
764 Ga0496121_0835977 3300048924 Bacteria 537
765 Ga0496124_0066593 3300048927 Bacteria 2999
766 Ga0496124_0196854 3300048927 Bacteria 1536
767 Ga0496124_0248340 3300048927 Bacteria 1318
768 Ga0496124_0269971 3300048927 Bacteria 1246
769 Ga0496125_0075993 3300048928 Bacteria 2596
770 Ga0496125_0346126 3300048928 Bacteria 890
771 Ga0496126_0004492 3300048929 Bacteria 16641
772 Ga0496126_0168207 3300048929 Bacteria 1869
773 Ga0496126_1170224 3300048929 Bacteria 567
774 Ga0495682_0167319 3300049460 Bacteria 783
775 Ga0501034_0000008 3300049571 Bacteria 354712
776 Ga0501036_0085643 3300049572 Bacteria 2664
777 Ga0501037_0116845 3300049573 Bacteria 1919
778 Ga0501040_0909939 3300049576 Bacteria 637
779 Ga0501043_0204329 3300049579 Bacteria 1532
780 Ga0501046_0690777 3300049580 Bacteria 719
781 Ga0501047_0022031 3300049581 Bacteria 6120
782 Ga0501048_0000873 3300049582 Bacteria 22261
783 Ga0501067_0058463 3300049583 Bacteria 2135
784 Ga0501067_0069336 3300049583 Bacteria 1952
785 Ga0501067_0751787 3300049583 Bacteria 549
786 Ga0501069_0201618 3300049585 Bacteria 1153
787 Ga0501073_0255321 3300049589 Bacteria 1210
788 Ga0501076_0672184 3300049592 Bacteria 855
789 Ga0501080_0957542 3300049742 Bacteria 744
790 Ga0501035_0023233 3300049822 Bacteria 5687
791 Ga0501044_0000004 3300049823 Bacteria 327475
792 Ga0501044_0043557 3300049823 Bacteria 4662
793 nmdc:mga03683_11827_c1 3300050489 Bacteria 3172
794 nmdc:mga03683_9498_c1 3300050489 Bacteria 3462
795 nmdc:mga03n38_5472_c1 3300050490 Bacteria 4328
796 nmdc:mga00v17_128557_c1 3300050491 Bacteria 1618
797 nmdc:mga00v17_354330_c1 3300050491 Bacteria 954
798 nmdc:mga0yw44_277686_c1 3300050492 Bacteria 1119
799 nmdc:mga0yw44_313242_c1 3300050492 Bacteria 1053
800 nmdc:mga0yw44_388730_c1 3300050492 Bacteria 942
801 nmdc:mga0yw44_43537_c1 3300050492 Bacteria 2328
802 nmdc:mga0yw44_522883_c1 3300050492 Bacteria 805
803 nmdc:mga0yw44_90618_c1 3300050492 Bacteria 1932
804 nmdc:mga0yw44_92292_c1 3300050492 Bacteria 1916
805 nmdc:mga0k408_466705_c1 3300050493 Bacteria 749
806 nmdc:mga0k408_90781_c2 3300050493 Bacteria 752
807 nmdc:mga06z11_155256_c1 3300050494 Bacteria 1304
808 nmdc:mga06z11_162328_c1 3300050494 Bacteria 1278
809 nmdc:mga06z11_246974_c1 3300050494 Bacteria 1050
810 nmdc:mga06z11_516882_c1 3300050494 Bacteria 724
811 nmdc:mga06z11_945793_c1 3300050494 Bacteria 525
812 nmdc:mga04h51_37804_c1 3300050495 Bacteria 1560
813 nmdc:mga04h51_506498_c1 3300050495 Bacteria 516
814 nmdc:mga07m45_16924_c1 3300050496 Bacteria 3908
815 nmdc:mga07m45_388601_c1 3300050496 Bacteria 810
816 nmdc:mga07m45_400531_c1 3300050496 Bacteria 797
817 nmdc:mga07m45_47787_c1 3300050496 Bacteria 2406
818 nmdc:mga07m45_53539_c1 3300050496 Bacteria 2280
819 nmdc:mga07m45_693764_c1 3300050496 Bacteria 586
820 nmdc:mga07m45_743336_c1 3300050496 Bacteria 563
821 nmdc:mga05p37_367396_c1 3300050507 Bacteria 1689
822 nmdc:mga05p37_703574_c1 3300050507 Bacteria 1122
823 nmdc:mga05p37_99136_c1 3300050507 Bacteria 3589
824 nmdc:mga09592_1065497_c1 3300050508 Bacteria 673
825 nmdc:mga09592_178764_c1 3300050508 Bacteria 1835
826 nmdc:mga06r32_318358_c1 3300050510 Bacteria 1541
827 nmdc:mga08y16_274932_c1 3300050511 Bacteria 1738
828 nmdc:mga0sz30_269877_c1 3300050516 Bacteria 758
829 nmdc:mga0sz30_505717_c1 3300050516 Bacteria 544
830 nmdc:mga0sz30_8886_c1 3300050516 Bacteria 3490
831 Ga0495601_0018737 3300053077 Bacteria 4213
832 Ga0495601_0225651 3300053077 Bacteria 1224
833 Ga0495612_0024685 3300053078 Bacteria 2413
834 Ga0495612_0355342 3300053078 Bacteria 662
835 Ga0500635_0015025 3300053080 Bacteria 2279
836 Ga0500635_0085202 3300053080 Bacteria 1141
837 Ga0495595_0002948 3300053084 Bacteria 6717
838 Ga0495595_0002987 3300053084 Bacteria 6681
839 Ga0495595_0337851 3300053084 Bacteria 759
840 Ga0495595_0455923 3300053084 Bacteria 650
841 Ga0495619_0002940 3300053085 Bacteria 11071
842 Ga0495619_0031393 3300053085 Bacteria 3443
843 Ga0495619_0066330 3300053085 Bacteria 2408
844 Ga0500643_031303 3300053087 Bacteria 1624
845 Ga0500646_0132656 3300053090 Bacteria 811
846 Ga0500583_0537438 3300053092 Bacteria 545
847 Ga0500651_0177192 3300053093 Bacteria 1268
848 Ga0500651_0261944 3300053093 Bacteria 1002
849 Ga0500566_0013769 3300053094 Bacteria 4758
850 Ga0500566_0311371 3300053094 Bacteria 737
851 Ga0500641_0018278 3300053096 Bacteria 2635
852 Ga0500554_049285 3300053102 Bacteria 1320
853 Ga0500555_055218 3300053103 Bacteria 1079
854 Ga0500593_286131 3300053117 Bacteria 536
855 Ga0500594_0134765 3300053118 Bacteria 785
856 Ga0500595_001972 3300053119 Bacteria 10531
857 Ga0500595_012703 3300053119 Bacteria 3247
858 Ga0500608_020498 3300053122 Bacteria 3041
859 Ga0500621_232020 3300053126 Bacteria 632
860 Ga0500642_0056899 3300053130 Bacteria 1744
861 Ga0500655_018441 3300053133 Bacteria 1296
862 Ga0500655_122012 3300053133 Bacteria 553
863 Ga0500658_0242962 3300053134 Bacteria 827
864 Ga0500568_0008843 3300053139 Bacteria 4824
865 Ga0500568_0177363 3300053139 Bacteria 784
866 Ga0500577_0543442 3300053142 Bacteria 507
867 Ga0500588_0077131 3300053146 Bacteria 1107
868 Ga0500589_108820 3300053147 Bacteria 1192
869 Ga0500589_141912 3300053147 Bacteria 989
870 Ga0500603_000823 3300053150 Bacteria 7417
871 Ga0500604_0018278 3300053151 Bacteria 1952
872 Ga0500622_0197267 3300053156 Bacteria 918
873 Ga0500638_000097 3300053162 Bacteria 16132
874 Ga0500636_0035467 3300053177 Bacteria 2952
875 Ga0500636_0137106 3300053177 Bacteria 1358
876 Ga0500636_0547882 3300053177 Bacteria 501
877 Ga0500637_0001475 3300053178 Bacteria 10029
878 Ga0500611_178227 3300053727 Bacteria 595
879 Ga0500645_115051 3300053730 Bacteria 753
880 Ga0500609_012998 3300053731 Bacteria 1127
881 Ga0501084_0099316 3300054114 Bacteria 2444
882 Ga0500661_000409 3300055283 Bacteria 7932
883 Ga0501082_0001489 3300060353 Bacteria 20609
884 Ga0501082_0074783 3300060353 Bacteria 2918
885 Ga0501082_1633533 3300060353 Bacteria 563
886 2509368212 2509276018 Bacteria 6910194
887 2513659655 2513237096 Bacteria 8722461
888 2513691721 2513237101 Bacteria 7952346
889 2513862682 2513237137 Bacteria 9558895
890 2513921625 2513237145 Bacteria 8979722
891 2644004643 2643221599 Bacteria 6292121
892 2644196846 2643221634 Bacteria 6705461
893 2644237448 2643221643 Bacteria 5749658
894 2644305073 2643221654 Bacteria 5273570
895 2688598064 2687453392 Bacteria 6880454
896 2723845867 2721755755 Bacteria 8322773
897 2793073765 2791355197 Bacteria 8420563
898 2793081829
899 2856333776 2856328259 Bacteria 6528202
900 2856338166 2856334872 Bacteria 7037011
901 2857369642 2857367948 Bacteria 6965560
902 2869169473 2869169390 Bacteria 6659796
903 2869237095 2869234852 Bacteria 6654993
904 2869246261 2869242130 Bacteria 6609239
905 2869250392 2869249662 Bacteria 6868783
906 2869268771 2869264136 Bacteria 6880765
907 2869272273 2869271264 Bacteria 6908218
908 2871465113 2871459585 Bacteria 6866887
909 2871486251 2871481445 Bacteria 6700002
910 2874114071 2874109183 Bacteria 6517025
911 2874117421 2874116593 Bacteria 6674494
912 2874132583 2874131515 Bacteria 6820270
913 2874165158 2874162495 Bacteria 6174670
914 2874609488 2874604998 Bacteria 7834745
915 2876390562 2876386047 Bacteria 6698674
916 2876404901 2876399893 Bacteria 6927900
917 2876411577 2876406927 Bacteria 6191900
918 2876421353 2876420981 Bacteria 6687741
919 2876808934 2876808645 Bacteria 8824342
920 2878737416 2878730984 Bacteria 6380721
921 2878779448 2878774303 Bacteria 6108671
922 2878782899 2878781027 Bacteria 6834456
923 2879110276 2879110137 Bacteria 8907982
924 2889040711 2889033259 Bacteria 9099371
925 2894818196 2894817345 Bacteria 4892941
926 2894820040 2894817345 Bacteria 4892941
927 2903515211 2903513507 Bacteria 6344008
928 2903754837 2903748898 Bacteria 9972761
929 2906367609 2906363423 Bacteria 6856682
930 2906370930 2906370794 Bacteria 6881062
931 2906391357 2906386501 Bacteria 5977019
932 2906398592 2906393657 Bacteria 6790866
933 2906407181 2906401398 Bacteria 6693206
934 2906413577 2906408224 Bacteria 6162342
935 2906429025 2906427513 Bacteria 6375796
936 2906636084 2906635258 Bacteria 8601019
937 2906665781 2906660503 Bacteria 8595048
938 2908743742 2908739725 Bacteria 8628932
939 2922157829 2922151315 Bacteria 6902399
940 2922176726 2922172374 Bacteria 6167644
941 2922179133 2922178524 Bacteria 6025201
942 2922367810 2922361189 Bacteria 7436256
943 2922392288 2922386360 Bacteria 7017218
944 2922429128
945 2924717825 2924710171 Bacteria 6752351
946 2924747335 2924741084 Bacteria 6661321
947 2924752276 2924748358 Bacteria 6154725
948 2935634280 2935630451 Bacteria 8169952
949 2937862409 2937861824 Bacteria 6660327
950 2937876008 2937868953 Bacteria 6639878
951 2941511170 2941507105 Bacteria 8166816
952 2941518554 2941515067 Bacteria 8166720
953 2941527183 2941523033 Bacteria 8169134
954 2941531065 2941531003 Bacteria 7653939
955 2958127488 2958122699 Bacteria 7280457
956 2958138767 2958137437 Bacteria 6050276
957 2958162232 2958158011 Bacteria 6058449
958 2961141978 2961136820 Bacteria 6775228
959 2961172181 2961170736 Bacteria 7072258
960 2961187455 2961183825 Bacteria 6688536
961 2965026069 2965025482 Bacteria 6532201
962 2965040009 2965032056 Bacteria 6887443
963 2965041457 2965040258 Bacteria 6855979
964 2965052579 2965047637 Bacteria 6623551
965 2965090063 2965089291 Bacteria 6866420
966 2965104587 2965102966 Bacteria 6800987
967 2965115690 2965110997 Bacteria 6693150
968 2970504779 2970503327 Bacteria 7099517
969 2970513673 2970510686 Bacteria 7006402
970 2970538701 2970532167 Bacteria 6553173
971 2970551763 2970547951 Bacteria 6931819
972 2970627490 2970627176 Bacteria 6680862
973 2977857345 2977851361 Bacteria 6694324
974 2977877827 2977872689 Bacteria 7270173
975 2977903830 2977898635 Bacteria 6675551
976 2977907646 2977907340 Bacteria 6577984
977 2977918859 2977915119 Bacteria 6829656
978 2977936653 2977935797 Bacteria 6252826
979 2977951084 2977950692 Bacteria 6893264
980 2977959914 2977957713 Bacteria 6877875
981 2979771244 2979764755 Bacteria 6610066
982 2979773414 2979772303 Bacteria 6618277
983 2979793230 2979793036 Bacteria 6808957
984 2979809416 2979808191 Bacteria 7179355
985 2987646241 2987645492 Bacteria 6117018
986 2987674685 2987673487 Bacteria 6884027
987 3004168376 3004167301 Bacteria 8330599
988 3004199385 3004195979 Bacteria 6776956
989 3004239447 3004232784 Bacteria 6662140
990 3004240030 3004239961 Bacteria 6892290
991 3005456599 3005452660 Bacteria 5889319
992 3005479298 3005474847 Bacteria 9259049
993 649872599 649633066 Bacteria 6690028
994 8004304068 8004300914 Bacteria 6132239
995 8004315650 8004312739 Bacteria 7444653
996 8004365172 8004361976 Bacteria 6858373
997 8004701601 8004695233 Bacteria 6731676
998 8004733241 8004727605 Bacteria 6643904
999 8006968649 8006964411 Bacteria 8966052
1000 8006990409 8006984368 Bacteria 9651211
1001 8006996371 8006994254 Bacteria 8309700
1002 8019557762 8019555841 Bacteria 9642137
1003 8056674688 8056673599 Bacteria 7871253
1004 8056690539 8056689827 Bacteria 6712655
1005 Ga0105248_10693242
1006 JGI24740J21852_10039356
1007 JGI24739J22299_10025701
1008 JGI24737J22298_10032210
1009 JGI24735J21928_10096102
1010 JGI24738J21930_10055845
1011 JGI25404J52841_10028295
1012 Ga0070658_10502921
1013 Ga0070658_11234264
1014 Ga0070676_10392278
1015 Ga0070683_101070301
1016 Ga0070683_101080154
1017 Ga0070690_100063676
1018 Ga0068869_100015866
1019 Ga0068869_100150162
1020 Ga0068869_100525783
1021 Ga0070680_100085528
1022 Ga0070680_100174899
1023 Ga0070680_100394192
1024 Ga0070682_101469809
1025 Ga0068868_100133434
1026 Ga0068868_100401660
1027 Ga0068868_100541615
1028 Ga0070660_100061272
1029 Ga0070660_100086099
1030 Ga0070660_100116666
1031 Ga0070660_100222100
1032 Ga0070660_100225123
1033 Ga0070691_10880330
1034 Ga0070687_100113193
1035 Ga0070661_100082671
1036 Ga0070661_100188537
1037 Ga0070668_100044770
1038 Ga0070668_100406470
1039 Ga0070668_100519621
1040 Ga0070675_100202571
1041 Ga0070675_100789664
1042 Ga0070671_100644649
1043 Ga0070671_101352222
1044 Ga0070674_100030526
1045 Ga0070674_100489911
1046 Ga0070673_100064592
1047 Ga0070673_100389664
1048 Ga0070688_100220007
1049 Ga0070659_100467564
1050 Ga0070659_100877986
1051 Ga0070714_100038907
1052 Ga0070714_100951059
1053 Ga0070713_100008997
1054 Ga0070713_100025614
1055 Ga0070710_10001323
1056 Ga0070701_10016381
1057 Ga0070711_100040022
1058 Ga0070711_100073013
1059 Ga0070711_100965594
1060 Ga0070705_100580887
1061 Ga0070700_100159450
1062 Ga0070700_100209452
1063 Ga0070700_101574484
1064 Ga0070663_100004927
1065 Ga0070663_100123312
1066 Ga0070678_100021934
1067 Ga0070662_100033210
1068 Ga0070662_100055790
1069 Ga0070681_10126301
1070 Ga0070681_10412005
1071 Ga0070681_10507344
1072 Ga0070681_10688752
1073 Ga0068867_100038760
1074 Ga0068867_100794163
1075 Ga0070698_100549219
1076 Ga0070679_100040704
1077 Ga0070679_100266373
1078 Ga0070679_101419413
1079 Ga0070684_100213388
1080 Ga0070697_100632260
1081 Ga0068853_100014558
1082 Ga0068853_100066019
1083 Ga0068853_100141321
1084 Ga0068853_100160826
1085 Ga0068853_100216451
1086 Ga0068853_100342322
1087 Ga0068853_100750060
1088 Ga0070672_100013720
1089 Ga0070695_100303691
1090 Ga0070695_100856482
1091 Ga0070693_100180431
1092 Ga0070693_100246710
1093 Ga0070665_100071088
1094 Ga0070665_100134870
1095 Ga0070665_100367902
1096 Ga0070704_100226455
1097 Ga0068855_100066543
1098 Ga0068855_100097944
1099 Ga0068855_100163435
1100 Ga0068855_100277969
1101 Ga0068855_102180026
1102 Ga0068857_100010083
1103 Ga0068857_100016903
1104 Ga0068857_100180444
1105 Ga0068857_100568753
1106 Ga0068854_100009252
1107 Ga0068854_100011841
1108 Ga0068854_100198165
1109 Ga0068856_100005753
1110 Ga0068856_100006749
1111 Ga0068856_100037307
1112 Ga0068856_100244928
1113 Ga0070702_100347086
1114 Ga0068852_100088878
1115 Ga0068852_100190699
1116 Ga0068852_100382459
1117 Ga0068859_100801071
1118 Ga0068859_100873993
1119 Ga0068866_10061021
1120 Ga0068866_10429840
1121 Ga0068861_100060839
1122 Ga0068861_100271472
1123 Ga0068851_10016691
1124 Ga0068851_10071614
1125 Ga0068863_100142543
1126 Ga0068863_100337552
1127 Ga0068863_100361190
1128 Ga0068858_100064822
1129 Ga0068858_100805092
1130 Ga0068858_101441449
1131 Ga0068860_100124217
1132 Ga0068860_100238253
1133 Ga0068860_100530726
1134 Ga0068862_100137129
1135 Ga0068862_100224621
1136 Ga0068862_100957387
1137 Ga0068862_101645670
1138 Ga0081455_10003355
1139 Ga0081455_10007167
1140 Ga0081455_10021699
1141 Ga0081538_10115446
1142 Ga0081538_10142378
1143 Ga0081540_1001032
1144 Ga0081540_1002786
1145 Ga0081540_1002954
1146 Ga0081540_1007525
1147 Ga0081540_1007738
1148 Ga0081540_1014291
1149 Ga0081540_1016193
1150 Ga0081540_1137261
1151 Ga0081540_1192691
1152 Ga0081540_1318452
1153 Ga0081539_10018493
1154 Ga0081539_10023497
1155 Ga0070717_10017140
1156 Ga0070717_11434177
1157 Ga0075365_10003538
1158 Ga0075365_10022932
1159 Ga0075365_10057275
1160 Ga0075365_10274031
1161 Ga0075368_10164869
1162 Ga0075363_100001158
1163 Ga0075363_100637246
1164 Ga0075364_10096159
1165 Ga0075364_10115052
1166 Ga0075364_11199133
1167 Ga0070715_10007268
1168 Ga0070716_100181083
1169 Ga0070716_100181223
1170 Ga0070716_100193743
1171 Ga0070712_100094123
1172 Ga0070712_100215277
1173 Ga0070712_100293346
1174 Ga0075362_10038749
1175 Ga0075362_10045644
1176 Ga0075362_10471014
1177 Ga0075367_10101088
1178 Ga0075367_10174758
1179 Ga0075367_10187400
1180 Ga0075367_10196244
1181 Ga0075367_10613399
1182 Ga0075369_10047677
1183 Ga0075369_10098844
1184 Ga0075369_10309963
1185 Ga0075369_10321822
1186 Ga0075366_10339278
1187 Ga0075366_10368691
1188 Ga0097621_100358989
1189 Ga0097621_102085031
1190 Ga0075370_10729755
1191 Ga0068871_100389943
1192 Ga0068871_101152032
1193 Ga0068871_102110222
1194 Ga0075428_100192302
1195 Ga0075428_100441443
1196 Ga0075431_100499532
1197 Ga0075431_101190209
1198 Ga0075434_101486478
1199 Ga0068865_100091161
1200 Ga0097620_100801105
1201 Ga0097620_100873973
1202 Ga0099794_10030428
1203 Ga0099795_10023693
1204 Ga0099795_10093986
1205 Ga0099795_10127485
1206 Ga0105251_10590333
1207 Ga0105250_10160153
1208 Ga0105240_10002409
1209 Ga0105240_10053294
1210 Ga0105240_10328284
1211 Ga0111539_10650228
1212 Ga0111539_13149324
1213 Ga0105245_10220241
1214 Ga0105245_10713389
1215 Ga0105245_11837056
1216 Ga0105245_11908235
1217 Ga0105247_10449358
1218 Ga0105247_10544544
1219 Ga0114129_10103659
1220 Ga0114129_11289216
1221 Ga0105243_10067114
1222 Ga0105241_10000269
1223 Ga0105241_10162189
1224 Ga0105241_10339732
1225 Ga0105242_10347345
1226 Ga0105242_10937885
1227 Ga0105242_11430405
1228 Ga0105242_12469319
1229 Ga0105248_10025744
1230 Ga0105248_10956650
1231 Ga0105237_10059189
1232 Ga0105237_10090547
1233 Ga0105237_10154856
1234 Ga0105237_10160768
1235 Ga0105237_10746115
1236 Ga0105237_11158257
1237 Ga0105238_10010406
1238 Ga0105238_10103450
1239 Ga0105238_10133209
1240 Ga0105238_10201611
1241 Ga0105249_10302364
1242 Ga0105249_10685830
1243 Ga0099796_10123283
1244 Ga0105239_10044037
1245 Ga0105239_10054941
1246 Ga0105239_10102818
1247 Ga0105239_10319121
1248 Ga0105239_10402831
1249 Ga0105239_10532559
1250 Ga0105239_11065269
1251 Ga0105239_11823925
1252 Ga0105246_10045143
1253 Ga0105246_10413571
1254 Ga0157315_1025224
1255 Ga0157370_10093663
1256 Ga0157370_10097046
1257 Ga0157369_10124140
1258 Ga0157374_12068387
1259 Ga0157378_10010051
1260 Ga0157378_10303715
1261 Ga0157378_10429977
1262 Ga0157372_12238683
1263 Ga0157375_10607109
1264 Ga0163163_10270859
1265 Ga0163163_10305046
1266 Ga0157380_10113233
1267 Ga0157377_10383155
1268 Ga0157379_10479951
1269 Ga0157379_11054582
1270 Ga0157379_11373587
1271 Ga0157379_11453851
1272 Ga0157376_10390515
1273 Ga0157376_10827621
1274 Ga0163161_10049232
1275 Ga0209233_1008120
1276 Ga0209130_1016398
1277 Ga0209025_1141824
1278 Ga0209758_1007398
1279 Ga0209758_1017972
1280 Ga0207656_10040888
1281 Ga0207696_1039036
1282 Ga0207692_10004070
1283 Ga0207692_10558515
1284 Ga0207710_10466672
1285 Ga0207647_10001356
1286 Ga0207685_10031395
1287 Ga0207685_10117865
1288 Ga0207685_10817564
1289 Ga0207699_10699720
1290 Ga0207645_10327453
1291 Ga0207645_10366252
1292 Ga0207643_10028299
1293 Ga0207705_10141242
1294 Ga0207705_10244138
1295 Ga0207684_10726795
1296 Ga0207654_10000939
1297 Ga0207654_10046765
1298 Ga0207654_10191788
1299 Ga0207707_10050546
1300 Ga0207707_10083424
1301 Ga0207707_10167047
1302 Ga0207695_10002086
1303 Ga0207695_10043865
1304 Ga0207695_10135037
1305 Ga0207695_10331588
1306 Ga0207695_10479059
1307 Ga0207671_10219619
1308 Ga0207671_10311669
1309 Ga0207671_10461312
1310 Ga0207671_10500052
1311 Ga0207671_10521926
1312 Ga0207693_10000606
1313 Ga0207693_10036058
1314 Ga0207693_10280141
1315 Ga0207693_10690195
1316 Ga0207663_10002328
1317 Ga0207663_10476393
1318 Ga0207663_11341508
1319 Ga0207660_10193176
1320 Ga0207660_10214610
1321 Ga0207660_10705187
1322 Ga0207657_10004938
1323 Ga0207657_10074968
1324 Ga0207657_10312593
1325 Ga0207649_10057376
1326 Ga0207649_10312202
1327 Ga0207652_10070088
1328 Ga0207652_10094481
1329 Ga0207652_10254030
1330 Ga0207652_10570276
1331 Ga0207681_10412901
1332 Ga0207681_10734383
1333 Ga0207681_11559212
1334 Ga0207694_10000787
1335 Ga0207694_10006017
1336 Ga0207694_10353373
1337 Ga0207694_10426042
1338 Ga0207694_10897978
1339 Ga0207659_10520616
1340 Ga0207687_10032210
1341 Ga0207687_10056507
1342 Ga0207687_10815856
1343 Ga0207700_10031994
1344 Ga0207700_10163092
1345 Ga0207664_10095218
1346 Ga0207644_10799177
1347 Ga0207644_11532845
1348 Ga0207690_10164100
1349 Ga0207690_10676852
1350 Ga0207706_10448498
1351 Ga0207686_10449407
1352 Ga0207686_10554599
1353 Ga0207686_10557231
1354 Ga0207709_10030165
1355 Ga0207709_10781365
1356 Ga0207670_10302307
1357 Ga0207669_11785916
1358 Ga0207704_10398232
1359 Ga0207704_11921229
1360 Ga0207665_10123226
1361 Ga0207665_10240072
1362 Ga0207665_10690951
1363 Ga0207691_10099702
1364 Ga0207711_10039722
1365 Ga0207689_10084226
1366 Ga0207689_10162653
1367 Ga0207689_10195132
1368 Ga0207689_10333873
1369 Ga0207661_10660984
1370 Ga0207679_11099542
1371 Ga0207667_10022739
1372 Ga0207667_10042826
1373 Ga0207667_10063877
1374 Ga0207667_10121508
1375 Ga0207667_10150794
1376 Ga0207667_11765857
1377 Ga0207651_10254224
1378 Ga0207712_10218668
1379 Ga0207712_11003775
1380 Ga0207712_11565211
1381 Ga0207712_11692182
1382 Ga0207668_10089610
1383 Ga0207668_10491171
1384 Ga0207640_10287731
1385 Ga0207640_10551976
1386 Ga0207640_10762162
1387 Ga0207658_10310580
1388 Ga0207677_10167755
1389 Ga0207677_10810989
1390 Ga0207677_11702432
1391 Ga0207703_10060442
1392 Ga0207703_10999509
1393 Ga0207639_10014324
1394 Ga0207639_10110463
1395 Ga0207639_10160502
1396 Ga0207639_10191860
1397 Ga0207639_10461700
1398 Ga0207639_10864525
1399 Ga0207639_11701219
1400 Ga0207639_12206645
1401 Ga0207678_10005558
1402 Ga0207678_10036066
1403 Ga0207678_10062772
1404 Ga0207678_10089061
1405 Ga0207678_10128449
1406 Ga0207708_10096720
1407 Ga0207708_10214763
1408 Ga0207708_10672006
1409 Ga0207708_10778587
1410 Ga0207702_10000005
1411 Ga0207702_10031505
1412 Ga0207702_10127557
1413 Ga0207702_10512867
1414 Ga0207641_10105754
1415 Ga0207641_10275382
1416 Ga0207641_10484064
1417 Ga0207641_11585182
1418 Ga0207648_10032444
1419 Ga0207648_10207585
1420 Ga0207648_10211914
1421 Ga0207676_10883131
1422 Ga0207674_10003061
1423 Ga0207674_10003961
1424 Ga0207674_10160125
1425 Ga0207674_10569803
1426 Ga0207675_100161351
1427 Ga0207675_100191005
1428 Ga0207675_100231314
1429 Ga0207675_100465667
1430 Ga0207675_100987564
1431 Ga0207683_10270371
1432 Ga0207683_10405285
1433 Ga0207683_10462526
1434 Ga0207698_10314657
1435 Ga0207698_10805407
1436 Ga0207698_11106538
1437 Ga0209179_1009585
1438 Ga0209179_1018187
1439 Ga0209179_1123476
1440 Ga0209588_1001806
1441 Ga0209813_10031797
1442 Ga0268266_10001654
1443 Ga0268266_10016919
1444 Ga0268266_10027234
1445 Ga0268266_10223640
1446 Ga0268265_10017287
1447 Ga0268265_10197398
1448 Ga0268265_10402679
1449 Ga0268265_10598452
1450 Ga0268265_10754747
1451 Ga0268264_10288745
1452 Ga0268264_10704182
1453 Ga0268264_10946004
1454 Ga0307515_10012760
1455 Ga0265773_1020391
1456 Ga0265330_10160351
1457 Ga0265330_10251092
1458 Ga0265332_10063963
1459 Ga0265325_10019623
1460 Ga0265339_10020279
1461 Ga0265316_10359021
1462 Ga0265316_10580821
1463 Ga0307509_10031263
1464 Ga0307408_101130381
1465 Ga0265313_10288400
1466 Ga0307508_10000010
1467 Ga0307516_10649299
1468 Ga0307405_10914521
1469 Ga0307410_11631805
1470 Ga0307406_10948202
1471 Ga0307412_10401618
1472 Ga0307416_100183653
1473 Ga0307416_100301559
1474 Ga0307416_101077458
1475 Ga0307411_10259134
1476 Ga0307415_100259304
1477 Ga0316593_10171051
1478 Ga0307510_10046716
1479 Ga0307510_10093090
1480 Ga0307510_10098623
1481 Ga0307510_10166514
1482 Ga0307510_10357640
1483 Ga0373926_0181052
1484 Ga0373951_0211713
1485 Ga0373923_0045638
1486 Ga0373923_0275751
1487 Ga0373936_0011900
1488 Ga0373936_0191091
1489 Ga0373945_0070598
1490 Ga0373953_0012681
1491 Ga0373953_0014657
1492 Ga0373953_0048566
1493 Ga0373954_0005242
1494 Ga0373954_0024546
1495 Ga0373954_0037892
1496 Ga0373956_0031781
1497 Ga0373956_0119763
1498 Ga0373957_0006606
1499 Ga0373957_0189047
1500 Ga0373957_0217889
1501 Ga0373957_0368905
1502 Ga0373943_0011889
1503 Ga0373943_0114082
1504 Ga0373943_0557411
1505 Ga0373946_0048934
1506 Ga0373955_0000832
1507 Ga0373955_0004930
1508 Ga0373955_0106746
1509 Ga0373955_0208411
1510 Ga0316574_0425879
1511 Ga0373924_0013131
1512 Ga0373935_0021078
1513 Ga0373935_0147869
1514 Ga0373927_0003926
1515 Ga0373927_0016694
1516 Ga0373927_0034763
1517 Ga0373927_0307434
1518 Ga0373933_0010086
1519 Ga0373933_0105608
1520 Ga0373933_0150299
1521 Ga0373933_0169990
1522 Ga0373947_0037519
1523 Ga0373947_0176306
1524 Ga0373947_0380379
1525 Ga0373937_0018236
1526 Ga0373937_0050091
1527 Ga0373937_0063209
1528 Ga0373937_0243475
1529 Ga0373925_0016994
1530 Ga0373925_0266880
1531 Ga0373925_1348682
1532 Ga0395905_0392844
1533 Ga0436363_0272408
1534 Ga0439465_0143183
1535 Ga0439465_0297463
1536 Ga0451807_1470248
1537 Ga0451849_0602933
1538 Ga0439458_0041325
1539 Ga0466969_0208002
1540 Ga0466966_0613919
1541 Ga0495617_272558
1542 Ga0495592_0035763
1543 Ga0495592_0040324
1544 Ga0495592_0094913
1545 Ga0495592_0216970
1546 Ga0495603_0000268
1547 Ga0495603_0180142
1548 Ga0495603_0277437
1549 Ga0495590_0059740
1550 Ga0495629_0007385
1551 Ga0495629_0028347
1552 Ga0495629_0070005
1553 Ga0495638_0066555
1554 Ga0495638_0145621
1555 Ga0495638_0575385
1556 Ga0495641_0009139
1557 Ga0495651_0003335
1558 Ga0495651_0102482
1559 Ga0495653_0027255
1560 Ga0495653_0091279
1561 Ga0495653_0097006
1562 Ga0495653_0136900
1563 Ga0495580_0005773
1564 Ga0495580_0082544
1565 Ga0495582_0000859
1566 Ga0495605_0036223
1567 Ga0495605_0224290
1568 Ga0495605_0259888
1569 Ga0495605_0405758
1570 Ga0495639_0003304
1571 Ga0495639_0051940
1572 Ga0495662_0000532
1573 Ga0495664_0094081
1574 Ga0495664_0288813
1575 Ga0495584_0082493
1576 Ga0495584_0214199
1577 Ga0495584_0492730
1578 Ga0495584_0552713
1579 Ga0495585_0064209
1580 Ga0495585_0098221
1581 Ga0495585_0130179
1582 Ga0495585_0329469
1583 Ga0495594_0005520
1584 Ga0495594_0024294
1585 Ga0495583_0419130
1586 Ga0495606_0222278
1587 Ga0495608_0003075
1588 Ga0495608_0026213
1589 Ga0495608_0182392
1590 Ga0495608_0682077
1591 Ga0495610_0055856
1592 Ga0495610_0097071
1593 Ga0495616_0047702
1594 Ga0495616_0283387
1595 Ga0495618_0123442
1596 Ga0495618_0358892
1597 Ga0495620_0164270
1598 Ga0495620_0404592
1599 Ga0495628_0010946
1600 Ga0495628_0024219
1601 Ga0495628_0094075
1602 Ga0495628_0146896
1603 Ga0495630_0074406
1604 Ga0495630_0078147
1605 Ga0495631_0133650
1606 Ga0495632_0002414
1607 Ga0495632_0019960
1608 Ga0495632_0097927
1609 Ga0495632_0197435
1610 Ga0495643_0307842
1611 Ga0495648_0364864
1612 Ga0495663_0204514
1613 Ga0495666_0020759
1614 Ga0495666_0114864
1615 Ga0495642_0259619
1616 Ga0495652_0018734
1617 Ga0495652_0037745
1618 Ga0495652_0132317
1619 Ga0495665_0000767
1620 Ga0495640_0031306
1621 Ga0495640_0032585
1622 Ga0495640_0133148
1623 Ga0495587_0006327
1624 Ga0495587_0012511
1625 Ga0495598_0016628
1626 Ga0495598_0123010
1627 Ga0495609_0206935
1628 Ga0495621_0083181
1629 Ga0495621_0380724
1630 Ga0495597_0249008
1631 Ga0495645_0107473
1632 Ga0495622_0022695
1633 Ga0495622_0067684
1634 Ga0495633_0056720
1635 Ga0495667_0007813
1636 Ga0495667_0024399
1637 Ga0495667_0047636
1638 Ga0495667_0049238
1639 Ga0495656_0027781
1640 Ga0495656_0057578
1641 Ga0495668_0100762
1642 Ga0495668_0115598
1643 Ga0495668_0297796
1644 Ga0495668_0551605
1645 Ga0495634_0002413
1646 Ga0495634_0221303
1647 Ga0495611_0094648
1648 Ga0495625_0120457
1649 Ga0495625_0217238
1650 Ga0495625_0529063
1651 Ga0495625_0698981
1652 Ga0495625_0865922
1653 Ga0495635_0004552
1654 Ga0495635_0006411
1655 Ga0495635_0193994
1656 Ga0495635_0616865
1657 Ga0495659_0048856
1658 Ga0495657_0016091
1659 Ga0495657_0056812
1660 Ga0495657_0097906
1661 Ga0495657_0132611
1662 Ga0495599_0003165
1663 Ga0495599_0043317
1664 Ga0495599_0121300
1665 Ga0495623_0004325
1666 Ga0495623_0068738
1667 Ga0495623_0101208
1668 Ga0495646_0046766
1669 Ga0495646_0050281
1670 Ga0495646_0052340
1671 Ga0495647_0013145
1672 Ga0495658_0000767
1673 Ga0495669_0045236
1674 Ga0495669_0117430
1675 Ga0495613_0010961
1676 Ga0495624_0001338
1677 Ga0495624_0144662
1678 Ga0495670_0018097
1679 Ga0495671_0380404
1680 Ga0495649_0001498
1681 Ga0495649_0275004
1682 Ga0495649_0337183
1683 Ga0495589_0218019
1684 Ga0495600_0012913
1685 Ga0495600_0108236
1686 Ga0495660_0414413
1687 Ga0495581_0003234
1688 Ga0495604_0007942
1689 Ga0495604_0019868
1690 Ga0495604_0025065
1691 Ga0495604_0233069
1692 Ga0495674_0012712
1693 Ga0495674_0032060
1694 Ga0495674_0399883
1695 Ga0495672_0024775
1696 Ga0495676_0014180
1697 Ga0495676_0040532
1698 Ga0495676_0419906
1699 Ga0495680_0003133
1700 Ga0495680_0013071
1701 Ga0495680_0128980
1702 Ga0495680_0437219
1703 Ga0495683_0145403
1704 Ga0495683_0182629
1705 Ga0495675_0001752
1706 Ga0495675_0235905
1707 Ga0495677_0159219
1708 Ga0495685_289365
1709 Ga0495673_0041572
1710 Ga0495681_0122820
1711 Ga0495684_0016251
1712 Ga0495684_0097622
1713 Ga0495686_0305714
1714 Ga0495686_0308391
1715 Ga0495686_0538970
1716 Ga0495593_0000895
1717 Ga0495593_0024499
1718 Ga0495602_0028085
1719 Ga0495602_0044259
1720 Ga0495602_0201565
1721 Ga0495602_0211698
1722 Ga0495615_0100106
1723 Ga0495626_0037084
1724 Ga0496100_0327158
1725 Ga0496101_0116047
1726 Ga0496101_0201888
1727 Ga0496101_0919581
1728 Ga0496102_0117237
1729 Ga0496102_0141606
1730 Ga0496102_0159894
1731 Ga0496102_0584356
1732 Ga0496102_1224779
1733 Ga0496103_0340209
1734 Ga0496103_0606787
1735 Ga0496104_0309352
1736 Ga0496104_0549781
1737 Ga0496106_0031798
1738 Ga0496106_0128742
1739 Ga0496106_0302429
1740 Ga0496107_0118103
1741 Ga0496107_0189234
1742 Ga0496107_0697923
1743 Ga0496107_0736496
1744 Ga0496108_0012011
1745 Ga0496108_1170925
1746 Ga0496109_0130718
1747 Ga0496109_0623238
1748 Ga0496110_0302033
1749 Ga0496111_0239967
1750 Ga0496112_0381580
1751 Ga0496114_0057676
1752 Ga0496114_0511281
1753 Ga0496114_0795974
1754 Ga0496114_1311492
1755 Ga0496115_0114630
1756 Ga0496115_0324781
1757 Ga0496116_0507073
1758 Ga0496118_0113989
1759 Ga0496119_0216375
1760 Ga0496119_0342549
1761 Ga0496120_0526299
1762 Ga0496121_0053802
1763 Ga0496121_0092789
1764 Ga0496121_0114308
1765 Ga0496121_0244925
1766 Ga0496121_0299343
1767 Ga0496121_0594884
1768 Ga0496121_0835977
1769 Ga0496124_0066593
1770 Ga0496124_0196854
1771 Ga0496124_0248340
1772 Ga0496124_0269971
1773 Ga0496125_0075993
1774 Ga0496125_0346126
1775 Ga0496126_0004492
1776 Ga0496126_0168207
1777 Ga0496126_1170224
1778 Ga0495682_0167319
1779 Ga0501034_0000008
1780 Ga0501036_0085643
1781 Ga0501037_0116845
1782 Ga0501040_0909939
1783 Ga0501043_0204329
1784 Ga0501046_0690777
1785 Ga0501047_0022031
1786 Ga0501048_0000873
1787 Ga0501067_0058463
1788 Ga0501067_0069336
1789 Ga0501067_0751787
1790 Ga0501069_0201618
1791 Ga0501073_0255321
1792 Ga0501076_0672184
1793 Ga0501080_0957542
1794 Ga0501035_0023233
1795 Ga0501044_0000004
1796 Ga0501044_0043557
1797 nmdc:mga03683_11827_c1
1798 nmdc:mga03683_9498_c1
1799 nmdc:mga03n38_5472_c1
1800 nmdc:mga00v17_128557_c1
1801 nmdc:mga00v17_354330_c1
1802 nmdc:mga0yw44_277686_c1
1803 nmdc:mga0yw44_313242_c1
1804 nmdc:mga0yw44_388730_c1
1805 nmdc:mga0yw44_43537_c1
1806 nmdc:mga0yw44_522883_c1
1807 nmdc:mga0yw44_90618_c1
1808 nmdc:mga0yw44_92292_c1
1809 nmdc:mga0k408_466705_c1
1810 nmdc:mga0k408_90781_c2
1811 nmdc:mga06z11_155256_c1
1812 nmdc:mga06z11_162328_c1
1813 nmdc:mga06z11_246974_c1
1814 nmdc:mga06z11_516882_c1
1815 nmdc:mga06z11_945793_c1
1816 nmdc:mga04h51_37804_c1
1817 nmdc:mga04h51_506498_c1
1818 nmdc:mga07m45_16924_c1
1819 nmdc:mga07m45_388601_c1
1820 nmdc:mga07m45_400531_c1
1821 nmdc:mga07m45_47787_c1
1822 nmdc:mga07m45_53539_c1
1823 nmdc:mga07m45_693764_c1
1824 nmdc:mga07m45_743336_c1
1825 nmdc:mga05p37_367396_c1
1826 nmdc:mga05p37_703574_c1
1827 nmdc:mga05p37_99136_c1
1828 nmdc:mga09592_1065497_c1
1829 nmdc:mga09592_178764_c1
1830 nmdc:mga06r32_318358_c1
1831 nmdc:mga08y16_274932_c1
1832 nmdc:mga0sz30_269877_c1
1833 nmdc:mga0sz30_505717_c1
1834 nmdc:mga0sz30_8886_c1
1835 Ga0495601_0018737
1836 Ga0495601_0225651
1837 Ga0495612_0024685
1838 Ga0495612_0355342
1839 Ga0500635_0015025
1840 Ga0500635_0085202
1841 Ga0495595_0002948
1842 Ga0495595_0002987
1843 Ga0495595_0337851
1844 Ga0495595_0455923
1845 Ga0495619_0002940
1846 Ga0495619_0031393
1847 Ga0495619_0066330
1848 Ga0500643_031303
1849 Ga0500646_0132656
1850 Ga0500583_0537438
1851 Ga0500651_0177192
1852 Ga0500651_0261944
1853 Ga0500566_0013769
1854 Ga0500566_0311371
1855 Ga0500641_0018278
1856 Ga0500554_049285
1857 Ga0500555_055218
1858 Ga0500593_286131
1859 Ga0500594_0134765
1860 Ga0500595_001972
1861 Ga0500595_012703
1862 Ga0500608_020498
1863 Ga0500621_232020
1864 Ga0500642_0056899
1865 Ga0500655_018441
1866 Ga0500655_122012
1867 Ga0500658_0242962
1868 Ga0500568_0008843
1869 Ga0500568_0177363
1870 Ga0500577_0543442
1871 Ga0500588_0077131
1872 Ga0500589_108820
1873 Ga0500589_141912
1874 Ga0500603_000823
1875 Ga0500604_0018278
1876 Ga0500622_0197267
1877 Ga0500638_000097
1878 Ga0500636_0035467
1879 Ga0500636_0137106
1880 Ga0500636_0547882
1881 Ga0500637_0001475
1882 Ga0500611_178227
1883 Ga0500645_115051
1884 Ga0500609_012998
1885 Ga0501084_0099316
1886 Ga0500661_000409
1887 Ga0501082_0001489
1888 Ga0501082_0074783
1889 Ga0501082_1633533
1890 2509368212
1891 2513659655
1892 2513691721
1893 2513862682
1894 2513921625
1895 2644004643
1896 2644196846
1897 2644237448
1898 2644305073
1899 2688598064
1900 2723845867
1901 2793073765
1902 2793081829
1903 2856333776
1904 2856338166
1905 2857369642
1906 2869169473
1907 2869237095
1908 2869246261
1909 2869250392
1910 2869268771
1911 2869272273
1912 2871465113
1913 2871486251
1914 2874114071
1915 2874117421
1916 2874132583
1917 2874165158
1918 2874609488
1919 2876390562
1920 2876404901
1921 2876411577
1922 2876421353
1923 2876808934
1924 2878737416
1925 2878779448
1926 2878782899
1927 2879110276
1928 2889040711
1929 2894818196
1930 2894820040
1931 2903515211
1932 2903754837
1933 2906367609
1934 2906370930
1935 2906391357
1936 2906398592
1937 2906407181
1938 2906413577
1939 2906429025
1940 2906636084
1941 2906665781
1942 2908743742
1943 2922157829
1944 2922176726
1945 2922179133
1946 2922367810
1947 2922392288
1948 2922429128
1949 2924717825
1950 2924747335
1951 2924752276
1952 2935634280
1953 2937862409
1954 2937876008
1955 2941511170
1956 2941518554
1957 2941527183
1958 2941531065
1959 2958127488
1960 2958138767
1961 2958162232
1962 2961141978
1963 2961172181
1964 2961187455
1965 2965026069
1966 2965040009
1967 2965041457
1968 2965052579
1969 2965090063
1970 2965104587
1971 2965115690
1972 2970504779
1973 2970513673
1974 2970538701
1975 2970551763
1976 2970627490
1977 2977857345
1978 2977877827
1979 2977903830
1980 2977907646
1981 2977918859
1982 2977936653
1983 2977951084
1984 2977959914
1985 2979771244
1986 2979773414
1987 2979793230
1988 2979809416
1989 2987646241
1990 2987674685
1991 3004168376
1992 3004199385
1993 3004239447
1994 3004240030
1995 3005456599
1996 3005479298
1997 649872599
1998 8004304068
1999 8004315650
2000 8004365172
2001 8004701601
2002 8004733241
2003 8006968649
2004 8006990409
2005 8006996371
2006 8019557762
2007 8056674688
2008 8056690539

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

6

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9712 3 130
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9712 3 130
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9704 3 130
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.9699 3 130
1j9b-assembly1.cif.gz_A arsenate reductase+0.4m arsenite from e. coli 0.9641 3 130
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9641 3 130 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9499 3 113 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9286 3 130 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.918 3 113 3.40.30.10
af_D7SFI3_9_110_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8994 2 31 3.40.30.10
ID Description Score Start End GO Terms
AF-A4GVS0-F1-model_v4 ArsC 0.9942 28 106 GO:0046685
AF-A0A659UVR1-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.993 1 118 GO:0008794
GO:0046685
AF-A0A0A7KNS5-F1-model_v4 arsenate reductase (glutathione/glutaredoxin) (EC 1.20.4.1) 0.9923 14 130 GO:0008794
GO:0046685
AF-A0A1X1D7F2-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9917 2 117 GO:0008794
GO:0046685
AF-A0A2S9Q4E8-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9916 1 132 GO:0008794
GO:0046685

Map