F488002

General Info

Members Datasets Scaffolds Average Seq Length
1006 651 2012 251

Family's Representative Sequence

Representative Sequence 3300003856|Ga0058692_1012258|Ga0058692_10122583
Length 269
Sequence LSSGQDGNTPAQSMWIGIISLFPEMFSAITEYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQVGVCELATSEKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGKQASAEEDSFSEGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQAKLLKEFQKEFRRQHNDDGQSGQ

Samples

Sample ID Description Type Environment
1 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
72 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
73 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
74 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300023304 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 Metatranscriptome Rhizosphere
84 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
131 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
144 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
154 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
164 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
167 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
168 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
171 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
172 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
179 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
180 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
181 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
184 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
185 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
186 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
187 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
188 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
189 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
190 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
191 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
194 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
198 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
274 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
275 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
276 2506520008 Serratia plymuthica AS12 Isolate Unclassified
277 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
278 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
279 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
280 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
281 2511231004 Pseudomonas sp. GM102 Isolate Nodule
282 2511231007 Pseudomonas sp. GM18 Isolate Nodule
283 2511231008 Pseudomonas sp. GM21 Isolate Nodule
284 2511231010 Pseudomonas sp. GM25 Isolate Nodule
285 2511231011 Pseudomonas sp. GM30 Isolate Nodule
286 2511231012 Pseudomonas sp. GM33 Isolate Nodule
287 2511231014 Pseudomonas sp. GM48 Isolate Nodule
288 2511231016 Pseudomonas sp. GM50 Isolate Nodule
289 2511231017 Pseudomonas sp. GM55 Isolate Nodule
290 2511231018 Pseudomonas sp. GM60 Isolate Nodule
291 2511231019 Pseudomonas sp. GM67 Isolate Nodule
292 2511231020 Pseudomonas sp. GM74 Isolate Nodule
293 2511231021 Pseudomonas sp. GM78 Isolate Nodule
294 2511231022 Pseudomonas sp. GM79 Isolate Nodule
295 2511231024 Pseudomonas sp. GM84 Isolate Nodule
296 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
297 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
298 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
299 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
300 2547132181 Kosakonia sacchari SP1 Isolate Stem
301 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
302 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
303 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
304 2561511199 Enterobacter sp. R4-368 Isolate Nodule
305 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
306 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
307 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
308 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
309 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
310 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
311 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
312 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
313 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
314 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
315 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
316 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
317 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
318 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
319 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
320 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
321 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
322 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
323 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
324 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
325 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
326 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
327 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
328 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
329 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
330 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
331 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
332 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
333 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
334 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
335 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
336 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
337 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
338 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
339 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
340 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
341 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
342 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
343 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
344 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
345 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
346 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
347 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
348 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
349 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
350 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
351 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
352 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
353 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
354 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
355 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
356 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
357 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
358 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
359 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
360 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
361 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
362 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
363 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
364 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
365 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
366 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
367 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
368 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
369 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
370 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
371 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
372 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
373 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
374 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
375 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
376 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
377 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
378 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
379 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
380 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
381 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
382 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
383 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
384 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
385 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
386 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
387 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
388 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
389 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
390 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
391 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
392 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
393 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
394 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
395 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
396 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
397 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
398 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
399 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
400 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
401 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
402 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
403 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
404 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
405 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
406 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
407 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
408 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
409 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
410 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
411 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
412 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
413 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
414 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
415 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
416 2636415599 Klebsiella variicola DX120E Isolate Unclassified
417 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
418 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
419 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
420 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
421 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
422 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
423 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
424 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
425 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
426 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
427 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
428 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
429 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
430 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
431 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
432 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
433 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
434 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
435 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
436 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
437 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
438 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
439 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
440 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
441 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
442 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
443 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
444 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
445 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
446 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
447 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
448 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
449 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
450 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
451 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
452 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
453 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
454 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
455 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
456 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
457 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
458 2751185917 Enterobacter sp. HK169 Isolate Unclassified
459 2765235841 Pseudomonas putida AA7 Isolate Unclassified
460 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
461 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
462 2773857670 Pseudomonas sp. 478 Isolate Unclassified
463 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
464 2773857673 Pseudomonas sp. 443 Isolate Unclassified
465 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
466 2775507074 Klebsiella sp. D5A Isolate Unclassified
467 2784132063 Pseudomonas sp. 424 Isolate Unclassified
468 2784132072 Pseudomonas sp. 460 Isolate Unclassified
469 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
470 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
471 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
472 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
473 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
474 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
475 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
476 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
477 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
478 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
479 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
480 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
481 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
482 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
483 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
484 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
485 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
486 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
487 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
488 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
489 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
490 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
491 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
492 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
493 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
494 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
495 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
496 2821118458 Enterobacter asburiae 609 Isolate Unclassified
497 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
498 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
499 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
500 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
501 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
502 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
503 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
504 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
505 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
506 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
507 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
508 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
509 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
510 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
511 2847085930 Erwinia persicina B64 Isolate Bulb
512 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
513 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
514 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
515 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
516 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
517 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
518 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
519 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
520 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
521 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
522 2865014394 Pantoea sp. R-71966 Isolate Unclassified
523 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
524 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
525 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
526 2876601092 Pantoea endophytica 596 Isolate Unclassified
527 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
528 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
529 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
530 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
531 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
532 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
533 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
534 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
535 2904504865 Serratia marcescens 1822 Isolate Unclassified
536 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
537 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
538 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
539 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
540 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
541 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
542 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
543 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
544 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
545 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
546 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
547 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
548 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
549 2919150387 Rahnella aceris 1817 Isolate Unclassified
550 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
551 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
552 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
553 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
554 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
555 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
556 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
557 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
558 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
559 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
560 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
561 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
562 2927143783 Rahnella sp. 2050 Isolate Unclassified
563 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
564 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
565 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
566 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
567 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
568 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
569 2932406140 Serratia sp. 2723 Isolate Rhizosphere
570 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
571 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
572 2937539931 Pantoea sp. LS15 Isolate Unclassified
573 2937967321 Serratia sp. YC16 Isolate Unclassified
574 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
575 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
576 2939577877 Serratia sp. 509 Isolate Rhizosphere
577 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
578 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
579 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
580 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
581 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
582 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
583 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
584 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
585 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
586 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
587 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
588 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
589 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
590 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
591 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
592 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
593 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
594 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
595 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
596 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
597 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
598 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
599 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
600 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
601 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
602 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
603 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
604 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
605 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
606 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
607 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
608 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
609 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
610 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
611 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
612 640753048 Serratia proteamaculans 568 Isolate Endosphere
613 8004592986 Serratia sp. S119 Isolate Unclassified
614 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
615 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
616 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
617 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
618 8018221730 Enterobacter sp. CM29 Isolate Unclassified
619 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
620 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
621 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
622 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
623 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
624 8052494512 Pseudomonas putida LD6 Isolate Unclassified
625 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
626 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
627 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
628 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
629 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
630 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
631 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
632 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
633 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
634 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
635 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
636 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
637 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
638 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
639 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
640 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
641 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
642 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
643 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
644 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
645 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
646 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
647 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
648 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
649 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
650 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
651 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 60.04
Metatranscriptomes 2.49
Isolates 37.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0.1
Endosphere 6.36
Nodule 3.58
Rhizoplane 13.02
Rhizosphere 56.06
Stem 0.1
Stem Tuber 0.5
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058692_1012258 3300003856 Bacteria 2038
2 MRS2a_Contig_908 2124908027 Bacteria 7011
3 JGI24741J21665_1007693 3300001915 Bacteria 2077
4 JGI24739J22299_10000495 3300001989 Bacteria 13927
5 JGI25154J39366_1004064 3300002738 Bacteria 2769
6 JGI25163J39215_1000022 3300002771 Bacteria 73877
7 JGI25164J39214_1000008 3300002772 Bacteria 311285
8 JGI25164J39214_1000100 3300002772 Bacteria 84404
9 JGI25152J39213_1000802 3300002773 Bacteria 15735
10 JGI25165J46597_1000207 3300003214 Bacteria 84404
11 rootH2_10027710 3300003320 Bacteria 31950
12 rootL2_10202333 3300003322 Bacteria 1935
13 Ga0055538_1000014 3300003751 Bacteria 311285
14 Ga0055538_1000028 3300003751 Bacteria 215806
15 Ga0055539_1000020 3300003752 Bacteria 311285
16 Ga0055539_1000037 3300003752 Bacteria 215806
17 Ga0055533_1000027 3300003756 Bacteria 311285
18 Ga0055533_1000047 3300003756 Bacteria 215806
19 Ga0055532_1000129 3300003758 Bacteria 74882
20 Ga0055525_1000032 3300003759 Bacteria 311285
21 Ga0055525_1000443 3300003759 Bacteria 23895
22 Ga0055536_1003337 3300003781 Bacteria 8684
23 Ga0055536_1011775 3300003781 Bacteria 3308
24 Ga0055530_10007005 3300003791 Bacteria 4861
25 Ga0055530_10030977 3300003791 Bacteria 1410
26 Ga0055531_10006469 3300003794 Bacteria 6649
27 Ga0055541_1000014 3300003841 Bacteria 311285
28 Ga0055541_1000025 3300003841 Bacteria 215806
29 Ga0058692_1006453 3300003856 Bacteria 3217
30 Ga0058692_1017030 3300003856 Bacteria 1601
31 Ga0058860_10094053 3300004801 Bacteria 1955
32 Ga0058860_10169596 3300004801 Bacteria 1593
33 Ga0058860_10195578 3300004801 Bacteria 1446
34 Ga0058860_12165330 3300004801 Bacteria 2117
35 Ga0058860_12187468 3300004801 Bacteria 2008
36 Ga0065703_1020270 3300005272 Bacteria 1919
37 Ga0065714_10000238 3300005288 Bacteria 6927
38 Ga0065714_10081923 3300005288 Bacteria 2342
39 Ga0065714_10087702 3300005288 Bacteria 2047
40 Ga0065704_10000888 3300005289 Bacteria 11210
41 Ga0065704_10002842 3300005289 Bacteria 14551
42 Ga0065704_10004084 3300005289 Bacteria 6154
43 Ga0065704_10026246 3300005289 Bacteria 1447
44 Ga0065704_10090186 3300005289 Bacteria 2806
45 Ga0065704_10139924 3300005289 Bacteria 1528
46 Ga0065712_10003691 3300005290 Bacteria 6497
47 Ga0065712_10067863 3300005290 Bacteria 24476
48 Ga0065712_10079070 3300005290 Bacteria 3257
49 Ga0065715_10133975 3300005293 Bacteria 1959
50 Ga0070661_100000022 3300005344 Bacteria 127714
51 Ga0070669_100001703 3300005353 Bacteria 15924
52 Ga0070669_100005661 3300005353 Bacteria 9020
53 Ga0070694_100087223 3300005444 Bacteria 2182
54 Ga0070662_100000041 3300005457 Bacteria 72879
55 Ga0070662_100004331 3300005457 Bacteria 8964
56 Ga0070698_100135638 3300005471 Bacteria 2415
57 Ga0068853_100007800 3300005539 Bacteria 8583
58 Ga0070696_100279255 3300005546 Bacteria 1273
59 Ga0070665_100007341 3300005548 Bacteria 11210
60 Ga0070665_100010625 3300005548 Bacteria 9318
61 Ga0070665_100083166 3300005548 Bacteria 3206
62 Ga0070664_100000646 3300005564 Bacteria 26728
63 Ga0068857_100073160 3300005577 Bacteria 3053
64 Ga0068857_100216748 3300005577 Bacteria 1748
65 Ga0068854_100020986 3300005578 Bacteria 4427
66 Ga0070702_100155902 3300005615 Bacteria 1471
67 Ga0068859_100015807 3300005617 Bacteria 7582
68 Ga0068851_10000044 3300005834 Bacteria 83228
69 Ga0068851_10012067 3300005834 Bacteria 4068
70 Ga0068851_10064435 3300005834 Bacteria 1884
71 Ga0081538_10087104 3300005981 Bacteria 1632
72 Ga0075364_10007670 3300006051 Bacteria 6419
73 Ga0075364_10020296 3300006051 Bacteria 4178
74 Ga0075364_10326818 3300006051 Bacteria 1044
75 Ga0070715_10018108 3300006163 Bacteria 2679
76 Ga0075367_10416592 3300006178 Bacteria 850
77 Ga0075434_100202485 3300006871 Bacteria 2005
78 Ga0097620_100015807 3300006931 Bacteria 7582
79 Ga0099823_1000054 3300006944 Bacteria 55085
80 Ga0079104_1000720 3300006946 Bacteria 29806
81 Ga0079104_1000769 3300006946 Bacteria 27495
82 Ga0079104_1002016 3300006946 Bacteria 11849
83 Ga0079104_1015557 3300006946 Bacteria 2250
84 Ga0079104_1020880 3300006946 Bacteria 1793
85 Ga0079104_1027141 3300006946 Bacteria 1471
86 Ga0099794_10005207 3300007265 Bacteria 5198
87 Ga0105251_10000151 3300009011 Bacteria 70872
88 Ga0105251_10000156 3300009011 Bacteria 69639
89 Ga0105251_10001256 3300009011 Bacteria 21931
90 Ga0105251_10007540 3300009011 Bacteria 6684
91 Ga0105251_10029112 3300009011 Bacteria 2785
92 Ga0105251_10050570 3300009011 Bacteria 1985
93 Ga0105251_10057196 3300009011 Bacteria 1843
94 Ga0105251_10059849 3300009011 Bacteria 1795
95 Ga0105251_10126641 3300009011 Bacteria 1159
96 Ga0105251_10158084 3300009011 Bacteria 1022
97 Ga0105244_10000272 3300009036 Bacteria 52218
98 Ga0105244_10000338 3300009036 Bacteria 44031
99 Ga0105244_10000932 3300009036 Bacteria 24659
100 Ga0105244_10002378 3300009036 Bacteria 14261
101 Ga0105244_10003891 3300009036 Bacteria 10503
102 Ga0105244_10004865 3300009036 Bacteria 9106
103 Ga0105244_10010841 3300009036 Bacteria 5503
104 Ga0105244_10049440 3300009036 Bacteria 2149
105 Ga0105244_10075100 3300009036 Bacteria 1680
106 Ga0105244_10115292 3300009036 Bacteria 1304
107 Ga0105244_10126386 3300009036 Bacteria 1235
108 Ga0105244_10141536 3300009036 Bacteria 1157
109 Ga0105244_10182263 3300009036 Bacteria 995
110 Ga0105244_10189344 3300009036 Bacteria 973
111 Ga0105250_10000042 3300009092 Bacteria 130495
112 Ga0105250_10000542 3300009092 Bacteria 26010
113 Ga0105250_10000611 3300009092 Bacteria 23296
114 Ga0105250_10001268 3300009092 Bacteria 13907
115 Ga0105250_10001773 3300009092 Bacteria 11331
116 Ga0105250_10003580 3300009092 Bacteria 7317
117 Ga0105250_10039616 3300009092 Bacteria 1889
118 Ga0105250_10094222 3300009092 Bacteria 1220
119 Ga0105250_10130066 3300009092 Bacteria 1039
120 Ga0105245_10155601 3300009098 Bacteria 2165
121 Ga0105247_10000301 3300009101 Bacteria 44602
122 Ga0105247_10469645 3300009101 Bacteria 911
123 Ga0105243_10010660 3300009148 Bacteria 6971
124 Ga0105243_10024754 3300009148 Bacteria 4582
125 Ga0105243_10238632 3300009148 Bacteria 1616
126 Ga0105243_10242685 3300009148 Bacteria 1604
127 Ga0105243_10361702 3300009148 Bacteria 1336
128 Ga0105241_10000008 3300009174 Bacteria 334281
129 Ga0105242_10007385 3300009176 Bacteria 8463
130 Ga0105242_10201976 3300009176 Bacteria 1766
131 Ga0105248_10027748 3300009177 Bacteria 6305
132 Ga0105237_10001243 3300009545 Bacteria 33994
133 Ga0105237_10174419 3300009545 Bacteria 2150
134 Ga0130087_1027949 3300009828 Bacteria 1890
135 Ga0105246_10056158 3300011119 Bacteria 2720
136 Ga0157373_10000463 3300013100 Bacteria 32226
137 Ga0157373_10063629 3300013100 Bacteria 2612
138 Ga0157373_10064357 3300013100 Bacteria 2596
139 Ga0157373_10146750 3300013100 Bacteria 1659
140 Ga0157373_10155477 3300013100 Bacteria 1609
141 Ga0157371_10001001 3300013102 Bacteria 31233
142 Ga0157371_10001008 3300013102 Bacteria 31048
143 Ga0157371_10002245 3300013102 Bacteria 18658
144 Ga0157371_10023605 3300013102 Bacteria 4498
145 Ga0157370_10002229 3300013104 Bacteria 23584
146 Ga0157370_10002252 3300013104 Bacteria 23438
147 Ga0157370_10004489 3300013104 Bacteria 15991
148 Ga0157370_10006004 3300013104 Bacteria 13513
149 Ga0157370_10033837 3300013104 Bacteria 4981
150 Ga0157370_10045091 3300013104 Bacteria 4233
151 Ga0157369_10000956 3300013105 Bacteria 36674
152 Ga0157369_10038217 3300013105 Bacteria 5248
153 Ga0163162_10044620 3300013306 Bacteria 4440
154 Ga0163162_10163690 3300013306 Bacteria 2347
155 Ga0163162_10279941 3300013306 Bacteria 1800
156 Ga0157372_10004322 3300013307 Bacteria 15189
157 Ga0157372_10008877 3300013307 Bacteria 10675
158 Ga0157372_10070044 3300013307 Bacteria 3945
159 Ga0157372_10152976 3300013307 Bacteria 2663
160 Ga0157372_10512069 3300013307 Bacteria 1399
161 Ga0157372_10551068 3300013307 Bacteria 1344
162 Ga0157380_10371786 3300014326 Bacteria 1346
163 Ga0157380_10855410 3300014326 Bacteria 932
164 Ga0182008_10001425 3300014497 Bacteria 16033
165 Ga0182006_1000069 3300015261 Bacteria 140097
166 Ga0183366_1002 3300015679 Bacteria 791639
167 Ga0183370_1002 3300015680 Bacteria 791639
168 Ga0183369_1002 3300015685 Bacteria 791621
169 Ga0183368_1005 3300015687 Bacteria 791621
170 Ga0163161_10000002 3300017792 Bacteria 411983
171 Ga0163161_10051926 3300017792 Bacteria 2971
172 Ga0163161_10060323 3300017792 Bacteria 2761
173 Ga0206356_11158939 3300020070 Bacteria 1733
174 Ga0206351_10013078 3300020077 Bacteria 2566
175 Ga0206352_10402763 3300020078 Bacteria 2145
176 Ga0206354_10196568 3300020081 Bacteria 1734
177 Ga0206354_10826925 3300020081 Bacteria 1891
178 Ga0154015_1698326 3300020610 Bacteria 1607
179 Ga0213876_10000444 3300021384 Bacteria 33655
180 Ga0224712_10079925 3300022467 Bacteria 1347
181 Ga0256714_107509 3300023304 Bacteria 2224
182 Ga0256744_141414 3300023309 Bacteria 1240
183 Ga0209435_100363 3300025206 Bacteria 10243
184 Ga0209760_100086 3300025207 Bacteria 74006
185 Ga0209760_100463 3300025207 Bacteria 9076
186 Ga0209784_100030 3300025224 Bacteria 327457
187 Ga0209784_100032 3300025224 Bacteria 314079
188 Ga0209566_100034 3300025225 Bacteria 327457
189 Ga0209566_100036 3300025225 Bacteria 314079
190 Ga0209674_100052 3300025226 Bacteria 327457
191 Ga0209674_100054 3300025226 Bacteria 314079
192 Ga0209147_100055 3300025229 Bacteria 262412
193 Ga0209563_100054 3300025230 Bacteria 327457
194 Ga0209563_100055 3300025230 Bacteria 314079
195 Ga0207427_100001 3300025231 Bacteria 1410763
196 Ga0207427_100035 3300025231 Bacteria 311526
197 Ga0209437_100003 3300025233 Bacteria 1517827
198 Ga0209437_100068 3300025233 Bacteria 311526
199 Ga0209437_100110 3300025233 Bacteria 215040
200 Ga0209258_100231 3300025242 Bacteria 104255
201 Ga0207425_1019345 3300025245 Bacteria 1467
202 Ga0209646_1000331 3300025246 Bacteria 35689
203 Ga0209677_100032 3300025253 Bacteria 327457
204 Ga0209677_100033 3300025253 Bacteria 314079
205 Ga0209759_1010939 3300025256 Bacteria 2620
206 Ga0209129_1000103 3300025258 Bacteria 161305
207 Ga0209233_1000007 3300025261 Bacteria 1411234
208 Ga0209565_1038113 3300025263 Bacteria 906
209 Ga0209675_1006388 3300025291 Bacteria 4738
210 Ga0209676_1000078 3300025292 Bacteria 296293
211 Ga0209676_1000503 3300025292 Bacteria 61955
212 Ga0209050_1000041 3300025298 Bacteria 408004
213 Ga0209050_1000060 3300025298 Bacteria 321699
214 Ga0209050_1000425 3300025298 Bacteria 77756
215 Ga0209051_1000037 3300025303 Bacteria 321747
216 Ga0209051_1000061 3300025303 Bacteria 253485
217 Ga0209051_1000085 3300025303 Bacteria 189973
218 Ga0209257_1000635 3300025304 Bacteria 56286
219 Ga0209257_1011547 3300025304 Bacteria 4235
220 Ga0207656_10000022 3300025321 Bacteria 106345
221 Ga0207656_10004274 3300025321 Bacteria 4978
222 Ga0207696_1000008 3300025711 Bacteria 568181
223 Ga0207696_1000009 3300025711 Bacteria 564405
224 Ga0207696_1000027 3300025711 Bacteria 412783
225 Ga0207696_1000032 3300025711 Bacteria 380071
226 Ga0207696_1000034 3300025711 Bacteria 350426
227 Ga0207696_1000129 3300025711 Bacteria 133308
228 Ga0207696_1000187 3300025711 Bacteria 96247
229 Ga0207696_1000262 3300025711 Bacteria 67626
230 Ga0207696_1000278 3300025711 Bacteria 60620
231 Ga0207696_1001031 3300025711 Bacteria 16601
232 Ga0207696_1001146 3300025711 Bacteria 15233
233 Ga0207696_1001494 3300025711 Bacteria 12582
234 Ga0207696_1002195 3300025711 Bacteria 9785
235 Ga0207696_1003240 3300025711 Bacteria 7510
236 Ga0207696_1006426 3300025711 Bacteria 4741
237 Ga0207696_1006575 3300025711 Bacteria 4668
238 Ga0207655_1000020 3300025728 Bacteria 524503
239 Ga0207655_1000054 3300025728 Bacteria 281894
240 Ga0207655_1000103 3300025728 Bacteria 185076
241 Ga0207655_1000357 3300025728 Bacteria 64976
242 Ga0207655_1000408 3300025728 Bacteria 59188
243 Ga0207655_1000569 3300025728 Bacteria 45865
244 Ga0207655_1000721 3300025728 Bacteria 37520
245 Ga0207655_1000752 3300025728 Bacteria 36357
246 Ga0207655_1000828 3300025728 Bacteria 33376
247 Ga0207655_1001231 3300025728 Bacteria 24607
248 Ga0207655_1001348 3300025728 Bacteria 23067
249 Ga0207655_1006303 3300025728 Bacteria 7886
250 Ga0207655_1007027 3300025728 Bacteria 7370
251 Ga0207655_1007625 3300025728 Bacteria 6990
252 Ga0207655_1007768 3300025728 Bacteria 6914
253 Ga0207655_1014196 3300025728 Bacteria 4519
254 Ga0207655_1017833 3300025728 Bacteria 3810
255 Ga0207655_1024660 3300025728 Bacteria 2942
256 Ga0207655_1036293 3300025728 Bacteria 2188
257 Ga0207655_1077163 3300025728 Bacteria 1216
258 Ga0207713_1000014 3300025735 Bacteria 432450
259 Ga0207713_1000028 3300025735 Bacteria 309074
260 Ga0207713_1000123 3300025735 Bacteria 122033
261 Ga0207713_1000129 3300025735 Bacteria 116027
262 Ga0207713_1000163 3300025735 Bacteria 98277
263 Ga0207713_1000223 3300025735 Bacteria 76591
264 Ga0207713_1001297 3300025735 Bacteria 20559
265 Ga0207713_1004295 3300025735 Bacteria 9287
266 Ga0207713_1005559 3300025735 Bacteria 7855
267 Ga0207713_1005686 3300025735 Bacteria 7740
268 Ga0207713_1006908 3300025735 Bacteria 6819
269 Ga0207713_1007366 3300025735 Bacteria 6507
270 Ga0207713_1008261 3300025735 Bacteria 6017
271 Ga0207713_1009429 3300025735 Bacteria 5501
272 Ga0207713_1033358 3300025735 Bacteria 2250
273 Ga0207713_1037467 3300025735 Bacteria 2067
274 Ga0207713_1049253 3300025735 Bacteria 1691
275 Ga0207710_10000061 3300025900 Bacteria 166665
276 Ga0207685_10039892 3300025905 Bacteria 1746
277 Ga0207654_10000009 3300025911 Bacteria 334291
278 Ga0207695_10164949 3300025913 Bacteria 2144
279 Ga0207671_10000034 3300025914 Bacteria 245048
280 Ga0207671_10109162 3300025914 Bacteria 2103
281 Ga0207649_10000006 3300025920 Bacteria 349180
282 Ga0207681_10000978 3300025923 Bacteria 18677
283 Ga0207681_10390162 3300025923 Bacteria 1122
284 Ga0207650_10000092 3300025925 Bacteria 116489
285 Ga0207706_10003133 3300025933 Bacteria 15889
286 Ga0207706_10061623 3300025933 Bacteria 3303
287 Ga0207686_10001893 3300025934 Bacteria 11588
288 Ga0207686_10032842 3300025934 Bacteria 3092
289 Ga0207709_10004825 3300025935 Bacteria 7725
290 Ga0207709_10014581 3300025935 Bacteria 4343
291 Ga0207709_10050415 3300025935 Bacteria 2545
292 Ga0207709_10060080 3300025935 Bacteria 2369
293 Ga0207669_10245343 3300025937 Bacteria 1330
294 Ga0207689_10305707 3300025942 Bacteria 1318
295 Ga0207679_10000010 3300025945 Bacteria 349180
296 Ga0207668_10007234 3300025972 Bacteria 6591
297 Ga0207639_10005461 3300026041 Bacteria 8587
298 Ga0207708_10361060 3300026075 Bacteria 1194
299 Ga0207674_10088438 3300026116 Bacteria 3091
300 Ga0207674_10103126 3300026116 Bacteria 2832
301 Ga0209281_1000010 3300027111 Bacteria 726106
302 Ga0209281_1000049 3300027111 Bacteria 322274
303 Ga0209281_1000054 3300027111 Bacteria 309505
304 Ga0209281_1000056 3300027111 Bacteria 307619
305 Ga0209281_1000371 3300027111 Bacteria 72619
306 Ga0209281_1000505 3300027111 Bacteria 51792
307 Ga0209281_1000576 3300027111 Bacteria 43355
308 Ga0209281_1000683 3300027111 Bacteria 35391
309 Ga0209281_1001352 3300027111 Bacteria 15206
310 Ga0209281_1013772 3300027111 Bacteria 1733
311 Ga0209281_1022875 3300027111 Bacteria 1192
312 Ga0209389_1000002 3300027296 Bacteria 333932
313 Ga0209371_1000013 3300027312 Bacteria 691516
314 Ga0209371_1000049 3300027312 Bacteria 279132
315 Ga0209371_1000572 3300027312 Bacteria 33334
316 Ga0209371_1000582 3300027312 Bacteria 32834
317 Ga0209371_1000935 3300027312 Bacteria 22868
318 Ga0209371_1001075 3300027312 Bacteria 20453
319 Ga0209371_1001276 3300027312 Bacteria 17779
320 Ga0209371_1002216 3300027312 Bacteria 11275
321 Ga0209371_1002307 3300027312 Bacteria 10875
322 Ga0209371_1002649 3300027312 Bacteria 9758
323 Ga0209371_1002734 3300027312 Bacteria 9478
324 Ga0209371_1014808 3300027312 Bacteria 2121
325 Ga0209371_1018024 3300027312 Bacteria 1809
326 Ga0209371_1022298 3300027312 Bacteria 1516
327 Ga0209981_1003851 3300027378 Bacteria 1954
328 Ga0209981_1006084 3300027378 Bacteria 1612
329 Ga0209984_1009488 3300027424 Bacteria 1238
330 Ga0209999_1007990 3300027543 Bacteria 1903
331 Ga0210002_1012214 3300027617 Bacteria 1332
332 Ga0209983_1004310 3300027665 Bacteria 2998
333 Ga0209971_1042692 3300027682 Bacteria 1092
334 Ga0209966_1003526 3300027695 Bacteria 2635
335 Ga0207428_10151233 3300027907 Bacteria 1767
336 Ga0268266_10000211 3300028379 Bacteria 101045
337 Ga0268266_10052890 3300028379 Bacteria 3488
338 Ga0311001_1010284 3300029277 Bacteria 2088
339 Ga0268256_1000014 3300030500 Bacteria 691435
340 Ga0268256_1000031 3300030500 Bacteria 425730
341 Ga0268256_1000227 3300030500 Bacteria 60732
342 Ga0268256_1000499 3300030500 Bacteria 33334
343 Ga0268256_1001137 3300030500 Bacteria 17252
344 Ga0268256_1001942 3300030500 Bacteria 11316
345 Ga0268256_1002473 3300030500 Bacteria 9388
346 Ga0268256_1003008 3300030500 Bacteria 7959
347 Ga0268256_1005389 3300030500 Bacteria 5025
348 Ga0268256_1019845 3300030500 Bacteria 1827
349 Ga0268256_1020097 3300030500 Bacteria 1809
350 Ga0316177_1087706 3300030731 Bacteria 2844
351 Ga0316183_1016295 3300030742 Bacteria 4569
352 Ga0265328_10000016 3300031239 Bacteria 132959
353 Ga0307408_100298698 3300031548 Bacteria 1348
354 Ga0307408_100392243 3300031548 Bacteria 1190
355 Ga0316575_10000446 3300031665 Bacteria 11788
356 Ga0316575_10011572 3300031665 Bacteria 3267
357 Ga0316579_10000802 3300031691 Bacteria 10838
358 Ga0316579_10022759 3300031691 Bacteria 2806
359 Ga0316579_10197790 3300031691 Bacteria 972
360 Ga0265314_10121058 3300031711 Bacteria 1647
361 Ga0307413_10060321 3300031824 Bacteria 2335
362 Ga0307412_10413110 3300031911 Bacteria 1102
363 Ga0307416_100350680 3300032002 Bacteria 1493
364 Ga0316585_10004730 3300032137 Bacteria 3813
365 Ga0316593_10000082 3300032168 Bacteria 11664
366 Ga0316593_10014396 3300032168 Bacteria 2358
367 Ga0316593_10024525 3300032168 Bacteria 1913
368 Ga0316593_10026492 3300032168 Bacteria 1854
369 Ga0316593_10032846 3300032168 Bacteria 1697
370 Ga0316593_10067079 3300032168 Bacteria 1236
371 Ga0373936_0117312 3300035113 Bacteria 1134
372 Ga0316574_0222461 3300035398 Bacteria 1209
373 Ga0373935_0065766 3300035692 Bacteria 2327
374 Ga0373935_0313854 3300035692 Bacteria 1111
375 Ga0373927_0038654 3300035695 Bacteria 3098
376 Ga0373937_0345012 3300036401 Bacteria 1410
377 Ga0316582_0002520 3300036647 Bacteria 8642
378 Ga0316584_0304221 3300036712 Bacteria 1154
379 Ga0373925_0041279 3300037068 Bacteria 3420
380 Ga0316581_0073803 3300037588 Bacteria 1048
381 Ga0400483_105112 3300039062 Bacteria 1430
382 Ga0400483_213263 3300039062 Bacteria 16387
383 Ga0436365_1801698 3300039437 Bacteria 33582
384 Ga0439436_0000220 3300041404 Bacteria 13690
385 Ga0439438_000042 3300041405 Bacteria 63992
386 Ga0439438_003009 3300041405 Bacteria 6954
387 Ga0439438_004922 3300041405 Bacteria 5004
388 Ga0439438_004959 3300041405 Bacteria 4977
389 Ga0439438_007456 3300041405 Bacteria 3738
390 Ga0439438_008294 3300041405 Bacteria 3462
391 Ga0439447_000338 3300041407 Bacteria 16822
392 Ga0439447_001723 3300041407 Bacteria 8011
393 Ga0439447_005050 3300041407 Bacteria 4441
394 Ga0439447_005875 3300041407 Bacteria 4038
395 Ga0439466_0000004 3300041411 Bacteria 462654
396 Ga0439466_0003385 3300041411 Bacteria 6198
397 Ga0451789_0093147 3300041443 Bacteria 1635
398 Ga0451797_1445638 3300041453 Bacteria 1648
399 Ga0451805_097769 3300041461 Bacteria 1588
400 Ga0451807_0192210 3300041486 Bacteria 1196
401 Ga0451835_0706369 3300041492 Bacteria 1294
402 Ga0451853_0953173 3300041512 Bacteria 2207
403 Ga0451853_1281195 3300041512 Bacteria 1006
404 Ga0452268_32449 3300041907 Bacteria 1374
405 Ga0439431_0003975 3300041997 Bacteria 3255
406 Ga0439441_002360 3300042001 Bacteria 2651
407 Ga0439443_024958 3300042003 Bacteria 961
408 Ga0439432_003406 3300042006 Bacteria 5902
409 Ga0439432_008690 3300042006 Bacteria 3560
410 Ga0439432_014747 3300042006 Bacteria 2643
411 Ga0439432_028853 3300042006 Bacteria 1805
412 Ga0439452_000009 3300042010 Bacteria 569493
413 Ga0439452_000013 3300042010 Bacteria 364058
414 Ga0439452_000094 3300042010 Bacteria 75452
415 Ga0439452_000121 3300042010 Bacteria 60858
416 Ga0439455_0044352 3300042012 Bacteria 1147
417 Ga0439456_008965 3300042013 Bacteria 2067
418 Ga0439463_003608 3300042016 Bacteria 3902
419 Ga0450911_000317 3300042115 Bacteria 17456
420 Ga0450923_009020 3300042125 Bacteria 1733
421 Ga0450900_001029 3300042136 Bacteria 2556
422 Ga0450902_004495 3300042137 Bacteria 2078
423 Ga0450904_000557 3300042139 Bacteria 7024
424 Ga0450905_013876 3300042142 Bacteria 1144
425 Ga0450907_000648 3300042146 Bacteria 9158
426 Ga0439446_0002391 3300042156 Bacteria 4496
427 Ga0439446_0002561 3300042156 Bacteria 4380
428 Ga0439435_0000397 3300042436 Bacteria 6743
429 Ga0439459_0002610 3300042438 Bacteria 2792
430 Ga0439464_0002684 3300042439 Bacteria 4413
431 Ga0439460_0000842 3300042461 Bacteria 6983
432 Ga0450893_0002336 3300042532 Bacteria 2946
433 Ga0450893_0015838 3300042532 Bacteria 1273
434 Ga0466981_0000032 3300044669 Bacteria 65341
435 Ga0495627_000177 3300046453 Bacteria 72359
436 Ga0495627_005014 3300046453 Bacteria 5420
437 Ga0495591_000222 3300046458 Bacteria 56621
438 Ga0495591_000590 3300046458 Bacteria 27551
439 Ga0495591_001740 3300046458 Bacteria 12974
440 Ga0495591_005309 3300046458 Bacteria 5996
441 Ga0495591_037354 3300046458 Bacteria 1406
442 Ga0495650_0000008 3300046471 Bacteria 688246
443 Ga0495650_0000059 3300046471 Bacteria 296253
444 Ga0495650_0000120 3300046471 Bacteria 184191
445 Ga0495605_0000235 3300046474 Bacteria 67625
446 Ga0495605_0026549 3300046474 Bacteria 3009
447 Ga0495584_0003803 3300046491 Bacteria 8213
448 Ga0495585_0023719 3300046492 Bacteria 3520
449 Ga0495594_0002336 3300046499 Bacteria 9871
450 Ga0495596_0009946 3300046500 Bacteria 4166
451 Ga0495607_0000756 3300046501 Bacteria 30975
452 Ga0495607_0038294 3300046501 Bacteria 2873
453 Ga0495583_0000389 3300046506 Bacteria 67583
454 Ga0495606_0008629 3300046507 Bacteria 8804
455 Ga0495610_0014899 3300046512 Bacteria 4545
456 Ga0495620_0000003 3300046515 Bacteria 345923
457 Ga0495620_0000900 3300046515 Bacteria 18247
458 Ga0495632_0003399 3300046519 Bacteria 11334
459 Ga0495632_0039573 3300046519 Bacteria 2379
460 Ga0495643_0006448 3300046522 Bacteria 7731
461 Ga0495643_0025859 3300046522 Bacteria 3318
462 Ga0495644_0009743 3300046523 Bacteria 3700
463 Ga0495644_0102312 3300046523 Bacteria 1084
464 Ga0495648_0009903 3300046524 Bacteria 7319
465 Ga0495648_0057910 3300046524 Bacteria 2320
466 Ga0495648_0068718 3300046524 Bacteria 2065
467 Ga0495654_0000148 3300046530 Bacteria 72863
468 Ga0495654_0000218 3300046530 Bacteria 53756
469 Ga0495654_0001237 3300046530 Bacteria 18027
470 Ga0495654_0007590 3300046530 Bacteria 6043
471 Ga0495654_0008728 3300046530 Bacteria 5583
472 Ga0495654_0041929 3300046530 Bacteria 2275
473 Ga0495654_0072730 3300046530 Bacteria 1626
474 Ga0495609_0000006 3300046538 Bacteria 431833
475 Ga0495609_0000296 3300046538 Bacteria 46065
476 Ga0495621_0036552 3300046539 Bacteria 1705
477 Ga0495633_0000309 3300046558 Bacteria 55647
478 Ga0495611_0208408 3300046648 Bacteria 911
479 Ga0495625_0119230 3300046660 Bacteria 1797
480 Ga0495661_0000224 3300046665 Bacteria 65089
481 Ga0495661_0000366 3300046665 Bacteria 49025
482 Ga0495588_0172530 3300046674 Bacteria 1143
483 Ga0495670_0012315 3300046691 Bacteria 4204
484 Ga0495671_0001722 3300046692 Bacteria 14204
485 Ga0495671_0024447 3300046692 Bacteria 3146
486 Ga0495649_0001477 3300046694 Bacteria 17652
487 Ga0495649_0037603 3300046694 Bacteria 2656
488 Ga0495649_0112441 3300046694 Bacteria 1443
489 Ga0495589_0000023 3300046794 Bacteria 195535
490 Ga0495660_0000019 3300046810 Bacteria 311047
491 Ga0495660_0000063 3300046810 Bacteria 129364
492 Ga0495660_0013204 3300046810 Bacteria 4785
493 Ga0495660_0041034 3300046810 Bacteria 2564
494 Ga0495660_0055764 3300046810 Bacteria 2138
495 Ga0495672_0000003 3300047320 Bacteria 728845
496 Ga0495672_0000025 3300047320 Bacteria 365425
497 Ga0495672_0000145 3300047320 Bacteria 104177
498 Ga0495672_0016757 3300047320 Bacteria 4920
499 Ga0495676_0031220 3300047321 Bacteria 4509
500 Ga0495676_0071324 3300047321 Bacteria 2670
501 Ga0495683_0000105 3300047323 Bacteria 87050
502 Ga0495683_0000201 3300047323 Bacteria 56536
503 Ga0495683_0007108 3300047323 Bacteria 6074
504 Ga0495679_000263 3300047446 Bacteria 43748
505 Ga0495679_000535 3300047446 Bacteria 26692
506 Ga0495679_001169 3300047446 Bacteria 15629
507 Ga0495679_011720 3300047446 Bacteria 3369
508 Ga0495673_0000011 3300047469 Bacteria 674140
509 Ga0495673_0000176 3300047469 Bacteria 103274
510 Ga0495673_0003561 3300047469 Bacteria 10246
511 Ga0495681_0047979 3300047470 Bacteria 2028
512 Ga0495626_0000413 3300048091 Bacteria 43901
513 Ga0496100_0030607 3300048903 Bacteria 3340
514 Ga0496100_0034666 3300048903 Bacteria 3169
515 Ga0496101_0000624 3300048904 Bacteria 21525
516 Ga0496102_0113265 3300048905 Bacteria 2530
517 Ga0496104_0017702 3300048907 Bacteria 6495
518 Ga0496104_0040576 3300048907 Bacteria 4363
519 Ga0496105_0032860 3300048908 Bacteria 4258
520 Ga0496105_0070984 3300048908 Bacteria 2878
521 Ga0496113_0074743 3300048916 Bacteria 2584
522 Ga0496114_0010183 3300048917 Bacteria 7481
523 Ga0496114_0843286 3300048917 Bacteria 796
524 Ga0496116_0000015 3300048919 Bacteria 560702
525 Ga0496116_0000096 3300048919 Bacteria 202230
526 Ga0496116_0001120 3300048919 Bacteria 32049
527 Ga0496116_0004381 3300048919 Bacteria 13500
528 Ga0496116_0005667 3300048919 Bacteria 11501
529 Ga0496116_0042872 3300048919 Bacteria 3088
530 Ga0496116_0052156 3300048919 Bacteria 2711
531 Ga0496116_0115965 3300048919 Bacteria 1561
532 Ga0496117_0000043 3300048920 Bacteria 309583
533 Ga0496117_0002805 3300048920 Bacteria 21246
534 Ga0496117_0003581 3300048920 Bacteria 17927
535 Ga0496117_0036499 3300048920 Bacteria 3676
536 Ga0496117_0052208 3300048920 Bacteria 2881
537 Ga0496117_0058545 3300048920 Bacteria 2667
538 Ga0496117_0070014 3300048920 Bacteria 2359
539 Ga0496117_0114350 3300048920 Bacteria 1673
540 Ga0496118_0000075 3300048921 Bacteria 196228
541 Ga0496118_0003147 3300048921 Bacteria 21106
542 Ga0496118_0006965 3300048921 Bacteria 12205
543 Ga0496118_0024462 3300048921 Bacteria 5208
544 Ga0496118_0024561 3300048921 Bacteria 5196
545 Ga0496118_0085790 3300048921 Bacteria 2190
546 Ga0496118_0094132 3300048921 Bacteria 2049
547 Ga0496118_0185699 3300048921 Bacteria 1250
548 Ga0496119_0000207 3300048922 Bacteria 83748
549 Ga0496119_0000355 3300048922 Bacteria 64264
550 Ga0496119_0003086 3300048922 Bacteria 17573
551 Ga0496119_0003653 3300048922 Bacteria 15793
552 Ga0496119_0004492 3300048922 Bacteria 13869
553 Ga0496119_0009362 3300048922 Bacteria 8422
554 Ga0496119_0022030 3300048922 Bacteria 4579
555 Ga0496119_0110181 3300048922 Bacteria 1529
556 Ga0496120_0002244 3300048923 Bacteria 20193
557 Ga0496120_0002287 3300048923 Bacteria 19874
558 Ga0496120_0002586 3300048923 Bacteria 18012
559 Ga0496120_0003799 3300048923 Bacteria 13310
560 Ga0496120_0004827 3300048923 Bacteria 11031
561 Ga0496120_0011502 3300048923 Bacteria 6081
562 Ga0496120_0017896 3300048923 Bacteria 4579
563 Ga0496120_0034663 3300048923 Bacteria 3021
564 Ga0496120_0128423 3300048923 Bacteria 1301
565 Ga0496121_0003934 3300048924 Bacteria 20565
566 Ga0496121_0162610 3300048924 Bacteria 1630
567 Ga0496122_0000170 3300048925 Bacteria 154389
568 Ga0496122_0000213 3300048925 Bacteria 129218
569 Ga0496122_0001232 3300048925 Bacteria 43246
570 Ga0496122_0002533 3300048925 Bacteria 25730
571 Ga0496122_0006705 3300048925 Bacteria 13101
572 Ga0496122_0075834 3300048925 Bacteria 2369
573 Ga0496122_0092780 3300048925 Bacteria 2051
574 Ga0496122_0246962 3300048925 Bacteria 1001
575 Ga0496123_0000058 3300048926 Bacteria 226832
576 Ga0496123_0000177 3300048926 Bacteria 129218
577 Ga0496123_0001000 3300048926 Bacteria 43259
578 Ga0496123_0003285 3300048926 Bacteria 18323
579 Ga0496123_0005016 3300048926 Bacteria 13549
580 Ga0496123_0005959 3300048926 Bacteria 12003
581 Ga0496123_0215385 3300048926 Bacteria 972
582 Ga0496123_0240750 3300048926 Bacteria 898
583 Ga0496124_0000026 3300048927 Bacteria 385387
584 Ga0496124_0000058 3300048927 Bacteria 242191
585 Ga0496124_0000246 3300048927 Bacteria 104777
586 Ga0496124_0000496 3300048927 Bacteria 67552
587 Ga0496124_0003737 3300048927 Bacteria 18344
588 Ga0496124_0004258 3300048927 Bacteria 16840
589 Ga0496124_0026202 3300048927 Bacteria 5262
590 Ga0496124_0036782 3300048927 Bacteria 4264
591 Ga0496124_0112630 3300048927 Bacteria 2187
592 Ga0496125_0001072 3300048928 Bacteria 42178
593 Ga0496125_0003468 3300048928 Bacteria 19086
594 Ga0496125_0004263 3300048928 Bacteria 16642
595 Ga0496125_0006018 3300048928 Bacteria 13270
596 Ga0496125_0015281 3300048928 Bacteria 7431
597 Ga0496125_0077588 3300048928 Bacteria 2559
598 Ga0496125_0100461 3300048928 Bacteria 2132
599 Ga0496126_0009982 3300048929 Bacteria 10024
600 Ga0496126_0010751 3300048929 Bacteria 9556
601 Ga0496126_0027891 3300048929 Bacteria 5386
602 Ga0496126_0321621 3300048929 Bacteria 1271
603 Ga0495678_000134 3300049459 Bacteria 88060
604 Ga0495678_001292 3300049459 Bacteria 20223
605 Ga0495678_110098 3300049459 Bacteria 940
606 Ga0495682_0000017 3300049460 Bacteria 233333
607 Ga0495682_0000424 3300049460 Bacteria 29663
608 Ga0501319_002409 3300049535 Bacteria 1182
609 Ga0501031_0167030 3300049568 Bacteria 1438
610 Ga0501033_0081147 3300049570 Bacteria 2379
611 Ga0501034_0000370 3300049571 Bacteria 76588
612 Ga0501034_0147031 3300049571 Bacteria 2334
613 Ga0501039_0050285 3300049575 Bacteria 3224
614 Ga0501040_0039070 3300049576 Bacteria 3227
615 Ga0501040_0373063 3300049576 Bacteria 1023
616 Ga0501041_0204072 3300049577 Bacteria 1239
617 Ga0501046_0284194 3300049580 Bacteria 1211
618 Ga0501047_0317461 3300049581 Bacteria 1398
619 Ga0501068_0065564 3300049584 Bacteria 2211
620 Ga0501071_0137832 3300049587 Bacteria 1816
621 Ga0501075_0069211 3300049591 Bacteria 2667
622 Ga0501081_0373077 3300049743 Bacteria 1053
623 Ga0501035_0035332 3300049822 Bacteria 4536
624 Ga0501044_0003067 3300049823 Bacteria 18910
625 Ga0501226_000079 3300049853 Bacteria 29272
626 nmdc:mga00v17_46703_c1 3300050491 Bacteria 2621
627 nmdc:mga00v17_50996_c1 3300050491 Bacteria 2516
628 Ga0500643_057712 3300053087 Bacteria 1095
629 Ga0500621_000048 3300053126 Bacteria 15257
630 2506576817 2506520007 Bacteria 5442880
631 2506581955 2506520008 Bacteria 5443009
632 2508850784 2508501071 Bacteria 5454741
633 2510284006 2510065053 Bacteria 5005518
634 2510293321 2510065055 Bacteria 5037935
635 2510312813 2510065058 Bacteria 5005894
636 2511253962 2511231004 Bacteria 6669789
637 2511274248 2511231007 Bacteria 6306603
638 2511277052 2511231008 Bacteria 6624100
639 2511289983 2511231010 Bacteria 6373152
640 2511297646 2511231011 Bacteria 6149768
641 2511300622 2511231012 Bacteria 6738011
642 2511315597 2511231014 Bacteria 6462302
643 2511329238 2511231016 Bacteria 6704427
644 2511332375 2511231017 Bacteria 6503007
645 2511336604 2511231018 Bacteria 6436256
646 2511346054 2511231019 Bacteria 6520662
647 2511352767 2511231020 Bacteria 6115223
648 2511355797 2511231021 Bacteria 7302637
649 2511362578 2511231022 Bacteria 6719296
650 2511375311 2511231024 Bacteria 5835885
651 2511382085 2511231025 Bacteria 5324661
652 2511437459 2511231035 Bacteria 5341610
653 2511823048 2511231156 Bacteria 6845832
654 2538425749 2537561728 Bacteria 5149301
655 2547698711 2547132181 Bacteria 4945084
656 2548652251 2547132416 Bacteria 4633861
657 2555247755 2554235231 Bacteria 5215788
658 2555258217 2554235234 Bacteria 5762085
659 2562463920 2561511199 Bacteria 5155034
660 2566035415 2565956521 Bacteria 4468993
661 2585826114 2585427591 Bacteria 5482980
662 2585831898 2585427592 Bacteria 5370892
663 2597865781 2597489888 Bacteria 6179543
664 2597871597 2597489889 Bacteria 6297495
665 2599328390 2599185155 Bacteria 5827168
666 2599355057 2599185160 Bacteria 6844013
667 2599361119 2599185161 Bacteria 6960462
668 2599367441 2599185162 Bacteria 6957254
669 2599374231 2599185163 Bacteria 6995158
670 2599380163 2599185164 Bacteria 6841688
671 2599386610 2599185165 Bacteria 6843250
672 2599393089 2599185166 Bacteria 6959206
673 2599399866 2599185167 Bacteria 6353609
674 2599404856 2599185168 Bacteria 6997636
675 2599412824 2599185169 Bacteria 5441380
676 2599452649 2599185179 Bacteria 6611171
677 2599461891 2599185181 Bacteria 6844519
678 2599467066 2599185182 Bacteria 6883168
679 2599491016 2599185186 Bacteria 6831633
680 2599501154 2599185188 Bacteria 6164180
681 2599508266 2599185189 Bacteria 5862825
682 2599514320 2599185190 Bacteria 6285678
683 2599521556 2599185191 Bacteria 6297582
684 2599613885 2599185212 Bacteria 6765997
685 2599770775 2599185248 Bacteria 6696816
686 2599881914 2599185288 Bacteria 6666191
687 2599886653 2599185289 Bacteria 6778765
688 2599893696 2599185290 Bacteria 6289611
689 2599897022 2599185291 Bacteria 6775623
690 2599928897 2599185299 Bacteria 4854625
691 2599934710 2599185300 Bacteria 6062622
692 2599943024 2599185302 Bacteria 5954930
693 2599951688 2599185303 Bacteria 6512725
694 2599953937 2599185304 Bacteria 5951361
695 2599959447 2599185305 Bacteria 6748700
696 2599968032 2599185306 Bacteria 6637356
697 2599974213 2599185307 Bacteria 6194719
698 2599979245 2599185308 Bacteria 6621546
699 2599985320 2599185309 Bacteria 5969593
700 2599987244 2599185310 Bacteria 6014457
701 2599995446 2599185311 Bacteria 6354990
702 2599999927 2599185312 Bacteria 5912071
703 2600008814 2599185313 Bacteria 6658188
704 2600013130 2599185314 Bacteria 6621749
705 2600016642 2599185315 Bacteria 6771107
706 2600025337 2599185316 Bacteria 6320029
707 2600029607 2599185317 Bacteria 6435722
708 2600035501 2599185318 Bacteria 6961590
709 2600041348 2599185319 Bacteria 6637840
710 2600045571 2599185320 Bacteria 5963263
711 2600056612 2599185321 Bacteria 6764560
712 2600058478 2599185322 Bacteria 6763055
713 2600063853 2599185323 Bacteria 6688755
714 2600074154 2599185324 Bacteria 6590677
715 2600079818 2599185325 Bacteria 6324919
716 2600214513 2599185356 Bacteria 6843884
717 2600358285 2600254930 Bacteria 6431253
718 2601525706 2600255254 Bacteria 5281859
719 2601528002 2600255255 Bacteria 5282785
720 2601533313 2600255256 Bacteria 5597742
721 2601538677 2600255257 Bacteria 5597196
722 2601614836 2600255280 Bacteria 5292309
723 2601620239 2600255281 Bacteria 5288753
724 2601626344 2600255283 Bacteria 6061572
725 2601646007 2600255287 Bacteria 5210468
726 2601648641 2600255288 Bacteria 5282738
727 2601652891 2600255289 Bacteria 5281907
728 2601658992 2600255290 Bacteria 5282218
729 2601666003 2600255291 Bacteria 5217298
730 2601692771 2600255296 Bacteria 5784754
731 2601698964 2600255298 Bacteria 5215185
732 2601703872 2600255299 Bacteria 5218662
733 2601705542 2600255300 Bacteria 5287774
734 2601711131 2600255301 Bacteria 5280532
735 2601716145 2600255302 Bacteria 5288235
736 2601723806 2600255303 Bacteria 5219315
737 2601726551 2600255304 Bacteria 5283973
738 2601731091 2600255305 Bacteria 5282329
739 2601736107 2600255306 Bacteria 5281613
740 2601743428 2600255307 Bacteria 5439064
741 2601754214 2600255309 Bacteria 5431045
742 2601757026 2600255310 Bacteria 5600903
743 2601761519 2600255311 Bacteria 5598766
744 2601774782 2600255313 Bacteria 6842543
745 2601800090 2600255318 Bacteria 6383414
746 2602021160 2600255392 Bacteria 5437392
747 2603641669 2602042046 Bacteria 5483348
748 2603643761 2602042047 Bacteria 4697674
749 2603658942 2602042052 Bacteria 5215873
750 2603663730 2602042053 Bacteria 5214361
751 2603701035 2602042066 Bacteria 4423871
752 2603704294 2602042067 Bacteria 4863713
753 2603838489 2602042103 Bacteria 5284714
754 2603844255 2602042104 Bacteria 5281639
755 2603848640 2602042105 Bacteria 5282303
756 2603853713 2602042106 Bacteria 5282744
757 2603865057 2602042109 Bacteria 5152801
758 2603871766 2602042110 Bacteria 5283285
759 2603879323 2602042111 Bacteria 5212080
760 2606048955 2603880178 Bacteria 5283018
761 2606068156 2603880184 Bacteria 5217896
762 2606074645 2603880185 Bacteria 6379190
763 2606127508 2603880199 Bacteria 6377649
764 2606146632 2603880202 Bacteria 5284684
765 2606176360 2603880211 Bacteria 5284226
766 2608670909 2608642108 Bacteria 4104624
767 2609914486 2609459761 Bacteria 5513740
768 2621297756 2619619299 Bacteria 6649820
769 2624478837 2623620443 Bacteria 6427864
770 2624494120 2623620446 Bacteria 6500345
771 2637223818 2636415599 Bacteria 5718434
772 2643842464 2643221565 Bacteria 6216018
773 2643873642 2643221571 Bacteria 6228673
774 2643955326 2643221589 Bacteria 6250934
775 2644023678 2643221602 Bacteria 6249926
776 2644188146 2643221633 Bacteria 6733554
777 2644281571 2643221650 Bacteria 7029547
778 2644623436 2643221713 Bacteria 6554480
779 2649121388 2648501241 Bacteria 5312320
780 2650897506 2648501693 Bacteria 5069560
781 2652548216 2651869719 Bacteria 6047974
782 2652974494 2651869818 Bacteria 5864031
783 2656276213 2654587920 Bacteria 5475511
784 2671094479 2667528170 Bacteria 6786960
785 2671097658 2667528171 Bacteria 6900659
786 2671104022 2667528172 Bacteria 5170840
787 2671109666 2667528173 Bacteria 5375747
788 2671127908 2667528176 Bacteria 6724917
789 2671588421 2671180115 Bacteria 5353919
790 2676409573 2675903046 Bacteria 5451247
791 2677897942 2675903420 Bacteria 6247433
792 2678261579 2675903515 Bacteria 6580491
793 2681998543 2681812866 Bacteria 4552357
794 2682007650 2681812869 Bacteria 5014465
795 2686354882 2684622997 Bacteria 4624240
796 2689443212 2687453601 Bacteria 5546041
797 2707100043 2706794495 Bacteria 4536932
798 2712472645 2711768156 Bacteria 4471618
799 2715757554 2713897149 Bacteria 6506249
800 2723250513 2721755607 Bacteria 5841722
801 2738670892 2738541265 Bacteria 6594665
802 2738689872 2738541271 Bacteria 5657310
803 2738749286 2738541282 Bacteria 6593925
804 2738811304 2738541294 Bacteria 6925949
805 2738858327 2738541303 Bacteria 6591772
806 2738898664 2738541309 Bacteria 6926455
807 2739196581 2738543004 Bacteria 6381073
808 2739257560 2738543015 Bacteria 6750701
809 2739265646 2738543016 Bacteria 5657564
810 2739286505 2738543020 Bacteria 5718238
811 2739291818 2738543021 Bacteria 5718241
812 2745007928 2744054620 Bacteria 6551379
813 2753857184 2751185917 Bacteria 4551186
814 2765582247 2765235841 Bacteria 6137024
815 2765590283 2765235842 Bacteria 4799256
816 2772437369 2772190666 Bacteria 5117644
817 2774122183 2773857670 Bacteria 6407454
818 2774131952 2773857672 Bacteria 4993178
819 2774136684 2773857673 Bacteria 6513460
820 2775539775 2775506706 Bacteria 4873073
821 2777020098 2775507074 Bacteria 5532402
822 2784260436 2784132063 Bacteria 6262788
823 2784314428 2784132072 Bacteria 6596533
824 2791925379 2791354903 Bacteria 4937680
825 2792314319 2791355010 Bacteria 4864581
826 2793404511 2791355275 Bacteria 4429597
827 2794594376 2791355520 Bacteria 5948615
828 2807177571 2806310673 Bacteria 4801221
829 2807409883 2806310737 Bacteria 5751088
830 2807458231 2806310745 Bacteria 5742165
831 2808854100 2808606361 Bacteria 6136259
832 2808906921 2808606373 Bacteria 4423627
833 2808923391 2808606376 Bacteria 6248667
834 2808928738 2808606377 Bacteria 6646337
835 2808934132 2808606378 Bacteria 6177535
836 2808945334 2808606380 Bacteria 6248705
837 2808950859 2808606381 Bacteria 6646461
838 2808956662 2808606382 Bacteria 6841132
839 2808962467 2808606383 Bacteria 6138645
840 2808980209 2808606385 Bacteria 6711065
841 2808995968 2808606388 Bacteria 6706662
842 2808997492 2808606389 Bacteria 6138126
843 2809126404 2808606414 Bacteria 4917181
844 2809215778 2808606445 Bacteria 6057339
845 2812370900 2811994881 Bacteria 6298475
846 2813727523 2811995292 Bacteria 5303342
847 2814695068 2814123068 Bacteria 5687681
848 2817493110 2816332298 Bacteria 6852809
849 2819658394 2818991456 Bacteria 6123676
850 2819702741 2818991464 Bacteria 6907494
851 2821120144 2821118458 Bacteria 4714306
852 2823378567 2823373977 Bacteria 4779415
853 2825653697 2825651385 Bacteria 6715909
854 2826584152 2826581358 Bacteria 5963467
855 2834034207 2834028612 Bacteria 6354979
856 2842808874 2842805378 Bacteria 5385175
857 2842820918 2842815866 Bacteria 5947510
858 2842829738 2842826826 Bacteria 5974129
859 2842843190 2842837860 Bacteria 6066181
860 2842849673 2842849001 Bacteria 5924277
861 2842857252 2842854478 Bacteria 6143501
862 2844428623 2844425489 Bacteria 4854065
863 2844530387 2844528606 Bacteria 4733806
864 2844668559 2844665904 Bacteria 6817974
865 2846541030 2846540461 Bacteria 5471451
866 2847086115 2847085930 Bacteria 5070450
867 2847798566 2847797336 Bacteria 5176640
868 2852105679 2852103415 Bacteria 5193810
869 2852612505 2852612431 Bacteria 6885235
870 2852662704 2852657418 Bacteria 6472974
871 2852669759 2852667396 Bacteria 6885555
872 2854603779 2854601825 Bacteria 4797592
873 2855198273 2855195626 Bacteria 4927512
874 2858467993 2858466076 Bacteria 4722413
875 2860340619 2860339153 Bacteria 6846989
876 2860872196 2860867994 Bacteria 5645326
877 2865016256 2865014394 Bacteria 4764573
878 2869552618 2869551831 Bacteria 5474685
879 2871275863 2871272651 Bacteria 5042015
880 2871283770 2871282230 Bacteria 4917173
881 2876601593 2876601092 Bacteria 5114497
882 2878030801 2878029506 Bacteria 6418441
883 2880231716 2880230671 Bacteria 6140320
884 2881613914 2881609920 Bacteria 4405319
885 2884087554 2884086401 Bacteria 5005459
886 2888367416 2888366609 Bacteria 5155009
887 2888374892 2888373701 Bacteria 5098052
888 2891673387 2891670763 Bacteria 4967099
889 2904478086 2904474040 Bacteria 5504324
890 2904506870 2904504865 Bacteria 5152820
891 2904518166 2904513164 Bacteria 5476410
892 2904520750 2904518522 Bacteria 6068986
893 2904553078 2904550169 Bacteria 6221258
894 2908451701 2908446538 Bacteria 6829095
895 2908672231 2908669403 Bacteria 5740494
896 2912964895 2912963787 Bacteria 5646108
897 2913037920 2913036834 Bacteria 6704877
898 2916180227 2916178963 Bacteria 5265078
899 2917071819 2917070673 Bacteria 6868303
900 2917836072 2917832318 Bacteria 5346010
901 2919064693 2919063839 Bacteria 6302690
902 2919113936 2919108558 Bacteria 5897419
903 2919128221 2919125081 Bacteria 5385106
904 2919153950 2919150387 Bacteria 5500879
905 2919160184 2919155634 Bacteria 4860545
906 2919458264 2919456309 Bacteria 6586567
907 2919482827 2919481497 Bacteria 6907839
908 2919495659 2919493220 Bacteria 4598500
909 2919498747 2919497567 Bacteria 4408621
910 2919544626 2919543075 Bacteria 4728703
911 2919689991 2919688452 Bacteria 4595932
912 2919699964 2919697872 Bacteria 6553725
913 2923525005 2923519811 Bacteria 6298479
914 2923527013 2923525760 Bacteria 4472324
915 2923591768 2923586266 Bacteria 6565975
916 2923636183 2923634449 Bacteria 4753480
917 2927147487 2927143783 Bacteria 5504251
918 2927837327 2927833300 Bacteria 4923934
919 2929145372 2929144301 Bacteria 6622272
920 2929194310 2929189879 Bacteria 5930554
921 2931371288 2931369376 Bacteria 6847892
922 2931395582 2931390751 Bacteria 6273349
923 2931399478 2931396565 Bacteria 7251677
924 2932410329 2932406140 Bacteria 5134491
925 2935353992 2935353572 Unclassified 6955622
926 2935629178 2935625433 Bacteria 5042964
927 2937543932 2937539931 Bacteria 4639830
928 2937970586 2937967321 Bacteria 5094075
929 2939570927 2939568625 Bacteria 4542555
930 2939577357 2939573065 Bacteria 4926053
931 2939582407 2939577877 Bacteria 5132791
932 2939604492 2939602548 Bacteria 4950493
933 2939609948 2939607340 Bacteria 4719256
934 2939621782 2939617950 Bacteria 4820956
935 2939637046 2939636861 Bacteria 6297853
936 2939645037 2939642701 Bacteria 4475280
937 2939653253 2939651529 Bacteria 5895393
938 2945876461 2945874760 Bacteria 5527237
939 2945931747 2945928738 Bacteria 6053221
940 2945951813 2945951305 Bacteria 4918162
941 2945961384 2945961074 Bacteria 7342064
942 2946007830 2946006987 Bacteria 6705746
943 2946032795 2946027586 Bacteria 6049274
944 2947233554 2947233263 Bacteria 6439278
945 2969080829 2969079654 Bacteria 5439582
946 2971822225 2971820967 Bacteria 5823634
947 2974301377 2974298342 Bacteria 4840922
948 2974315514 2974310843 Bacteria 4947816
949 2974439686 2974435778 Bacteria 4876478
950 2978978350 2978975091 Bacteria 4704313
951 2984495385 2984494565 Bacteria 5000175
952 2984503856 2984499530 Bacteria 5020881
953 2984507561 2984504281 Bacteria 5262371
954 2984563290 2984559226 Bacteria 5683096
955 2984596025 2984595703 Bacteria 5682994
956 2988732916 2988728565 Bacteria 6124362
957 2990200576 2990196909 Bacteria 4054280
958 2990265095 2990261002 Bacteria 4919493
959 3000378062 3000376612 Bacteria 4705565
960 3007512443 3007511990 Bacteria 6481491
961 3007624334 3007619802 Bacteria 6411688
962 3007721430 3007718800 Bacteria 5971527
963 3007803761 3007803356 Bacteria 5931491
964 3007871270 3007866637 Bacteria 5899198
965 3007876204 3007872151 Bacteria 5268868
966 637318436 637000220 Bacteria 7074893
967 640936369 640753048 Bacteria 5495657
968 8004597681 8004592986 Bacteria 5122074
969 8011354296 8011350971 Bacteria 6158957
970 8015399069 8015394850 Bacteria 5064660
971 8016730309 8016728285 Bacteria 5263933
972 8016734739 8016733728 Bacteria 5274317
973 8018222666 8018221730 Bacteria 4616064
974 8018405299 8018405270 Bacteria 4978981
975 8019503798 8019499862 Bacteria 5169538
976 8019508900 8019504834 Bacteria 4819156
977 8019773305 8019769354 Bacteria 6924660
978 8019776630 8019775933 Bacteria 6858656
979 8052495698 8052494512 Bacteria 5765634
980 8054286175 8054285046 Bacteria 6919322
981 8054351137 8054347763 Bacteria 5901107
982 8054508096 8054503363 Bacteria 6101651
983 8054847735 8054844752 Bacteria 4450330
984 8054851566 8054849141 Bacteria 5232694
985 8054929508 8054929484 Bacteria 5599761
986 8055088487 8055087960 Bacteria 4784273
987 8055096855 8055092621 Bacteria 4873875
988 8055098206 8055097453 Bacteria 4865496
989 8055694754 8055693939 Bacteria 4772047
990 8055823049 8055817908 Bacteria 6609162
991 8055883259 8055878733 Bacteria 5907058
992 8056120234 8056115690 Bacteria 5527654
993 8056121916 8056120720 Bacteria 5758328
994 8056130798 8056125926 Bacteria 6228218
995 8056136463 8056131705 Bacteria 6107031
996 8056141858 8056137416 Bacteria 6147080
997 8056147909 8056143049 Bacteria 6307666
998 8056153493 8056148874 Bacteria 6479865
999 8056155572 8056155041 Bacteria 6486948
1000 8056162716 8056161164 Bacteria 6106669
1001 8056176116 8056172158 Bacteria 6133900
1002 8056183413 8056177738 Bacteria 6748268
1003 8056569718 8056569372 Bacteria 5997322
1004 8057163339 8057160832 Bacteria 3268302
1005 8057305436 8057304971 Bacteria 4649742
1006 8057803333 8057798959 Bacteria 6713499
1007 Ga0058692_1012258
1008 MRS2a_Contig_908
1009 JGI24741J21665_1007693
1010 JGI24739J22299_10000495
1011 JGI25154J39366_1004064
1012 JGI25163J39215_1000022
1013 JGI25164J39214_1000008
1014 JGI25164J39214_1000100
1015 JGI25152J39213_1000802
1016 JGI25165J46597_1000207
1017 rootH2_10027710
1018 rootL2_10202333
1019 Ga0055538_1000014
1020 Ga0055538_1000028
1021 Ga0055539_1000020
1022 Ga0055539_1000037
1023 Ga0055533_1000027
1024 Ga0055533_1000047
1025 Ga0055532_1000129
1026 Ga0055525_1000032
1027 Ga0055525_1000443
1028 Ga0055536_1003337
1029 Ga0055536_1011775
1030 Ga0055530_10007005
1031 Ga0055530_10030977
1032 Ga0055531_10006469
1033 Ga0055541_1000014
1034 Ga0055541_1000025
1035 Ga0058692_1006453
1036 Ga0058692_1017030
1037 Ga0058860_10094053
1038 Ga0058860_10169596
1039 Ga0058860_10195578
1040 Ga0058860_12165330
1041 Ga0058860_12187468
1042 Ga0065703_1020270
1043 Ga0065714_10000238
1044 Ga0065714_10081923
1045 Ga0065714_10087702
1046 Ga0065704_10000888
1047 Ga0065704_10002842
1048 Ga0065704_10004084
1049 Ga0065704_10026246
1050 Ga0065704_10090186
1051 Ga0065704_10139924
1052 Ga0065712_10003691
1053 Ga0065712_10067863
1054 Ga0065712_10079070
1055 Ga0065715_10133975
1056 Ga0070661_100000022
1057 Ga0070669_100001703
1058 Ga0070669_100005661
1059 Ga0070694_100087223
1060 Ga0070662_100000041
1061 Ga0070662_100004331
1062 Ga0070698_100135638
1063 Ga0068853_100007800
1064 Ga0070696_100279255
1065 Ga0070665_100007341
1066 Ga0070665_100010625
1067 Ga0070665_100083166
1068 Ga0070664_100000646
1069 Ga0068857_100073160
1070 Ga0068857_100216748
1071 Ga0068854_100020986
1072 Ga0070702_100155902
1073 Ga0068859_100015807
1074 Ga0068851_10000044
1075 Ga0068851_10012067
1076 Ga0068851_10064435
1077 Ga0081538_10087104
1078 Ga0075364_10007670
1079 Ga0075364_10020296
1080 Ga0075364_10326818
1081 Ga0070715_10018108
1082 Ga0075367_10416592
1083 Ga0075434_100202485
1084 Ga0097620_100015807
1085 Ga0099823_1000054
1086 Ga0079104_1000720
1087 Ga0079104_1000769
1088 Ga0079104_1002016
1089 Ga0079104_1015557
1090 Ga0079104_1020880
1091 Ga0079104_1027141
1092 Ga0099794_10005207
1093 Ga0105251_10000151
1094 Ga0105251_10000156
1095 Ga0105251_10001256
1096 Ga0105251_10007540
1097 Ga0105251_10029112
1098 Ga0105251_10050570
1099 Ga0105251_10057196
1100 Ga0105251_10059849
1101 Ga0105251_10126641
1102 Ga0105251_10158084
1103 Ga0105244_10000272
1104 Ga0105244_10000338
1105 Ga0105244_10000932
1106 Ga0105244_10002378
1107 Ga0105244_10003891
1108 Ga0105244_10004865
1109 Ga0105244_10010841
1110 Ga0105244_10049440
1111 Ga0105244_10075100
1112 Ga0105244_10115292
1113 Ga0105244_10126386
1114 Ga0105244_10141536
1115 Ga0105244_10182263
1116 Ga0105244_10189344
1117 Ga0105250_10000042
1118 Ga0105250_10000542
1119 Ga0105250_10000611
1120 Ga0105250_10001268
1121 Ga0105250_10001773
1122 Ga0105250_10003580
1123 Ga0105250_10039616
1124 Ga0105250_10094222
1125 Ga0105250_10130066
1126 Ga0105245_10155601
1127 Ga0105247_10000301
1128 Ga0105247_10469645
1129 Ga0105243_10010660
1130 Ga0105243_10024754
1131 Ga0105243_10238632
1132 Ga0105243_10242685
1133 Ga0105243_10361702
1134 Ga0105241_10000008
1135 Ga0105242_10007385
1136 Ga0105242_10201976
1137 Ga0105248_10027748
1138 Ga0105237_10001243
1139 Ga0105237_10174419
1140 Ga0130087_1027949
1141 Ga0105246_10056158
1142 Ga0157373_10000463
1143 Ga0157373_10063629
1144 Ga0157373_10064357
1145 Ga0157373_10146750
1146 Ga0157373_10155477
1147 Ga0157371_10001001
1148 Ga0157371_10001008
1149 Ga0157371_10002245
1150 Ga0157371_10023605
1151 Ga0157370_10002229
1152 Ga0157370_10002252
1153 Ga0157370_10004489
1154 Ga0157370_10006004
1155 Ga0157370_10033837
1156 Ga0157370_10045091
1157 Ga0157369_10000956
1158 Ga0157369_10038217
1159 Ga0163162_10044620
1160 Ga0163162_10163690
1161 Ga0163162_10279941
1162 Ga0157372_10004322
1163 Ga0157372_10008877
1164 Ga0157372_10070044
1165 Ga0157372_10152976
1166 Ga0157372_10512069
1167 Ga0157372_10551068
1168 Ga0157380_10371786
1169 Ga0157380_10855410
1170 Ga0182008_10001425
1171 Ga0182006_1000069
1172 Ga0183366_1002
1173 Ga0183370_1002
1174 Ga0183369_1002
1175 Ga0183368_1005
1176 Ga0163161_10000002
1177 Ga0163161_10051926
1178 Ga0163161_10060323
1179 Ga0206356_11158939
1180 Ga0206351_10013078
1181 Ga0206352_10402763
1182 Ga0206354_10196568
1183 Ga0206354_10826925
1184 Ga0154015_1698326
1185 Ga0213876_10000444
1186 Ga0224712_10079925
1187 Ga0256714_107509
1188 Ga0256744_141414
1189 Ga0209435_100363
1190 Ga0209760_100086
1191 Ga0209760_100463
1192 Ga0209784_100030
1193 Ga0209784_100032
1194 Ga0209566_100034
1195 Ga0209566_100036
1196 Ga0209674_100052
1197 Ga0209674_100054
1198 Ga0209147_100055
1199 Ga0209563_100054
1200 Ga0209563_100055
1201 Ga0207427_100001
1202 Ga0207427_100035
1203 Ga0209437_100003
1204 Ga0209437_100068
1205 Ga0209437_100110
1206 Ga0209258_100231
1207 Ga0207425_1019345
1208 Ga0209646_1000331
1209 Ga0209677_100032
1210 Ga0209677_100033
1211 Ga0209759_1010939
1212 Ga0209129_1000103
1213 Ga0209233_1000007
1214 Ga0209565_1038113
1215 Ga0209675_1006388
1216 Ga0209676_1000078
1217 Ga0209676_1000503
1218 Ga0209050_1000041
1219 Ga0209050_1000060
1220 Ga0209050_1000425
1221 Ga0209051_1000037
1222 Ga0209051_1000061
1223 Ga0209051_1000085
1224 Ga0209257_1000635
1225 Ga0209257_1011547
1226 Ga0207656_10000022
1227 Ga0207656_10004274
1228 Ga0207696_1000008
1229 Ga0207696_1000009
1230 Ga0207696_1000027
1231 Ga0207696_1000032
1232 Ga0207696_1000034
1233 Ga0207696_1000129
1234 Ga0207696_1000187
1235 Ga0207696_1000262
1236 Ga0207696_1000278
1237 Ga0207696_1001031
1238 Ga0207696_1001146
1239 Ga0207696_1001494
1240 Ga0207696_1002195
1241 Ga0207696_1003240
1242 Ga0207696_1006426
1243 Ga0207696_1006575
1244 Ga0207655_1000020
1245 Ga0207655_1000054
1246 Ga0207655_1000103
1247 Ga0207655_1000357
1248 Ga0207655_1000408
1249 Ga0207655_1000569
1250 Ga0207655_1000721
1251 Ga0207655_1000752
1252 Ga0207655_1000828
1253 Ga0207655_1001231
1254 Ga0207655_1001348
1255 Ga0207655_1006303
1256 Ga0207655_1007027
1257 Ga0207655_1007625
1258 Ga0207655_1007768
1259 Ga0207655_1014196
1260 Ga0207655_1017833
1261 Ga0207655_1024660
1262 Ga0207655_1036293
1263 Ga0207655_1077163
1264 Ga0207713_1000014
1265 Ga0207713_1000028
1266 Ga0207713_1000123
1267 Ga0207713_1000129
1268 Ga0207713_1000163
1269 Ga0207713_1000223
1270 Ga0207713_1001297
1271 Ga0207713_1004295
1272 Ga0207713_1005559
1273 Ga0207713_1005686
1274 Ga0207713_1006908
1275 Ga0207713_1007366
1276 Ga0207713_1008261
1277 Ga0207713_1009429
1278 Ga0207713_1033358
1279 Ga0207713_1037467
1280 Ga0207713_1049253
1281 Ga0207710_10000061
1282 Ga0207685_10039892
1283 Ga0207654_10000009
1284 Ga0207695_10164949
1285 Ga0207671_10000034
1286 Ga0207671_10109162
1287 Ga0207649_10000006
1288 Ga0207681_10000978
1289 Ga0207681_10390162
1290 Ga0207650_10000092
1291 Ga0207706_10003133
1292 Ga0207706_10061623
1293 Ga0207686_10001893
1294 Ga0207686_10032842
1295 Ga0207709_10004825
1296 Ga0207709_10014581
1297 Ga0207709_10050415
1298 Ga0207709_10060080
1299 Ga0207669_10245343
1300 Ga0207689_10305707
1301 Ga0207679_10000010
1302 Ga0207668_10007234
1303 Ga0207639_10005461
1304 Ga0207708_10361060
1305 Ga0207674_10088438
1306 Ga0207674_10103126
1307 Ga0209281_1000010
1308 Ga0209281_1000049
1309 Ga0209281_1000054
1310 Ga0209281_1000056
1311 Ga0209281_1000371
1312 Ga0209281_1000505
1313 Ga0209281_1000576
1314 Ga0209281_1000683
1315 Ga0209281_1001352
1316 Ga0209281_1013772
1317 Ga0209281_1022875
1318 Ga0209389_1000002
1319 Ga0209371_1000013
1320 Ga0209371_1000049
1321 Ga0209371_1000572
1322 Ga0209371_1000582
1323 Ga0209371_1000935
1324 Ga0209371_1001075
1325 Ga0209371_1001276
1326 Ga0209371_1002216
1327 Ga0209371_1002307
1328 Ga0209371_1002649
1329 Ga0209371_1002734
1330 Ga0209371_1014808
1331 Ga0209371_1018024
1332 Ga0209371_1022298
1333 Ga0209981_1003851
1334 Ga0209981_1006084
1335 Ga0209984_1009488
1336 Ga0209999_1007990
1337 Ga0210002_1012214
1338 Ga0209983_1004310
1339 Ga0209971_1042692
1340 Ga0209966_1003526
1341 Ga0207428_10151233
1342 Ga0268266_10000211
1343 Ga0268266_10052890
1344 Ga0311001_1010284
1345 Ga0268256_1000014
1346 Ga0268256_1000031
1347 Ga0268256_1000227
1348 Ga0268256_1000499
1349 Ga0268256_1001137
1350 Ga0268256_1001942
1351 Ga0268256_1002473
1352 Ga0268256_1003008
1353 Ga0268256_1005389
1354 Ga0268256_1019845
1355 Ga0268256_1020097
1356 Ga0316177_1087706
1357 Ga0316183_1016295
1358 Ga0265328_10000016
1359 Ga0307408_100298698
1360 Ga0307408_100392243
1361 Ga0316575_10000446
1362 Ga0316575_10011572
1363 Ga0316579_10000802
1364 Ga0316579_10022759
1365 Ga0316579_10197790
1366 Ga0265314_10121058
1367 Ga0307413_10060321
1368 Ga0307412_10413110
1369 Ga0307416_100350680
1370 Ga0316585_10004730
1371 Ga0316593_10000082
1372 Ga0316593_10014396
1373 Ga0316593_10024525
1374 Ga0316593_10026492
1375 Ga0316593_10032846
1376 Ga0316593_10067079
1377 Ga0373936_0117312
1378 Ga0316574_0222461
1379 Ga0373935_0065766
1380 Ga0373935_0313854
1381 Ga0373927_0038654
1382 Ga0373937_0345012
1383 Ga0316582_0002520
1384 Ga0316584_0304221
1385 Ga0373925_0041279
1386 Ga0316581_0073803
1387 Ga0400483_105112
1388 Ga0400483_213263
1389 Ga0436365_1801698
1390 Ga0439436_0000220
1391 Ga0439438_000042
1392 Ga0439438_003009
1393 Ga0439438_004922
1394 Ga0439438_004959
1395 Ga0439438_007456
1396 Ga0439438_008294
1397 Ga0439447_000338
1398 Ga0439447_001723
1399 Ga0439447_005050
1400 Ga0439447_005875
1401 Ga0439466_0000004
1402 Ga0439466_0003385
1403 Ga0451789_0093147
1404 Ga0451797_1445638
1405 Ga0451805_097769
1406 Ga0451807_0192210
1407 Ga0451835_0706369
1408 Ga0451853_0953173
1409 Ga0451853_1281195
1410 Ga0452268_32449
1411 Ga0439431_0003975
1412 Ga0439441_002360
1413 Ga0439443_024958
1414 Ga0439432_003406
1415 Ga0439432_008690
1416 Ga0439432_014747
1417 Ga0439432_028853
1418 Ga0439452_000009
1419 Ga0439452_000013
1420 Ga0439452_000094
1421 Ga0439452_000121
1422 Ga0439455_0044352
1423 Ga0439456_008965
1424 Ga0439463_003608
1425 Ga0450911_000317
1426 Ga0450923_009020
1427 Ga0450900_001029
1428 Ga0450902_004495
1429 Ga0450904_000557
1430 Ga0450905_013876
1431 Ga0450907_000648
1432 Ga0439446_0002391
1433 Ga0439446_0002561
1434 Ga0439435_0000397
1435 Ga0439459_0002610
1436 Ga0439464_0002684
1437 Ga0439460_0000842
1438 Ga0450893_0002336
1439 Ga0450893_0015838
1440 Ga0466981_0000032
1441 Ga0495627_000177
1442 Ga0495627_005014
1443 Ga0495591_000222
1444 Ga0495591_000590
1445 Ga0495591_001740
1446 Ga0495591_005309
1447 Ga0495591_037354
1448 Ga0495650_0000008
1449 Ga0495650_0000059
1450 Ga0495650_0000120
1451 Ga0495605_0000235
1452 Ga0495605_0026549
1453 Ga0495584_0003803
1454 Ga0495585_0023719
1455 Ga0495594_0002336
1456 Ga0495596_0009946
1457 Ga0495607_0000756
1458 Ga0495607_0038294
1459 Ga0495583_0000389
1460 Ga0495606_0008629
1461 Ga0495610_0014899
1462 Ga0495620_0000003
1463 Ga0495620_0000900
1464 Ga0495632_0003399
1465 Ga0495632_0039573
1466 Ga0495643_0006448
1467 Ga0495643_0025859
1468 Ga0495644_0009743
1469 Ga0495644_0102312
1470 Ga0495648_0009903
1471 Ga0495648_0057910
1472 Ga0495648_0068718
1473 Ga0495654_0000148
1474 Ga0495654_0000218
1475 Ga0495654_0001237
1476 Ga0495654_0007590
1477 Ga0495654_0008728
1478 Ga0495654_0041929
1479 Ga0495654_0072730
1480 Ga0495609_0000006
1481 Ga0495609_0000296
1482 Ga0495621_0036552
1483 Ga0495633_0000309
1484 Ga0495611_0208408
1485 Ga0495625_0119230
1486 Ga0495661_0000224
1487 Ga0495661_0000366
1488 Ga0495588_0172530
1489 Ga0495670_0012315
1490 Ga0495671_0001722
1491 Ga0495671_0024447
1492 Ga0495649_0001477
1493 Ga0495649_0037603
1494 Ga0495649_0112441
1495 Ga0495589_0000023
1496 Ga0495660_0000019
1497 Ga0495660_0000063
1498 Ga0495660_0013204
1499 Ga0495660_0041034
1500 Ga0495660_0055764
1501 Ga0495672_0000003
1502 Ga0495672_0000025
1503 Ga0495672_0000145
1504 Ga0495672_0016757
1505 Ga0495676_0031220
1506 Ga0495676_0071324
1507 Ga0495683_0000105
1508 Ga0495683_0000201
1509 Ga0495683_0007108
1510 Ga0495679_000263
1511 Ga0495679_000535
1512 Ga0495679_001169
1513 Ga0495679_011720
1514 Ga0495673_0000011
1515 Ga0495673_0000176
1516 Ga0495673_0003561
1517 Ga0495681_0047979
1518 Ga0495626_0000413
1519 Ga0496100_0030607
1520 Ga0496100_0034666
1521 Ga0496101_0000624
1522 Ga0496102_0113265
1523 Ga0496104_0017702
1524 Ga0496104_0040576
1525 Ga0496105_0032860
1526 Ga0496105_0070984
1527 Ga0496113_0074743
1528 Ga0496114_0010183
1529 Ga0496114_0843286
1530 Ga0496116_0000015
1531 Ga0496116_0000096
1532 Ga0496116_0001120
1533 Ga0496116_0004381
1534 Ga0496116_0005667
1535 Ga0496116_0042872
1536 Ga0496116_0052156
1537 Ga0496116_0115965
1538 Ga0496117_0000043
1539 Ga0496117_0002805
1540 Ga0496117_0003581
1541 Ga0496117_0036499
1542 Ga0496117_0052208
1543 Ga0496117_0058545
1544 Ga0496117_0070014
1545 Ga0496117_0114350
1546 Ga0496118_0000075
1547 Ga0496118_0003147
1548 Ga0496118_0006965
1549 Ga0496118_0024462
1550 Ga0496118_0024561
1551 Ga0496118_0085790
1552 Ga0496118_0094132
1553 Ga0496118_0185699
1554 Ga0496119_0000207
1555 Ga0496119_0000355
1556 Ga0496119_0003086
1557 Ga0496119_0003653
1558 Ga0496119_0004492
1559 Ga0496119_0009362
1560 Ga0496119_0022030
1561 Ga0496119_0110181
1562 Ga0496120_0002244
1563 Ga0496120_0002287
1564 Ga0496120_0002586
1565 Ga0496120_0003799
1566 Ga0496120_0004827
1567 Ga0496120_0011502
1568 Ga0496120_0017896
1569 Ga0496120_0034663
1570 Ga0496120_0128423
1571 Ga0496121_0003934
1572 Ga0496121_0162610
1573 Ga0496122_0000170
1574 Ga0496122_0000213
1575 Ga0496122_0001232
1576 Ga0496122_0002533
1577 Ga0496122_0006705
1578 Ga0496122_0075834
1579 Ga0496122_0092780
1580 Ga0496122_0246962
1581 Ga0496123_0000058
1582 Ga0496123_0000177
1583 Ga0496123_0001000
1584 Ga0496123_0003285
1585 Ga0496123_0005016
1586 Ga0496123_0005959
1587 Ga0496123_0215385
1588 Ga0496123_0240750
1589 Ga0496124_0000026
1590 Ga0496124_0000058
1591 Ga0496124_0000246
1592 Ga0496124_0000496
1593 Ga0496124_0003737
1594 Ga0496124_0004258
1595 Ga0496124_0026202
1596 Ga0496124_0036782
1597 Ga0496124_0112630
1598 Ga0496125_0001072
1599 Ga0496125_0003468
1600 Ga0496125_0004263
1601 Ga0496125_0006018
1602 Ga0496125_0015281
1603 Ga0496125_0077588
1604 Ga0496125_0100461
1605 Ga0496126_0009982
1606 Ga0496126_0010751
1607 Ga0496126_0027891
1608 Ga0496126_0321621
1609 Ga0495678_000134
1610 Ga0495678_001292
1611 Ga0495678_110098
1612 Ga0495682_0000017
1613 Ga0495682_0000424
1614 Ga0501319_002409
1615 Ga0501031_0167030
1616 Ga0501033_0081147
1617 Ga0501034_0000370
1618 Ga0501034_0147031
1619 Ga0501039_0050285
1620 Ga0501040_0039070
1621 Ga0501040_0373063
1622 Ga0501041_0204072
1623 Ga0501046_0284194
1624 Ga0501047_0317461
1625 Ga0501068_0065564
1626 Ga0501071_0137832
1627 Ga0501075_0069211
1628 Ga0501081_0373077
1629 Ga0501035_0035332
1630 Ga0501044_0003067
1631 Ga0501226_000079
1632 nmdc:mga00v17_46703_c1
1633 nmdc:mga00v17_50996_c1
1634 Ga0500643_057712
1635 Ga0500621_000048
1636 2506576817
1637 2506581955
1638 2508850784
1639 2510284006
1640 2510293321
1641 2510312813
1642 2511253962
1643 2511274248
1644 2511277052
1645 2511289983
1646 2511297646
1647 2511300622
1648 2511315597
1649 2511329238
1650 2511332375
1651 2511336604
1652 2511346054
1653 2511352767
1654 2511355797
1655 2511362578
1656 2511375311
1657 2511382085
1658 2511437459
1659 2511823048
1660 2538425749
1661 2547698711
1662 2548652251
1663 2555247755
1664 2555258217
1665 2562463920
1666 2566035415
1667 2585826114
1668 2585831898
1669 2597865781
1670 2597871597
1671 2599328390
1672 2599355057
1673 2599361119
1674 2599367441
1675 2599374231
1676 2599380163
1677 2599386610
1678 2599393089
1679 2599399866
1680 2599404856
1681 2599412824
1682 2599452649
1683 2599461891
1684 2599467066
1685 2599491016
1686 2599501154
1687 2599508266
1688 2599514320
1689 2599521556
1690 2599613885
1691 2599770775
1692 2599881914
1693 2599886653
1694 2599893696
1695 2599897022
1696 2599928897
1697 2599934710
1698 2599943024
1699 2599951688
1700 2599953937
1701 2599959447
1702 2599968032
1703 2599974213
1704 2599979245
1705 2599985320
1706 2599987244
1707 2599995446
1708 2599999927
1709 2600008814
1710 2600013130
1711 2600016642
1712 2600025337
1713 2600029607
1714 2600035501
1715 2600041348
1716 2600045571
1717 2600056612
1718 2600058478
1719 2600063853
1720 2600074154
1721 2600079818
1722 2600214513
1723 2600358285
1724 2601525706
1725 2601528002
1726 2601533313
1727 2601538677
1728 2601614836
1729 2601620239
1730 2601626344
1731 2601646007
1732 2601648641
1733 2601652891
1734 2601658992
1735 2601666003
1736 2601692771
1737 2601698964
1738 2601703872
1739 2601705542
1740 2601711131
1741 2601716145
1742 2601723806
1743 2601726551
1744 2601731091
1745 2601736107
1746 2601743428
1747 2601754214
1748 2601757026
1749 2601761519
1750 2601774782
1751 2601800090
1752 2602021160
1753 2603641669
1754 2603643761
1755 2603658942
1756 2603663730
1757 2603701035
1758 2603704294
1759 2603838489
1760 2603844255
1761 2603848640
1762 2603853713
1763 2603865057
1764 2603871766
1765 2603879323
1766 2606048955
1767 2606068156
1768 2606074645
1769 2606127508
1770 2606146632
1771 2606176360
1772 2608670909
1773 2609914486
1774 2621297756
1775 2624478837
1776 2624494120
1777 2637223818
1778 2643842464
1779 2643873642
1780 2643955326
1781 2644023678
1782 2644188146
1783 2644281571
1784 2644623436
1785 2649121388
1786 2650897506
1787 2652548216
1788 2652974494
1789 2656276213
1790 2671094479
1791 2671097658
1792 2671104022
1793 2671109666
1794 2671127908
1795 2671588421
1796 2676409573
1797 2677897942
1798 2678261579
1799 2681998543
1800 2682007650
1801 2686354882
1802 2689443212
1803 2707100043
1804 2712472645
1805 2715757554
1806 2723250513
1807 2738670892
1808 2738689872
1809 2738749286
1810 2738811304
1811 2738858327
1812 2738898664
1813 2739196581
1814 2739257560
1815 2739265646
1816 2739286505
1817 2739291818
1818 2745007928
1819 2753857184
1820 2765582247
1821 2765590283
1822 2772437369
1823 2774122183
1824 2774131952
1825 2774136684
1826 2775539775
1827 2777020098
1828 2784260436
1829 2784314428
1830 2791925379
1831 2792314319
1832 2793404511
1833 2794594376
1834 2807177571
1835 2807409883
1836 2807458231
1837 2808854100
1838 2808906921
1839 2808923391
1840 2808928738
1841 2808934132
1842 2808945334
1843 2808950859
1844 2808956662
1845 2808962467
1846 2808980209
1847 2808995968
1848 2808997492
1849 2809126404
1850 2809215778
1851 2812370900
1852 2813727523
1853 2814695068
1854 2817493110
1855 2819658394
1856 2819702741
1857 2821120144
1858 2823378567
1859 2825653697
1860 2826584152
1861 2834034207
1862 2842808874
1863 2842820918
1864 2842829738
1865 2842843190
1866 2842849673
1867 2842857252
1868 2844428623
1869 2844530387
1870 2844668559
1871 2846541030
1872 2847086115
1873 2847798566
1874 2852105679
1875 2852612505
1876 2852662704
1877 2852669759
1878 2854603779
1879 2855198273
1880 2858467993
1881 2860340619
1882 2860872196
1883 2865016256
1884 2869552618
1885 2871275863
1886 2871283770
1887 2876601593
1888 2878030801
1889 2880231716
1890 2881613914
1891 2884087554
1892 2888367416
1893 2888374892
1894 2891673387
1895 2904478086
1896 2904506870
1897 2904518166
1898 2904520750
1899 2904553078
1900 2908451701
1901 2908672231
1902 2912964895
1903 2913037920
1904 2916180227
1905 2917071819
1906 2917836072
1907 2919064693
1908 2919113936
1909 2919128221
1910 2919153950
1911 2919160184
1912 2919458264
1913 2919482827
1914 2919495659
1915 2919498747
1916 2919544626
1917 2919689991
1918 2919699964
1919 2923525005
1920 2923527013
1921 2923591768
1922 2923636183
1923 2927147487
1924 2927837327
1925 2929145372
1926 2929194310
1927 2931371288
1928 2931395582
1929 2931399478
1930 2932410329
1931 2935353992
1932 2935629178
1933 2937543932
1934 2937970586
1935 2939570927
1936 2939577357
1937 2939582407
1938 2939604492
1939 2939609948
1940 2939621782
1941 2939637046
1942 2939645037
1943 2939653253
1944 2945876461
1945 2945931747
1946 2945951813
1947 2945961384
1948 2946007830
1949 2946032795
1950 2947233554
1951 2969080829
1952 2971822225
1953 2974301377
1954 2974315514
1955 2974439686
1956 2978978350
1957 2984495385
1958 2984503856
1959 2984507561
1960 2984563290
1961 2984596025
1962 2988732916
1963 2990200576
1964 2990265095
1965 3000378062
1966 3007512443
1967 3007624334
1968 3007721430
1969 3007803761
1970 3007871270
1971 3007876204
1972 637318436
1973 640936369
1974 8004597681
1975 8011354296
1976 8015399069
1977 8016730309
1978 8016734739
1979 8018222666
1980 8018405299
1981 8019503798
1982 8019508900
1983 8019773305
1984 8019776630
1985 8052495698
1986 8054286175
1987 8054351137
1988 8054508096
1989 8054847735
1990 8054851566
1991 8054929508
1992 8055088487
1993 8055096855
1994 8055098206
1995 8055694754
1996 8055823049
1997 8055883259
1998 8056120234
1999 8056121916
2000 8056130798
2001 8056136463
2002 8056141858
2003 8056147909
2004 8056153493
2005 8056155572
2006 8056162716
2007 8056176116
2008 8056183413
2009 8056569718
2010 8057163339
2011 8057305436
2012 8057803333

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

35

234

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3knu-assembly1.cif.gz_B crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.79 12 218
3knu-assembly1.cif.gz_A crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.7865 12 222
4mcb-assembly1.cif.gz_A h.influenzae trmd in complex with n-(4-{[(1h-imidazol-2-ylmethyl)amino]methyl}benzyl)-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide 0.7855 12 227
3knu-assembly2.cif.gz_C crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.7836 12 218
4mcc-assembly1.cif.gz_A hintrmd in complex with n-[4-(aminomethyl)benzyl]-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide 0.7804 12 227
ID Description Score Start End Superfamily
5wyrA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9255 11 172 3.40.1280.10
1oy5C01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9057 10 172 3.40.1280.10
3iefB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9053 10 168 3.40.1280.10
5wyrA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9041 11 172 3.40.1280.10
1oy5C01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8901 10 172 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A509BR58-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9321 12 172 GO:0002939
GO:0005829
GO:0052906
AF-A0A418H6T7-F1-model_v4 deleted 0.9247 12 160
AF-A0A730N7J1-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9232 12 139 GO:0002939
GO:0005829
GO:0052906
AF-A0A509BR58-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9211 12 172 GO:0002939
GO:0005829
GO:0052906
AF-A0A661TIM6-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9204 12 171 GO:0002939
GO:0005829
GO:0052906

Map