F488002
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1006 | 651 | 2012 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300003856|Ga0058692_1012258|Ga0058692_10122583 |
| Length | 269 |
| Sequence | LSSGQDGNTPAQSMWIGIISLFPEMFSAITEYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQVGVCELATSEKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGKQASAEEDSFSEGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQAKLLKEFQKEFRRQHNDDGQSGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 22 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 48 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 49 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 50 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009828 | Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E | Metatranscriptome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 70 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 72 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 73 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 74 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300023304 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 | Metatranscriptome | Rhizosphere |
| 84 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 85 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 130 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 131 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 142 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 144 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 145 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 148 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 154 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 161 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 164 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 167 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 168 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 169 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 170 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 173 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 177 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 178 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 179 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 180 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 181 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 182 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 183 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 184 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 185 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 186 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 187 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 188 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 189 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 190 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 191 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 192 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 193 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 194 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 195 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 196 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 197 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 198 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 199 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 244 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 245 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 246 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 247 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 248 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 249 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 250 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 251 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 252 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 272 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 274 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 275 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 276 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 277 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 278 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 279 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 280 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 281 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 282 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 283 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 284 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 285 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 286 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 287 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 288 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 289 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 290 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 291 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 292 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 293 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 294 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 295 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 296 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 297 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 298 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 299 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 300 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 301 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 302 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 303 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 304 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 305 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 306 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 307 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 308 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 309 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 310 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 311 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 312 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 313 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 314 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 315 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 316 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 317 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 318 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 319 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 320 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 321 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 322 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 323 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 324 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 325 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 326 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 327 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 328 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 329 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 330 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 331 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 332 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 333 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 334 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 335 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 336 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 337 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 338 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 339 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 340 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 341 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 342 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 343 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 344 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 345 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 346 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 347 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 348 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 349 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 350 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 351 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 352 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 353 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 354 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 355 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 356 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 357 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 358 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 359 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 360 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 361 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 362 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 363 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 364 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 365 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 366 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 367 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 368 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 369 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 370 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 371 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 372 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 373 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 374 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 375 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 376 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 377 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 378 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 379 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 380 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 381 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 382 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 383 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 384 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 385 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 386 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 387 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 388 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 389 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 390 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 391 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 392 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 393 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 394 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 395 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 396 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 397 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 398 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 399 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 400 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 401 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 402 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 403 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 404 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 405 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 406 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 407 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 408 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 409 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 410 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 411 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 412 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 413 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 414 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 415 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 416 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 417 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 418 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 419 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 420 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 421 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 422 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 423 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 424 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 425 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 426 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 427 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 428 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 429 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 430 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 431 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 432 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 433 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 434 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 435 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 436 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 437 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 438 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 439 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 440 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 441 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 442 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 443 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 444 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 445 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 446 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 447 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 448 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 449 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 450 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 451 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 452 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 453 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 454 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 455 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 456 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 457 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 458 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 459 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 460 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 461 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 462 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 463 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 464 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 465 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 466 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 467 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 468 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 469 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 470 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 471 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 472 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 473 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 474 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 475 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 476 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 477 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 478 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 479 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 480 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 481 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 482 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 483 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 484 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 485 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 486 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 487 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 488 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 489 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 490 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 491 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 492 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 493 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 494 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 495 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 496 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 497 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 498 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 499 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 500 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 501 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 502 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 503 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 504 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 505 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 506 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 507 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 508 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 509 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 510 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 511 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 512 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 513 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 514 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 515 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 516 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 517 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 518 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 519 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 520 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 521 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 522 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 523 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 524 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 525 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 526 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 527 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 528 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 529 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 530 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 531 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 532 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 533 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 534 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 535 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 536 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 537 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 538 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 539 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 540 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 541 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 542 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 543 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 544 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 545 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 546 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 547 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 548 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 549 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 550 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 551 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 552 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 553 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 554 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 555 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 556 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 557 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 558 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 559 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 560 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 561 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 562 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 563 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 564 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 565 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 566 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 567 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 568 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 569 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 570 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 571 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 572 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 573 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 574 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 575 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 576 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 577 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 578 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 579 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 580 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 581 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 582 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 583 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 584 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 585 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 586 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 587 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 588 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 589 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 590 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 591 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 592 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 593 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 594 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 595 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 596 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 597 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 598 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 599 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 600 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 601 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 602 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 603 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 604 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 605 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 606 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 607 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 608 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 609 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 610 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 611 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 612 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 613 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 614 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 615 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 616 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 617 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 618 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 619 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 620 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 621 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 622 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 623 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 624 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 625 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 626 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 627 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 628 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 629 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 630 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 631 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 632 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 633 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 634 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 635 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 636 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 637 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 638 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 639 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 640 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 641 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 642 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 643 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 644 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 645 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 646 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 647 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 648 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 649 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 650 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 651 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 60.04 |
| Metatranscriptomes | 2.49 |
| Isolates | 37.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.6 |
| Bulb | 0.1 |
| Endosphere | 6.36 |
| Nodule | 3.58 |
| Rhizoplane | 13.02 |
| Rhizosphere | 56.06 |
| Stem | 0.1 |
| Stem Tuber | 0.5 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058692_1012258 | 3300003856 | Bacteria | 2038 |
| 2 | MRS2a_Contig_908 | 2124908027 | Bacteria | 7011 |
| 3 | JGI24741J21665_1007693 | 3300001915 | Bacteria | 2077 |
| 4 | JGI24739J22299_10000495 | 3300001989 | Bacteria | 13927 |
| 5 | JGI25154J39366_1004064 | 3300002738 | Bacteria | 2769 |
| 6 | JGI25163J39215_1000022 | 3300002771 | Bacteria | 73877 |
| 7 | JGI25164J39214_1000008 | 3300002772 | Bacteria | 311285 |
| 8 | JGI25164J39214_1000100 | 3300002772 | Bacteria | 84404 |
| 9 | JGI25152J39213_1000802 | 3300002773 | Bacteria | 15735 |
| 10 | JGI25165J46597_1000207 | 3300003214 | Bacteria | 84404 |
| 11 | rootH2_10027710 | 3300003320 | Bacteria | 31950 |
| 12 | rootL2_10202333 | 3300003322 | Bacteria | 1935 |
| 13 | Ga0055538_1000014 | 3300003751 | Bacteria | 311285 |
| 14 | Ga0055538_1000028 | 3300003751 | Bacteria | 215806 |
| 15 | Ga0055539_1000020 | 3300003752 | Bacteria | 311285 |
| 16 | Ga0055539_1000037 | 3300003752 | Bacteria | 215806 |
| 17 | Ga0055533_1000027 | 3300003756 | Bacteria | 311285 |
| 18 | Ga0055533_1000047 | 3300003756 | Bacteria | 215806 |
| 19 | Ga0055532_1000129 | 3300003758 | Bacteria | 74882 |
| 20 | Ga0055525_1000032 | 3300003759 | Bacteria | 311285 |
| 21 | Ga0055525_1000443 | 3300003759 | Bacteria | 23895 |
| 22 | Ga0055536_1003337 | 3300003781 | Bacteria | 8684 |
| 23 | Ga0055536_1011775 | 3300003781 | Bacteria | 3308 |
| 24 | Ga0055530_10007005 | 3300003791 | Bacteria | 4861 |
| 25 | Ga0055530_10030977 | 3300003791 | Bacteria | 1410 |
| 26 | Ga0055531_10006469 | 3300003794 | Bacteria | 6649 |
| 27 | Ga0055541_1000014 | 3300003841 | Bacteria | 311285 |
| 28 | Ga0055541_1000025 | 3300003841 | Bacteria | 215806 |
| 29 | Ga0058692_1006453 | 3300003856 | Bacteria | 3217 |
| 30 | Ga0058692_1017030 | 3300003856 | Bacteria | 1601 |
| 31 | Ga0058860_10094053 | 3300004801 | Bacteria | 1955 |
| 32 | Ga0058860_10169596 | 3300004801 | Bacteria | 1593 |
| 33 | Ga0058860_10195578 | 3300004801 | Bacteria | 1446 |
| 34 | Ga0058860_12165330 | 3300004801 | Bacteria | 2117 |
| 35 | Ga0058860_12187468 | 3300004801 | Bacteria | 2008 |
| 36 | Ga0065703_1020270 | 3300005272 | Bacteria | 1919 |
| 37 | Ga0065714_10000238 | 3300005288 | Bacteria | 6927 |
| 38 | Ga0065714_10081923 | 3300005288 | Bacteria | 2342 |
| 39 | Ga0065714_10087702 | 3300005288 | Bacteria | 2047 |
| 40 | Ga0065704_10000888 | 3300005289 | Bacteria | 11210 |
| 41 | Ga0065704_10002842 | 3300005289 | Bacteria | 14551 |
| 42 | Ga0065704_10004084 | 3300005289 | Bacteria | 6154 |
| 43 | Ga0065704_10026246 | 3300005289 | Bacteria | 1447 |
| 44 | Ga0065704_10090186 | 3300005289 | Bacteria | 2806 |
| 45 | Ga0065704_10139924 | 3300005289 | Bacteria | 1528 |
| 46 | Ga0065712_10003691 | 3300005290 | Bacteria | 6497 |
| 47 | Ga0065712_10067863 | 3300005290 | Bacteria | 24476 |
| 48 | Ga0065712_10079070 | 3300005290 | Bacteria | 3257 |
| 49 | Ga0065715_10133975 | 3300005293 | Bacteria | 1959 |
| 50 | Ga0070661_100000022 | 3300005344 | Bacteria | 127714 |
| 51 | Ga0070669_100001703 | 3300005353 | Bacteria | 15924 |
| 52 | Ga0070669_100005661 | 3300005353 | Bacteria | 9020 |
| 53 | Ga0070694_100087223 | 3300005444 | Bacteria | 2182 |
| 54 | Ga0070662_100000041 | 3300005457 | Bacteria | 72879 |
| 55 | Ga0070662_100004331 | 3300005457 | Bacteria | 8964 |
| 56 | Ga0070698_100135638 | 3300005471 | Bacteria | 2415 |
| 57 | Ga0068853_100007800 | 3300005539 | Bacteria | 8583 |
| 58 | Ga0070696_100279255 | 3300005546 | Bacteria | 1273 |
| 59 | Ga0070665_100007341 | 3300005548 | Bacteria | 11210 |
| 60 | Ga0070665_100010625 | 3300005548 | Bacteria | 9318 |
| 61 | Ga0070665_100083166 | 3300005548 | Bacteria | 3206 |
| 62 | Ga0070664_100000646 | 3300005564 | Bacteria | 26728 |
| 63 | Ga0068857_100073160 | 3300005577 | Bacteria | 3053 |
| 64 | Ga0068857_100216748 | 3300005577 | Bacteria | 1748 |
| 65 | Ga0068854_100020986 | 3300005578 | Bacteria | 4427 |
| 66 | Ga0070702_100155902 | 3300005615 | Bacteria | 1471 |
| 67 | Ga0068859_100015807 | 3300005617 | Bacteria | 7582 |
| 68 | Ga0068851_10000044 | 3300005834 | Bacteria | 83228 |
| 69 | Ga0068851_10012067 | 3300005834 | Bacteria | 4068 |
| 70 | Ga0068851_10064435 | 3300005834 | Bacteria | 1884 |
| 71 | Ga0081538_10087104 | 3300005981 | Bacteria | 1632 |
| 72 | Ga0075364_10007670 | 3300006051 | Bacteria | 6419 |
| 73 | Ga0075364_10020296 | 3300006051 | Bacteria | 4178 |
| 74 | Ga0075364_10326818 | 3300006051 | Bacteria | 1044 |
| 75 | Ga0070715_10018108 | 3300006163 | Bacteria | 2679 |
| 76 | Ga0075367_10416592 | 3300006178 | Bacteria | 850 |
| 77 | Ga0075434_100202485 | 3300006871 | Bacteria | 2005 |
| 78 | Ga0097620_100015807 | 3300006931 | Bacteria | 7582 |
| 79 | Ga0099823_1000054 | 3300006944 | Bacteria | 55085 |
| 80 | Ga0079104_1000720 | 3300006946 | Bacteria | 29806 |
| 81 | Ga0079104_1000769 | 3300006946 | Bacteria | 27495 |
| 82 | Ga0079104_1002016 | 3300006946 | Bacteria | 11849 |
| 83 | Ga0079104_1015557 | 3300006946 | Bacteria | 2250 |
| 84 | Ga0079104_1020880 | 3300006946 | Bacteria | 1793 |
| 85 | Ga0079104_1027141 | 3300006946 | Bacteria | 1471 |
| 86 | Ga0099794_10005207 | 3300007265 | Bacteria | 5198 |
| 87 | Ga0105251_10000151 | 3300009011 | Bacteria | 70872 |
| 88 | Ga0105251_10000156 | 3300009011 | Bacteria | 69639 |
| 89 | Ga0105251_10001256 | 3300009011 | Bacteria | 21931 |
| 90 | Ga0105251_10007540 | 3300009011 | Bacteria | 6684 |
| 91 | Ga0105251_10029112 | 3300009011 | Bacteria | 2785 |
| 92 | Ga0105251_10050570 | 3300009011 | Bacteria | 1985 |
| 93 | Ga0105251_10057196 | 3300009011 | Bacteria | 1843 |
| 94 | Ga0105251_10059849 | 3300009011 | Bacteria | 1795 |
| 95 | Ga0105251_10126641 | 3300009011 | Bacteria | 1159 |
| 96 | Ga0105251_10158084 | 3300009011 | Bacteria | 1022 |
| 97 | Ga0105244_10000272 | 3300009036 | Bacteria | 52218 |
| 98 | Ga0105244_10000338 | 3300009036 | Bacteria | 44031 |
| 99 | Ga0105244_10000932 | 3300009036 | Bacteria | 24659 |
| 100 | Ga0105244_10002378 | 3300009036 | Bacteria | 14261 |
| 101 | Ga0105244_10003891 | 3300009036 | Bacteria | 10503 |
| 102 | Ga0105244_10004865 | 3300009036 | Bacteria | 9106 |
| 103 | Ga0105244_10010841 | 3300009036 | Bacteria | 5503 |
| 104 | Ga0105244_10049440 | 3300009036 | Bacteria | 2149 |
| 105 | Ga0105244_10075100 | 3300009036 | Bacteria | 1680 |
| 106 | Ga0105244_10115292 | 3300009036 | Bacteria | 1304 |
| 107 | Ga0105244_10126386 | 3300009036 | Bacteria | 1235 |
| 108 | Ga0105244_10141536 | 3300009036 | Bacteria | 1157 |
| 109 | Ga0105244_10182263 | 3300009036 | Bacteria | 995 |
| 110 | Ga0105244_10189344 | 3300009036 | Bacteria | 973 |
| 111 | Ga0105250_10000042 | 3300009092 | Bacteria | 130495 |
| 112 | Ga0105250_10000542 | 3300009092 | Bacteria | 26010 |
| 113 | Ga0105250_10000611 | 3300009092 | Bacteria | 23296 |
| 114 | Ga0105250_10001268 | 3300009092 | Bacteria | 13907 |
| 115 | Ga0105250_10001773 | 3300009092 | Bacteria | 11331 |
| 116 | Ga0105250_10003580 | 3300009092 | Bacteria | 7317 |
| 117 | Ga0105250_10039616 | 3300009092 | Bacteria | 1889 |
| 118 | Ga0105250_10094222 | 3300009092 | Bacteria | 1220 |
| 119 | Ga0105250_10130066 | 3300009092 | Bacteria | 1039 |
| 120 | Ga0105245_10155601 | 3300009098 | Bacteria | 2165 |
| 121 | Ga0105247_10000301 | 3300009101 | Bacteria | 44602 |
| 122 | Ga0105247_10469645 | 3300009101 | Bacteria | 911 |
| 123 | Ga0105243_10010660 | 3300009148 | Bacteria | 6971 |
| 124 | Ga0105243_10024754 | 3300009148 | Bacteria | 4582 |
| 125 | Ga0105243_10238632 | 3300009148 | Bacteria | 1616 |
| 126 | Ga0105243_10242685 | 3300009148 | Bacteria | 1604 |
| 127 | Ga0105243_10361702 | 3300009148 | Bacteria | 1336 |
| 128 | Ga0105241_10000008 | 3300009174 | Bacteria | 334281 |
| 129 | Ga0105242_10007385 | 3300009176 | Bacteria | 8463 |
| 130 | Ga0105242_10201976 | 3300009176 | Bacteria | 1766 |
| 131 | Ga0105248_10027748 | 3300009177 | Bacteria | 6305 |
| 132 | Ga0105237_10001243 | 3300009545 | Bacteria | 33994 |
| 133 | Ga0105237_10174419 | 3300009545 | Bacteria | 2150 |
| 134 | Ga0130087_1027949 | 3300009828 | Bacteria | 1890 |
| 135 | Ga0105246_10056158 | 3300011119 | Bacteria | 2720 |
| 136 | Ga0157373_10000463 | 3300013100 | Bacteria | 32226 |
| 137 | Ga0157373_10063629 | 3300013100 | Bacteria | 2612 |
| 138 | Ga0157373_10064357 | 3300013100 | Bacteria | 2596 |
| 139 | Ga0157373_10146750 | 3300013100 | Bacteria | 1659 |
| 140 | Ga0157373_10155477 | 3300013100 | Bacteria | 1609 |
| 141 | Ga0157371_10001001 | 3300013102 | Bacteria | 31233 |
| 142 | Ga0157371_10001008 | 3300013102 | Bacteria | 31048 |
| 143 | Ga0157371_10002245 | 3300013102 | Bacteria | 18658 |
| 144 | Ga0157371_10023605 | 3300013102 | Bacteria | 4498 |
| 145 | Ga0157370_10002229 | 3300013104 | Bacteria | 23584 |
| 146 | Ga0157370_10002252 | 3300013104 | Bacteria | 23438 |
| 147 | Ga0157370_10004489 | 3300013104 | Bacteria | 15991 |
| 148 | Ga0157370_10006004 | 3300013104 | Bacteria | 13513 |
| 149 | Ga0157370_10033837 | 3300013104 | Bacteria | 4981 |
| 150 | Ga0157370_10045091 | 3300013104 | Bacteria | 4233 |
| 151 | Ga0157369_10000956 | 3300013105 | Bacteria | 36674 |
| 152 | Ga0157369_10038217 | 3300013105 | Bacteria | 5248 |
| 153 | Ga0163162_10044620 | 3300013306 | Bacteria | 4440 |
| 154 | Ga0163162_10163690 | 3300013306 | Bacteria | 2347 |
| 155 | Ga0163162_10279941 | 3300013306 | Bacteria | 1800 |
| 156 | Ga0157372_10004322 | 3300013307 | Bacteria | 15189 |
| 157 | Ga0157372_10008877 | 3300013307 | Bacteria | 10675 |
| 158 | Ga0157372_10070044 | 3300013307 | Bacteria | 3945 |
| 159 | Ga0157372_10152976 | 3300013307 | Bacteria | 2663 |
| 160 | Ga0157372_10512069 | 3300013307 | Bacteria | 1399 |
| 161 | Ga0157372_10551068 | 3300013307 | Bacteria | 1344 |
| 162 | Ga0157380_10371786 | 3300014326 | Bacteria | 1346 |
| 163 | Ga0157380_10855410 | 3300014326 | Bacteria | 932 |
| 164 | Ga0182008_10001425 | 3300014497 | Bacteria | 16033 |
| 165 | Ga0182006_1000069 | 3300015261 | Bacteria | 140097 |
| 166 | Ga0183366_1002 | 3300015679 | Bacteria | 791639 |
| 167 | Ga0183370_1002 | 3300015680 | Bacteria | 791639 |
| 168 | Ga0183369_1002 | 3300015685 | Bacteria | 791621 |
| 169 | Ga0183368_1005 | 3300015687 | Bacteria | 791621 |
| 170 | Ga0163161_10000002 | 3300017792 | Bacteria | 411983 |
| 171 | Ga0163161_10051926 | 3300017792 | Bacteria | 2971 |
| 172 | Ga0163161_10060323 | 3300017792 | Bacteria | 2761 |
| 173 | Ga0206356_11158939 | 3300020070 | Bacteria | 1733 |
| 174 | Ga0206351_10013078 | 3300020077 | Bacteria | 2566 |
| 175 | Ga0206352_10402763 | 3300020078 | Bacteria | 2145 |
| 176 | Ga0206354_10196568 | 3300020081 | Bacteria | 1734 |
| 177 | Ga0206354_10826925 | 3300020081 | Bacteria | 1891 |
| 178 | Ga0154015_1698326 | 3300020610 | Bacteria | 1607 |
| 179 | Ga0213876_10000444 | 3300021384 | Bacteria | 33655 |
| 180 | Ga0224712_10079925 | 3300022467 | Bacteria | 1347 |
| 181 | Ga0256714_107509 | 3300023304 | Bacteria | 2224 |
| 182 | Ga0256744_141414 | 3300023309 | Bacteria | 1240 |
| 183 | Ga0209435_100363 | 3300025206 | Bacteria | 10243 |
| 184 | Ga0209760_100086 | 3300025207 | Bacteria | 74006 |
| 185 | Ga0209760_100463 | 3300025207 | Bacteria | 9076 |
| 186 | Ga0209784_100030 | 3300025224 | Bacteria | 327457 |
| 187 | Ga0209784_100032 | 3300025224 | Bacteria | 314079 |
| 188 | Ga0209566_100034 | 3300025225 | Bacteria | 327457 |
| 189 | Ga0209566_100036 | 3300025225 | Bacteria | 314079 |
| 190 | Ga0209674_100052 | 3300025226 | Bacteria | 327457 |
| 191 | Ga0209674_100054 | 3300025226 | Bacteria | 314079 |
| 192 | Ga0209147_100055 | 3300025229 | Bacteria | 262412 |
| 193 | Ga0209563_100054 | 3300025230 | Bacteria | 327457 |
| 194 | Ga0209563_100055 | 3300025230 | Bacteria | 314079 |
| 195 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 196 | Ga0207427_100035 | 3300025231 | Bacteria | 311526 |
| 197 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 198 | Ga0209437_100068 | 3300025233 | Bacteria | 311526 |
| 199 | Ga0209437_100110 | 3300025233 | Bacteria | 215040 |
| 200 | Ga0209258_100231 | 3300025242 | Bacteria | 104255 |
| 201 | Ga0207425_1019345 | 3300025245 | Bacteria | 1467 |
| 202 | Ga0209646_1000331 | 3300025246 | Bacteria | 35689 |
| 203 | Ga0209677_100032 | 3300025253 | Bacteria | 327457 |
| 204 | Ga0209677_100033 | 3300025253 | Bacteria | 314079 |
| 205 | Ga0209759_1010939 | 3300025256 | Bacteria | 2620 |
| 206 | Ga0209129_1000103 | 3300025258 | Bacteria | 161305 |
| 207 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 208 | Ga0209565_1038113 | 3300025263 | Bacteria | 906 |
| 209 | Ga0209675_1006388 | 3300025291 | Bacteria | 4738 |
| 210 | Ga0209676_1000078 | 3300025292 | Bacteria | 296293 |
| 211 | Ga0209676_1000503 | 3300025292 | Bacteria | 61955 |
| 212 | Ga0209050_1000041 | 3300025298 | Bacteria | 408004 |
| 213 | Ga0209050_1000060 | 3300025298 | Bacteria | 321699 |
| 214 | Ga0209050_1000425 | 3300025298 | Bacteria | 77756 |
| 215 | Ga0209051_1000037 | 3300025303 | Bacteria | 321747 |
| 216 | Ga0209051_1000061 | 3300025303 | Bacteria | 253485 |
| 217 | Ga0209051_1000085 | 3300025303 | Bacteria | 189973 |
| 218 | Ga0209257_1000635 | 3300025304 | Bacteria | 56286 |
| 219 | Ga0209257_1011547 | 3300025304 | Bacteria | 4235 |
| 220 | Ga0207656_10000022 | 3300025321 | Bacteria | 106345 |
| 221 | Ga0207656_10004274 | 3300025321 | Bacteria | 4978 |
| 222 | Ga0207696_1000008 | 3300025711 | Bacteria | 568181 |
| 223 | Ga0207696_1000009 | 3300025711 | Bacteria | 564405 |
| 224 | Ga0207696_1000027 | 3300025711 | Bacteria | 412783 |
| 225 | Ga0207696_1000032 | 3300025711 | Bacteria | 380071 |
| 226 | Ga0207696_1000034 | 3300025711 | Bacteria | 350426 |
| 227 | Ga0207696_1000129 | 3300025711 | Bacteria | 133308 |
| 228 | Ga0207696_1000187 | 3300025711 | Bacteria | 96247 |
| 229 | Ga0207696_1000262 | 3300025711 | Bacteria | 67626 |
| 230 | Ga0207696_1000278 | 3300025711 | Bacteria | 60620 |
| 231 | Ga0207696_1001031 | 3300025711 | Bacteria | 16601 |
| 232 | Ga0207696_1001146 | 3300025711 | Bacteria | 15233 |
| 233 | Ga0207696_1001494 | 3300025711 | Bacteria | 12582 |
| 234 | Ga0207696_1002195 | 3300025711 | Bacteria | 9785 |
| 235 | Ga0207696_1003240 | 3300025711 | Bacteria | 7510 |
| 236 | Ga0207696_1006426 | 3300025711 | Bacteria | 4741 |
| 237 | Ga0207696_1006575 | 3300025711 | Bacteria | 4668 |
| 238 | Ga0207655_1000020 | 3300025728 | Bacteria | 524503 |
| 239 | Ga0207655_1000054 | 3300025728 | Bacteria | 281894 |
| 240 | Ga0207655_1000103 | 3300025728 | Bacteria | 185076 |
| 241 | Ga0207655_1000357 | 3300025728 | Bacteria | 64976 |
| 242 | Ga0207655_1000408 | 3300025728 | Bacteria | 59188 |
| 243 | Ga0207655_1000569 | 3300025728 | Bacteria | 45865 |
| 244 | Ga0207655_1000721 | 3300025728 | Bacteria | 37520 |
| 245 | Ga0207655_1000752 | 3300025728 | Bacteria | 36357 |
| 246 | Ga0207655_1000828 | 3300025728 | Bacteria | 33376 |
| 247 | Ga0207655_1001231 | 3300025728 | Bacteria | 24607 |
| 248 | Ga0207655_1001348 | 3300025728 | Bacteria | 23067 |
| 249 | Ga0207655_1006303 | 3300025728 | Bacteria | 7886 |
| 250 | Ga0207655_1007027 | 3300025728 | Bacteria | 7370 |
| 251 | Ga0207655_1007625 | 3300025728 | Bacteria | 6990 |
| 252 | Ga0207655_1007768 | 3300025728 | Bacteria | 6914 |
| 253 | Ga0207655_1014196 | 3300025728 | Bacteria | 4519 |
| 254 | Ga0207655_1017833 | 3300025728 | Bacteria | 3810 |
| 255 | Ga0207655_1024660 | 3300025728 | Bacteria | 2942 |
| 256 | Ga0207655_1036293 | 3300025728 | Bacteria | 2188 |
| 257 | Ga0207655_1077163 | 3300025728 | Bacteria | 1216 |
| 258 | Ga0207713_1000014 | 3300025735 | Bacteria | 432450 |
| 259 | Ga0207713_1000028 | 3300025735 | Bacteria | 309074 |
| 260 | Ga0207713_1000123 | 3300025735 | Bacteria | 122033 |
| 261 | Ga0207713_1000129 | 3300025735 | Bacteria | 116027 |
| 262 | Ga0207713_1000163 | 3300025735 | Bacteria | 98277 |
| 263 | Ga0207713_1000223 | 3300025735 | Bacteria | 76591 |
| 264 | Ga0207713_1001297 | 3300025735 | Bacteria | 20559 |
| 265 | Ga0207713_1004295 | 3300025735 | Bacteria | 9287 |
| 266 | Ga0207713_1005559 | 3300025735 | Bacteria | 7855 |
| 267 | Ga0207713_1005686 | 3300025735 | Bacteria | 7740 |
| 268 | Ga0207713_1006908 | 3300025735 | Bacteria | 6819 |
| 269 | Ga0207713_1007366 | 3300025735 | Bacteria | 6507 |
| 270 | Ga0207713_1008261 | 3300025735 | Bacteria | 6017 |
| 271 | Ga0207713_1009429 | 3300025735 | Bacteria | 5501 |
| 272 | Ga0207713_1033358 | 3300025735 | Bacteria | 2250 |
| 273 | Ga0207713_1037467 | 3300025735 | Bacteria | 2067 |
| 274 | Ga0207713_1049253 | 3300025735 | Bacteria | 1691 |
| 275 | Ga0207710_10000061 | 3300025900 | Bacteria | 166665 |
| 276 | Ga0207685_10039892 | 3300025905 | Bacteria | 1746 |
| 277 | Ga0207654_10000009 | 3300025911 | Bacteria | 334291 |
| 278 | Ga0207695_10164949 | 3300025913 | Bacteria | 2144 |
| 279 | Ga0207671_10000034 | 3300025914 | Bacteria | 245048 |
| 280 | Ga0207671_10109162 | 3300025914 | Bacteria | 2103 |
| 281 | Ga0207649_10000006 | 3300025920 | Bacteria | 349180 |
| 282 | Ga0207681_10000978 | 3300025923 | Bacteria | 18677 |
| 283 | Ga0207681_10390162 | 3300025923 | Bacteria | 1122 |
| 284 | Ga0207650_10000092 | 3300025925 | Bacteria | 116489 |
| 285 | Ga0207706_10003133 | 3300025933 | Bacteria | 15889 |
| 286 | Ga0207706_10061623 | 3300025933 | Bacteria | 3303 |
| 287 | Ga0207686_10001893 | 3300025934 | Bacteria | 11588 |
| 288 | Ga0207686_10032842 | 3300025934 | Bacteria | 3092 |
| 289 | Ga0207709_10004825 | 3300025935 | Bacteria | 7725 |
| 290 | Ga0207709_10014581 | 3300025935 | Bacteria | 4343 |
| 291 | Ga0207709_10050415 | 3300025935 | Bacteria | 2545 |
| 292 | Ga0207709_10060080 | 3300025935 | Bacteria | 2369 |
| 293 | Ga0207669_10245343 | 3300025937 | Bacteria | 1330 |
| 294 | Ga0207689_10305707 | 3300025942 | Bacteria | 1318 |
| 295 | Ga0207679_10000010 | 3300025945 | Bacteria | 349180 |
| 296 | Ga0207668_10007234 | 3300025972 | Bacteria | 6591 |
| 297 | Ga0207639_10005461 | 3300026041 | Bacteria | 8587 |
| 298 | Ga0207708_10361060 | 3300026075 | Bacteria | 1194 |
| 299 | Ga0207674_10088438 | 3300026116 | Bacteria | 3091 |
| 300 | Ga0207674_10103126 | 3300026116 | Bacteria | 2832 |
| 301 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 302 | Ga0209281_1000049 | 3300027111 | Bacteria | 322274 |
| 303 | Ga0209281_1000054 | 3300027111 | Bacteria | 309505 |
| 304 | Ga0209281_1000056 | 3300027111 | Bacteria | 307619 |
| 305 | Ga0209281_1000371 | 3300027111 | Bacteria | 72619 |
| 306 | Ga0209281_1000505 | 3300027111 | Bacteria | 51792 |
| 307 | Ga0209281_1000576 | 3300027111 | Bacteria | 43355 |
| 308 | Ga0209281_1000683 | 3300027111 | Bacteria | 35391 |
| 309 | Ga0209281_1001352 | 3300027111 | Bacteria | 15206 |
| 310 | Ga0209281_1013772 | 3300027111 | Bacteria | 1733 |
| 311 | Ga0209281_1022875 | 3300027111 | Bacteria | 1192 |
| 312 | Ga0209389_1000002 | 3300027296 | Bacteria | 333932 |
| 313 | Ga0209371_1000013 | 3300027312 | Bacteria | 691516 |
| 314 | Ga0209371_1000049 | 3300027312 | Bacteria | 279132 |
| 315 | Ga0209371_1000572 | 3300027312 | Bacteria | 33334 |
| 316 | Ga0209371_1000582 | 3300027312 | Bacteria | 32834 |
| 317 | Ga0209371_1000935 | 3300027312 | Bacteria | 22868 |
| 318 | Ga0209371_1001075 | 3300027312 | Bacteria | 20453 |
| 319 | Ga0209371_1001276 | 3300027312 | Bacteria | 17779 |
| 320 | Ga0209371_1002216 | 3300027312 | Bacteria | 11275 |
| 321 | Ga0209371_1002307 | 3300027312 | Bacteria | 10875 |
| 322 | Ga0209371_1002649 | 3300027312 | Bacteria | 9758 |
| 323 | Ga0209371_1002734 | 3300027312 | Bacteria | 9478 |
| 324 | Ga0209371_1014808 | 3300027312 | Bacteria | 2121 |
| 325 | Ga0209371_1018024 | 3300027312 | Bacteria | 1809 |
| 326 | Ga0209371_1022298 | 3300027312 | Bacteria | 1516 |
| 327 | Ga0209981_1003851 | 3300027378 | Bacteria | 1954 |
| 328 | Ga0209981_1006084 | 3300027378 | Bacteria | 1612 |
| 329 | Ga0209984_1009488 | 3300027424 | Bacteria | 1238 |
| 330 | Ga0209999_1007990 | 3300027543 | Bacteria | 1903 |
| 331 | Ga0210002_1012214 | 3300027617 | Bacteria | 1332 |
| 332 | Ga0209983_1004310 | 3300027665 | Bacteria | 2998 |
| 333 | Ga0209971_1042692 | 3300027682 | Bacteria | 1092 |
| 334 | Ga0209966_1003526 | 3300027695 | Bacteria | 2635 |
| 335 | Ga0207428_10151233 | 3300027907 | Bacteria | 1767 |
| 336 | Ga0268266_10000211 | 3300028379 | Bacteria | 101045 |
| 337 | Ga0268266_10052890 | 3300028379 | Bacteria | 3488 |
| 338 | Ga0311001_1010284 | 3300029277 | Bacteria | 2088 |
| 339 | Ga0268256_1000014 | 3300030500 | Bacteria | 691435 |
| 340 | Ga0268256_1000031 | 3300030500 | Bacteria | 425730 |
| 341 | Ga0268256_1000227 | 3300030500 | Bacteria | 60732 |
| 342 | Ga0268256_1000499 | 3300030500 | Bacteria | 33334 |
| 343 | Ga0268256_1001137 | 3300030500 | Bacteria | 17252 |
| 344 | Ga0268256_1001942 | 3300030500 | Bacteria | 11316 |
| 345 | Ga0268256_1002473 | 3300030500 | Bacteria | 9388 |
| 346 | Ga0268256_1003008 | 3300030500 | Bacteria | 7959 |
| 347 | Ga0268256_1005389 | 3300030500 | Bacteria | 5025 |
| 348 | Ga0268256_1019845 | 3300030500 | Bacteria | 1827 |
| 349 | Ga0268256_1020097 | 3300030500 | Bacteria | 1809 |
| 350 | Ga0316177_1087706 | 3300030731 | Bacteria | 2844 |
| 351 | Ga0316183_1016295 | 3300030742 | Bacteria | 4569 |
| 352 | Ga0265328_10000016 | 3300031239 | Bacteria | 132959 |
| 353 | Ga0307408_100298698 | 3300031548 | Bacteria | 1348 |
| 354 | Ga0307408_100392243 | 3300031548 | Bacteria | 1190 |
| 355 | Ga0316575_10000446 | 3300031665 | Bacteria | 11788 |
| 356 | Ga0316575_10011572 | 3300031665 | Bacteria | 3267 |
| 357 | Ga0316579_10000802 | 3300031691 | Bacteria | 10838 |
| 358 | Ga0316579_10022759 | 3300031691 | Bacteria | 2806 |
| 359 | Ga0316579_10197790 | 3300031691 | Bacteria | 972 |
| 360 | Ga0265314_10121058 | 3300031711 | Bacteria | 1647 |
| 361 | Ga0307413_10060321 | 3300031824 | Bacteria | 2335 |
| 362 | Ga0307412_10413110 | 3300031911 | Bacteria | 1102 |
| 363 | Ga0307416_100350680 | 3300032002 | Bacteria | 1493 |
| 364 | Ga0316585_10004730 | 3300032137 | Bacteria | 3813 |
| 365 | Ga0316593_10000082 | 3300032168 | Bacteria | 11664 |
| 366 | Ga0316593_10014396 | 3300032168 | Bacteria | 2358 |
| 367 | Ga0316593_10024525 | 3300032168 | Bacteria | 1913 |
| 368 | Ga0316593_10026492 | 3300032168 | Bacteria | 1854 |
| 369 | Ga0316593_10032846 | 3300032168 | Bacteria | 1697 |
| 370 | Ga0316593_10067079 | 3300032168 | Bacteria | 1236 |
| 371 | Ga0373936_0117312 | 3300035113 | Bacteria | 1134 |
| 372 | Ga0316574_0222461 | 3300035398 | Bacteria | 1209 |
| 373 | Ga0373935_0065766 | 3300035692 | Bacteria | 2327 |
| 374 | Ga0373935_0313854 | 3300035692 | Bacteria | 1111 |
| 375 | Ga0373927_0038654 | 3300035695 | Bacteria | 3098 |
| 376 | Ga0373937_0345012 | 3300036401 | Bacteria | 1410 |
| 377 | Ga0316582_0002520 | 3300036647 | Bacteria | 8642 |
| 378 | Ga0316584_0304221 | 3300036712 | Bacteria | 1154 |
| 379 | Ga0373925_0041279 | 3300037068 | Bacteria | 3420 |
| 380 | Ga0316581_0073803 | 3300037588 | Bacteria | 1048 |
| 381 | Ga0400483_105112 | 3300039062 | Bacteria | 1430 |
| 382 | Ga0400483_213263 | 3300039062 | Bacteria | 16387 |
| 383 | Ga0436365_1801698 | 3300039437 | Bacteria | 33582 |
| 384 | Ga0439436_0000220 | 3300041404 | Bacteria | 13690 |
| 385 | Ga0439438_000042 | 3300041405 | Bacteria | 63992 |
| 386 | Ga0439438_003009 | 3300041405 | Bacteria | 6954 |
| 387 | Ga0439438_004922 | 3300041405 | Bacteria | 5004 |
| 388 | Ga0439438_004959 | 3300041405 | Bacteria | 4977 |
| 389 | Ga0439438_007456 | 3300041405 | Bacteria | 3738 |
| 390 | Ga0439438_008294 | 3300041405 | Bacteria | 3462 |
| 391 | Ga0439447_000338 | 3300041407 | Bacteria | 16822 |
| 392 | Ga0439447_001723 | 3300041407 | Bacteria | 8011 |
| 393 | Ga0439447_005050 | 3300041407 | Bacteria | 4441 |
| 394 | Ga0439447_005875 | 3300041407 | Bacteria | 4038 |
| 395 | Ga0439466_0000004 | 3300041411 | Bacteria | 462654 |
| 396 | Ga0439466_0003385 | 3300041411 | Bacteria | 6198 |
| 397 | Ga0451789_0093147 | 3300041443 | Bacteria | 1635 |
| 398 | Ga0451797_1445638 | 3300041453 | Bacteria | 1648 |
| 399 | Ga0451805_097769 | 3300041461 | Bacteria | 1588 |
| 400 | Ga0451807_0192210 | 3300041486 | Bacteria | 1196 |
| 401 | Ga0451835_0706369 | 3300041492 | Bacteria | 1294 |
| 402 | Ga0451853_0953173 | 3300041512 | Bacteria | 2207 |
| 403 | Ga0451853_1281195 | 3300041512 | Bacteria | 1006 |
| 404 | Ga0452268_32449 | 3300041907 | Bacteria | 1374 |
| 405 | Ga0439431_0003975 | 3300041997 | Bacteria | 3255 |
| 406 | Ga0439441_002360 | 3300042001 | Bacteria | 2651 |
| 407 | Ga0439443_024958 | 3300042003 | Bacteria | 961 |
| 408 | Ga0439432_003406 | 3300042006 | Bacteria | 5902 |
| 409 | Ga0439432_008690 | 3300042006 | Bacteria | 3560 |
| 410 | Ga0439432_014747 | 3300042006 | Bacteria | 2643 |
| 411 | Ga0439432_028853 | 3300042006 | Bacteria | 1805 |
| 412 | Ga0439452_000009 | 3300042010 | Bacteria | 569493 |
| 413 | Ga0439452_000013 | 3300042010 | Bacteria | 364058 |
| 414 | Ga0439452_000094 | 3300042010 | Bacteria | 75452 |
| 415 | Ga0439452_000121 | 3300042010 | Bacteria | 60858 |
| 416 | Ga0439455_0044352 | 3300042012 | Bacteria | 1147 |
| 417 | Ga0439456_008965 | 3300042013 | Bacteria | 2067 |
| 418 | Ga0439463_003608 | 3300042016 | Bacteria | 3902 |
| 419 | Ga0450911_000317 | 3300042115 | Bacteria | 17456 |
| 420 | Ga0450923_009020 | 3300042125 | Bacteria | 1733 |
| 421 | Ga0450900_001029 | 3300042136 | Bacteria | 2556 |
| 422 | Ga0450902_004495 | 3300042137 | Bacteria | 2078 |
| 423 | Ga0450904_000557 | 3300042139 | Bacteria | 7024 |
| 424 | Ga0450905_013876 | 3300042142 | Bacteria | 1144 |
| 425 | Ga0450907_000648 | 3300042146 | Bacteria | 9158 |
| 426 | Ga0439446_0002391 | 3300042156 | Bacteria | 4496 |
| 427 | Ga0439446_0002561 | 3300042156 | Bacteria | 4380 |
| 428 | Ga0439435_0000397 | 3300042436 | Bacteria | 6743 |
| 429 | Ga0439459_0002610 | 3300042438 | Bacteria | 2792 |
| 430 | Ga0439464_0002684 | 3300042439 | Bacteria | 4413 |
| 431 | Ga0439460_0000842 | 3300042461 | Bacteria | 6983 |
| 432 | Ga0450893_0002336 | 3300042532 | Bacteria | 2946 |
| 433 | Ga0450893_0015838 | 3300042532 | Bacteria | 1273 |
| 434 | Ga0466981_0000032 | 3300044669 | Bacteria | 65341 |
| 435 | Ga0495627_000177 | 3300046453 | Bacteria | 72359 |
| 436 | Ga0495627_005014 | 3300046453 | Bacteria | 5420 |
| 437 | Ga0495591_000222 | 3300046458 | Bacteria | 56621 |
| 438 | Ga0495591_000590 | 3300046458 | Bacteria | 27551 |
| 439 | Ga0495591_001740 | 3300046458 | Bacteria | 12974 |
| 440 | Ga0495591_005309 | 3300046458 | Bacteria | 5996 |
| 441 | Ga0495591_037354 | 3300046458 | Bacteria | 1406 |
| 442 | Ga0495650_0000008 | 3300046471 | Bacteria | 688246 |
| 443 | Ga0495650_0000059 | 3300046471 | Bacteria | 296253 |
| 444 | Ga0495650_0000120 | 3300046471 | Bacteria | 184191 |
| 445 | Ga0495605_0000235 | 3300046474 | Bacteria | 67625 |
| 446 | Ga0495605_0026549 | 3300046474 | Bacteria | 3009 |
| 447 | Ga0495584_0003803 | 3300046491 | Bacteria | 8213 |
| 448 | Ga0495585_0023719 | 3300046492 | Bacteria | 3520 |
| 449 | Ga0495594_0002336 | 3300046499 | Bacteria | 9871 |
| 450 | Ga0495596_0009946 | 3300046500 | Bacteria | 4166 |
| 451 | Ga0495607_0000756 | 3300046501 | Bacteria | 30975 |
| 452 | Ga0495607_0038294 | 3300046501 | Bacteria | 2873 |
| 453 | Ga0495583_0000389 | 3300046506 | Bacteria | 67583 |
| 454 | Ga0495606_0008629 | 3300046507 | Bacteria | 8804 |
| 455 | Ga0495610_0014899 | 3300046512 | Bacteria | 4545 |
| 456 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 457 | Ga0495620_0000900 | 3300046515 | Bacteria | 18247 |
| 458 | Ga0495632_0003399 | 3300046519 | Bacteria | 11334 |
| 459 | Ga0495632_0039573 | 3300046519 | Bacteria | 2379 |
| 460 | Ga0495643_0006448 | 3300046522 | Bacteria | 7731 |
| 461 | Ga0495643_0025859 | 3300046522 | Bacteria | 3318 |
| 462 | Ga0495644_0009743 | 3300046523 | Bacteria | 3700 |
| 463 | Ga0495644_0102312 | 3300046523 | Bacteria | 1084 |
| 464 | Ga0495648_0009903 | 3300046524 | Bacteria | 7319 |
| 465 | Ga0495648_0057910 | 3300046524 | Bacteria | 2320 |
| 466 | Ga0495648_0068718 | 3300046524 | Bacteria | 2065 |
| 467 | Ga0495654_0000148 | 3300046530 | Bacteria | 72863 |
| 468 | Ga0495654_0000218 | 3300046530 | Bacteria | 53756 |
| 469 | Ga0495654_0001237 | 3300046530 | Bacteria | 18027 |
| 470 | Ga0495654_0007590 | 3300046530 | Bacteria | 6043 |
| 471 | Ga0495654_0008728 | 3300046530 | Bacteria | 5583 |
| 472 | Ga0495654_0041929 | 3300046530 | Bacteria | 2275 |
| 473 | Ga0495654_0072730 | 3300046530 | Bacteria | 1626 |
| 474 | Ga0495609_0000006 | 3300046538 | Bacteria | 431833 |
| 475 | Ga0495609_0000296 | 3300046538 | Bacteria | 46065 |
| 476 | Ga0495621_0036552 | 3300046539 | Bacteria | 1705 |
| 477 | Ga0495633_0000309 | 3300046558 | Bacteria | 55647 |
| 478 | Ga0495611_0208408 | 3300046648 | Bacteria | 911 |
| 479 | Ga0495625_0119230 | 3300046660 | Bacteria | 1797 |
| 480 | Ga0495661_0000224 | 3300046665 | Bacteria | 65089 |
| 481 | Ga0495661_0000366 | 3300046665 | Bacteria | 49025 |
| 482 | Ga0495588_0172530 | 3300046674 | Bacteria | 1143 |
| 483 | Ga0495670_0012315 | 3300046691 | Bacteria | 4204 |
| 484 | Ga0495671_0001722 | 3300046692 | Bacteria | 14204 |
| 485 | Ga0495671_0024447 | 3300046692 | Bacteria | 3146 |
| 486 | Ga0495649_0001477 | 3300046694 | Bacteria | 17652 |
| 487 | Ga0495649_0037603 | 3300046694 | Bacteria | 2656 |
| 488 | Ga0495649_0112441 | 3300046694 | Bacteria | 1443 |
| 489 | Ga0495589_0000023 | 3300046794 | Bacteria | 195535 |
| 490 | Ga0495660_0000019 | 3300046810 | Bacteria | 311047 |
| 491 | Ga0495660_0000063 | 3300046810 | Bacteria | 129364 |
| 492 | Ga0495660_0013204 | 3300046810 | Bacteria | 4785 |
| 493 | Ga0495660_0041034 | 3300046810 | Bacteria | 2564 |
| 494 | Ga0495660_0055764 | 3300046810 | Bacteria | 2138 |
| 495 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 496 | Ga0495672_0000025 | 3300047320 | Bacteria | 365425 |
| 497 | Ga0495672_0000145 | 3300047320 | Bacteria | 104177 |
| 498 | Ga0495672_0016757 | 3300047320 | Bacteria | 4920 |
| 499 | Ga0495676_0031220 | 3300047321 | Bacteria | 4509 |
| 500 | Ga0495676_0071324 | 3300047321 | Bacteria | 2670 |
| 501 | Ga0495683_0000105 | 3300047323 | Bacteria | 87050 |
| 502 | Ga0495683_0000201 | 3300047323 | Bacteria | 56536 |
| 503 | Ga0495683_0007108 | 3300047323 | Bacteria | 6074 |
| 504 | Ga0495679_000263 | 3300047446 | Bacteria | 43748 |
| 505 | Ga0495679_000535 | 3300047446 | Bacteria | 26692 |
| 506 | Ga0495679_001169 | 3300047446 | Bacteria | 15629 |
| 507 | Ga0495679_011720 | 3300047446 | Bacteria | 3369 |
| 508 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 509 | Ga0495673_0000176 | 3300047469 | Bacteria | 103274 |
| 510 | Ga0495673_0003561 | 3300047469 | Bacteria | 10246 |
| 511 | Ga0495681_0047979 | 3300047470 | Bacteria | 2028 |
| 512 | Ga0495626_0000413 | 3300048091 | Bacteria | 43901 |
| 513 | Ga0496100_0030607 | 3300048903 | Bacteria | 3340 |
| 514 | Ga0496100_0034666 | 3300048903 | Bacteria | 3169 |
| 515 | Ga0496101_0000624 | 3300048904 | Bacteria | 21525 |
| 516 | Ga0496102_0113265 | 3300048905 | Bacteria | 2530 |
| 517 | Ga0496104_0017702 | 3300048907 | Bacteria | 6495 |
| 518 | Ga0496104_0040576 | 3300048907 | Bacteria | 4363 |
| 519 | Ga0496105_0032860 | 3300048908 | Bacteria | 4258 |
| 520 | Ga0496105_0070984 | 3300048908 | Bacteria | 2878 |
| 521 | Ga0496113_0074743 | 3300048916 | Bacteria | 2584 |
| 522 | Ga0496114_0010183 | 3300048917 | Bacteria | 7481 |
| 523 | Ga0496114_0843286 | 3300048917 | Bacteria | 796 |
| 524 | Ga0496116_0000015 | 3300048919 | Bacteria | 560702 |
| 525 | Ga0496116_0000096 | 3300048919 | Bacteria | 202230 |
| 526 | Ga0496116_0001120 | 3300048919 | Bacteria | 32049 |
| 527 | Ga0496116_0004381 | 3300048919 | Bacteria | 13500 |
| 528 | Ga0496116_0005667 | 3300048919 | Bacteria | 11501 |
| 529 | Ga0496116_0042872 | 3300048919 | Bacteria | 3088 |
| 530 | Ga0496116_0052156 | 3300048919 | Bacteria | 2711 |
| 531 | Ga0496116_0115965 | 3300048919 | Bacteria | 1561 |
| 532 | Ga0496117_0000043 | 3300048920 | Bacteria | 309583 |
| 533 | Ga0496117_0002805 | 3300048920 | Bacteria | 21246 |
| 534 | Ga0496117_0003581 | 3300048920 | Bacteria | 17927 |
| 535 | Ga0496117_0036499 | 3300048920 | Bacteria | 3676 |
| 536 | Ga0496117_0052208 | 3300048920 | Bacteria | 2881 |
| 537 | Ga0496117_0058545 | 3300048920 | Bacteria | 2667 |
| 538 | Ga0496117_0070014 | 3300048920 | Bacteria | 2359 |
| 539 | Ga0496117_0114350 | 3300048920 | Bacteria | 1673 |
| 540 | Ga0496118_0000075 | 3300048921 | Bacteria | 196228 |
| 541 | Ga0496118_0003147 | 3300048921 | Bacteria | 21106 |
| 542 | Ga0496118_0006965 | 3300048921 | Bacteria | 12205 |
| 543 | Ga0496118_0024462 | 3300048921 | Bacteria | 5208 |
| 544 | Ga0496118_0024561 | 3300048921 | Bacteria | 5196 |
| 545 | Ga0496118_0085790 | 3300048921 | Bacteria | 2190 |
| 546 | Ga0496118_0094132 | 3300048921 | Bacteria | 2049 |
| 547 | Ga0496118_0185699 | 3300048921 | Bacteria | 1250 |
| 548 | Ga0496119_0000207 | 3300048922 | Bacteria | 83748 |
| 549 | Ga0496119_0000355 | 3300048922 | Bacteria | 64264 |
| 550 | Ga0496119_0003086 | 3300048922 | Bacteria | 17573 |
| 551 | Ga0496119_0003653 | 3300048922 | Bacteria | 15793 |
| 552 | Ga0496119_0004492 | 3300048922 | Bacteria | 13869 |
| 553 | Ga0496119_0009362 | 3300048922 | Bacteria | 8422 |
| 554 | Ga0496119_0022030 | 3300048922 | Bacteria | 4579 |
| 555 | Ga0496119_0110181 | 3300048922 | Bacteria | 1529 |
| 556 | Ga0496120_0002244 | 3300048923 | Bacteria | 20193 |
| 557 | Ga0496120_0002287 | 3300048923 | Bacteria | 19874 |
| 558 | Ga0496120_0002586 | 3300048923 | Bacteria | 18012 |
| 559 | Ga0496120_0003799 | 3300048923 | Bacteria | 13310 |
| 560 | Ga0496120_0004827 | 3300048923 | Bacteria | 11031 |
| 561 | Ga0496120_0011502 | 3300048923 | Bacteria | 6081 |
| 562 | Ga0496120_0017896 | 3300048923 | Bacteria | 4579 |
| 563 | Ga0496120_0034663 | 3300048923 | Bacteria | 3021 |
| 564 | Ga0496120_0128423 | 3300048923 | Bacteria | 1301 |
| 565 | Ga0496121_0003934 | 3300048924 | Bacteria | 20565 |
| 566 | Ga0496121_0162610 | 3300048924 | Bacteria | 1630 |
| 567 | Ga0496122_0000170 | 3300048925 | Bacteria | 154389 |
| 568 | Ga0496122_0000213 | 3300048925 | Bacteria | 129218 |
| 569 | Ga0496122_0001232 | 3300048925 | Bacteria | 43246 |
| 570 | Ga0496122_0002533 | 3300048925 | Bacteria | 25730 |
| 571 | Ga0496122_0006705 | 3300048925 | Bacteria | 13101 |
| 572 | Ga0496122_0075834 | 3300048925 | Bacteria | 2369 |
| 573 | Ga0496122_0092780 | 3300048925 | Bacteria | 2051 |
| 574 | Ga0496122_0246962 | 3300048925 | Bacteria | 1001 |
| 575 | Ga0496123_0000058 | 3300048926 | Bacteria | 226832 |
| 576 | Ga0496123_0000177 | 3300048926 | Bacteria | 129218 |
| 577 | Ga0496123_0001000 | 3300048926 | Bacteria | 43259 |
| 578 | Ga0496123_0003285 | 3300048926 | Bacteria | 18323 |
| 579 | Ga0496123_0005016 | 3300048926 | Bacteria | 13549 |
| 580 | Ga0496123_0005959 | 3300048926 | Bacteria | 12003 |
| 581 | Ga0496123_0215385 | 3300048926 | Bacteria | 972 |
| 582 | Ga0496123_0240750 | 3300048926 | Bacteria | 898 |
| 583 | Ga0496124_0000026 | 3300048927 | Bacteria | 385387 |
| 584 | Ga0496124_0000058 | 3300048927 | Bacteria | 242191 |
| 585 | Ga0496124_0000246 | 3300048927 | Bacteria | 104777 |
| 586 | Ga0496124_0000496 | 3300048927 | Bacteria | 67552 |
| 587 | Ga0496124_0003737 | 3300048927 | Bacteria | 18344 |
| 588 | Ga0496124_0004258 | 3300048927 | Bacteria | 16840 |
| 589 | Ga0496124_0026202 | 3300048927 | Bacteria | 5262 |
| 590 | Ga0496124_0036782 | 3300048927 | Bacteria | 4264 |
| 591 | Ga0496124_0112630 | 3300048927 | Bacteria | 2187 |
| 592 | Ga0496125_0001072 | 3300048928 | Bacteria | 42178 |
| 593 | Ga0496125_0003468 | 3300048928 | Bacteria | 19086 |
| 594 | Ga0496125_0004263 | 3300048928 | Bacteria | 16642 |
| 595 | Ga0496125_0006018 | 3300048928 | Bacteria | 13270 |
| 596 | Ga0496125_0015281 | 3300048928 | Bacteria | 7431 |
| 597 | Ga0496125_0077588 | 3300048928 | Bacteria | 2559 |
| 598 | Ga0496125_0100461 | 3300048928 | Bacteria | 2132 |
| 599 | Ga0496126_0009982 | 3300048929 | Bacteria | 10024 |
| 600 | Ga0496126_0010751 | 3300048929 | Bacteria | 9556 |
| 601 | Ga0496126_0027891 | 3300048929 | Bacteria | 5386 |
| 602 | Ga0496126_0321621 | 3300048929 | Bacteria | 1271 |
| 603 | Ga0495678_000134 | 3300049459 | Bacteria | 88060 |
| 604 | Ga0495678_001292 | 3300049459 | Bacteria | 20223 |
| 605 | Ga0495678_110098 | 3300049459 | Bacteria | 940 |
| 606 | Ga0495682_0000017 | 3300049460 | Bacteria | 233333 |
| 607 | Ga0495682_0000424 | 3300049460 | Bacteria | 29663 |
| 608 | Ga0501319_002409 | 3300049535 | Bacteria | 1182 |
| 609 | Ga0501031_0167030 | 3300049568 | Bacteria | 1438 |
| 610 | Ga0501033_0081147 | 3300049570 | Bacteria | 2379 |
| 611 | Ga0501034_0000370 | 3300049571 | Bacteria | 76588 |
| 612 | Ga0501034_0147031 | 3300049571 | Bacteria | 2334 |
| 613 | Ga0501039_0050285 | 3300049575 | Bacteria | 3224 |
| 614 | Ga0501040_0039070 | 3300049576 | Bacteria | 3227 |
| 615 | Ga0501040_0373063 | 3300049576 | Bacteria | 1023 |
| 616 | Ga0501041_0204072 | 3300049577 | Bacteria | 1239 |
| 617 | Ga0501046_0284194 | 3300049580 | Bacteria | 1211 |
| 618 | Ga0501047_0317461 | 3300049581 | Bacteria | 1398 |
| 619 | Ga0501068_0065564 | 3300049584 | Bacteria | 2211 |
| 620 | Ga0501071_0137832 | 3300049587 | Bacteria | 1816 |
| 621 | Ga0501075_0069211 | 3300049591 | Bacteria | 2667 |
| 622 | Ga0501081_0373077 | 3300049743 | Bacteria | 1053 |
| 623 | Ga0501035_0035332 | 3300049822 | Bacteria | 4536 |
| 624 | Ga0501044_0003067 | 3300049823 | Bacteria | 18910 |
| 625 | Ga0501226_000079 | 3300049853 | Bacteria | 29272 |
| 626 | nmdc:mga00v17_46703_c1 | 3300050491 | Bacteria | 2621 |
| 627 | nmdc:mga00v17_50996_c1 | 3300050491 | Bacteria | 2516 |
| 628 | Ga0500643_057712 | 3300053087 | Bacteria | 1095 |
| 629 | Ga0500621_000048 | 3300053126 | Bacteria | 15257 |
| 630 | 2506576817 | 2506520007 | Bacteria | 5442880 |
| 631 | 2506581955 | 2506520008 | Bacteria | 5443009 |
| 632 | 2508850784 | 2508501071 | Bacteria | 5454741 |
| 633 | 2510284006 | 2510065053 | Bacteria | 5005518 |
| 634 | 2510293321 | 2510065055 | Bacteria | 5037935 |
| 635 | 2510312813 | 2510065058 | Bacteria | 5005894 |
| 636 | 2511253962 | 2511231004 | Bacteria | 6669789 |
| 637 | 2511274248 | 2511231007 | Bacteria | 6306603 |
| 638 | 2511277052 | 2511231008 | Bacteria | 6624100 |
| 639 | 2511289983 | 2511231010 | Bacteria | 6373152 |
| 640 | 2511297646 | 2511231011 | Bacteria | 6149768 |
| 641 | 2511300622 | 2511231012 | Bacteria | 6738011 |
| 642 | 2511315597 | 2511231014 | Bacteria | 6462302 |
| 643 | 2511329238 | 2511231016 | Bacteria | 6704427 |
| 644 | 2511332375 | 2511231017 | Bacteria | 6503007 |
| 645 | 2511336604 | 2511231018 | Bacteria | 6436256 |
| 646 | 2511346054 | 2511231019 | Bacteria | 6520662 |
| 647 | 2511352767 | 2511231020 | Bacteria | 6115223 |
| 648 | 2511355797 | 2511231021 | Bacteria | 7302637 |
| 649 | 2511362578 | 2511231022 | Bacteria | 6719296 |
| 650 | 2511375311 | 2511231024 | Bacteria | 5835885 |
| 651 | 2511382085 | 2511231025 | Bacteria | 5324661 |
| 652 | 2511437459 | 2511231035 | Bacteria | 5341610 |
| 653 | 2511823048 | 2511231156 | Bacteria | 6845832 |
| 654 | 2538425749 | 2537561728 | Bacteria | 5149301 |
| 655 | 2547698711 | 2547132181 | Bacteria | 4945084 |
| 656 | 2548652251 | 2547132416 | Bacteria | 4633861 |
| 657 | 2555247755 | 2554235231 | Bacteria | 5215788 |
| 658 | 2555258217 | 2554235234 | Bacteria | 5762085 |
| 659 | 2562463920 | 2561511199 | Bacteria | 5155034 |
| 660 | 2566035415 | 2565956521 | Bacteria | 4468993 |
| 661 | 2585826114 | 2585427591 | Bacteria | 5482980 |
| 662 | 2585831898 | 2585427592 | Bacteria | 5370892 |
| 663 | 2597865781 | 2597489888 | Bacteria | 6179543 |
| 664 | 2597871597 | 2597489889 | Bacteria | 6297495 |
| 665 | 2599328390 | 2599185155 | Bacteria | 5827168 |
| 666 | 2599355057 | 2599185160 | Bacteria | 6844013 |
| 667 | 2599361119 | 2599185161 | Bacteria | 6960462 |
| 668 | 2599367441 | 2599185162 | Bacteria | 6957254 |
| 669 | 2599374231 | 2599185163 | Bacteria | 6995158 |
| 670 | 2599380163 | 2599185164 | Bacteria | 6841688 |
| 671 | 2599386610 | 2599185165 | Bacteria | 6843250 |
| 672 | 2599393089 | 2599185166 | Bacteria | 6959206 |
| 673 | 2599399866 | 2599185167 | Bacteria | 6353609 |
| 674 | 2599404856 | 2599185168 | Bacteria | 6997636 |
| 675 | 2599412824 | 2599185169 | Bacteria | 5441380 |
| 676 | 2599452649 | 2599185179 | Bacteria | 6611171 |
| 677 | 2599461891 | 2599185181 | Bacteria | 6844519 |
| 678 | 2599467066 | 2599185182 | Bacteria | 6883168 |
| 679 | 2599491016 | 2599185186 | Bacteria | 6831633 |
| 680 | 2599501154 | 2599185188 | Bacteria | 6164180 |
| 681 | 2599508266 | 2599185189 | Bacteria | 5862825 |
| 682 | 2599514320 | 2599185190 | Bacteria | 6285678 |
| 683 | 2599521556 | 2599185191 | Bacteria | 6297582 |
| 684 | 2599613885 | 2599185212 | Bacteria | 6765997 |
| 685 | 2599770775 | 2599185248 | Bacteria | 6696816 |
| 686 | 2599881914 | 2599185288 | Bacteria | 6666191 |
| 687 | 2599886653 | 2599185289 | Bacteria | 6778765 |
| 688 | 2599893696 | 2599185290 | Bacteria | 6289611 |
| 689 | 2599897022 | 2599185291 | Bacteria | 6775623 |
| 690 | 2599928897 | 2599185299 | Bacteria | 4854625 |
| 691 | 2599934710 | 2599185300 | Bacteria | 6062622 |
| 692 | 2599943024 | 2599185302 | Bacteria | 5954930 |
| 693 | 2599951688 | 2599185303 | Bacteria | 6512725 |
| 694 | 2599953937 | 2599185304 | Bacteria | 5951361 |
| 695 | 2599959447 | 2599185305 | Bacteria | 6748700 |
| 696 | 2599968032 | 2599185306 | Bacteria | 6637356 |
| 697 | 2599974213 | 2599185307 | Bacteria | 6194719 |
| 698 | 2599979245 | 2599185308 | Bacteria | 6621546 |
| 699 | 2599985320 | 2599185309 | Bacteria | 5969593 |
| 700 | 2599987244 | 2599185310 | Bacteria | 6014457 |
| 701 | 2599995446 | 2599185311 | Bacteria | 6354990 |
| 702 | 2599999927 | 2599185312 | Bacteria | 5912071 |
| 703 | 2600008814 | 2599185313 | Bacteria | 6658188 |
| 704 | 2600013130 | 2599185314 | Bacteria | 6621749 |
| 705 | 2600016642 | 2599185315 | Bacteria | 6771107 |
| 706 | 2600025337 | 2599185316 | Bacteria | 6320029 |
| 707 | 2600029607 | 2599185317 | Bacteria | 6435722 |
| 708 | 2600035501 | 2599185318 | Bacteria | 6961590 |
| 709 | 2600041348 | 2599185319 | Bacteria | 6637840 |
| 710 | 2600045571 | 2599185320 | Bacteria | 5963263 |
| 711 | 2600056612 | 2599185321 | Bacteria | 6764560 |
| 712 | 2600058478 | 2599185322 | Bacteria | 6763055 |
| 713 | 2600063853 | 2599185323 | Bacteria | 6688755 |
| 714 | 2600074154 | 2599185324 | Bacteria | 6590677 |
| 715 | 2600079818 | 2599185325 | Bacteria | 6324919 |
| 716 | 2600214513 | 2599185356 | Bacteria | 6843884 |
| 717 | 2600358285 | 2600254930 | Bacteria | 6431253 |
| 718 | 2601525706 | 2600255254 | Bacteria | 5281859 |
| 719 | 2601528002 | 2600255255 | Bacteria | 5282785 |
| 720 | 2601533313 | 2600255256 | Bacteria | 5597742 |
| 721 | 2601538677 | 2600255257 | Bacteria | 5597196 |
| 722 | 2601614836 | 2600255280 | Bacteria | 5292309 |
| 723 | 2601620239 | 2600255281 | Bacteria | 5288753 |
| 724 | 2601626344 | 2600255283 | Bacteria | 6061572 |
| 725 | 2601646007 | 2600255287 | Bacteria | 5210468 |
| 726 | 2601648641 | 2600255288 | Bacteria | 5282738 |
| 727 | 2601652891 | 2600255289 | Bacteria | 5281907 |
| 728 | 2601658992 | 2600255290 | Bacteria | 5282218 |
| 729 | 2601666003 | 2600255291 | Bacteria | 5217298 |
| 730 | 2601692771 | 2600255296 | Bacteria | 5784754 |
| 731 | 2601698964 | 2600255298 | Bacteria | 5215185 |
| 732 | 2601703872 | 2600255299 | Bacteria | 5218662 |
| 733 | 2601705542 | 2600255300 | Bacteria | 5287774 |
| 734 | 2601711131 | 2600255301 | Bacteria | 5280532 |
| 735 | 2601716145 | 2600255302 | Bacteria | 5288235 |
| 736 | 2601723806 | 2600255303 | Bacteria | 5219315 |
| 737 | 2601726551 | 2600255304 | Bacteria | 5283973 |
| 738 | 2601731091 | 2600255305 | Bacteria | 5282329 |
| 739 | 2601736107 | 2600255306 | Bacteria | 5281613 |
| 740 | 2601743428 | 2600255307 | Bacteria | 5439064 |
| 741 | 2601754214 | 2600255309 | Bacteria | 5431045 |
| 742 | 2601757026 | 2600255310 | Bacteria | 5600903 |
| 743 | 2601761519 | 2600255311 | Bacteria | 5598766 |
| 744 | 2601774782 | 2600255313 | Bacteria | 6842543 |
| 745 | 2601800090 | 2600255318 | Bacteria | 6383414 |
| 746 | 2602021160 | 2600255392 | Bacteria | 5437392 |
| 747 | 2603641669 | 2602042046 | Bacteria | 5483348 |
| 748 | 2603643761 | 2602042047 | Bacteria | 4697674 |
| 749 | 2603658942 | 2602042052 | Bacteria | 5215873 |
| 750 | 2603663730 | 2602042053 | Bacteria | 5214361 |
| 751 | 2603701035 | 2602042066 | Bacteria | 4423871 |
| 752 | 2603704294 | 2602042067 | Bacteria | 4863713 |
| 753 | 2603838489 | 2602042103 | Bacteria | 5284714 |
| 754 | 2603844255 | 2602042104 | Bacteria | 5281639 |
| 755 | 2603848640 | 2602042105 | Bacteria | 5282303 |
| 756 | 2603853713 | 2602042106 | Bacteria | 5282744 |
| 757 | 2603865057 | 2602042109 | Bacteria | 5152801 |
| 758 | 2603871766 | 2602042110 | Bacteria | 5283285 |
| 759 | 2603879323 | 2602042111 | Bacteria | 5212080 |
| 760 | 2606048955 | 2603880178 | Bacteria | 5283018 |
| 761 | 2606068156 | 2603880184 | Bacteria | 5217896 |
| 762 | 2606074645 | 2603880185 | Bacteria | 6379190 |
| 763 | 2606127508 | 2603880199 | Bacteria | 6377649 |
| 764 | 2606146632 | 2603880202 | Bacteria | 5284684 |
| 765 | 2606176360 | 2603880211 | Bacteria | 5284226 |
| 766 | 2608670909 | 2608642108 | Bacteria | 4104624 |
| 767 | 2609914486 | 2609459761 | Bacteria | 5513740 |
| 768 | 2621297756 | 2619619299 | Bacteria | 6649820 |
| 769 | 2624478837 | 2623620443 | Bacteria | 6427864 |
| 770 | 2624494120 | 2623620446 | Bacteria | 6500345 |
| 771 | 2637223818 | 2636415599 | Bacteria | 5718434 |
| 772 | 2643842464 | 2643221565 | Bacteria | 6216018 |
| 773 | 2643873642 | 2643221571 | Bacteria | 6228673 |
| 774 | 2643955326 | 2643221589 | Bacteria | 6250934 |
| 775 | 2644023678 | 2643221602 | Bacteria | 6249926 |
| 776 | 2644188146 | 2643221633 | Bacteria | 6733554 |
| 777 | 2644281571 | 2643221650 | Bacteria | 7029547 |
| 778 | 2644623436 | 2643221713 | Bacteria | 6554480 |
| 779 | 2649121388 | 2648501241 | Bacteria | 5312320 |
| 780 | 2650897506 | 2648501693 | Bacteria | 5069560 |
| 781 | 2652548216 | 2651869719 | Bacteria | 6047974 |
| 782 | 2652974494 | 2651869818 | Bacteria | 5864031 |
| 783 | 2656276213 | 2654587920 | Bacteria | 5475511 |
| 784 | 2671094479 | 2667528170 | Bacteria | 6786960 |
| 785 | 2671097658 | 2667528171 | Bacteria | 6900659 |
| 786 | 2671104022 | 2667528172 | Bacteria | 5170840 |
| 787 | 2671109666 | 2667528173 | Bacteria | 5375747 |
| 788 | 2671127908 | 2667528176 | Bacteria | 6724917 |
| 789 | 2671588421 | 2671180115 | Bacteria | 5353919 |
| 790 | 2676409573 | 2675903046 | Bacteria | 5451247 |
| 791 | 2677897942 | 2675903420 | Bacteria | 6247433 |
| 792 | 2678261579 | 2675903515 | Bacteria | 6580491 |
| 793 | 2681998543 | 2681812866 | Bacteria | 4552357 |
| 794 | 2682007650 | 2681812869 | Bacteria | 5014465 |
| 795 | 2686354882 | 2684622997 | Bacteria | 4624240 |
| 796 | 2689443212 | 2687453601 | Bacteria | 5546041 |
| 797 | 2707100043 | 2706794495 | Bacteria | 4536932 |
| 798 | 2712472645 | 2711768156 | Bacteria | 4471618 |
| 799 | 2715757554 | 2713897149 | Bacteria | 6506249 |
| 800 | 2723250513 | 2721755607 | Bacteria | 5841722 |
| 801 | 2738670892 | 2738541265 | Bacteria | 6594665 |
| 802 | 2738689872 | 2738541271 | Bacteria | 5657310 |
| 803 | 2738749286 | 2738541282 | Bacteria | 6593925 |
| 804 | 2738811304 | 2738541294 | Bacteria | 6925949 |
| 805 | 2738858327 | 2738541303 | Bacteria | 6591772 |
| 806 | 2738898664 | 2738541309 | Bacteria | 6926455 |
| 807 | 2739196581 | 2738543004 | Bacteria | 6381073 |
| 808 | 2739257560 | 2738543015 | Bacteria | 6750701 |
| 809 | 2739265646 | 2738543016 | Bacteria | 5657564 |
| 810 | 2739286505 | 2738543020 | Bacteria | 5718238 |
| 811 | 2739291818 | 2738543021 | Bacteria | 5718241 |
| 812 | 2745007928 | 2744054620 | Bacteria | 6551379 |
| 813 | 2753857184 | 2751185917 | Bacteria | 4551186 |
| 814 | 2765582247 | 2765235841 | Bacteria | 6137024 |
| 815 | 2765590283 | 2765235842 | Bacteria | 4799256 |
| 816 | 2772437369 | 2772190666 | Bacteria | 5117644 |
| 817 | 2774122183 | 2773857670 | Bacteria | 6407454 |
| 818 | 2774131952 | 2773857672 | Bacteria | 4993178 |
| 819 | 2774136684 | 2773857673 | Bacteria | 6513460 |
| 820 | 2775539775 | 2775506706 | Bacteria | 4873073 |
| 821 | 2777020098 | 2775507074 | Bacteria | 5532402 |
| 822 | 2784260436 | 2784132063 | Bacteria | 6262788 |
| 823 | 2784314428 | 2784132072 | Bacteria | 6596533 |
| 824 | 2791925379 | 2791354903 | Bacteria | 4937680 |
| 825 | 2792314319 | 2791355010 | Bacteria | 4864581 |
| 826 | 2793404511 | 2791355275 | Bacteria | 4429597 |
| 827 | 2794594376 | 2791355520 | Bacteria | 5948615 |
| 828 | 2807177571 | 2806310673 | Bacteria | 4801221 |
| 829 | 2807409883 | 2806310737 | Bacteria | 5751088 |
| 830 | 2807458231 | 2806310745 | Bacteria | 5742165 |
| 831 | 2808854100 | 2808606361 | Bacteria | 6136259 |
| 832 | 2808906921 | 2808606373 | Bacteria | 4423627 |
| 833 | 2808923391 | 2808606376 | Bacteria | 6248667 |
| 834 | 2808928738 | 2808606377 | Bacteria | 6646337 |
| 835 | 2808934132 | 2808606378 | Bacteria | 6177535 |
| 836 | 2808945334 | 2808606380 | Bacteria | 6248705 |
| 837 | 2808950859 | 2808606381 | Bacteria | 6646461 |
| 838 | 2808956662 | 2808606382 | Bacteria | 6841132 |
| 839 | 2808962467 | 2808606383 | Bacteria | 6138645 |
| 840 | 2808980209 | 2808606385 | Bacteria | 6711065 |
| 841 | 2808995968 | 2808606388 | Bacteria | 6706662 |
| 842 | 2808997492 | 2808606389 | Bacteria | 6138126 |
| 843 | 2809126404 | 2808606414 | Bacteria | 4917181 |
| 844 | 2809215778 | 2808606445 | Bacteria | 6057339 |
| 845 | 2812370900 | 2811994881 | Bacteria | 6298475 |
| 846 | 2813727523 | 2811995292 | Bacteria | 5303342 |
| 847 | 2814695068 | 2814123068 | Bacteria | 5687681 |
| 848 | 2817493110 | 2816332298 | Bacteria | 6852809 |
| 849 | 2819658394 | 2818991456 | Bacteria | 6123676 |
| 850 | 2819702741 | 2818991464 | Bacteria | 6907494 |
| 851 | 2821120144 | 2821118458 | Bacteria | 4714306 |
| 852 | 2823378567 | 2823373977 | Bacteria | 4779415 |
| 853 | 2825653697 | 2825651385 | Bacteria | 6715909 |
| 854 | 2826584152 | 2826581358 | Bacteria | 5963467 |
| 855 | 2834034207 | 2834028612 | Bacteria | 6354979 |
| 856 | 2842808874 | 2842805378 | Bacteria | 5385175 |
| 857 | 2842820918 | 2842815866 | Bacteria | 5947510 |
| 858 | 2842829738 | 2842826826 | Bacteria | 5974129 |
| 859 | 2842843190 | 2842837860 | Bacteria | 6066181 |
| 860 | 2842849673 | 2842849001 | Bacteria | 5924277 |
| 861 | 2842857252 | 2842854478 | Bacteria | 6143501 |
| 862 | 2844428623 | 2844425489 | Bacteria | 4854065 |
| 863 | 2844530387 | 2844528606 | Bacteria | 4733806 |
| 864 | 2844668559 | 2844665904 | Bacteria | 6817974 |
| 865 | 2846541030 | 2846540461 | Bacteria | 5471451 |
| 866 | 2847086115 | 2847085930 | Bacteria | 5070450 |
| 867 | 2847798566 | 2847797336 | Bacteria | 5176640 |
| 868 | 2852105679 | 2852103415 | Bacteria | 5193810 |
| 869 | 2852612505 | 2852612431 | Bacteria | 6885235 |
| 870 | 2852662704 | 2852657418 | Bacteria | 6472974 |
| 871 | 2852669759 | 2852667396 | Bacteria | 6885555 |
| 872 | 2854603779 | 2854601825 | Bacteria | 4797592 |
| 873 | 2855198273 | 2855195626 | Bacteria | 4927512 |
| 874 | 2858467993 | 2858466076 | Bacteria | 4722413 |
| 875 | 2860340619 | 2860339153 | Bacteria | 6846989 |
| 876 | 2860872196 | 2860867994 | Bacteria | 5645326 |
| 877 | 2865016256 | 2865014394 | Bacteria | 4764573 |
| 878 | 2869552618 | 2869551831 | Bacteria | 5474685 |
| 879 | 2871275863 | 2871272651 | Bacteria | 5042015 |
| 880 | 2871283770 | 2871282230 | Bacteria | 4917173 |
| 881 | 2876601593 | 2876601092 | Bacteria | 5114497 |
| 882 | 2878030801 | 2878029506 | Bacteria | 6418441 |
| 883 | 2880231716 | 2880230671 | Bacteria | 6140320 |
| 884 | 2881613914 | 2881609920 | Bacteria | 4405319 |
| 885 | 2884087554 | 2884086401 | Bacteria | 5005459 |
| 886 | 2888367416 | 2888366609 | Bacteria | 5155009 |
| 887 | 2888374892 | 2888373701 | Bacteria | 5098052 |
| 888 | 2891673387 | 2891670763 | Bacteria | 4967099 |
| 889 | 2904478086 | 2904474040 | Bacteria | 5504324 |
| 890 | 2904506870 | 2904504865 | Bacteria | 5152820 |
| 891 | 2904518166 | 2904513164 | Bacteria | 5476410 |
| 892 | 2904520750 | 2904518522 | Bacteria | 6068986 |
| 893 | 2904553078 | 2904550169 | Bacteria | 6221258 |
| 894 | 2908451701 | 2908446538 | Bacteria | 6829095 |
| 895 | 2908672231 | 2908669403 | Bacteria | 5740494 |
| 896 | 2912964895 | 2912963787 | Bacteria | 5646108 |
| 897 | 2913037920 | 2913036834 | Bacteria | 6704877 |
| 898 | 2916180227 | 2916178963 | Bacteria | 5265078 |
| 899 | 2917071819 | 2917070673 | Bacteria | 6868303 |
| 900 | 2917836072 | 2917832318 | Bacteria | 5346010 |
| 901 | 2919064693 | 2919063839 | Bacteria | 6302690 |
| 902 | 2919113936 | 2919108558 | Bacteria | 5897419 |
| 903 | 2919128221 | 2919125081 | Bacteria | 5385106 |
| 904 | 2919153950 | 2919150387 | Bacteria | 5500879 |
| 905 | 2919160184 | 2919155634 | Bacteria | 4860545 |
| 906 | 2919458264 | 2919456309 | Bacteria | 6586567 |
| 907 | 2919482827 | 2919481497 | Bacteria | 6907839 |
| 908 | 2919495659 | 2919493220 | Bacteria | 4598500 |
| 909 | 2919498747 | 2919497567 | Bacteria | 4408621 |
| 910 | 2919544626 | 2919543075 | Bacteria | 4728703 |
| 911 | 2919689991 | 2919688452 | Bacteria | 4595932 |
| 912 | 2919699964 | 2919697872 | Bacteria | 6553725 |
| 913 | 2923525005 | 2923519811 | Bacteria | 6298479 |
| 914 | 2923527013 | 2923525760 | Bacteria | 4472324 |
| 915 | 2923591768 | 2923586266 | Bacteria | 6565975 |
| 916 | 2923636183 | 2923634449 | Bacteria | 4753480 |
| 917 | 2927147487 | 2927143783 | Bacteria | 5504251 |
| 918 | 2927837327 | 2927833300 | Bacteria | 4923934 |
| 919 | 2929145372 | 2929144301 | Bacteria | 6622272 |
| 920 | 2929194310 | 2929189879 | Bacteria | 5930554 |
| 921 | 2931371288 | 2931369376 | Bacteria | 6847892 |
| 922 | 2931395582 | 2931390751 | Bacteria | 6273349 |
| 923 | 2931399478 | 2931396565 | Bacteria | 7251677 |
| 924 | 2932410329 | 2932406140 | Bacteria | 5134491 |
| 925 | 2935353992 | 2935353572 | Unclassified | 6955622 |
| 926 | 2935629178 | 2935625433 | Bacteria | 5042964 |
| 927 | 2937543932 | 2937539931 | Bacteria | 4639830 |
| 928 | 2937970586 | 2937967321 | Bacteria | 5094075 |
| 929 | 2939570927 | 2939568625 | Bacteria | 4542555 |
| 930 | 2939577357 | 2939573065 | Bacteria | 4926053 |
| 931 | 2939582407 | 2939577877 | Bacteria | 5132791 |
| 932 | 2939604492 | 2939602548 | Bacteria | 4950493 |
| 933 | 2939609948 | 2939607340 | Bacteria | 4719256 |
| 934 | 2939621782 | 2939617950 | Bacteria | 4820956 |
| 935 | 2939637046 | 2939636861 | Bacteria | 6297853 |
| 936 | 2939645037 | 2939642701 | Bacteria | 4475280 |
| 937 | 2939653253 | 2939651529 | Bacteria | 5895393 |
| 938 | 2945876461 | 2945874760 | Bacteria | 5527237 |
| 939 | 2945931747 | 2945928738 | Bacteria | 6053221 |
| 940 | 2945951813 | 2945951305 | Bacteria | 4918162 |
| 941 | 2945961384 | 2945961074 | Bacteria | 7342064 |
| 942 | 2946007830 | 2946006987 | Bacteria | 6705746 |
| 943 | 2946032795 | 2946027586 | Bacteria | 6049274 |
| 944 | 2947233554 | 2947233263 | Bacteria | 6439278 |
| 945 | 2969080829 | 2969079654 | Bacteria | 5439582 |
| 946 | 2971822225 | 2971820967 | Bacteria | 5823634 |
| 947 | 2974301377 | 2974298342 | Bacteria | 4840922 |
| 948 | 2974315514 | 2974310843 | Bacteria | 4947816 |
| 949 | 2974439686 | 2974435778 | Bacteria | 4876478 |
| 950 | 2978978350 | 2978975091 | Bacteria | 4704313 |
| 951 | 2984495385 | 2984494565 | Bacteria | 5000175 |
| 952 | 2984503856 | 2984499530 | Bacteria | 5020881 |
| 953 | 2984507561 | 2984504281 | Bacteria | 5262371 |
| 954 | 2984563290 | 2984559226 | Bacteria | 5683096 |
| 955 | 2984596025 | 2984595703 | Bacteria | 5682994 |
| 956 | 2988732916 | 2988728565 | Bacteria | 6124362 |
| 957 | 2990200576 | 2990196909 | Bacteria | 4054280 |
| 958 | 2990265095 | 2990261002 | Bacteria | 4919493 |
| 959 | 3000378062 | 3000376612 | Bacteria | 4705565 |
| 960 | 3007512443 | 3007511990 | Bacteria | 6481491 |
| 961 | 3007624334 | 3007619802 | Bacteria | 6411688 |
| 962 | 3007721430 | 3007718800 | Bacteria | 5971527 |
| 963 | 3007803761 | 3007803356 | Bacteria | 5931491 |
| 964 | 3007871270 | 3007866637 | Bacteria | 5899198 |
| 965 | 3007876204 | 3007872151 | Bacteria | 5268868 |
| 966 | 637318436 | 637000220 | Bacteria | 7074893 |
| 967 | 640936369 | 640753048 | Bacteria | 5495657 |
| 968 | 8004597681 | 8004592986 | Bacteria | 5122074 |
| 969 | 8011354296 | 8011350971 | Bacteria | 6158957 |
| 970 | 8015399069 | 8015394850 | Bacteria | 5064660 |
| 971 | 8016730309 | 8016728285 | Bacteria | 5263933 |
| 972 | 8016734739 | 8016733728 | Bacteria | 5274317 |
| 973 | 8018222666 | 8018221730 | Bacteria | 4616064 |
| 974 | 8018405299 | 8018405270 | Bacteria | 4978981 |
| 975 | 8019503798 | 8019499862 | Bacteria | 5169538 |
| 976 | 8019508900 | 8019504834 | Bacteria | 4819156 |
| 977 | 8019773305 | 8019769354 | Bacteria | 6924660 |
| 978 | 8019776630 | 8019775933 | Bacteria | 6858656 |
| 979 | 8052495698 | 8052494512 | Bacteria | 5765634 |
| 980 | 8054286175 | 8054285046 | Bacteria | 6919322 |
| 981 | 8054351137 | 8054347763 | Bacteria | 5901107 |
| 982 | 8054508096 | 8054503363 | Bacteria | 6101651 |
| 983 | 8054847735 | 8054844752 | Bacteria | 4450330 |
| 984 | 8054851566 | 8054849141 | Bacteria | 5232694 |
| 985 | 8054929508 | 8054929484 | Bacteria | 5599761 |
| 986 | 8055088487 | 8055087960 | Bacteria | 4784273 |
| 987 | 8055096855 | 8055092621 | Bacteria | 4873875 |
| 988 | 8055098206 | 8055097453 | Bacteria | 4865496 |
| 989 | 8055694754 | 8055693939 | Bacteria | 4772047 |
| 990 | 8055823049 | 8055817908 | Bacteria | 6609162 |
| 991 | 8055883259 | 8055878733 | Bacteria | 5907058 |
| 992 | 8056120234 | 8056115690 | Bacteria | 5527654 |
| 993 | 8056121916 | 8056120720 | Bacteria | 5758328 |
| 994 | 8056130798 | 8056125926 | Bacteria | 6228218 |
| 995 | 8056136463 | 8056131705 | Bacteria | 6107031 |
| 996 | 8056141858 | 8056137416 | Bacteria | 6147080 |
| 997 | 8056147909 | 8056143049 | Bacteria | 6307666 |
| 998 | 8056153493 | 8056148874 | Bacteria | 6479865 |
| 999 | 8056155572 | 8056155041 | Bacteria | 6486948 |
| 1000 | 8056162716 | 8056161164 | Bacteria | 6106669 |
| 1001 | 8056176116 | 8056172158 | Bacteria | 6133900 |
| 1002 | 8056183413 | 8056177738 | Bacteria | 6748268 |
| 1003 | 8056569718 | 8056569372 | Bacteria | 5997322 |
| 1004 | 8057163339 | 8057160832 | Bacteria | 3268302 |
| 1005 | 8057305436 | 8057304971 | Bacteria | 4649742 |
| 1006 | 8057803333 | 8057798959 | Bacteria | 6713499 |
| 1007 | Ga0058692_1012258 | |||
| 1008 | MRS2a_Contig_908 | |||
| 1009 | JGI24741J21665_1007693 | |||
| 1010 | JGI24739J22299_10000495 | |||
| 1011 | JGI25154J39366_1004064 | |||
| 1012 | JGI25163J39215_1000022 | |||
| 1013 | JGI25164J39214_1000008 | |||
| 1014 | JGI25164J39214_1000100 | |||
| 1015 | JGI25152J39213_1000802 | |||
| 1016 | JGI25165J46597_1000207 | |||
| 1017 | rootH2_10027710 | |||
| 1018 | rootL2_10202333 | |||
| 1019 | Ga0055538_1000014 | |||
| 1020 | Ga0055538_1000028 | |||
| 1021 | Ga0055539_1000020 | |||
| 1022 | Ga0055539_1000037 | |||
| 1023 | Ga0055533_1000027 | |||
| 1024 | Ga0055533_1000047 | |||
| 1025 | Ga0055532_1000129 | |||
| 1026 | Ga0055525_1000032 | |||
| 1027 | Ga0055525_1000443 | |||
| 1028 | Ga0055536_1003337 | |||
| 1029 | Ga0055536_1011775 | |||
| 1030 | Ga0055530_10007005 | |||
| 1031 | Ga0055530_10030977 | |||
| 1032 | Ga0055531_10006469 | |||
| 1033 | Ga0055541_1000014 | |||
| 1034 | Ga0055541_1000025 | |||
| 1035 | Ga0058692_1006453 | |||
| 1036 | Ga0058692_1017030 | |||
| 1037 | Ga0058860_10094053 | |||
| 1038 | Ga0058860_10169596 | |||
| 1039 | Ga0058860_10195578 | |||
| 1040 | Ga0058860_12165330 | |||
| 1041 | Ga0058860_12187468 | |||
| 1042 | Ga0065703_1020270 | |||
| 1043 | Ga0065714_10000238 | |||
| 1044 | Ga0065714_10081923 | |||
| 1045 | Ga0065714_10087702 | |||
| 1046 | Ga0065704_10000888 | |||
| 1047 | Ga0065704_10002842 | |||
| 1048 | Ga0065704_10004084 | |||
| 1049 | Ga0065704_10026246 | |||
| 1050 | Ga0065704_10090186 | |||
| 1051 | Ga0065704_10139924 | |||
| 1052 | Ga0065712_10003691 | |||
| 1053 | Ga0065712_10067863 | |||
| 1054 | Ga0065712_10079070 | |||
| 1055 | Ga0065715_10133975 | |||
| 1056 | Ga0070661_100000022 | |||
| 1057 | Ga0070669_100001703 | |||
| 1058 | Ga0070669_100005661 | |||
| 1059 | Ga0070694_100087223 | |||
| 1060 | Ga0070662_100000041 | |||
| 1061 | Ga0070662_100004331 | |||
| 1062 | Ga0070698_100135638 | |||
| 1063 | Ga0068853_100007800 | |||
| 1064 | Ga0070696_100279255 | |||
| 1065 | Ga0070665_100007341 | |||
| 1066 | Ga0070665_100010625 | |||
| 1067 | Ga0070665_100083166 | |||
| 1068 | Ga0070664_100000646 | |||
| 1069 | Ga0068857_100073160 | |||
| 1070 | Ga0068857_100216748 | |||
| 1071 | Ga0068854_100020986 | |||
| 1072 | Ga0070702_100155902 | |||
| 1073 | Ga0068859_100015807 | |||
| 1074 | Ga0068851_10000044 | |||
| 1075 | Ga0068851_10012067 | |||
| 1076 | Ga0068851_10064435 | |||
| 1077 | Ga0081538_10087104 | |||
| 1078 | Ga0075364_10007670 | |||
| 1079 | Ga0075364_10020296 | |||
| 1080 | Ga0075364_10326818 | |||
| 1081 | Ga0070715_10018108 | |||
| 1082 | Ga0075367_10416592 | |||
| 1083 | Ga0075434_100202485 | |||
| 1084 | Ga0097620_100015807 | |||
| 1085 | Ga0099823_1000054 | |||
| 1086 | Ga0079104_1000720 | |||
| 1087 | Ga0079104_1000769 | |||
| 1088 | Ga0079104_1002016 | |||
| 1089 | Ga0079104_1015557 | |||
| 1090 | Ga0079104_1020880 | |||
| 1091 | Ga0079104_1027141 | |||
| 1092 | Ga0099794_10005207 | |||
| 1093 | Ga0105251_10000151 | |||
| 1094 | Ga0105251_10000156 | |||
| 1095 | Ga0105251_10001256 | |||
| 1096 | Ga0105251_10007540 | |||
| 1097 | Ga0105251_10029112 | |||
| 1098 | Ga0105251_10050570 | |||
| 1099 | Ga0105251_10057196 | |||
| 1100 | Ga0105251_10059849 | |||
| 1101 | Ga0105251_10126641 | |||
| 1102 | Ga0105251_10158084 | |||
| 1103 | Ga0105244_10000272 | |||
| 1104 | Ga0105244_10000338 | |||
| 1105 | Ga0105244_10000932 | |||
| 1106 | Ga0105244_10002378 | |||
| 1107 | Ga0105244_10003891 | |||
| 1108 | Ga0105244_10004865 | |||
| 1109 | Ga0105244_10010841 | |||
| 1110 | Ga0105244_10049440 | |||
| 1111 | Ga0105244_10075100 | |||
| 1112 | Ga0105244_10115292 | |||
| 1113 | Ga0105244_10126386 | |||
| 1114 | Ga0105244_10141536 | |||
| 1115 | Ga0105244_10182263 | |||
| 1116 | Ga0105244_10189344 | |||
| 1117 | Ga0105250_10000042 | |||
| 1118 | Ga0105250_10000542 | |||
| 1119 | Ga0105250_10000611 | |||
| 1120 | Ga0105250_10001268 | |||
| 1121 | Ga0105250_10001773 | |||
| 1122 | Ga0105250_10003580 | |||
| 1123 | Ga0105250_10039616 | |||
| 1124 | Ga0105250_10094222 | |||
| 1125 | Ga0105250_10130066 | |||
| 1126 | Ga0105245_10155601 | |||
| 1127 | Ga0105247_10000301 | |||
| 1128 | Ga0105247_10469645 | |||
| 1129 | Ga0105243_10010660 | |||
| 1130 | Ga0105243_10024754 | |||
| 1131 | Ga0105243_10238632 | |||
| 1132 | Ga0105243_10242685 | |||
| 1133 | Ga0105243_10361702 | |||
| 1134 | Ga0105241_10000008 | |||
| 1135 | Ga0105242_10007385 | |||
| 1136 | Ga0105242_10201976 | |||
| 1137 | Ga0105248_10027748 | |||
| 1138 | Ga0105237_10001243 | |||
| 1139 | Ga0105237_10174419 | |||
| 1140 | Ga0130087_1027949 | |||
| 1141 | Ga0105246_10056158 | |||
| 1142 | Ga0157373_10000463 | |||
| 1143 | Ga0157373_10063629 | |||
| 1144 | Ga0157373_10064357 | |||
| 1145 | Ga0157373_10146750 | |||
| 1146 | Ga0157373_10155477 | |||
| 1147 | Ga0157371_10001001 | |||
| 1148 | Ga0157371_10001008 | |||
| 1149 | Ga0157371_10002245 | |||
| 1150 | Ga0157371_10023605 | |||
| 1151 | Ga0157370_10002229 | |||
| 1152 | Ga0157370_10002252 | |||
| 1153 | Ga0157370_10004489 | |||
| 1154 | Ga0157370_10006004 | |||
| 1155 | Ga0157370_10033837 | |||
| 1156 | Ga0157370_10045091 | |||
| 1157 | Ga0157369_10000956 | |||
| 1158 | Ga0157369_10038217 | |||
| 1159 | Ga0163162_10044620 | |||
| 1160 | Ga0163162_10163690 | |||
| 1161 | Ga0163162_10279941 | |||
| 1162 | Ga0157372_10004322 | |||
| 1163 | Ga0157372_10008877 | |||
| 1164 | Ga0157372_10070044 | |||
| 1165 | Ga0157372_10152976 | |||
| 1166 | Ga0157372_10512069 | |||
| 1167 | Ga0157372_10551068 | |||
| 1168 | Ga0157380_10371786 | |||
| 1169 | Ga0157380_10855410 | |||
| 1170 | Ga0182008_10001425 | |||
| 1171 | Ga0182006_1000069 | |||
| 1172 | Ga0183366_1002 | |||
| 1173 | Ga0183370_1002 | |||
| 1174 | Ga0183369_1002 | |||
| 1175 | Ga0183368_1005 | |||
| 1176 | Ga0163161_10000002 | |||
| 1177 | Ga0163161_10051926 | |||
| 1178 | Ga0163161_10060323 | |||
| 1179 | Ga0206356_11158939 | |||
| 1180 | Ga0206351_10013078 | |||
| 1181 | Ga0206352_10402763 | |||
| 1182 | Ga0206354_10196568 | |||
| 1183 | Ga0206354_10826925 | |||
| 1184 | Ga0154015_1698326 | |||
| 1185 | Ga0213876_10000444 | |||
| 1186 | Ga0224712_10079925 | |||
| 1187 | Ga0256714_107509 | |||
| 1188 | Ga0256744_141414 | |||
| 1189 | Ga0209435_100363 | |||
| 1190 | Ga0209760_100086 | |||
| 1191 | Ga0209760_100463 | |||
| 1192 | Ga0209784_100030 | |||
| 1193 | Ga0209784_100032 | |||
| 1194 | Ga0209566_100034 | |||
| 1195 | Ga0209566_100036 | |||
| 1196 | Ga0209674_100052 | |||
| 1197 | Ga0209674_100054 | |||
| 1198 | Ga0209147_100055 | |||
| 1199 | Ga0209563_100054 | |||
| 1200 | Ga0209563_100055 | |||
| 1201 | Ga0207427_100001 | |||
| 1202 | Ga0207427_100035 | |||
| 1203 | Ga0209437_100003 | |||
| 1204 | Ga0209437_100068 | |||
| 1205 | Ga0209437_100110 | |||
| 1206 | Ga0209258_100231 | |||
| 1207 | Ga0207425_1019345 | |||
| 1208 | Ga0209646_1000331 | |||
| 1209 | Ga0209677_100032 | |||
| 1210 | Ga0209677_100033 | |||
| 1211 | Ga0209759_1010939 | |||
| 1212 | Ga0209129_1000103 | |||
| 1213 | Ga0209233_1000007 | |||
| 1214 | Ga0209565_1038113 | |||
| 1215 | Ga0209675_1006388 | |||
| 1216 | Ga0209676_1000078 | |||
| 1217 | Ga0209676_1000503 | |||
| 1218 | Ga0209050_1000041 | |||
| 1219 | Ga0209050_1000060 | |||
| 1220 | Ga0209050_1000425 | |||
| 1221 | Ga0209051_1000037 | |||
| 1222 | Ga0209051_1000061 | |||
| 1223 | Ga0209051_1000085 | |||
| 1224 | Ga0209257_1000635 | |||
| 1225 | Ga0209257_1011547 | |||
| 1226 | Ga0207656_10000022 | |||
| 1227 | Ga0207656_10004274 | |||
| 1228 | Ga0207696_1000008 | |||
| 1229 | Ga0207696_1000009 | |||
| 1230 | Ga0207696_1000027 | |||
| 1231 | Ga0207696_1000032 | |||
| 1232 | Ga0207696_1000034 | |||
| 1233 | Ga0207696_1000129 | |||
| 1234 | Ga0207696_1000187 | |||
| 1235 | Ga0207696_1000262 | |||
| 1236 | Ga0207696_1000278 | |||
| 1237 | Ga0207696_1001031 | |||
| 1238 | Ga0207696_1001146 | |||
| 1239 | Ga0207696_1001494 | |||
| 1240 | Ga0207696_1002195 | |||
| 1241 | Ga0207696_1003240 | |||
| 1242 | Ga0207696_1006426 | |||
| 1243 | Ga0207696_1006575 | |||
| 1244 | Ga0207655_1000020 | |||
| 1245 | Ga0207655_1000054 | |||
| 1246 | Ga0207655_1000103 | |||
| 1247 | Ga0207655_1000357 | |||
| 1248 | Ga0207655_1000408 | |||
| 1249 | Ga0207655_1000569 | |||
| 1250 | Ga0207655_1000721 | |||
| 1251 | Ga0207655_1000752 | |||
| 1252 | Ga0207655_1000828 | |||
| 1253 | Ga0207655_1001231 | |||
| 1254 | Ga0207655_1001348 | |||
| 1255 | Ga0207655_1006303 | |||
| 1256 | Ga0207655_1007027 | |||
| 1257 | Ga0207655_1007625 | |||
| 1258 | Ga0207655_1007768 | |||
| 1259 | Ga0207655_1014196 | |||
| 1260 | Ga0207655_1017833 | |||
| 1261 | Ga0207655_1024660 | |||
| 1262 | Ga0207655_1036293 | |||
| 1263 | Ga0207655_1077163 | |||
| 1264 | Ga0207713_1000014 | |||
| 1265 | Ga0207713_1000028 | |||
| 1266 | Ga0207713_1000123 | |||
| 1267 | Ga0207713_1000129 | |||
| 1268 | Ga0207713_1000163 | |||
| 1269 | Ga0207713_1000223 | |||
| 1270 | Ga0207713_1001297 | |||
| 1271 | Ga0207713_1004295 | |||
| 1272 | Ga0207713_1005559 | |||
| 1273 | Ga0207713_1005686 | |||
| 1274 | Ga0207713_1006908 | |||
| 1275 | Ga0207713_1007366 | |||
| 1276 | Ga0207713_1008261 | |||
| 1277 | Ga0207713_1009429 | |||
| 1278 | Ga0207713_1033358 | |||
| 1279 | Ga0207713_1037467 | |||
| 1280 | Ga0207713_1049253 | |||
| 1281 | Ga0207710_10000061 | |||
| 1282 | Ga0207685_10039892 | |||
| 1283 | Ga0207654_10000009 | |||
| 1284 | Ga0207695_10164949 | |||
| 1285 | Ga0207671_10000034 | |||
| 1286 | Ga0207671_10109162 | |||
| 1287 | Ga0207649_10000006 | |||
| 1288 | Ga0207681_10000978 | |||
| 1289 | Ga0207681_10390162 | |||
| 1290 | Ga0207650_10000092 | |||
| 1291 | Ga0207706_10003133 | |||
| 1292 | Ga0207706_10061623 | |||
| 1293 | Ga0207686_10001893 | |||
| 1294 | Ga0207686_10032842 | |||
| 1295 | Ga0207709_10004825 | |||
| 1296 | Ga0207709_10014581 | |||
| 1297 | Ga0207709_10050415 | |||
| 1298 | Ga0207709_10060080 | |||
| 1299 | Ga0207669_10245343 | |||
| 1300 | Ga0207689_10305707 | |||
| 1301 | Ga0207679_10000010 | |||
| 1302 | Ga0207668_10007234 | |||
| 1303 | Ga0207639_10005461 | |||
| 1304 | Ga0207708_10361060 | |||
| 1305 | Ga0207674_10088438 | |||
| 1306 | Ga0207674_10103126 | |||
| 1307 | Ga0209281_1000010 | |||
| 1308 | Ga0209281_1000049 | |||
| 1309 | Ga0209281_1000054 | |||
| 1310 | Ga0209281_1000056 | |||
| 1311 | Ga0209281_1000371 | |||
| 1312 | Ga0209281_1000505 | |||
| 1313 | Ga0209281_1000576 | |||
| 1314 | Ga0209281_1000683 | |||
| 1315 | Ga0209281_1001352 | |||
| 1316 | Ga0209281_1013772 | |||
| 1317 | Ga0209281_1022875 | |||
| 1318 | Ga0209389_1000002 | |||
| 1319 | Ga0209371_1000013 | |||
| 1320 | Ga0209371_1000049 | |||
| 1321 | Ga0209371_1000572 | |||
| 1322 | Ga0209371_1000582 | |||
| 1323 | Ga0209371_1000935 | |||
| 1324 | Ga0209371_1001075 | |||
| 1325 | Ga0209371_1001276 | |||
| 1326 | Ga0209371_1002216 | |||
| 1327 | Ga0209371_1002307 | |||
| 1328 | Ga0209371_1002649 | |||
| 1329 | Ga0209371_1002734 | |||
| 1330 | Ga0209371_1014808 | |||
| 1331 | Ga0209371_1018024 | |||
| 1332 | Ga0209371_1022298 | |||
| 1333 | Ga0209981_1003851 | |||
| 1334 | Ga0209981_1006084 | |||
| 1335 | Ga0209984_1009488 | |||
| 1336 | Ga0209999_1007990 | |||
| 1337 | Ga0210002_1012214 | |||
| 1338 | Ga0209983_1004310 | |||
| 1339 | Ga0209971_1042692 | |||
| 1340 | Ga0209966_1003526 | |||
| 1341 | Ga0207428_10151233 | |||
| 1342 | Ga0268266_10000211 | |||
| 1343 | Ga0268266_10052890 | |||
| 1344 | Ga0311001_1010284 | |||
| 1345 | Ga0268256_1000014 | |||
| 1346 | Ga0268256_1000031 | |||
| 1347 | Ga0268256_1000227 | |||
| 1348 | Ga0268256_1000499 | |||
| 1349 | Ga0268256_1001137 | |||
| 1350 | Ga0268256_1001942 | |||
| 1351 | Ga0268256_1002473 | |||
| 1352 | Ga0268256_1003008 | |||
| 1353 | Ga0268256_1005389 | |||
| 1354 | Ga0268256_1019845 | |||
| 1355 | Ga0268256_1020097 | |||
| 1356 | Ga0316177_1087706 | |||
| 1357 | Ga0316183_1016295 | |||
| 1358 | Ga0265328_10000016 | |||
| 1359 | Ga0307408_100298698 | |||
| 1360 | Ga0307408_100392243 | |||
| 1361 | Ga0316575_10000446 | |||
| 1362 | Ga0316575_10011572 | |||
| 1363 | Ga0316579_10000802 | |||
| 1364 | Ga0316579_10022759 | |||
| 1365 | Ga0316579_10197790 | |||
| 1366 | Ga0265314_10121058 | |||
| 1367 | Ga0307413_10060321 | |||
| 1368 | Ga0307412_10413110 | |||
| 1369 | Ga0307416_100350680 | |||
| 1370 | Ga0316585_10004730 | |||
| 1371 | Ga0316593_10000082 | |||
| 1372 | Ga0316593_10014396 | |||
| 1373 | Ga0316593_10024525 | |||
| 1374 | Ga0316593_10026492 | |||
| 1375 | Ga0316593_10032846 | |||
| 1376 | Ga0316593_10067079 | |||
| 1377 | Ga0373936_0117312 | |||
| 1378 | Ga0316574_0222461 | |||
| 1379 | Ga0373935_0065766 | |||
| 1380 | Ga0373935_0313854 | |||
| 1381 | Ga0373927_0038654 | |||
| 1382 | Ga0373937_0345012 | |||
| 1383 | Ga0316582_0002520 | |||
| 1384 | Ga0316584_0304221 | |||
| 1385 | Ga0373925_0041279 | |||
| 1386 | Ga0316581_0073803 | |||
| 1387 | Ga0400483_105112 | |||
| 1388 | Ga0400483_213263 | |||
| 1389 | Ga0436365_1801698 | |||
| 1390 | Ga0439436_0000220 | |||
| 1391 | Ga0439438_000042 | |||
| 1392 | Ga0439438_003009 | |||
| 1393 | Ga0439438_004922 | |||
| 1394 | Ga0439438_004959 | |||
| 1395 | Ga0439438_007456 | |||
| 1396 | Ga0439438_008294 | |||
| 1397 | Ga0439447_000338 | |||
| 1398 | Ga0439447_001723 | |||
| 1399 | Ga0439447_005050 | |||
| 1400 | Ga0439447_005875 | |||
| 1401 | Ga0439466_0000004 | |||
| 1402 | Ga0439466_0003385 | |||
| 1403 | Ga0451789_0093147 | |||
| 1404 | Ga0451797_1445638 | |||
| 1405 | Ga0451805_097769 | |||
| 1406 | Ga0451807_0192210 | |||
| 1407 | Ga0451835_0706369 | |||
| 1408 | Ga0451853_0953173 | |||
| 1409 | Ga0451853_1281195 | |||
| 1410 | Ga0452268_32449 | |||
| 1411 | Ga0439431_0003975 | |||
| 1412 | Ga0439441_002360 | |||
| 1413 | Ga0439443_024958 | |||
| 1414 | Ga0439432_003406 | |||
| 1415 | Ga0439432_008690 | |||
| 1416 | Ga0439432_014747 | |||
| 1417 | Ga0439432_028853 | |||
| 1418 | Ga0439452_000009 | |||
| 1419 | Ga0439452_000013 | |||
| 1420 | Ga0439452_000094 | |||
| 1421 | Ga0439452_000121 | |||
| 1422 | Ga0439455_0044352 | |||
| 1423 | Ga0439456_008965 | |||
| 1424 | Ga0439463_003608 | |||
| 1425 | Ga0450911_000317 | |||
| 1426 | Ga0450923_009020 | |||
| 1427 | Ga0450900_001029 | |||
| 1428 | Ga0450902_004495 | |||
| 1429 | Ga0450904_000557 | |||
| 1430 | Ga0450905_013876 | |||
| 1431 | Ga0450907_000648 | |||
| 1432 | Ga0439446_0002391 | |||
| 1433 | Ga0439446_0002561 | |||
| 1434 | Ga0439435_0000397 | |||
| 1435 | Ga0439459_0002610 | |||
| 1436 | Ga0439464_0002684 | |||
| 1437 | Ga0439460_0000842 | |||
| 1438 | Ga0450893_0002336 | |||
| 1439 | Ga0450893_0015838 | |||
| 1440 | Ga0466981_0000032 | |||
| 1441 | Ga0495627_000177 | |||
| 1442 | Ga0495627_005014 | |||
| 1443 | Ga0495591_000222 | |||
| 1444 | Ga0495591_000590 | |||
| 1445 | Ga0495591_001740 | |||
| 1446 | Ga0495591_005309 | |||
| 1447 | Ga0495591_037354 | |||
| 1448 | Ga0495650_0000008 | |||
| 1449 | Ga0495650_0000059 | |||
| 1450 | Ga0495650_0000120 | |||
| 1451 | Ga0495605_0000235 | |||
| 1452 | Ga0495605_0026549 | |||
| 1453 | Ga0495584_0003803 | |||
| 1454 | Ga0495585_0023719 | |||
| 1455 | Ga0495594_0002336 | |||
| 1456 | Ga0495596_0009946 | |||
| 1457 | Ga0495607_0000756 | |||
| 1458 | Ga0495607_0038294 | |||
| 1459 | Ga0495583_0000389 | |||
| 1460 | Ga0495606_0008629 | |||
| 1461 | Ga0495610_0014899 | |||
| 1462 | Ga0495620_0000003 | |||
| 1463 | Ga0495620_0000900 | |||
| 1464 | Ga0495632_0003399 | |||
| 1465 | Ga0495632_0039573 | |||
| 1466 | Ga0495643_0006448 | |||
| 1467 | Ga0495643_0025859 | |||
| 1468 | Ga0495644_0009743 | |||
| 1469 | Ga0495644_0102312 | |||
| 1470 | Ga0495648_0009903 | |||
| 1471 | Ga0495648_0057910 | |||
| 1472 | Ga0495648_0068718 | |||
| 1473 | Ga0495654_0000148 | |||
| 1474 | Ga0495654_0000218 | |||
| 1475 | Ga0495654_0001237 | |||
| 1476 | Ga0495654_0007590 | |||
| 1477 | Ga0495654_0008728 | |||
| 1478 | Ga0495654_0041929 | |||
| 1479 | Ga0495654_0072730 | |||
| 1480 | Ga0495609_0000006 | |||
| 1481 | Ga0495609_0000296 | |||
| 1482 | Ga0495621_0036552 | |||
| 1483 | Ga0495633_0000309 | |||
| 1484 | Ga0495611_0208408 | |||
| 1485 | Ga0495625_0119230 | |||
| 1486 | Ga0495661_0000224 | |||
| 1487 | Ga0495661_0000366 | |||
| 1488 | Ga0495588_0172530 | |||
| 1489 | Ga0495670_0012315 | |||
| 1490 | Ga0495671_0001722 | |||
| 1491 | Ga0495671_0024447 | |||
| 1492 | Ga0495649_0001477 | |||
| 1493 | Ga0495649_0037603 | |||
| 1494 | Ga0495649_0112441 | |||
| 1495 | Ga0495589_0000023 | |||
| 1496 | Ga0495660_0000019 | |||
| 1497 | Ga0495660_0000063 | |||
| 1498 | Ga0495660_0013204 | |||
| 1499 | Ga0495660_0041034 | |||
| 1500 | Ga0495660_0055764 | |||
| 1501 | Ga0495672_0000003 | |||
| 1502 | Ga0495672_0000025 | |||
| 1503 | Ga0495672_0000145 | |||
| 1504 | Ga0495672_0016757 | |||
| 1505 | Ga0495676_0031220 | |||
| 1506 | Ga0495676_0071324 | |||
| 1507 | Ga0495683_0000105 | |||
| 1508 | Ga0495683_0000201 | |||
| 1509 | Ga0495683_0007108 | |||
| 1510 | Ga0495679_000263 | |||
| 1511 | Ga0495679_000535 | |||
| 1512 | Ga0495679_001169 | |||
| 1513 | Ga0495679_011720 | |||
| 1514 | Ga0495673_0000011 | |||
| 1515 | Ga0495673_0000176 | |||
| 1516 | Ga0495673_0003561 | |||
| 1517 | Ga0495681_0047979 | |||
| 1518 | Ga0495626_0000413 | |||
| 1519 | Ga0496100_0030607 | |||
| 1520 | Ga0496100_0034666 | |||
| 1521 | Ga0496101_0000624 | |||
| 1522 | Ga0496102_0113265 | |||
| 1523 | Ga0496104_0017702 | |||
| 1524 | Ga0496104_0040576 | |||
| 1525 | Ga0496105_0032860 | |||
| 1526 | Ga0496105_0070984 | |||
| 1527 | Ga0496113_0074743 | |||
| 1528 | Ga0496114_0010183 | |||
| 1529 | Ga0496114_0843286 | |||
| 1530 | Ga0496116_0000015 | |||
| 1531 | Ga0496116_0000096 | |||
| 1532 | Ga0496116_0001120 | |||
| 1533 | Ga0496116_0004381 | |||
| 1534 | Ga0496116_0005667 | |||
| 1535 | Ga0496116_0042872 | |||
| 1536 | Ga0496116_0052156 | |||
| 1537 | Ga0496116_0115965 | |||
| 1538 | Ga0496117_0000043 | |||
| 1539 | Ga0496117_0002805 | |||
| 1540 | Ga0496117_0003581 | |||
| 1541 | Ga0496117_0036499 | |||
| 1542 | Ga0496117_0052208 | |||
| 1543 | Ga0496117_0058545 | |||
| 1544 | Ga0496117_0070014 | |||
| 1545 | Ga0496117_0114350 | |||
| 1546 | Ga0496118_0000075 | |||
| 1547 | Ga0496118_0003147 | |||
| 1548 | Ga0496118_0006965 | |||
| 1549 | Ga0496118_0024462 | |||
| 1550 | Ga0496118_0024561 | |||
| 1551 | Ga0496118_0085790 | |||
| 1552 | Ga0496118_0094132 | |||
| 1553 | Ga0496118_0185699 | |||
| 1554 | Ga0496119_0000207 | |||
| 1555 | Ga0496119_0000355 | |||
| 1556 | Ga0496119_0003086 | |||
| 1557 | Ga0496119_0003653 | |||
| 1558 | Ga0496119_0004492 | |||
| 1559 | Ga0496119_0009362 | |||
| 1560 | Ga0496119_0022030 | |||
| 1561 | Ga0496119_0110181 | |||
| 1562 | Ga0496120_0002244 | |||
| 1563 | Ga0496120_0002287 | |||
| 1564 | Ga0496120_0002586 | |||
| 1565 | Ga0496120_0003799 | |||
| 1566 | Ga0496120_0004827 | |||
| 1567 | Ga0496120_0011502 | |||
| 1568 | Ga0496120_0017896 | |||
| 1569 | Ga0496120_0034663 | |||
| 1570 | Ga0496120_0128423 | |||
| 1571 | Ga0496121_0003934 | |||
| 1572 | Ga0496121_0162610 | |||
| 1573 | Ga0496122_0000170 | |||
| 1574 | Ga0496122_0000213 | |||
| 1575 | Ga0496122_0001232 | |||
| 1576 | Ga0496122_0002533 | |||
| 1577 | Ga0496122_0006705 | |||
| 1578 | Ga0496122_0075834 | |||
| 1579 | Ga0496122_0092780 | |||
| 1580 | Ga0496122_0246962 | |||
| 1581 | Ga0496123_0000058 | |||
| 1582 | Ga0496123_0000177 | |||
| 1583 | Ga0496123_0001000 | |||
| 1584 | Ga0496123_0003285 | |||
| 1585 | Ga0496123_0005016 | |||
| 1586 | Ga0496123_0005959 | |||
| 1587 | Ga0496123_0215385 | |||
| 1588 | Ga0496123_0240750 | |||
| 1589 | Ga0496124_0000026 | |||
| 1590 | Ga0496124_0000058 | |||
| 1591 | Ga0496124_0000246 | |||
| 1592 | Ga0496124_0000496 | |||
| 1593 | Ga0496124_0003737 | |||
| 1594 | Ga0496124_0004258 | |||
| 1595 | Ga0496124_0026202 | |||
| 1596 | Ga0496124_0036782 | |||
| 1597 | Ga0496124_0112630 | |||
| 1598 | Ga0496125_0001072 | |||
| 1599 | Ga0496125_0003468 | |||
| 1600 | Ga0496125_0004263 | |||
| 1601 | Ga0496125_0006018 | |||
| 1602 | Ga0496125_0015281 | |||
| 1603 | Ga0496125_0077588 | |||
| 1604 | Ga0496125_0100461 | |||
| 1605 | Ga0496126_0009982 | |||
| 1606 | Ga0496126_0010751 | |||
| 1607 | Ga0496126_0027891 | |||
| 1608 | Ga0496126_0321621 | |||
| 1609 | Ga0495678_000134 | |||
| 1610 | Ga0495678_001292 | |||
| 1611 | Ga0495678_110098 | |||
| 1612 | Ga0495682_0000017 | |||
| 1613 | Ga0495682_0000424 | |||
| 1614 | Ga0501319_002409 | |||
| 1615 | Ga0501031_0167030 | |||
| 1616 | Ga0501033_0081147 | |||
| 1617 | Ga0501034_0000370 | |||
| 1618 | Ga0501034_0147031 | |||
| 1619 | Ga0501039_0050285 | |||
| 1620 | Ga0501040_0039070 | |||
| 1621 | Ga0501040_0373063 | |||
| 1622 | Ga0501041_0204072 | |||
| 1623 | Ga0501046_0284194 | |||
| 1624 | Ga0501047_0317461 | |||
| 1625 | Ga0501068_0065564 | |||
| 1626 | Ga0501071_0137832 | |||
| 1627 | Ga0501075_0069211 | |||
| 1628 | Ga0501081_0373077 | |||
| 1629 | Ga0501035_0035332 | |||
| 1630 | Ga0501044_0003067 | |||
| 1631 | Ga0501226_000079 | |||
| 1632 | nmdc:mga00v17_46703_c1 | |||
| 1633 | nmdc:mga00v17_50996_c1 | |||
| 1634 | Ga0500643_057712 | |||
| 1635 | Ga0500621_000048 | |||
| 1636 | 2506576817 | |||
| 1637 | 2506581955 | |||
| 1638 | 2508850784 | |||
| 1639 | 2510284006 | |||
| 1640 | 2510293321 | |||
| 1641 | 2510312813 | |||
| 1642 | 2511253962 | |||
| 1643 | 2511274248 | |||
| 1644 | 2511277052 | |||
| 1645 | 2511289983 | |||
| 1646 | 2511297646 | |||
| 1647 | 2511300622 | |||
| 1648 | 2511315597 | |||
| 1649 | 2511329238 | |||
| 1650 | 2511332375 | |||
| 1651 | 2511336604 | |||
| 1652 | 2511346054 | |||
| 1653 | 2511352767 | |||
| 1654 | 2511355797 | |||
| 1655 | 2511362578 | |||
| 1656 | 2511375311 | |||
| 1657 | 2511382085 | |||
| 1658 | 2511437459 | |||
| 1659 | 2511823048 | |||
| 1660 | 2538425749 | |||
| 1661 | 2547698711 | |||
| 1662 | 2548652251 | |||
| 1663 | 2555247755 | |||
| 1664 | 2555258217 | |||
| 1665 | 2562463920 | |||
| 1666 | 2566035415 | |||
| 1667 | 2585826114 | |||
| 1668 | 2585831898 | |||
| 1669 | 2597865781 | |||
| 1670 | 2597871597 | |||
| 1671 | 2599328390 | |||
| 1672 | 2599355057 | |||
| 1673 | 2599361119 | |||
| 1674 | 2599367441 | |||
| 1675 | 2599374231 | |||
| 1676 | 2599380163 | |||
| 1677 | 2599386610 | |||
| 1678 | 2599393089 | |||
| 1679 | 2599399866 | |||
| 1680 | 2599404856 | |||
| 1681 | 2599412824 | |||
| 1682 | 2599452649 | |||
| 1683 | 2599461891 | |||
| 1684 | 2599467066 | |||
| 1685 | 2599491016 | |||
| 1686 | 2599501154 | |||
| 1687 | 2599508266 | |||
| 1688 | 2599514320 | |||
| 1689 | 2599521556 | |||
| 1690 | 2599613885 | |||
| 1691 | 2599770775 | |||
| 1692 | 2599881914 | |||
| 1693 | 2599886653 | |||
| 1694 | 2599893696 | |||
| 1695 | 2599897022 | |||
| 1696 | 2599928897 | |||
| 1697 | 2599934710 | |||
| 1698 | 2599943024 | |||
| 1699 | 2599951688 | |||
| 1700 | 2599953937 | |||
| 1701 | 2599959447 | |||
| 1702 | 2599968032 | |||
| 1703 | 2599974213 | |||
| 1704 | 2599979245 | |||
| 1705 | 2599985320 | |||
| 1706 | 2599987244 | |||
| 1707 | 2599995446 | |||
| 1708 | 2599999927 | |||
| 1709 | 2600008814 | |||
| 1710 | 2600013130 | |||
| 1711 | 2600016642 | |||
| 1712 | 2600025337 | |||
| 1713 | 2600029607 | |||
| 1714 | 2600035501 | |||
| 1715 | 2600041348 | |||
| 1716 | 2600045571 | |||
| 1717 | 2600056612 | |||
| 1718 | 2600058478 | |||
| 1719 | 2600063853 | |||
| 1720 | 2600074154 | |||
| 1721 | 2600079818 | |||
| 1722 | 2600214513 | |||
| 1723 | 2600358285 | |||
| 1724 | 2601525706 | |||
| 1725 | 2601528002 | |||
| 1726 | 2601533313 | |||
| 1727 | 2601538677 | |||
| 1728 | 2601614836 | |||
| 1729 | 2601620239 | |||
| 1730 | 2601626344 | |||
| 1731 | 2601646007 | |||
| 1732 | 2601648641 | |||
| 1733 | 2601652891 | |||
| 1734 | 2601658992 | |||
| 1735 | 2601666003 | |||
| 1736 | 2601692771 | |||
| 1737 | 2601698964 | |||
| 1738 | 2601703872 | |||
| 1739 | 2601705542 | |||
| 1740 | 2601711131 | |||
| 1741 | 2601716145 | |||
| 1742 | 2601723806 | |||
| 1743 | 2601726551 | |||
| 1744 | 2601731091 | |||
| 1745 | 2601736107 | |||
| 1746 | 2601743428 | |||
| 1747 | 2601754214 | |||
| 1748 | 2601757026 | |||
| 1749 | 2601761519 | |||
| 1750 | 2601774782 | |||
| 1751 | 2601800090 | |||
| 1752 | 2602021160 | |||
| 1753 | 2603641669 | |||
| 1754 | 2603643761 | |||
| 1755 | 2603658942 | |||
| 1756 | 2603663730 | |||
| 1757 | 2603701035 | |||
| 1758 | 2603704294 | |||
| 1759 | 2603838489 | |||
| 1760 | 2603844255 | |||
| 1761 | 2603848640 | |||
| 1762 | 2603853713 | |||
| 1763 | 2603865057 | |||
| 1764 | 2603871766 | |||
| 1765 | 2603879323 | |||
| 1766 | 2606048955 | |||
| 1767 | 2606068156 | |||
| 1768 | 2606074645 | |||
| 1769 | 2606127508 | |||
| 1770 | 2606146632 | |||
| 1771 | 2606176360 | |||
| 1772 | 2608670909 | |||
| 1773 | 2609914486 | |||
| 1774 | 2621297756 | |||
| 1775 | 2624478837 | |||
| 1776 | 2624494120 | |||
| 1777 | 2637223818 | |||
| 1778 | 2643842464 | |||
| 1779 | 2643873642 | |||
| 1780 | 2643955326 | |||
| 1781 | 2644023678 | |||
| 1782 | 2644188146 | |||
| 1783 | 2644281571 | |||
| 1784 | 2644623436 | |||
| 1785 | 2649121388 | |||
| 1786 | 2650897506 | |||
| 1787 | 2652548216 | |||
| 1788 | 2652974494 | |||
| 1789 | 2656276213 | |||
| 1790 | 2671094479 | |||
| 1791 | 2671097658 | |||
| 1792 | 2671104022 | |||
| 1793 | 2671109666 | |||
| 1794 | 2671127908 | |||
| 1795 | 2671588421 | |||
| 1796 | 2676409573 | |||
| 1797 | 2677897942 | |||
| 1798 | 2678261579 | |||
| 1799 | 2681998543 | |||
| 1800 | 2682007650 | |||
| 1801 | 2686354882 | |||
| 1802 | 2689443212 | |||
| 1803 | 2707100043 | |||
| 1804 | 2712472645 | |||
| 1805 | 2715757554 | |||
| 1806 | 2723250513 | |||
| 1807 | 2738670892 | |||
| 1808 | 2738689872 | |||
| 1809 | 2738749286 | |||
| 1810 | 2738811304 | |||
| 1811 | 2738858327 | |||
| 1812 | 2738898664 | |||
| 1813 | 2739196581 | |||
| 1814 | 2739257560 | |||
| 1815 | 2739265646 | |||
| 1816 | 2739286505 | |||
| 1817 | 2739291818 | |||
| 1818 | 2745007928 | |||
| 1819 | 2753857184 | |||
| 1820 | 2765582247 | |||
| 1821 | 2765590283 | |||
| 1822 | 2772437369 | |||
| 1823 | 2774122183 | |||
| 1824 | 2774131952 | |||
| 1825 | 2774136684 | |||
| 1826 | 2775539775 | |||
| 1827 | 2777020098 | |||
| 1828 | 2784260436 | |||
| 1829 | 2784314428 | |||
| 1830 | 2791925379 | |||
| 1831 | 2792314319 | |||
| 1832 | 2793404511 | |||
| 1833 | 2794594376 | |||
| 1834 | 2807177571 | |||
| 1835 | 2807409883 | |||
| 1836 | 2807458231 | |||
| 1837 | 2808854100 | |||
| 1838 | 2808906921 | |||
| 1839 | 2808923391 | |||
| 1840 | 2808928738 | |||
| 1841 | 2808934132 | |||
| 1842 | 2808945334 | |||
| 1843 | 2808950859 | |||
| 1844 | 2808956662 | |||
| 1845 | 2808962467 | |||
| 1846 | 2808980209 | |||
| 1847 | 2808995968 | |||
| 1848 | 2808997492 | |||
| 1849 | 2809126404 | |||
| 1850 | 2809215778 | |||
| 1851 | 2812370900 | |||
| 1852 | 2813727523 | |||
| 1853 | 2814695068 | |||
| 1854 | 2817493110 | |||
| 1855 | 2819658394 | |||
| 1856 | 2819702741 | |||
| 1857 | 2821120144 | |||
| 1858 | 2823378567 | |||
| 1859 | 2825653697 | |||
| 1860 | 2826584152 | |||
| 1861 | 2834034207 | |||
| 1862 | 2842808874 | |||
| 1863 | 2842820918 | |||
| 1864 | 2842829738 | |||
| 1865 | 2842843190 | |||
| 1866 | 2842849673 | |||
| 1867 | 2842857252 | |||
| 1868 | 2844428623 | |||
| 1869 | 2844530387 | |||
| 1870 | 2844668559 | |||
| 1871 | 2846541030 | |||
| 1872 | 2847086115 | |||
| 1873 | 2847798566 | |||
| 1874 | 2852105679 | |||
| 1875 | 2852612505 | |||
| 1876 | 2852662704 | |||
| 1877 | 2852669759 | |||
| 1878 | 2854603779 | |||
| 1879 | 2855198273 | |||
| 1880 | 2858467993 | |||
| 1881 | 2860340619 | |||
| 1882 | 2860872196 | |||
| 1883 | 2865016256 | |||
| 1884 | 2869552618 | |||
| 1885 | 2871275863 | |||
| 1886 | 2871283770 | |||
| 1887 | 2876601593 | |||
| 1888 | 2878030801 | |||
| 1889 | 2880231716 | |||
| 1890 | 2881613914 | |||
| 1891 | 2884087554 | |||
| 1892 | 2888367416 | |||
| 1893 | 2888374892 | |||
| 1894 | 2891673387 | |||
| 1895 | 2904478086 | |||
| 1896 | 2904506870 | |||
| 1897 | 2904518166 | |||
| 1898 | 2904520750 | |||
| 1899 | 2904553078 | |||
| 1900 | 2908451701 | |||
| 1901 | 2908672231 | |||
| 1902 | 2912964895 | |||
| 1903 | 2913037920 | |||
| 1904 | 2916180227 | |||
| 1905 | 2917071819 | |||
| 1906 | 2917836072 | |||
| 1907 | 2919064693 | |||
| 1908 | 2919113936 | |||
| 1909 | 2919128221 | |||
| 1910 | 2919153950 | |||
| 1911 | 2919160184 | |||
| 1912 | 2919458264 | |||
| 1913 | 2919482827 | |||
| 1914 | 2919495659 | |||
| 1915 | 2919498747 | |||
| 1916 | 2919544626 | |||
| 1917 | 2919689991 | |||
| 1918 | 2919699964 | |||
| 1919 | 2923525005 | |||
| 1920 | 2923527013 | |||
| 1921 | 2923591768 | |||
| 1922 | 2923636183 | |||
| 1923 | 2927147487 | |||
| 1924 | 2927837327 | |||
| 1925 | 2929145372 | |||
| 1926 | 2929194310 | |||
| 1927 | 2931371288 | |||
| 1928 | 2931395582 | |||
| 1929 | 2931399478 | |||
| 1930 | 2932410329 | |||
| 1931 | 2935353992 | |||
| 1932 | 2935629178 | |||
| 1933 | 2937543932 | |||
| 1934 | 2937970586 | |||
| 1935 | 2939570927 | |||
| 1936 | 2939577357 | |||
| 1937 | 2939582407 | |||
| 1938 | 2939604492 | |||
| 1939 | 2939609948 | |||
| 1940 | 2939621782 | |||
| 1941 | 2939637046 | |||
| 1942 | 2939645037 | |||
| 1943 | 2939653253 | |||
| 1944 | 2945876461 | |||
| 1945 | 2945931747 | |||
| 1946 | 2945951813 | |||
| 1947 | 2945961384 | |||
| 1948 | 2946007830 | |||
| 1949 | 2946032795 | |||
| 1950 | 2947233554 | |||
| 1951 | 2969080829 | |||
| 1952 | 2971822225 | |||
| 1953 | 2974301377 | |||
| 1954 | 2974315514 | |||
| 1955 | 2974439686 | |||
| 1956 | 2978978350 | |||
| 1957 | 2984495385 | |||
| 1958 | 2984503856 | |||
| 1959 | 2984507561 | |||
| 1960 | 2984563290 | |||
| 1961 | 2984596025 | |||
| 1962 | 2988732916 | |||
| 1963 | 2990200576 | |||
| 1964 | 2990265095 | |||
| 1965 | 3000378062 | |||
| 1966 | 3007512443 | |||
| 1967 | 3007624334 | |||
| 1968 | 3007721430 | |||
| 1969 | 3007803761 | |||
| 1970 | 3007871270 | |||
| 1971 | 3007876204 | |||
| 1972 | 637318436 | |||
| 1973 | 640936369 | |||
| 1974 | 8004597681 | |||
| 1975 | 8011354296 | |||
| 1976 | 8015399069 | |||
| 1977 | 8016730309 | |||
| 1978 | 8016734739 | |||
| 1979 | 8018222666 | |||
| 1980 | 8018405299 | |||
| 1981 | 8019503798 | |||
| 1982 | 8019508900 | |||
| 1983 | 8019773305 | |||
| 1984 | 8019776630 | |||
| 1985 | 8052495698 | |||
| 1986 | 8054286175 | |||
| 1987 | 8054351137 | |||
| 1988 | 8054508096 | |||
| 1989 | 8054847735 | |||
| 1990 | 8054851566 | |||
| 1991 | 8054929508 | |||
| 1992 | 8055088487 | |||
| 1993 | 8055096855 | |||
| 1994 | 8055098206 | |||
| 1995 | 8055694754 | |||
| 1996 | 8055823049 | |||
| 1997 | 8055883259 | |||
| 1998 | 8056120234 | |||
| 1999 | 8056121916 | |||
| 2000 | 8056130798 | |||
| 2001 | 8056136463 | |||
| 2002 | 8056141858 | |||
| 2003 | 8056147909 | |||
| 2004 | 8056153493 | |||
| 2005 | 8056155572 | |||
| 2006 | 8056162716 | |||
| 2007 | 8056176116 | |||
| 2008 | 8056183413 | |||
| 2009 | 8056569718 | |||
| 2010 | 8057163339 | |||
| 2011 | 8057305436 | |||
| 2012 | 8057803333 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3knu-assembly1.cif.gz_B | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.79 | 12 | 218 |
| 3knu-assembly1.cif.gz_A | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.7865 | 12 | 222 |
| 4mcb-assembly1.cif.gz_A | h.influenzae trmd in complex with n-(4-{[(1h-imidazol-2-ylmethyl)amino]methyl}benzyl)-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide | 0.7855 | 12 | 227 |
| 3knu-assembly2.cif.gz_C | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.7836 | 12 | 218 |
| 4mcc-assembly1.cif.gz_A | hintrmd in complex with n-[4-(aminomethyl)benzyl]-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide | 0.7804 | 12 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5wyrA01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9255 | 11 | 172 | 3.40.1280.10 |
| 1oy5C01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9057 | 10 | 172 | 3.40.1280.10 |
| 3iefB01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9053 | 10 | 168 | 3.40.1280.10 |
| 5wyrA01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9041 | 11 | 172 | 3.40.1280.10 |
| 1oy5C01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8901 | 10 | 172 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A509BR58-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) | 0.9321 | 12 | 172 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A418H6T7-F1-model_v4 | deleted | 0.9247 | 12 | 160 |
|
| AF-A0A730N7J1-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD | 0.9232 | 12 | 139 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A509BR58-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) | 0.9211 | 12 | 172 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A661TIM6-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) | 0.9204 | 12 | 171 |
GO:0002939
GO:0005829 GO:0052906 |