F488014
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1006 | 357 | 2012 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0194673|Ga0495628_0194673_753_1436 |
| Length | 227 |
| Sequence | MDKNDRPTHVSLAAVLQVRGGELQVLLWERARDPFSGAFALPGGYLARGETLEASIRRHLAAKVDVQELSHLEQLITLSDPGRSPDWQLATAYLGLVPSDLDPSVPDDTGWHPVDGMPPMAFDHGRIVLAARDRLRAKLSYTNLGFALAPEQFSISELRILYRAALGHAVSATNLQRVLLRRGLLEATGERRESGRTGGRPAQLFKFRSRELAITDQFAVLRPPDER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 195 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 220 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 221 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 222 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 223 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 224 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 227 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 228 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 357 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.6 |
| Nodule | 0 |
| Rhizoplane | 7.06 |
| Rhizosphere | 92.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495628_0194673 | 3300046516 | Bacteria | 1530 |
| 2 | Ga0070676_10170312 | 3300005328 | Bacteria | 1408 |
| 3 | Ga0070676_10274992 | 3300005328 | Bacteria | 1133 |
| 4 | Ga0070683_100010526 | 3300005329 | Bacteria | 7953 |
| 5 | Ga0070683_100030721 | 3300005329 | Bacteria | 4880 |
| 6 | Ga0070683_100093732 | 3300005329 | Bacteria | 2822 |
| 7 | Ga0070683_100108788 | 3300005329 | Bacteria | 2614 |
| 8 | Ga0070683_100673014 | 3300005329 | Bacteria | 991 |
| 9 | Ga0070690_100058141 | 3300005330 | Bacteria | 2482 |
| 10 | Ga0070690_100675360 | 3300005330 | Bacteria | 791 |
| 11 | Ga0070670_100004558 | 3300005331 | Bacteria | 11621 |
| 12 | Ga0070670_100445513 | 3300005331 | Bacteria | 1147 |
| 13 | Ga0070670_100506941 | 3300005331 | Bacteria | 1073 |
| 14 | Ga0070677_10117878 | 3300005333 | Bacteria | 1195 |
| 15 | Ga0068869_100134891 | 3300005334 | Bacteria | 1901 |
| 16 | Ga0068869_100266316 | 3300005334 | Bacteria | 1373 |
| 17 | Ga0070666_10261571 | 3300005335 | Bacteria | 1227 |
| 18 | Ga0070680_100046414 | 3300005336 | Bacteria | 3534 |
| 19 | Ga0070680_100058836 | 3300005336 | Bacteria | 3143 |
| 20 | Ga0070680_100089834 | 3300005336 | Bacteria | 2542 |
| 21 | Ga0070682_100027742 | 3300005337 | Bacteria | 3399 |
| 22 | Ga0070682_100080855 | 3300005337 | Bacteria | 2102 |
| 23 | Ga0070682_100209756 | 3300005337 | Bacteria | 1380 |
| 24 | Ga0068868_100007316 | 3300005338 | Bacteria | 7858 |
| 25 | Ga0068868_100021354 | 3300005338 | Bacteria | 4875 |
| 26 | Ga0068868_100339510 | 3300005338 | Bacteria | 1284 |
| 27 | Ga0068868_100350397 | 3300005338 | Bacteria | 1264 |
| 28 | Ga0070660_100010010 | 3300005339 | Bacteria | 6686 |
| 29 | Ga0070660_100127818 | 3300005339 | Bacteria | 2032 |
| 30 | Ga0070660_100197194 | 3300005339 | Bacteria | 1632 |
| 31 | Ga0070689_100040095 | 3300005340 | Bacteria | 3588 |
| 32 | Ga0070691_10013064 | 3300005341 | Bacteria | 3802 |
| 33 | Ga0070691_10063264 | 3300005341 | Bacteria | 1783 |
| 34 | Ga0070687_100098299 | 3300005343 | Bacteria | 1634 |
| 35 | Ga0070687_100251789 | 3300005343 | Bacteria | 1098 |
| 36 | Ga0070687_100281023 | 3300005343 | Unclassified | 1048 |
| 37 | Ga0070661_100005618 | 3300005344 | Bacteria | 8640 |
| 38 | Ga0070661_100172986 | 3300005344 | Bacteria | 1641 |
| 39 | Ga0070692_10018623 | 3300005345 | Bacteria | 3342 |
| 40 | Ga0070692_10022668 | 3300005345 | Bacteria | 3069 |
| 41 | Ga0070692_10043384 | 3300005345 | Bacteria | 2312 |
| 42 | Ga0070692_10055417 | 3300005345 | Bacteria | 2073 |
| 43 | Ga0070668_100052295 | 3300005347 | Bacteria | 3148 |
| 44 | Ga0070669_100303530 | 3300005353 | Bacteria | 1285 |
| 45 | Ga0070669_100360689 | 3300005353 | Bacteria | 1182 |
| 46 | Ga0070675_100008298 | 3300005354 | Bacteria | 8059 |
| 47 | Ga0070675_100020892 | 3300005354 | Bacteria | 5227 |
| 48 | Ga0070675_100064048 | 3300005354 | Bacteria | 3039 |
| 49 | Ga0070671_100099507 | 3300005355 | Bacteria | 2439 |
| 50 | Ga0070671_100235294 | 3300005355 | Bacteria | 1555 |
| 51 | Ga0070674_100004873 | 3300005356 | Bacteria | 7692 |
| 52 | Ga0070674_100032821 | 3300005356 | Bacteria | 3451 |
| 53 | Ga0070673_100015557 | 3300005364 | Bacteria | 5349 |
| 54 | Ga0070673_100101873 | 3300005364 | Bacteria | 2366 |
| 55 | Ga0070673_100198516 | 3300005364 | Bacteria | 1727 |
| 56 | Ga0070688_100001368 | 3300005365 | Bacteria | 12116 |
| 57 | Ga0070659_100021773 | 3300005366 | Bacteria | 4887 |
| 58 | Ga0070659_100104689 | 3300005366 | Bacteria | 2280 |
| 59 | Ga0070659_100297361 | 3300005366 | Bacteria | 1345 |
| 60 | Ga0070709_10102125 | 3300005434 | Bacteria | 1912 |
| 61 | Ga0070709_10106861 | 3300005434 | Bacteria | 1874 |
| 62 | Ga0070709_10139929 | 3300005434 | Bacteria | 1662 |
| 63 | Ga0070709_10384252 | 3300005434 | Bacteria | 1044 |
| 64 | Ga0070714_100006361 | 3300005435 | Bacteria | 9110 |
| 65 | Ga0070714_100027611 | 3300005435 | Bacteria | 4702 |
| 66 | Ga0070714_100439123 | 3300005435 | Bacteria | 1238 |
| 67 | Ga0070713_100046229 | 3300005436 | Bacteria | 3571 |
| 68 | Ga0070713_100163717 | 3300005436 | Bacteria | 1987 |
| 69 | Ga0070710_10024620 | 3300005437 | Bacteria | 3178 |
| 70 | Ga0070710_10055042 | 3300005437 | Bacteria | 2246 |
| 71 | Ga0070710_10365305 | 3300005437 | Bacteria | 959 |
| 72 | Ga0070701_10074375 | 3300005438 | Bacteria | 1824 |
| 73 | Ga0070701_10322995 | 3300005438 | Bacteria | 955 |
| 74 | Ga0070701_10374607 | 3300005438 | Bacteria | 895 |
| 75 | Ga0070711_100031456 | 3300005439 | Bacteria | 3523 |
| 76 | Ga0070711_100151483 | 3300005439 | Bacteria | 1749 |
| 77 | Ga0070705_100016331 | 3300005440 | Bacteria | 3857 |
| 78 | Ga0070705_100126314 | 3300005440 | Bacteria | 1661 |
| 79 | Ga0070705_100166789 | 3300005440 | Bacteria | 1478 |
| 80 | Ga0070700_100258893 | 3300005441 | Bacteria | 1252 |
| 81 | Ga0070694_100129494 | 3300005444 | Bacteria | 1821 |
| 82 | Ga0070694_100312771 | 3300005444 | Unclassified | 1207 |
| 83 | Ga0070694_100315843 | 3300005444 | Bacteria | 1201 |
| 84 | Ga0070708_100111799 | 3300005445 | Bacteria | 2511 |
| 85 | Ga0070663_100463186 | 3300005455 | Bacteria | 1047 |
| 86 | Ga0070678_100047065 | 3300005456 | Bacteria | 3097 |
| 87 | Ga0070678_100120198 | 3300005456 | Bacteria | 2070 |
| 88 | Ga0070662_100025843 | 3300005457 | Bacteria | 4059 |
| 89 | Ga0070662_100047877 | 3300005457 | Bacteria | 3078 |
| 90 | Ga0070662_100049741 | 3300005457 | Bacteria | 3023 |
| 91 | Ga0070681_10010646 | 3300005458 | Bacteria | 9090 |
| 92 | Ga0070681_10072510 | 3300005458 | Bacteria | 3406 |
| 93 | Ga0070681_10109385 | 3300005458 | Bacteria | 2704 |
| 94 | Ga0070681_10111208 | 3300005458 | Bacteria | 2679 |
| 95 | Ga0070681_10157304 | 3300005458 | Bacteria | 2197 |
| 96 | Ga0070681_10525567 | 3300005458 | Bacteria | 1096 |
| 97 | Ga0068867_100125736 | 3300005459 | Bacteria | 1987 |
| 98 | Ga0068867_100368487 | 3300005459 | Bacteria | 1203 |
| 99 | Ga0068867_100600759 | 3300005459 | Bacteria | 959 |
| 100 | Ga0070685_10079141 | 3300005466 | Bacteria | 1966 |
| 101 | Ga0070706_100079668 | 3300005467 | Bacteria | 3032 |
| 102 | Ga0070706_100417551 | 3300005467 | Bacteria | 1249 |
| 103 | Ga0070707_100045152 | 3300005468 | Bacteria | 4217 |
| 104 | Ga0070707_100576395 | 3300005468 | Bacteria | 1088 |
| 105 | Ga0070698_100003809 | 3300005471 | Bacteria | 16569 |
| 106 | Ga0070698_100093669 | 3300005471 | Bacteria | 2983 |
| 107 | Ga0070698_100165592 | 3300005471 | Bacteria | 2154 |
| 108 | Ga0070699_100018076 | 3300005518 | Bacteria | 6056 |
| 109 | Ga0070699_100129624 | 3300005518 | Bacteria | 2223 |
| 110 | Ga0070699_100346905 | 3300005518 | Bacteria | 1337 |
| 111 | Ga0070679_100019573 | 3300005530 | Bacteria | 6585 |
| 112 | Ga0070679_100079277 | 3300005530 | Bacteria | 3274 |
| 113 | Ga0070684_100032413 | 3300005535 | Bacteria | 4453 |
| 114 | Ga0070684_100054320 | 3300005535 | Bacteria | 3490 |
| 115 | Ga0070684_100058008 | 3300005535 | Bacteria | 3382 |
| 116 | Ga0070684_100064221 | 3300005535 | Bacteria | 3220 |
| 117 | Ga0070684_100108152 | 3300005535 | Bacteria | 2491 |
| 118 | Ga0070684_100146967 | 3300005535 | Bacteria | 2134 |
| 119 | Ga0070684_100150315 | 3300005535 | Bacteria | 2109 |
| 120 | Ga0070684_100363746 | 3300005535 | Bacteria | 1331 |
| 121 | Ga0070697_100449917 | 3300005536 | Bacteria | 1122 |
| 122 | Ga0068853_100238839 | 3300005539 | Bacteria | 1665 |
| 123 | Ga0068853_100462979 | 3300005539 | Bacteria | 1193 |
| 124 | Ga0070672_100052860 | 3300005543 | Bacteria | 3174 |
| 125 | Ga0070672_100133499 | 3300005543 | Bacteria | 2042 |
| 126 | Ga0070686_100036145 | 3300005544 | Bacteria | 3057 |
| 127 | Ga0070686_100096566 | 3300005544 | Bacteria | 1987 |
| 128 | Ga0070686_100270999 | 3300005544 | Bacteria | 1248 |
| 129 | Ga0070695_100037784 | 3300005545 | Bacteria | 3044 |
| 130 | Ga0070696_100102904 | 3300005546 | Bacteria | 2049 |
| 131 | Ga0070696_100104935 | 3300005546 | Bacteria | 2030 |
| 132 | Ga0070696_100140374 | 3300005546 | Bacteria | 1766 |
| 133 | Ga0070696_100221629 | 3300005546 | Bacteria | 1419 |
| 134 | Ga0070696_100281641 | 3300005546 | Bacteria | 1268 |
| 135 | Ga0070696_100298038 | 3300005546 | Bacteria | 1234 |
| 136 | Ga0070693_100020916 | 3300005547 | Bacteria | 3458 |
| 137 | Ga0070693_100042085 | 3300005547 | Bacteria | 2573 |
| 138 | Ga0070693_100055327 | 3300005547 | Bacteria | 2285 |
| 139 | Ga0070665_100005986 | 3300005548 | Bacteria | 12445 |
| 140 | Ga0070665_100517631 | 3300005548 | Bacteria | 1205 |
| 141 | Ga0070704_100054906 | 3300005549 | Bacteria | 2821 |
| 142 | Ga0070704_100456241 | 3300005549 | Bacteria | 1101 |
| 143 | Ga0070704_100687007 | 3300005549 | Bacteria | 906 |
| 144 | Ga0068855_100042188 | 3300005563 | Bacteria | 5406 |
| 145 | Ga0068855_100060313 | 3300005563 | Bacteria | 4437 |
| 146 | Ga0068855_100060464 | 3300005563 | Bacteria | 4430 |
| 147 | Ga0068855_100180637 | 3300005563 | Bacteria | 2386 |
| 148 | Ga0068855_100218143 | 3300005563 | Bacteria | 2140 |
| 149 | Ga0070664_100015002 | 3300005564 | Bacteria | 6324 |
| 150 | Ga0070664_100018297 | 3300005564 | Bacteria | 5752 |
| 151 | Ga0070664_100098010 | 3300005564 | Bacteria | 2546 |
| 152 | Ga0070664_100186476 | 3300005564 | Bacteria | 1846 |
| 153 | Ga0070664_100249567 | 3300005564 | Bacteria | 1595 |
| 154 | Ga0068857_100080037 | 3300005577 | Bacteria | 2917 |
| 155 | Ga0068857_100237502 | 3300005577 | Bacteria | 1668 |
| 156 | Ga0068857_100608227 | 3300005577 | Bacteria | 1034 |
| 157 | Ga0068854_100069129 | 3300005578 | Bacteria | 2577 |
| 158 | Ga0068856_100013325 | 3300005614 | Bacteria | 7961 |
| 159 | Ga0068856_100043524 | 3300005614 | Bacteria | 4418 |
| 160 | Ga0068856_100094581 | 3300005614 | Bacteria | 2975 |
| 161 | Ga0068856_100228427 | 3300005614 | Bacteria | 1876 |
| 162 | Ga0068856_100265400 | 3300005614 | Bacteria | 1732 |
| 163 | Ga0068856_100274019 | 3300005614 | Bacteria | 1703 |
| 164 | Ga0070702_100040560 | 3300005615 | Bacteria | 2605 |
| 165 | Ga0070702_100122272 | 3300005615 | Bacteria | 1631 |
| 166 | Ga0070702_100162239 | 3300005615 | Bacteria | 1446 |
| 167 | Ga0068852_100032201 | 3300005616 | Bacteria | 4338 |
| 168 | Ga0068852_100057505 | 3300005616 | Bacteria | 3365 |
| 169 | Ga0068852_100194564 | 3300005616 | Bacteria | 1915 |
| 170 | Ga0068859_100048871 | 3300005617 | Bacteria | 4249 |
| 171 | Ga0068864_100015513 | 3300005618 | Bacteria | 6334 |
| 172 | Ga0068864_100151816 | 3300005618 | Bacteria | 2099 |
| 173 | Ga0068866_10361364 | 3300005718 | Bacteria | 926 |
| 174 | Ga0068861_100024868 | 3300005719 | Bacteria | 4336 |
| 175 | Ga0068861_100216134 | 3300005719 | Bacteria | 1617 |
| 176 | Ga0068861_100407148 | 3300005719 | Bacteria | 1209 |
| 177 | Ga0068863_100331038 | 3300005841 | Bacteria | 1480 |
| 178 | Ga0068863_100426302 | 3300005841 | Bacteria | 1300 |
| 179 | Ga0068863_100431081 | 3300005841 | Bacteria | 1292 |
| 180 | Ga0068860_100243658 | 3300005843 | Bacteria | 1749 |
| 181 | Ga0081455_10027092 | 3300005937 | Bacteria | 5257 |
| 182 | Ga0081455_10046689 | 3300005937 | Bacteria | 3755 |
| 183 | Ga0081455_10090237 | 3300005937 | Bacteria | 2485 |
| 184 | Ga0081538_10000076 | 3300005981 | Bacteria | 94022 |
| 185 | Ga0081538_10000300 | 3300005981 | Bacteria | 57016 |
| 186 | Ga0081538_10026055 | 3300005981 | Bacteria | 4102 |
| 187 | Ga0081538_10048346 | 3300005981 | Unclassified | 2596 |
| 188 | Ga0081538_10051989 | 3300005981 | Bacteria | 2453 |
| 189 | Ga0081540_1003715 | 3300005983 | Bacteria | 11960 |
| 190 | Ga0081540_1005515 | 3300005983 | Bacteria | 9433 |
| 191 | Ga0081540_1063637 | 3300005983 | Bacteria | 1745 |
| 192 | Ga0070717_10011361 | 3300006028 | Bacteria | 6759 |
| 193 | Ga0070717_10094777 | 3300006028 | Bacteria | 2525 |
| 194 | Ga0075365_10066531 | 3300006038 | Bacteria | 2418 |
| 195 | Ga0075364_10086130 | 3300006051 | Bacteria | 2081 |
| 196 | Ga0070716_100292805 | 3300006173 | Bacteria | 1129 |
| 197 | Ga0070712_100008629 | 3300006175 | Bacteria | 6417 |
| 198 | Ga0070712_100083956 | 3300006175 | Bacteria | 2314 |
| 199 | Ga0075367_10017839 | 3300006178 | Bacteria | 3903 |
| 200 | Ga0097621_100485250 | 3300006237 | Bacteria | 1117 |
| 201 | Ga0068871_100053405 | 3300006358 | Bacteria | 3275 |
| 202 | Ga0068871_100629787 | 3300006358 | Bacteria | 977 |
| 203 | Ga0075428_100136001 | 3300006844 | Bacteria | 2672 |
| 204 | Ga0075430_100082750 | 3300006846 | Bacteria | 2689 |
| 205 | Ga0075431_100296531 | 3300006847 | Bacteria | 1634 |
| 206 | Ga0075431_100576961 | 3300006847 | Bacteria | 1110 |
| 207 | Ga0075431_100960151 | 3300006847 | Bacteria | 823 |
| 208 | Ga0075433_10140395 | 3300006852 | Bacteria | 2147 |
| 209 | Ga0075433_10142622 | 3300006852 | Bacteria | 2129 |
| 210 | Ga0075433_10440588 | 3300006852 | Bacteria | 1148 |
| 211 | Ga0075434_100025155 | 3300006871 | Bacteria | 5824 |
| 212 | Ga0075434_100026803 | 3300006871 | Bacteria | 5652 |
| 213 | Ga0075434_100186900 | 3300006871 | Bacteria | 2092 |
| 214 | Ga0075434_100858593 | 3300006871 | Bacteria | 923 |
| 215 | Ga0068865_100124461 | 3300006881 | Bacteria | 1922 |
| 216 | Ga0075436_100093264 | 3300006914 | Bacteria | 2093 |
| 217 | Ga0097620_100048873 | 3300006931 | Bacteria | 4249 |
| 218 | Ga0075435_100018197 | 3300007076 | Bacteria | 5336 |
| 219 | Ga0075435_100080322 | 3300007076 | Bacteria | 2677 |
| 220 | Ga0105244_10064564 | 3300009036 | Bacteria | 1836 |
| 221 | Ga0105240_10519878 | 3300009093 | Bacteria | 1321 |
| 222 | Ga0111539_10056105 | 3300009094 | Bacteria | 4683 |
| 223 | Ga0111539_10072315 | 3300009094 | Bacteria | 4067 |
| 224 | Ga0111539_10132468 | 3300009094 | Bacteria | 2919 |
| 225 | Ga0111539_10155021 | 3300009094 | Bacteria | 2680 |
| 226 | Ga0111539_10158252 | 3300009094 | Bacteria | 2650 |
| 227 | Ga0111539_10160340 | 3300009094 | Bacteria | 2631 |
| 228 | Ga0111539_10250665 | 3300009094 | Bacteria | 2061 |
| 229 | Ga0111539_11136095 | 3300009094 | Bacteria | 908 |
| 230 | Ga0105245_10005762 | 3300009098 | Bacteria | 10870 |
| 231 | Ga0105245_10068041 | 3300009098 | Bacteria | 3226 |
| 232 | Ga0105245_10073128 | 3300009098 | Bacteria | 3116 |
| 233 | Ga0105245_10102412 | 3300009098 | Bacteria | 2651 |
| 234 | Ga0105245_10108727 | 3300009098 | Bacteria | 2576 |
| 235 | Ga0105245_10167952 | 3300009098 | Bacteria | 2087 |
| 236 | Ga0105245_10224154 | 3300009098 | Bacteria | 1815 |
| 237 | Ga0105247_10041847 | 3300009101 | Bacteria | 2804 |
| 238 | Ga0114129_10024803 | 3300009147 | Bacteria | 8501 |
| 239 | Ga0114129_10141735 | 3300009147 | Bacteria | 3294 |
| 240 | Ga0114129_10157542 | 3300009147 | Bacteria | 3104 |
| 241 | Ga0114129_10327665 | 3300009147 | Bacteria | 2034 |
| 242 | Ga0114129_10696914 | 3300009147 | Bacteria | 1306 |
| 243 | Ga0114129_11054611 | 3300009147 | Bacteria | 1020 |
| 244 | Ga0114129_11254601 | 3300009147 | Bacteria | 920 |
| 245 | Ga0105243_10004817 | 3300009148 | Bacteria | 10599 |
| 246 | Ga0105243_10131101 | 3300009148 | Bacteria | 2126 |
| 247 | Ga0105243_10234139 | 3300009148 | Bacteria | 1631 |
| 248 | Ga0105241_10074465 | 3300009174 | Bacteria | 2644 |
| 249 | Ga0105242_10020716 | 3300009176 | Bacteria | 5158 |
| 250 | Ga0105242_10043812 | 3300009176 | Bacteria | 3621 |
| 251 | Ga0105242_10066830 | 3300009176 | Bacteria | 2970 |
| 252 | Ga0105242_10519592 | 3300009176 | Bacteria | 1136 |
| 253 | Ga0105242_10578191 | 3300009176 | Bacteria | 1081 |
| 254 | Ga0105248_10034523 | 3300009177 | Bacteria | 5657 |
| 255 | Ga0105248_10679717 | 3300009177 | Bacteria | 1161 |
| 256 | Ga0105237_10214426 | 3300009545 | Bacteria | 1925 |
| 257 | Ga0105237_10772343 | 3300009545 | Bacteria | 968 |
| 258 | Ga0105238_10107501 | 3300009551 | Bacteria | 2771 |
| 259 | Ga0105238_10166990 | 3300009551 | Bacteria | 2177 |
| 260 | Ga0105249_10005728 | 3300009553 | Bacteria | 10745 |
| 261 | Ga0105249_10382062 | 3300009553 | Bacteria | 1434 |
| 262 | Ga0105239_10011273 | 3300010375 | Bacteria | 9970 |
| 263 | Ga0105239_10040782 | 3300010375 | Bacteria | 5087 |
| 264 | Ga0105239_10055777 | 3300010375 | Bacteria | 4334 |
| 265 | Ga0105239_10118833 | 3300010375 | Bacteria | 2933 |
| 266 | Ga0105239_10142102 | 3300010375 | Bacteria | 2675 |
| 267 | Ga0105246_10018147 | 3300011119 | Bacteria | 4481 |
| 268 | Ga0105246_10509397 | 3300011119 | Unclassified | 1024 |
| 269 | Ga0157314_1011093 | 3300012500 | Bacteria | 789 |
| 270 | Ga0157373_10076066 | 3300013100 | Bacteria | 2369 |
| 271 | Ga0157371_10014451 | 3300013102 | Bacteria | 5957 |
| 272 | Ga0157371_10407839 | 3300013102 | Bacteria | 995 |
| 273 | Ga0157371_10414982 | 3300013102 | Bacteria | 986 |
| 274 | Ga0157370_10147976 | 3300013104 | Bacteria | 2186 |
| 275 | Ga0157369_10011625 | 3300013105 | Bacteria | 9996 |
| 276 | Ga0157369_10057246 | 3300013105 | Bacteria | 4206 |
| 277 | Ga0157369_10527492 | 3300013105 | Bacteria | 1221 |
| 278 | Ga0157374_10093309 | 3300013296 | Bacteria | 2874 |
| 279 | Ga0157378_10096674 | 3300013297 | Bacteria | 2691 |
| 280 | Ga0163162_10186609 | 3300013306 | Bacteria | 2201 |
| 281 | Ga0163162_10267808 | 3300013306 | Bacteria | 1840 |
| 282 | Ga0163162_10590259 | 3300013306 | Bacteria | 1237 |
| 283 | Ga0157372_10132768 | 3300013307 | Bacteria | 2866 |
| 284 | Ga0157372_10399051 | 3300013307 | Bacteria | 1603 |
| 285 | Ga0157372_10479918 | 3300013307 | Bacteria | 1449 |
| 286 | Ga0157372_10756652 | 3300013307 | Unclassified | 1130 |
| 287 | Ga0157372_10853533 | 3300013307 | Bacteria | 1057 |
| 288 | Ga0157375_10033349 | 3300013308 | Bacteria | 4891 |
| 289 | Ga0157375_10090847 | 3300013308 | Bacteria | 3113 |
| 290 | Ga0157375_10308447 | 3300013308 | Bacteria | 1747 |
| 291 | Ga0157375_10651570 | 3300013308 | Unclassified | 1209 |
| 292 | Ga0157380_10177687 | 3300014326 | Bacteria | 1867 |
| 293 | Ga0157380_10374611 | 3300014326 | Bacteria | 1341 |
| 294 | Ga0182008_10123316 | 3300014497 | Bacteria | 1289 |
| 295 | Ga0157377_10003642 | 3300014745 | Bacteria | 6984 |
| 296 | Ga0157377_10008029 | 3300014745 | Bacteria | 5130 |
| 297 | Ga0157377_10010514 | 3300014745 | Bacteria | 4580 |
| 298 | Ga0157377_10404594 | 3300014745 | Bacteria | 931 |
| 299 | Ga0157379_10018230 | 3300014968 | Bacteria | 6186 |
| 300 | Ga0157376_10214912 | 3300014969 | Bacteria | 1777 |
| 301 | Ga0163161_10116736 | 3300017792 | Bacteria | 2001 |
| 302 | Ga0163161_10125777 | 3300017792 | Bacteria | 1930 |
| 303 | Ga0213871_10010655 | 3300021441 | Bacteria | 2091 |
| 304 | Ga0207656_10094560 | 3300025321 | Bacteria | 1362 |
| 305 | Ga0207692_10012888 | 3300025898 | Bacteria | 3606 |
| 306 | Ga0207642_10048351 | 3300025899 | Unclassified | 1907 |
| 307 | Ga0207642_10283007 | 3300025899 | Bacteria | 954 |
| 308 | Ga0207710_10044172 | 3300025900 | Bacteria | 1984 |
| 309 | Ga0207688_10003730 | 3300025901 | Bacteria | 8311 |
| 310 | Ga0207688_10017875 | 3300025901 | Bacteria | 3859 |
| 311 | Ga0207688_10033778 | 3300025901 | Bacteria | 2830 |
| 312 | Ga0207647_10082493 | 3300025904 | Bacteria | 1926 |
| 313 | Ga0207685_10091519 | 3300025905 | Bacteria | 1282 |
| 314 | Ga0207699_10083295 | 3300025906 | Bacteria | 1989 |
| 315 | Ga0207699_10305052 | 3300025906 | Bacteria | 1113 |
| 316 | Ga0207699_10435918 | 3300025906 | Bacteria | 938 |
| 317 | Ga0207645_10068502 | 3300025907 | Bacteria | 2269 |
| 318 | Ga0207645_10148234 | 3300025907 | Bacteria | 1531 |
| 319 | Ga0207643_10012440 | 3300025908 | Bacteria | 4600 |
| 320 | Ga0207684_10115414 | 3300025910 | Bacteria | 2300 |
| 321 | Ga0207707_10063261 | 3300025912 | Bacteria | 3220 |
| 322 | Ga0207707_10180597 | 3300025912 | Bacteria | 1842 |
| 323 | Ga0207707_10575366 | 3300025912 | Bacteria | 955 |
| 324 | Ga0207707_10599383 | 3300025912 | Unclassified | 933 |
| 325 | Ga0207695_10550267 | 3300025913 | Bacteria | 1036 |
| 326 | Ga0207671_10328029 | 3300025914 | Bacteria | 1212 |
| 327 | Ga0207693_10000576 | 3300025915 | Bacteria | 32918 |
| 328 | Ga0207693_10008025 | 3300025915 | Bacteria | 8669 |
| 329 | Ga0207693_10053620 | 3300025915 | Bacteria | 3164 |
| 330 | Ga0207693_10133673 | 3300025915 | Bacteria | 1950 |
| 331 | Ga0207663_10003164 | 3300025916 | Bacteria | 8006 |
| 332 | Ga0207663_10099633 | 3300025916 | Bacteria | 1948 |
| 333 | Ga0207660_10116957 | 3300025917 | Bacteria | 2014 |
| 334 | Ga0207662_10047174 | 3300025918 | Bacteria | 2551 |
| 335 | Ga0207662_10231916 | 3300025918 | Bacteria | 1206 |
| 336 | Ga0207657_10004578 | 3300025919 | Bacteria | 14619 |
| 337 | Ga0207657_10023123 | 3300025919 | Bacteria | 5795 |
| 338 | Ga0207657_10071551 | 3300025919 | Bacteria | 2936 |
| 339 | Ga0207657_10122606 | 3300025919 | Bacteria | 2138 |
| 340 | Ga0207652_10016442 | 3300025921 | Bacteria | 6042 |
| 341 | Ga0207652_10138059 | 3300025921 | Bacteria | 2178 |
| 342 | Ga0207652_10176264 | 3300025921 | Bacteria | 1920 |
| 343 | Ga0207652_10856779 | 3300025921 | Unclassified | 804 |
| 344 | Ga0207646_10001540 | 3300025922 | Bacteria | 28247 |
| 345 | Ga0207646_10012924 | 3300025922 | Bacteria | 8002 |
| 346 | Ga0207646_10276679 | 3300025922 | Bacteria | 1517 |
| 347 | Ga0207681_10187593 | 3300025923 | Bacteria | 1580 |
| 348 | Ga0207681_10411870 | 3300025923 | Bacteria | 1094 |
| 349 | Ga0207681_10459448 | 3300025923 | Bacteria | 1037 |
| 350 | Ga0207694_10075943 | 3300025924 | Bacteria | 2631 |
| 351 | Ga0207650_10393815 | 3300025925 | Bacteria | 1145 |
| 352 | Ga0207659_10293672 | 3300025926 | Unclassified | 1332 |
| 353 | Ga0207659_10555281 | 3300025926 | Bacteria | 976 |
| 354 | Ga0207687_10010823 | 3300025927 | Bacteria | 5962 |
| 355 | Ga0207687_10020460 | 3300025927 | Bacteria | 4389 |
| 356 | Ga0207687_10034840 | 3300025927 | Bacteria | 3421 |
| 357 | Ga0207687_10064593 | 3300025927 | Bacteria | 2596 |
| 358 | Ga0207687_10105718 | 3300025927 | Bacteria | 2080 |
| 359 | Ga0207687_10367497 | 3300025927 | Bacteria | 1176 |
| 360 | Ga0207700_10126602 | 3300025928 | Bacteria | 2079 |
| 361 | Ga0207700_10127263 | 3300025928 | Bacteria | 2074 |
| 362 | Ga0207700_10177384 | 3300025928 | Bacteria | 1781 |
| 363 | Ga0207664_10014478 | 3300025929 | Bacteria | 5697 |
| 364 | Ga0207664_10030449 | 3300025929 | Bacteria | 4120 |
| 365 | Ga0207644_10073448 | 3300025931 | Bacteria | 2508 |
| 366 | Ga0207644_10285008 | 3300025931 | Bacteria | 1327 |
| 367 | Ga0207690_10128471 | 3300025932 | Bacteria | 1851 |
| 368 | Ga0207706_10004721 | 3300025933 | Bacteria | 12757 |
| 369 | Ga0207706_10013517 | 3300025933 | Bacteria | 7419 |
| 370 | Ga0207706_10060822 | 3300025933 | Bacteria | 3326 |
| 371 | Ga0207706_10061263 | 3300025933 | Bacteria | 3313 |
| 372 | Ga0207686_10247532 | 3300025934 | Bacteria | 1300 |
| 373 | Ga0207686_10534999 | 3300025934 | Bacteria | 914 |
| 374 | Ga0207709_10011368 | 3300025935 | Bacteria | 4910 |
| 375 | Ga0207709_10664862 | 3300025935 | Bacteria | 831 |
| 376 | Ga0207669_10011806 | 3300025937 | Bacteria | 4268 |
| 377 | Ga0207669_10241208 | 3300025937 | Bacteria | 1340 |
| 378 | Ga0207669_10497768 | 3300025937 | Unclassified | 974 |
| 379 | Ga0207669_10573348 | 3300025937 | Bacteria | 914 |
| 380 | Ga0207665_10009724 | 3300025939 | Bacteria | 6313 |
| 381 | Ga0207665_10065530 | 3300025939 | Bacteria | 2470 |
| 382 | Ga0207665_10398255 | 3300025939 | Bacteria | 1048 |
| 383 | Ga0207691_10045494 | 3300025940 | Bacteria | 4034 |
| 384 | Ga0207691_10060473 | 3300025940 | Bacteria | 3442 |
| 385 | Ga0207691_10751816 | 3300025940 | Bacteria | 821 |
| 386 | Ga0207711_10640946 | 3300025941 | Bacteria | 991 |
| 387 | Ga0207711_10774224 | 3300025941 | Bacteria | 894 |
| 388 | Ga0207689_10034038 | 3300025942 | Bacteria | 4231 |
| 389 | Ga0207689_10154754 | 3300025942 | Bacteria | 1890 |
| 390 | Ga0207661_10000830 | 3300025944 | Bacteria | 20256 |
| 391 | Ga0207661_10016847 | 3300025944 | Bacteria | 5397 |
| 392 | Ga0207661_10023423 | 3300025944 | Bacteria | 4665 |
| 393 | Ga0207661_10029103 | 3300025944 | Bacteria | 4239 |
| 394 | Ga0207661_10049324 | 3300025944 | Bacteria | 3350 |
| 395 | Ga0207661_10082592 | 3300025944 | Bacteria | 2656 |
| 396 | Ga0207661_10578391 | 3300025944 | Bacteria | 1030 |
| 397 | Ga0207661_10822703 | 3300025944 | Bacteria | 855 |
| 398 | Ga0207679_10096985 | 3300025945 | Bacteria | 2295 |
| 399 | Ga0207679_10247459 | 3300025945 | Bacteria | 1514 |
| 400 | Ga0207679_10276545 | 3300025945 | Bacteria | 1438 |
| 401 | Ga0207679_10625353 | 3300025945 | Unclassified | 972 |
| 402 | Ga0207667_10040231 | 3300025949 | Bacteria | 4979 |
| 403 | Ga0207667_10125515 | 3300025949 | Bacteria | 2643 |
| 404 | Ga0207651_10401240 | 3300025960 | Bacteria | 1166 |
| 405 | Ga0207712_10053891 | 3300025961 | Bacteria | 2824 |
| 406 | Ga0207668_10101542 | 3300025972 | Bacteria | 2138 |
| 407 | Ga0207640_10031394 | 3300025981 | Bacteria | 3282 |
| 408 | Ga0207640_10068885 | 3300025981 | Bacteria | 2373 |
| 409 | Ga0207640_10395191 | 3300025981 | Unclassified | 1124 |
| 410 | Ga0207658_10071913 | 3300025986 | Bacteria | 2621 |
| 411 | Ga0207677_10095392 | 3300026023 | Bacteria | 2174 |
| 412 | Ga0207677_10167403 | 3300026023 | Unclassified | 1714 |
| 413 | Ga0207703_10382441 | 3300026035 | Bacteria | 1302 |
| 414 | Ga0207639_10042771 | 3300026041 | Bacteria | 3397 |
| 415 | Ga0207678_10064647 | 3300026067 | Bacteria | 3143 |
| 416 | Ga0207678_10078022 | 3300026067 | Bacteria | 2837 |
| 417 | Ga0207678_10112999 | 3300026067 | Bacteria | 2317 |
| 418 | Ga0207708_10001284 | 3300026075 | Bacteria | 18862 |
| 419 | Ga0207708_10029296 | 3300026075 | Bacteria | 4172 |
| 420 | Ga0207708_10081901 | 3300026075 | Bacteria | 2481 |
| 421 | Ga0207708_10098610 | 3300026075 | Bacteria | 2259 |
| 422 | Ga0207702_10032325 | 3300026078 | Bacteria | 4366 |
| 423 | Ga0207702_10056494 | 3300026078 | Bacteria | 3333 |
| 424 | Ga0207702_10110418 | 3300026078 | Bacteria | 2444 |
| 425 | Ga0207702_10417827 | 3300026078 | Bacteria | 1296 |
| 426 | Ga0207702_10540710 | 3300026078 | Bacteria | 1139 |
| 427 | Ga0207641_10117834 | 3300026088 | Bacteria | 2365 |
| 428 | Ga0207641_10300625 | 3300026088 | Bacteria | 1516 |
| 429 | Ga0207648_10008265 | 3300026089 | Bacteria | 10106 |
| 430 | Ga0207648_10175589 | 3300026089 | Bacteria | 1895 |
| 431 | Ga0207676_10130276 | 3300026095 | Bacteria | 2137 |
| 432 | Ga0207676_10143690 | 3300026095 | Unclassified | 2046 |
| 433 | Ga0207676_10666462 | 3300026095 | Bacteria | 1005 |
| 434 | Ga0207674_10055272 | 3300026116 | Bacteria | 4037 |
| 435 | Ga0207674_10098354 | 3300026116 | Bacteria | 2909 |
| 436 | Ga0207674_10247760 | 3300026116 | Bacteria | 1728 |
| 437 | Ga0207675_100000792 | 3300026118 | Bacteria | 31451 |
| 438 | Ga0207675_100007683 | 3300026118 | Bacteria | 10172 |
| 439 | Ga0207675_100052001 | 3300026118 | Bacteria | 3823 |
| 440 | Ga0207683_10000898 | 3300026121 | Bacteria | 27389 |
| 441 | Ga0207683_10063501 | 3300026121 | Bacteria | 3253 |
| 442 | Ga0207683_10263121 | 3300026121 | Bacteria | 1575 |
| 443 | Ga0207683_10349106 | 3300026121 | Bacteria | 1358 |
| 444 | Ga0207698_10343875 | 3300026142 | Bacteria | 1406 |
| 445 | Ga0207698_10615290 | 3300026142 | Bacteria | 1072 |
| 446 | Ga0207428_10013003 | 3300027907 | Bacteria | 7290 |
| 447 | Ga0207428_10402711 | 3300027907 | Bacteria | 1002 |
| 448 | Ga0268266_10548620 | 3300028379 | Bacteria | 1107 |
| 449 | Ga0268265_10237570 | 3300028380 | Bacteria | 1606 |
| 450 | Ga0265338_10004598 | 3300028800 | Bacteria | 18567 |
| 451 | Ga0265338_10006450 | 3300028800 | Bacteria | 14955 |
| 452 | Ga0265338_10011093 | 3300028800 | Bacteria | 10448 |
| 453 | Ga0265338_10029240 | 3300028800 | Bacteria | 5467 |
| 454 | Ga0265320_10023981 | 3300031240 | Bacteria | 3236 |
| 455 | Ga0265339_10028524 | 3300031249 | Bacteria | 3173 |
| 456 | Ga0265327_10044202 | 3300031251 | Unclassified | 2377 |
| 457 | Ga0265327_10201583 | 3300031251 | Bacteria | 901 |
| 458 | Ga0265316_10053799 | 3300031344 | Bacteria | 3153 |
| 459 | Ga0265314_10020439 | 3300031711 | Bacteria | 5110 |
| 460 | Ga0307410_10083699 | 3300031852 | Bacteria | 2247 |
| 461 | Ga0307412_10243138 | 3300031911 | Bacteria | 1393 |
| 462 | Ga0307409_100079707 | 3300031995 | Bacteria | 2640 |
| 463 | Ga0373930_0041076 | 3300034816 | Bacteria | 986 |
| 464 | Ga0373948_0017891 | 3300034817 | Bacteria | 1326 |
| 465 | Ga0373959_0006484 | 3300034820 | Bacteria | 1944 |
| 466 | Ga0373944_0028793 | 3300035089 | Bacteria | 1655 |
| 467 | Ga0373944_0065560 | 3300035089 | Bacteria | 1173 |
| 468 | Ga0373952_0015088 | 3300035092 | Bacteria | 1556 |
| 469 | Ga0373932_0008243 | 3300035112 | Bacteria | 2490 |
| 470 | Ga0373936_0038087 | 3300035113 | Bacteria | 1922 |
| 471 | Ga0373939_0037580 | 3300035114 | Bacteria | 1439 |
| 472 | Ga0373941_0043517 | 3300035115 | Bacteria | 1398 |
| 473 | Ga0373945_0015864 | 3300035116 | Bacteria | 2538 |
| 474 | Ga0373943_0006250 | 3300035170 | Bacteria | 5351 |
| 475 | Ga0373943_0011455 | 3300035170 | Bacteria | 3990 |
| 476 | Ga0373943_0021180 | 3300035170 | Bacteria | 3001 |
| 477 | Ga0373946_0019592 | 3300035171 | Bacteria | 2608 |
| 478 | Ga0373946_0180973 | 3300035171 | Bacteria | 1000 |
| 479 | Ga0373961_0009301 | 3300035241 | Bacteria | 2403 |
| 480 | Ga0373961_0051566 | 3300035241 | Bacteria | 1222 |
| 481 | Ga0373962_0056646 | 3300035242 | Bacteria | 1142 |
| 482 | Ga0373931_0419401 | 3300035691 | Bacteria | 850 |
| 483 | Ga0373935_0003142 | 3300035692 | Bacteria | 9527 |
| 484 | Ga0373935_0098036 | 3300035692 | Bacteria | 1929 |
| 485 | Ga0373935_0143669 | 3300035692 | Bacteria | 1614 |
| 486 | Ga0373927_0044249 | 3300035695 | Bacteria | 2881 |
| 487 | Ga0373927_0139482 | 3300035695 | Bacteria | 1585 |
| 488 | Ga0373947_0005913 | 3300035725 | Bacteria | 7128 |
| 489 | Ga0373947_0035992 | 3300035725 | Bacteria | 2933 |
| 490 | Ga0373947_0071012 | 3300035725 | Bacteria | 2135 |
| 491 | Ga0373947_0134731 | 3300035725 | Bacteria | 1580 |
| 492 | Ga0373947_0498335 | 3300035725 | Bacteria | 827 |
| 493 | Ga0373937_0064158 | 3300036401 | Bacteria | 3379 |
| 494 | Ga0373937_0104136 | 3300036401 | Unclassified | 2636 |
| 495 | Ga0373925_0002557 | 3300037068 | Bacteria | 14492 |
| 496 | Ga0373925_0103583 | 3300037068 | Bacteria | 2191 |
| 497 | Ga0373925_0176254 | 3300037068 | Bacteria | 1690 |
| 498 | Ga0395899_0003978 | 3300037312 | Bacteria | 11644 |
| 499 | Ga0395899_0004636 | 3300037312 | Bacteria | 10720 |
| 500 | Ga0395899_0005711 | 3300037312 | Bacteria | 9658 |
| 501 | Ga0395899_0005949 | 3300037312 | Bacteria | 9475 |
| 502 | Ga0395899_0043736 | 3300037312 | Bacteria | 3339 |
| 503 | Ga0395899_0062943 | 3300037312 | Bacteria | 2731 |
| 504 | Ga0395899_0162380 | 3300037312 | Bacteria | 1577 |
| 505 | Ga0395900_0001538 | 3300037418 | Bacteria | 27416 |
| 506 | Ga0395900_0002131 | 3300037418 | Bacteria | 22136 |
| 507 | Ga0395900_0017645 | 3300037418 | Bacteria | 7284 |
| 508 | Ga0395900_0032901 | 3300037418 | Bacteria | 5334 |
| 509 | Ga0395900_0039455 | 3300037418 | Bacteria | 4865 |
| 510 | Ga0395900_0074450 | 3300037418 | Bacteria | 3491 |
| 511 | Ga0395900_0106737 | 3300037418 | Bacteria | 2877 |
| 512 | Ga0395900_0155628 | 3300037418 | Bacteria | 2334 |
| 513 | Ga0395900_0295472 | 3300037418 | Unclassified | 1608 |
| 514 | Ga0395900_0726084 | 3300037418 | Bacteria | 925 |
| 515 | Ga0395898_0001713 | 3300037466 | Bacteria | 29061 |
| 516 | Ga0395898_0006214 | 3300037466 | Bacteria | 12794 |
| 517 | Ga0395898_0007822 | 3300037466 | Bacteria | 11347 |
| 518 | Ga0395898_0013668 | 3300037466 | Bacteria | 8351 |
| 519 | Ga0395898_0019994 | 3300037466 | Bacteria | 6807 |
| 520 | Ga0395898_0022082 | 3300037466 | Bacteria | 6447 |
| 521 | Ga0395898_0042127 | 3300037466 | Bacteria | 4506 |
| 522 | Ga0395898_0068826 | 3300037466 | Bacteria | 3425 |
| 523 | Ga0395898_0123763 | 3300037466 | Bacteria | 2478 |
| 524 | Ga0395898_0139205 | 3300037466 | Bacteria | 2324 |
| 525 | Ga0395898_0139418 | 3300037466 | Bacteria | 2321 |
| 526 | Ga0395898_0217029 | 3300037466 | Bacteria | 1824 |
| 527 | Ga0395898_0679637 | 3300037466 | Bacteria | 972 |
| 528 | Ga0395905_0000568 | 3300037471 | Bacteria | 50013 |
| 529 | Ga0395905_0003732 | 3300037471 | Bacteria | 16136 |
| 530 | Ga0395905_0016012 | 3300037471 | Bacteria | 7128 |
| 531 | Ga0395905_0018371 | 3300037471 | Bacteria | 6637 |
| 532 | Ga0395905_0135514 | 3300037471 | Bacteria | 2316 |
| 533 | Ga0395905_0194296 | 3300037471 | Unclassified | 1903 |
| 534 | Ga0395905_0500715 | 3300037471 | Bacteria | 1115 |
| 535 | Ga0395901_0009430 | 3300038443 | Bacteria | 9904 |
| 536 | Ga0395901_0017370 | 3300038443 | Bacteria | 7344 |
| 537 | Ga0395901_0018641 | 3300038443 | Bacteria | 7087 |
| 538 | Ga0395901_0020467 | 3300038443 | Bacteria | 6771 |
| 539 | Ga0395901_0026136 | 3300038443 | Bacteria | 5993 |
| 540 | Ga0395901_0069980 | 3300038443 | Bacteria | 3655 |
| 541 | Ga0395901_0076085 | 3300038443 | Bacteria | 3502 |
| 542 | Ga0395901_0085143 | 3300038443 | Bacteria | 3304 |
| 543 | Ga0395901_0213821 | 3300038443 | Bacteria | 2017 |
| 544 | Ga0395901_0264320 | 3300038443 | Bacteria | 1790 |
| 545 | Ga0395901_0339255 | 3300038443 | Bacteria | 1553 |
| 546 | Ga0436360_0031091 | 3300039438 | Bacteria | 2733 |
| 547 | Ga0436360_1357140 | 3300039438 | Bacteria | 11037 |
| 548 | Ga0451833_0356990 | 3300041491 | Bacteria | 821 |
| 549 | Ga0451853_0568896 | 3300041512 | Bacteria | 1573 |
| 550 | Ga0439448_0024436 | 3300042005 | Bacteria | 1889 |
| 551 | Ga0439448_0106799 | 3300042005 | Bacteria | 954 |
| 552 | Ga0450916_003096 | 3300042530 | Bacteria | 1808 |
| 553 | Ga0466965_0050569 | 3300044683 | Bacteria | 2061 |
| 554 | Ga0466965_0063514 | 3300044683 | Bacteria | 1848 |
| 555 | Ga0466961_0105175 | 3300044693 | Bacteria | 1777 |
| 556 | Ga0466963_0000078 | 3300044694 | Bacteria | 33439 |
| 557 | Ga0466963_0011463 | 3300044694 | Bacteria | 5399 |
| 558 | Ga0466963_0016740 | 3300044694 | Bacteria | 4562 |
| 559 | Ga0466963_0021180 | 3300044694 | Bacteria | 4098 |
| 560 | Ga0466963_0028613 | 3300044694 | Bacteria | 3580 |
| 561 | Ga0466963_0041189 | 3300044694 | Bacteria | 3028 |
| 562 | Ga0466963_0041747 | 3300044694 | Bacteria | 3009 |
| 563 | Ga0466964_0002212 | 3300044706 | Bacteria | 6880 |
| 564 | Ga0466964_0006461 | 3300044706 | Bacteria | 4369 |
| 565 | Ga0466964_0014756 | 3300044706 | Bacteria | 2972 |
| 566 | Ga0466964_0025021 | 3300044706 | Bacteria | 2329 |
| 567 | Ga0466971_0031655 | 3300044719 | Bacteria | 2369 |
| 568 | Ga0466968_0001161 | 3300044735 | Bacteria | 9335 |
| 569 | Ga0466968_0019006 | 3300044735 | Bacteria | 2761 |
| 570 | Ga0466968_0038202 | 3300044735 | Bacteria | 2017 |
| 571 | Ga0466970_0005539 | 3300044765 | Bacteria | 6271 |
| 572 | Ga0466957_0017365 | 3300044842 | Bacteria | 4212 |
| 573 | Ga0466957_0018612 | 3300044842 | Bacteria | 4080 |
| 574 | Ga0466957_0024965 | 3300044842 | Bacteria | 3540 |
| 575 | Ga0466960_0004248 | 3300044901 | Bacteria | 5580 |
| 576 | Ga0466959_0003883 | 3300045049 | Bacteria | 9918 |
| 577 | Ga0451576_0042487 | 3300045051 | Bacteria | 4798 |
| 578 | Ga0466958_0005370 | 3300045836 | Bacteria | 6886 |
| 579 | Ga0466958_0021049 | 3300045836 | Bacteria | 3807 |
| 580 | Ga0466958_0035475 | 3300045836 | Bacteria | 2980 |
| 581 | Ga0466958_0047614 | 3300045836 | Bacteria | 2588 |
| 582 | Ga0466967_0001286 | 3300045976 | Bacteria | 14281 |
| 583 | Ga0466967_0015711 | 3300045976 | Bacteria | 5945 |
| 584 | Ga0466967_0017616 | 3300045976 | Bacteria | 5679 |
| 585 | Ga0466967_0058874 | 3300045976 | Bacteria | 3397 |
| 586 | Ga0466967_0085623 | 3300045976 | Bacteria | 2853 |
| 587 | Ga0466967_0172295 | 3300045976 | Bacteria | 2037 |
| 588 | Ga0466967_0226828 | 3300045976 | Bacteria | 1777 |
| 589 | Ga0466967_0357259 | 3300045976 | Bacteria | 1415 |
| 590 | Ga0466967_0454653 | 3300045976 | Bacteria | 1252 |
| 591 | Ga0466967_0494239 | 3300045976 | Unclassified | 1200 |
| 592 | Ga0466967_0589405 | 3300045976 | Bacteria | 1096 |
| 593 | Ga0495617_082333 | 3300046452 | Bacteria | 1054 |
| 594 | Ga0495592_0001100 | 3300046454 | Bacteria | 18772 |
| 595 | Ga0495592_0150679 | 3300046454 | Bacteria | 1609 |
| 596 | Ga0495603_0001085 | 3300046455 | Bacteria | 15790 |
| 597 | Ga0495603_0021259 | 3300046455 | Bacteria | 3929 |
| 598 | Ga0495603_0235373 | 3300046455 | Bacteria | 1055 |
| 599 | Ga0495629_0031019 | 3300046459 | Bacteria | 3786 |
| 600 | Ga0495629_0096666 | 3300046459 | Bacteria | 2060 |
| 601 | Ga0495629_0117051 | 3300046459 | Bacteria | 1857 |
| 602 | Ga0495641_0006376 | 3300046461 | Bacteria | 7656 |
| 603 | Ga0495641_0007577 | 3300046461 | Bacteria | 6756 |
| 604 | Ga0495641_0015690 | 3300046461 | Bacteria | 4026 |
| 605 | Ga0495641_0065788 | 3300046461 | Bacteria | 1632 |
| 606 | Ga0495641_0171947 | 3300046461 | Bacteria | 969 |
| 607 | Ga0495641_0251006 | 3300046461 | Unclassified | 795 |
| 608 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 609 | Ga0495651_0367769 | 3300046462 | Bacteria | 946 |
| 610 | Ga0495653_0000897 | 3300046463 | Bacteria | 23064 |
| 611 | Ga0495653_0020261 | 3300046463 | Bacteria | 5392 |
| 612 | Ga0495653_0253515 | 3300046463 | Bacteria | 1167 |
| 613 | Ga0495580_0006136 | 3300046472 | Bacteria | 9829 |
| 614 | Ga0495582_0009374 | 3300046473 | Bacteria | 5392 |
| 615 | Ga0495582_0024199 | 3300046473 | Bacteria | 3321 |
| 616 | Ga0495582_0055400 | 3300046473 | Bacteria | 2186 |
| 617 | Ga0495582_0057706 | 3300046473 | Bacteria | 2140 |
| 618 | Ga0495582_0112155 | 3300046473 | Bacteria | 1532 |
| 619 | Ga0495582_0122001 | 3300046473 | Bacteria | 1469 |
| 620 | Ga0495605_0067662 | 3300046474 | Bacteria | 1694 |
| 621 | Ga0495605_0080990 | 3300046474 | Bacteria | 1519 |
| 622 | Ga0495605_0088248 | 3300046474 | Bacteria | 1441 |
| 623 | Ga0495605_0098368 | 3300046474 | Bacteria | 1348 |
| 624 | Ga0495639_0000501 | 3300046475 | Bacteria | 18483 |
| 625 | Ga0495639_0221951 | 3300046475 | Bacteria | 929 |
| 626 | Ga0495662_0001886 | 3300046476 | Bacteria | 10513 |
| 627 | Ga0495664_0002065 | 3300046477 | Bacteria | 10743 |
| 628 | Ga0495664_0128889 | 3300046477 | Unclassified | 1531 |
| 629 | Ga0495664_0190698 | 3300046477 | Bacteria | 1242 |
| 630 | Ga0495664_0323347 | 3300046477 | Bacteria | 930 |
| 631 | Ga0495584_0066994 | 3300046491 | Bacteria | 1806 |
| 632 | Ga0495584_0214495 | 3300046491 | Bacteria | 978 |
| 633 | Ga0495594_0062163 | 3300046499 | Bacteria | 2067 |
| 634 | Ga0495608_0002739 | 3300046511 | Bacteria | 12647 |
| 635 | Ga0495608_0034644 | 3300046511 | Bacteria | 3407 |
| 636 | Ga0495608_0125010 | 3300046511 | Bacteria | 1648 |
| 637 | Ga0495618_0005615 | 3300046514 | Bacteria | 7629 |
| 638 | Ga0495618_0034614 | 3300046514 | Bacteria | 3168 |
| 639 | Ga0495618_0088301 | 3300046514 | Bacteria | 1983 |
| 640 | Ga0495618_0131883 | 3300046514 | Bacteria | 1599 |
| 641 | Ga0495618_0178829 | 3300046514 | Bacteria | 1348 |
| 642 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 643 | Ga0495628_0059003 | 3300046516 | Bacteria | 3014 |
| 644 | Ga0495628_0134071 | 3300046516 | Bacteria | 1894 |
| 645 | Ga0495628_0138982 | 3300046516 | Bacteria | 1854 |
| 646 | Ga0495630_0002033 | 3300046517 | Bacteria | 14060 |
| 647 | Ga0495630_0024442 | 3300046517 | Bacteria | 4467 |
| 648 | Ga0495630_0300069 | 3300046517 | Bacteria | 1227 |
| 649 | Ga0495644_0008508 | 3300046523 | Bacteria | 3952 |
| 650 | Ga0495663_0015359 | 3300046525 | Bacteria | 2157 |
| 651 | Ga0495663_0151074 | 3300046525 | Bacteria | 792 |
| 652 | Ga0495642_0067778 | 3300046528 | Bacteria | 1489 |
| 653 | Ga0495652_0000045 | 3300046529 | Bacteria | 122469 |
| 654 | Ga0495652_0042153 | 3300046529 | Bacteria | 3936 |
| 655 | Ga0495652_0053980 | 3300046529 | Bacteria | 3423 |
| 656 | Ga0495652_0094719 | 3300046529 | Bacteria | 2435 |
| 657 | Ga0495652_0103526 | 3300046529 | Bacteria | 2304 |
| 658 | Ga0495652_0117373 | 3300046529 | Bacteria | 2129 |
| 659 | Ga0495665_0001055 | 3300046531 | Bacteria | 14632 |
| 660 | Ga0495665_0041667 | 3300046531 | Bacteria | 2445 |
| 661 | Ga0495665_0092438 | 3300046531 | Bacteria | 1590 |
| 662 | Ga0495640_0013846 | 3300046533 | Bacteria | 6125 |
| 663 | Ga0495586_0003415 | 3300046535 | Bacteria | 8516 |
| 664 | Ga0495586_0167880 | 3300046535 | Bacteria | 1239 |
| 665 | Ga0495587_0000275 | 3300046536 | Bacteria | 36839 |
| 666 | Ga0495609_0047591 | 3300046538 | Bacteria | 1919 |
| 667 | Ga0495645_0000068 | 3300046543 | Bacteria | 72552 |
| 668 | Ga0495645_0039361 | 3300046543 | Bacteria | 3448 |
| 669 | Ga0495633_0167924 | 3300046558 | Bacteria | 1012 |
| 670 | Ga0495667_0135084 | 3300046559 | Bacteria | 1590 |
| 671 | Ga0495667_0194273 | 3300046559 | Bacteria | 1300 |
| 672 | Ga0495667_0281579 | 3300046559 | Bacteria | 1055 |
| 673 | Ga0495667_0290741 | 3300046559 | Unclassified | 1036 |
| 674 | Ga0495656_0013736 | 3300046615 | Bacteria | 3019 |
| 675 | Ga0495634_0008960 | 3300046642 | Bacteria | 7409 |
| 676 | Ga0495634_0025336 | 3300046642 | Bacteria | 4152 |
| 677 | Ga0495634_0084281 | 3300046642 | Bacteria | 2072 |
| 678 | Ga0495635_0011230 | 3300046663 | Bacteria | 6279 |
| 679 | Ga0495635_0072700 | 3300046663 | Bacteria | 2356 |
| 680 | Ga0495635_0321520 | 3300046663 | Bacteria | 1035 |
| 681 | Ga0495588_0023673 | 3300046674 | Bacteria | 3042 |
| 682 | Ga0495657_0034070 | 3300046675 | Bacteria | 3540 |
| 683 | Ga0495657_0065711 | 3300046675 | Bacteria | 2385 |
| 684 | Ga0495657_0160855 | 3300046675 | Bacteria | 1389 |
| 685 | Ga0495599_0187364 | 3300046678 | Unclassified | 1274 |
| 686 | Ga0495623_0000418 | 3300046679 | Bacteria | 28005 |
| 687 | Ga0495623_0026350 | 3300046679 | Bacteria | 3743 |
| 688 | Ga0495646_0042520 | 3300046680 | Bacteria | 2788 |
| 689 | Ga0495647_0000727 | 3300046681 | Bacteria | 9738 |
| 690 | Ga0495647_0030306 | 3300046681 | Bacteria | 2006 |
| 691 | Ga0495658_0000785 | 3300046683 | Bacteria | 17124 |
| 692 | Ga0495658_0046801 | 3300046683 | Bacteria | 2433 |
| 693 | Ga0495658_0183985 | 3300046683 | Bacteria | 1297 |
| 694 | Ga0495613_0026907 | 3300046689 | Bacteria | 4282 |
| 695 | Ga0495613_0087313 | 3300046689 | Bacteria | 2261 |
| 696 | Ga0495613_0111817 | 3300046689 | Bacteria | 1968 |
| 697 | Ga0495613_0116148 | 3300046689 | Bacteria | 1925 |
| 698 | Ga0495613_0433742 | 3300046689 | Bacteria | 892 |
| 699 | Ga0495624_0008642 | 3300046690 | Bacteria | 7092 |
| 700 | Ga0495624_0027399 | 3300046690 | Bacteria | 3731 |
| 701 | Ga0495624_0364988 | 3300046690 | Bacteria | 868 |
| 702 | Ga0495600_0076415 | 3300046809 | Bacteria | 2187 |
| 703 | Ga0495660_0048675 | 3300046810 | Bacteria | 2318 |
| 704 | Ga0495581_0005357 | 3300047315 | Bacteria | 7420 |
| 705 | Ga0495581_0042870 | 3300047315 | Bacteria | 2618 |
| 706 | Ga0495604_0000111 | 3300047317 | Bacteria | 68576 |
| 707 | Ga0495604_0195457 | 3300047317 | Bacteria | 1407 |
| 708 | Ga0495636_0193453 | 3300047318 | Bacteria | 926 |
| 709 | Ga0495674_0039026 | 3300047319 | Bacteria | 4257 |
| 710 | Ga0495674_0039406 | 3300047319 | Bacteria | 4235 |
| 711 | Ga0495674_0077523 | 3300047319 | Bacteria | 2857 |
| 712 | Ga0495676_0007744 | 3300047321 | Bacteria | 9855 |
| 713 | Ga0495676_0023091 | 3300047321 | Bacteria | 5403 |
| 714 | Ga0495676_0041233 | 3300047321 | Bacteria | 3801 |
| 715 | Ga0495680_0019156 | 3300047322 | Bacteria | 5789 |
| 716 | Ga0495680_0035061 | 3300047322 | Bacteria | 4045 |
| 717 | Ga0495680_0035134 | 3300047322 | Bacteria | 4039 |
| 718 | Ga0495680_0101234 | 3300047322 | Bacteria | 2146 |
| 719 | Ga0495675_0000269 | 3300047444 | Bacteria | 37748 |
| 720 | Ga0495685_051438 | 3300047447 | Bacteria | 1397 |
| 721 | Ga0495685_156318 | 3300047447 | Bacteria | 740 |
| 722 | Ga0495684_0007069 | 3300047471 | Bacteria | 8713 |
| 723 | Ga0495684_0019190 | 3300047471 | Bacteria | 5262 |
| 724 | Ga0495684_0028360 | 3300047471 | Bacteria | 4298 |
| 725 | Ga0495684_0072972 | 3300047471 | Bacteria | 2607 |
| 726 | Ga0495593_0001801 | 3300047673 | Bacteria | 12729 |
| 727 | Ga0495602_0006456 | 3300048088 | Bacteria | 12295 |
| 728 | Ga0495602_0058330 | 3300048088 | Bacteria | 3379 |
| 729 | Ga0495602_0276630 | 3300048088 | Bacteria | 1239 |
| 730 | Ga0495614_0001124 | 3300048089 | Bacteria | 11490 |
| 731 | Ga0495614_0086288 | 3300048089 | Bacteria | 1363 |
| 732 | Ga0496100_0081197 | 3300048903 | Bacteria | 2190 |
| 733 | Ga0496100_0155982 | 3300048903 | Bacteria | 1633 |
| 734 | Ga0496101_0054399 | 3300048904 | Unclassified | 2890 |
| 735 | Ga0496101_0063607 | 3300048904 | Bacteria | 2686 |
| 736 | Ga0496101_0291893 | 3300048904 | Bacteria | 1276 |
| 737 | Ga0496101_0308477 | 3300048904 | Bacteria | 1240 |
| 738 | Ga0496102_0042738 | 3300048905 | Bacteria | 4108 |
| 739 | Ga0496102_0113738 | 3300048905 | Bacteria | 2525 |
| 740 | Ga0496102_0276811 | 3300048905 | Bacteria | 1582 |
| 741 | Ga0496103_0025317 | 3300048906 | Bacteria | 3585 |
| 742 | Ga0496104_0006439 | 3300048907 | Bacteria | 10322 |
| 743 | Ga0496104_0028580 | 3300048907 | Bacteria | 5168 |
| 744 | Ga0496104_0036322 | 3300048907 | Bacteria | 4606 |
| 745 | Ga0496104_0118833 | 3300048907 | Bacteria | 2538 |
| 746 | Ga0496104_0388266 | 3300048907 | Bacteria | 1308 |
| 747 | Ga0496105_0001401 | 3300048908 | Bacteria | 16942 |
| 748 | Ga0496105_0011337 | 3300048908 | Bacteria | 7040 |
| 749 | Ga0496105_0043302 | 3300048908 | Bacteria | 3713 |
| 750 | Ga0496105_0048667 | 3300048908 | Bacteria | 3499 |
| 751 | Ga0496106_0019249 | 3300048909 | Bacteria | 5063 |
| 752 | Ga0496106_0148408 | 3300048909 | Bacteria | 1848 |
| 753 | Ga0496106_0544241 | 3300048909 | Unclassified | 932 |
| 754 | Ga0496107_0105074 | 3300048910 | Bacteria | 2073 |
| 755 | Ga0496107_0121564 | 3300048910 | Bacteria | 1924 |
| 756 | Ga0496107_0394022 | 3300048910 | Bacteria | 1030 |
| 757 | Ga0496107_0414886 | 3300048910 | Bacteria | 1001 |
| 758 | Ga0496107_0438241 | 3300048910 | Bacteria | 971 |
| 759 | Ga0496107_0527720 | 3300048910 | Bacteria | 875 |
| 760 | Ga0496108_0015080 | 3300048911 | Bacteria | 6309 |
| 761 | Ga0496108_0062022 | 3300048911 | Bacteria | 3148 |
| 762 | Ga0496108_0098698 | 3300048911 | Bacteria | 2488 |
| 763 | Ga0496108_0111143 | 3300048911 | Bacteria | 2343 |
| 764 | Ga0496108_0380606 | 3300048911 | Bacteria | 1232 |
| 765 | Ga0496108_0750480 | 3300048911 | Bacteria | 844 |
| 766 | Ga0496109_0007539 | 3300048912 | Bacteria | 9221 |
| 767 | Ga0496109_0024995 | 3300048912 | Bacteria | 5317 |
| 768 | Ga0496109_0025340 | 3300048912 | Bacteria | 5284 |
| 769 | Ga0496109_0034439 | 3300048912 | Bacteria | 4560 |
| 770 | Ga0496109_0037616 | 3300048912 | Bacteria | 4372 |
| 771 | Ga0496109_0056106 | 3300048912 | Bacteria | 3594 |
| 772 | Ga0496109_0540410 | 3300048912 | Bacteria | 1099 |
| 773 | Ga0496110_0001330 | 3300048913 | Bacteria | 17765 |
| 774 | Ga0496110_0004457 | 3300048913 | Bacteria | 10855 |
| 775 | Ga0496110_0014989 | 3300048913 | Bacteria | 6445 |
| 776 | Ga0496110_0126452 | 3300048913 | Bacteria | 2306 |
| 777 | Ga0496110_0178148 | 3300048913 | Bacteria | 1930 |
| 778 | Ga0496110_0200048 | 3300048913 | Bacteria | 1815 |
| 779 | Ga0496110_0221527 | 3300048913 | Bacteria | 1720 |
| 780 | Ga0496110_0339570 | 3300048913 | Bacteria | 1368 |
| 781 | Ga0496110_0648437 | 3300048913 | Bacteria | 956 |
| 782 | Ga0496111_0000032 | 3300048914 | Bacteria | 55961 |
| 783 | Ga0496111_0068765 | 3300048914 | Bacteria | 2574 |
| 784 | Ga0496111_0175602 | 3300048914 | Bacteria | 1592 |
| 785 | Ga0496112_0062538 | 3300048915 | Bacteria | 3672 |
| 786 | Ga0496112_0080458 | 3300048915 | Bacteria | 3222 |
| 787 | Ga0496112_0127978 | 3300048915 | Bacteria | 2510 |
| 788 | Ga0496112_0266672 | 3300048915 | Bacteria | 1661 |
| 789 | Ga0496113_0002660 | 3300048916 | Bacteria | 10470 |
| 790 | Ga0496113_0066603 | 3300048916 | Bacteria | 2728 |
| 791 | Ga0496113_0135654 | 3300048916 | Bacteria | 1934 |
| 792 | Ga0496113_0572661 | 3300048916 | Bacteria | 905 |
| 793 | Ga0496114_0020590 | 3300048917 | Bacteria | 5354 |
| 794 | Ga0496114_0030412 | 3300048917 | Bacteria | 4443 |
| 795 | Ga0496114_0101522 | 3300048917 | Bacteria | 2456 |
| 796 | Ga0496114_0145592 | 3300048917 | Bacteria | 2053 |
| 797 | Ga0496114_0223164 | 3300048917 | Bacteria | 1654 |
| 798 | Ga0496114_0255138 | 3300048917 | Unclassified | 1543 |
| 799 | Ga0496115_0033089 | 3300048918 | Bacteria | 4080 |
| 800 | Ga0496115_0046857 | 3300048918 | Bacteria | 3456 |
| 801 | Ga0496115_0067297 | 3300048918 | Bacteria | 2897 |
| 802 | Ga0496115_0136910 | 3300048918 | Bacteria | 2019 |
| 803 | Ga0501031_0004130 | 3300049568 | Bacteria | 9380 |
| 804 | Ga0501031_0021989 | 3300049568 | Bacteria | 4156 |
| 805 | Ga0501031_0031234 | 3300049568 | Bacteria | 3474 |
| 806 | Ga0501031_0145221 | 3300049568 | Bacteria | 1550 |
| 807 | Ga0501031_0190213 | 3300049568 | Bacteria | 1340 |
| 808 | Ga0501031_0302569 | 3300049568 | Bacteria | 1036 |
| 809 | Ga0501032_0025748 | 3300049569 | Bacteria | 4055 |
| 810 | Ga0501033_0024673 | 3300049570 | Bacteria | 4534 |
| 811 | Ga0501033_0153308 | 3300049570 | Bacteria | 1661 |
| 812 | Ga0501033_0425716 | 3300049570 | Bacteria | 924 |
| 813 | Ga0501034_0147911 | 3300049571 | Bacteria | 2326 |
| 814 | Ga0501034_0180252 | 3300049571 | Bacteria | 2077 |
| 815 | Ga0501036_0008004 | 3300049572 | Bacteria | 8650 |
| 816 | Ga0501036_0016593 | 3300049572 | Bacteria | 6150 |
| 817 | Ga0501036_0024991 | 3300049572 | Bacteria | 5038 |
| 818 | Ga0501036_0025945 | 3300049572 | Bacteria | 4944 |
| 819 | Ga0501036_0190515 | 3300049572 | Bacteria | 1725 |
| 820 | Ga0501036_0262728 | 3300049572 | Bacteria | 1446 |
| 821 | Ga0501037_0198657 | 3300049573 | Bacteria | 1418 |
| 822 | Ga0501038_0007786 | 3300049574 | Bacteria | 9871 |
| 823 | Ga0501038_0022966 | 3300049574 | Bacteria | 5583 |
| 824 | Ga0501038_0027466 | 3300049574 | Bacteria | 5062 |
| 825 | Ga0501038_0057562 | 3300049574 | Bacteria | 3337 |
| 826 | Ga0501038_0215717 | 3300049574 | Bacteria | 1533 |
| 827 | Ga0501039_0012132 | 3300049575 | Bacteria | 6570 |
| 828 | Ga0501039_0015380 | 3300049575 | Bacteria | 5857 |
| 829 | Ga0501039_0015712 | 3300049575 | Bacteria | 5791 |
| 830 | Ga0501039_0143576 | 3300049575 | Bacteria | 1875 |
| 831 | Ga0501039_0192535 | 3300049575 | Bacteria | 1603 |
| 832 | Ga0501040_0004395 | 3300049576 | Bacteria | 9157 |
| 833 | Ga0501040_0010534 | 3300049576 | Bacteria | 6047 |
| 834 | Ga0501040_0013989 | 3300049576 | Bacteria | 5283 |
| 835 | Ga0501040_0014456 | 3300049576 | Bacteria | 5200 |
| 836 | Ga0501040_0015141 | 3300049576 | Bacteria | 5095 |
| 837 | Ga0501040_0044449 | 3300049576 | Bacteria | 3028 |
| 838 | Ga0501040_0605599 | 3300049576 | Bacteria | 791 |
| 839 | Ga0501041_0009218 | 3300049577 | Bacteria | 5812 |
| 840 | Ga0501041_0017314 | 3300049577 | Bacteria | 4288 |
| 841 | Ga0501041_0027728 | 3300049577 | Bacteria | 3414 |
| 842 | Ga0501041_0087337 | 3300049577 | Bacteria | 1924 |
| 843 | Ga0501042_0027464 | 3300049578 | Bacteria | 4002 |
| 844 | Ga0501042_0062802 | 3300049578 | Bacteria | 2654 |
| 845 | Ga0501042_0078920 | 3300049578 | Bacteria | 2358 |
| 846 | Ga0501042_0097272 | 3300049578 | Bacteria | 2115 |
| 847 | Ga0501042_0120088 | 3300049578 | Bacteria | 1892 |
| 848 | Ga0501042_0141559 | 3300049578 | Bacteria | 1734 |
| 849 | Ga0501043_0068441 | 3300049579 | Bacteria | 2787 |
| 850 | Ga0501043_0189854 | 3300049579 | Bacteria | 1598 |
| 851 | Ga0501046_0095509 | 3300049580 | Bacteria | 2283 |
| 852 | Ga0501046_0103821 | 3300049580 | Bacteria | 2178 |
| 853 | Ga0501046_0105497 | 3300049580 | Bacteria | 2158 |
| 854 | Ga0501046_0118277 | 3300049580 | Bacteria | 2018 |
| 855 | Ga0501046_0133899 | 3300049580 | Bacteria | 1878 |
| 856 | Ga0501046_0179797 | 3300049580 | Bacteria | 1582 |
| 857 | Ga0501046_0395322 | 3300049580 | Bacteria | 999 |
| 858 | Ga0501048_0091882 | 3300049582 | Bacteria | 2140 |
| 859 | Ga0501048_0110777 | 3300049582 | Bacteria | 1938 |
| 860 | Ga0501048_0117411 | 3300049582 | Bacteria | 1879 |
| 861 | Ga0501048_0121674 | 3300049582 | Bacteria | 1844 |
| 862 | Ga0501067_0004259 | 3300049583 | Bacteria | 7890 |
| 863 | Ga0501067_0091179 | 3300049583 | Bacteria | 1692 |
| 864 | Ga0501068_0003825 | 3300049584 | Bacteria | 8165 |
| 865 | Ga0501068_0012024 | 3300049584 | Bacteria | 4897 |
| 866 | Ga0501068_0022024 | 3300049584 | Bacteria | 3724 |
| 867 | Ga0501068_0234268 | 3300049584 | Unclassified | 1168 |
| 868 | Ga0501069_0006559 | 3300049585 | Bacteria | 6085 |
| 869 | Ga0501069_0108936 | 3300049585 | Bacteria | 1576 |
| 870 | Ga0501070_0057731 | 3300049586 | Bacteria | 3218 |
| 871 | Ga0501070_0112778 | 3300049586 | Bacteria | 2247 |
| 872 | Ga0501070_0171936 | 3300049586 | Bacteria | 1784 |
| 873 | Ga0501070_0553486 | 3300049586 | Unclassified | 921 |
| 874 | Ga0501071_0000662 | 3300049587 | Bacteria | 17990 |
| 875 | Ga0501071_0002358 | 3300049587 | Bacteria | 11428 |
| 876 | Ga0501071_0003764 | 3300049587 | Bacteria | 9525 |
| 877 | Ga0501071_0017605 | 3300049587 | Bacteria | 4932 |
| 878 | Ga0501071_0109438 | 3300049587 | Bacteria | 2041 |
| 879 | Ga0501071_0124740 | 3300049587 | Bacteria | 1910 |
| 880 | Ga0501072_0009405 | 3300049588 | Bacteria | 7433 |
| 881 | Ga0501072_0014926 | 3300049588 | Bacteria | 5953 |
| 882 | Ga0501072_0043954 | 3300049588 | Bacteria | 3512 |
| 883 | Ga0501072_0165441 | 3300049588 | Bacteria | 1764 |
| 884 | Ga0501072_0746376 | 3300049588 | Bacteria | 768 |
| 885 | Ga0501073_0017993 | 3300049589 | Bacteria | 5110 |
| 886 | Ga0501073_0028772 | 3300049589 | Bacteria | 3970 |
| 887 | Ga0501073_0121910 | 3300049589 | Bacteria | 1807 |
| 888 | Ga0501074_0025399 | 3300049590 | Bacteria | 4302 |
| 889 | Ga0501074_0054282 | 3300049590 | Bacteria | 2890 |
| 890 | Ga0501074_0202049 | 3300049590 | Bacteria | 1416 |
| 891 | Ga0501075_0006475 | 3300049591 | Bacteria | 8059 |
| 892 | Ga0501075_0009784 | 3300049591 | Bacteria | 6719 |
| 893 | Ga0501075_0021498 | 3300049591 | Bacteria | 4705 |
| 894 | Ga0501075_0141940 | 3300049591 | Bacteria | 1830 |
| 895 | Ga0501075_0302866 | 3300049591 | Bacteria | 1218 |
| 896 | Ga0501075_0305890 | 3300049591 | Bacteria | 1211 |
| 897 | Ga0501076_0002743 | 3300049592 | Bacteria | 12198 |
| 898 | Ga0501076_0004119 | 3300049592 | Bacteria | 10281 |
| 899 | Ga0501076_0008503 | 3300049592 | Bacteria | 7522 |
| 900 | Ga0501076_0022464 | 3300049592 | Bacteria | 4847 |
| 901 | Ga0501076_0034678 | 3300049592 | Bacteria | 3945 |
| 902 | Ga0501076_0131669 | 3300049592 | Bacteria | 2028 |
| 903 | Ga0501077_0011297 | 3300049593 | Bacteria | 5576 |
| 904 | Ga0501077_0011863 | 3300049593 | Bacteria | 5449 |
| 905 | Ga0501077_0013786 | 3300049593 | Bacteria | 5069 |
| 906 | Ga0501077_0015480 | 3300049593 | Bacteria | 4802 |
| 907 | Ga0501077_0059599 | 3300049593 | Bacteria | 2422 |
| 908 | Ga0501077_0116353 | 3300049593 | Bacteria | 1694 |
| 909 | Ga0501079_0001035 | 3300049741 | Bacteria | 19256 |
| 910 | Ga0501079_0006655 | 3300049741 | Bacteria | 8692 |
| 911 | Ga0501079_0019804 | 3300049741 | Bacteria | 5141 |
| 912 | Ga0501079_0030888 | 3300049741 | Bacteria | 4116 |
| 913 | Ga0501079_0124106 | 3300049741 | Bacteria | 2009 |
| 914 | Ga0501079_0698593 | 3300049741 | Unclassified | 798 |
| 915 | Ga0501080_0003647 | 3300049742 | Bacteria | 13590 |
| 916 | Ga0501080_0029574 | 3300049742 | Bacteria | 5101 |
| 917 | Ga0501080_0040480 | 3300049742 | Bacteria | 4346 |
| 918 | Ga0501080_0051488 | 3300049742 | Bacteria | 3831 |
| 919 | Ga0501080_0102925 | 3300049742 | Bacteria | 2648 |
| 920 | Ga0501080_0244698 | 3300049742 | Bacteria | 1636 |
| 921 | Ga0501081_0013919 | 3300049743 | Bacteria | 5295 |
| 922 | Ga0501081_0048542 | 3300049743 | Bacteria | 2921 |
| 923 | Ga0501081_0063891 | 3300049743 | Bacteria | 2555 |
| 924 | Ga0501081_0099746 | 3300049743 | Bacteria | 2052 |
| 925 | Ga0501081_0099892 | 3300049743 | Bacteria | 2050 |
| 926 | Ga0501081_0120340 | 3300049743 | Bacteria | 1869 |
| 927 | Ga0501081_0125495 | 3300049743 | Bacteria | 1830 |
| 928 | Ga0501081_0130527 | 3300049743 | Bacteria | 1795 |
| 929 | Ga0501081_0471520 | 3300049743 | Unclassified | 934 |
| 930 | Ga0501083_0016349 | 3300049744 | Bacteria | 5195 |
| 931 | Ga0501083_0048521 | 3300049744 | Bacteria | 2865 |
| 932 | Ga0501083_0104507 | 3300049744 | Bacteria | 1866 |
| 933 | Ga0501035_0011508 | 3300049822 | Bacteria | 8199 |
| 934 | Ga0501035_0036848 | 3300049822 | Bacteria | 4431 |
| 935 | Ga0501035_0586551 | 3300049822 | Bacteria | 910 |
| 936 | Ga0501044_0659558 | 3300049823 | Unclassified | 935 |
| 937 | Ga0501045_0012025 | 3300049824 | Bacteria | 6084 |
| 938 | Ga0501045_0045550 | 3300049824 | Bacteria | 3193 |
| 939 | Ga0501045_0100698 | 3300049824 | Bacteria | 2138 |
| 940 | Ga0501045_0134883 | 3300049824 | Bacteria | 1835 |
| 941 | Ga0501045_0375467 | 3300049824 | Bacteria | 1058 |
| 942 | nmdc:mga00v17_151205_c1 | 3300050491 | Bacteria | 1492 |
| 943 | nmdc:mga0yw44_13142_c1 | 3300050492 | Bacteria | 4347 |
| 944 | nmdc:mga0yw44_486881_c1 | 3300050492 | Bacteria | 837 |
| 945 | nmdc:mga05p37_33357_c1 | 3300050507 | Bacteria | 6306 |
| 946 | nmdc:mga05p37_468043_c1 | 3300050507 | Bacteria | 1455 |
| 947 | nmdc:mga05p37_828795_c1 | 3300050507 | Bacteria | 1008 |
| 948 | nmdc:mga0qj67_81380_c1 | 3300050509 | Bacteria | 2596 |
| 949 | nmdc:mga06r32_623040_c1 | 3300050510 | Bacteria | 1048 |
| 950 | nmdc:mga06r32_664645_c1 | 3300050510 | Bacteria | 1009 |
| 951 | nmdc:mga08y16_220279_c1 | 3300050511 | Bacteria | 1965 |
| 952 | nmdc:mga08y16_226420_c1 | 3300050511 | Bacteria | 1935 |
| 953 | nmdc:mga08y16_301178_c1 | 3300050511 | Bacteria | 1652 |
| 954 | nmdc:mga08y16_71033_c1 | 3300050511 | Bacteria | 3629 |
| 955 | nmdc:mga08y16_80438_c1 | 3300050511 | Bacteria | 3397 |
| 956 | nmdc:mga0n895_1025339_c1 | 3300050512 | Bacteria | 805 |
| 957 | nmdc:mga0n895_180440_c1 | 3300050512 | Bacteria | 2143 |
| 958 | nmdc:mga0n895_18289_c1 | 3300050512 | Bacteria | 6481 |
| 959 | nmdc:mga0n895_25870_c1 | 3300050512 | Bacteria | 5551 |
| 960 | nmdc:mga0rr50_13713_c1 | 3300050513 | Bacteria | 5288 |
| 961 | nmdc:mga0rr50_37076_c1 | 3300050513 | Bacteria | 3516 |
| 962 | nmdc:mga0rr50_3765_c2 | 3300050513 | Bacteria | 4255 |
| 963 | nmdc:mga0rr50_41479_c1 | 3300050513 | Bacteria | 3354 |
| 964 | nmdc:mga0rr50_635422_c1 | 3300050513 | Bacteria | 911 |
| 965 | nmdc:mga08x19_661623_c1 | 3300050514 | Bacteria | 741 |
| 966 | nmdc:mga08x19_9687_c1 | 3300050514 | Bacteria | 5768 |
| 967 | nmdc:mga0a205_130345_c1 | 3300050515 | Bacteria | 2415 |
| 968 | nmdc:mga0a205_35285_c1 | 3300050515 | Bacteria | 4802 |
| 969 | nmdc:mga0a205_615979_c1 | 3300050515 | Bacteria | 938 |
| 970 | nmdc:mga0a205_85268_c1 | 3300050515 | Bacteria | 3051 |
| 971 | Ga0495601_0000390 | 3300053077 | Bacteria | 23265 |
| 972 | Ga0495601_0001759 | 3300053077 | Bacteria | 11994 |
| 973 | Ga0495601_0030181 | 3300053077 | Bacteria | 3365 |
| 974 | Ga0495601_0162919 | 3300053077 | Bacteria | 1457 |
| 975 | Ga0495601_0247728 | 3300053077 | Unclassified | 1163 |
| 976 | Ga0495612_0001906 | 3300053078 | Bacteria | 8581 |
| 977 | Ga0495612_0016196 | 3300053078 | Bacteria | 2987 |
| 978 | Ga0495595_0011388 | 3300053084 | Bacteria | 3717 |
| 979 | Ga0495595_0024017 | 3300053084 | Bacteria | 2689 |
| 980 | Ga0495595_0028065 | 3300053084 | Bacteria | 2512 |
| 981 | Ga0495595_0127114 | 3300053084 | Bacteria | 1244 |
| 982 | Ga0495595_0263214 | 3300053084 | Bacteria | 864 |
| 983 | Ga0495595_0335714 | 3300053084 | Unclassified | 762 |
| 984 | Ga0495619_0004098 | 3300053085 | Bacteria | 9329 |
| 985 | Ga0495619_0038421 | 3300053085 | Bacteria | 3123 |
| 986 | Ga0495619_0111793 | 3300053085 | Bacteria | 1867 |
| 987 | Ga0495619_0139034 | 3300053085 | Bacteria | 1672 |
| 988 | Ga0501084_0004616 | 3300054114 | Bacteria | 11251 |
| 989 | Ga0501084_0027772 | 3300054114 | Bacteria | 4729 |
| 990 | Ga0501084_0095950 | 3300054114 | Bacteria | 2490 |
| 991 | Ga0501084_0125126 | 3300054114 | Bacteria | 2163 |
| 992 | Ga0501084_0146704 | 3300054114 | Bacteria | 1987 |
| 993 | Ga0501084_0153509 | 3300054114 | Bacteria | 1941 |
| 994 | Ga0501084_0736170 | 3300054114 | Bacteria | 831 |
| 995 | Ga0501082_0006621 | 3300060353 | Bacteria | 10026 |
| 996 | Ga0501082_0016686 | 3300060353 | Bacteria | 6324 |
| 997 | Ga0501082_0024304 | 3300060353 | Bacteria | 5223 |
| 998 | Ga0501082_0026950 | 3300060353 | Bacteria | 4951 |
| 999 | Ga0501082_0086289 | 3300060353 | Bacteria | 2707 |
| 1000 | Ga0530510_0017996 | 3300061734 | Bacteria | 5008 |
| 1001 | Ga0530510_0117033 | 3300061734 | Bacteria | 1954 |
| 1002 | Ga0530510_0118013 | 3300061734 | Bacteria | 1946 |
| 1003 | Ga0530510_0259018 | 3300061734 | Bacteria | 1297 |
| 1004 | Ga0530510_0578857 | 3300061734 | Unclassified | 853 |
| 1005 | Ga0530510_0614558 | 3300061734 | Bacteria | 827 |
| 1006 | 2870789797 | 2870782633 | Bacteria | 9624083 |
| 1007 | Ga0495628_0194673 | |||
| 1008 | Ga0070676_10170312 | |||
| 1009 | Ga0070676_10274992 | |||
| 1010 | Ga0070683_100010526 | |||
| 1011 | Ga0070683_100030721 | |||
| 1012 | Ga0070683_100093732 | |||
| 1013 | Ga0070683_100108788 | |||
| 1014 | Ga0070683_100673014 | |||
| 1015 | Ga0070690_100058141 | |||
| 1016 | Ga0070690_100675360 | |||
| 1017 | Ga0070670_100004558 | |||
| 1018 | Ga0070670_100445513 | |||
| 1019 | Ga0070670_100506941 | |||
| 1020 | Ga0070677_10117878 | |||
| 1021 | Ga0068869_100134891 | |||
| 1022 | Ga0068869_100266316 | |||
| 1023 | Ga0070666_10261571 | |||
| 1024 | Ga0070680_100046414 | |||
| 1025 | Ga0070680_100058836 | |||
| 1026 | Ga0070680_100089834 | |||
| 1027 | Ga0070682_100027742 | |||
| 1028 | Ga0070682_100080855 | |||
| 1029 | Ga0070682_100209756 | |||
| 1030 | Ga0068868_100007316 | |||
| 1031 | Ga0068868_100021354 | |||
| 1032 | Ga0068868_100339510 | |||
| 1033 | Ga0068868_100350397 | |||
| 1034 | Ga0070660_100010010 | |||
| 1035 | Ga0070660_100127818 | |||
| 1036 | Ga0070660_100197194 | |||
| 1037 | Ga0070689_100040095 | |||
| 1038 | Ga0070691_10013064 | |||
| 1039 | Ga0070691_10063264 | |||
| 1040 | Ga0070687_100098299 | |||
| 1041 | Ga0070687_100251789 | |||
| 1042 | Ga0070687_100281023 | |||
| 1043 | Ga0070661_100005618 | |||
| 1044 | Ga0070661_100172986 | |||
| 1045 | Ga0070692_10018623 | |||
| 1046 | Ga0070692_10022668 | |||
| 1047 | Ga0070692_10043384 | |||
| 1048 | Ga0070692_10055417 | |||
| 1049 | Ga0070668_100052295 | |||
| 1050 | Ga0070669_100303530 | |||
| 1051 | Ga0070669_100360689 | |||
| 1052 | Ga0070675_100008298 | |||
| 1053 | Ga0070675_100020892 | |||
| 1054 | Ga0070675_100064048 | |||
| 1055 | Ga0070671_100099507 | |||
| 1056 | Ga0070671_100235294 | |||
| 1057 | Ga0070674_100004873 | |||
| 1058 | Ga0070674_100032821 | |||
| 1059 | Ga0070673_100015557 | |||
| 1060 | Ga0070673_100101873 | |||
| 1061 | Ga0070673_100198516 | |||
| 1062 | Ga0070688_100001368 | |||
| 1063 | Ga0070659_100021773 | |||
| 1064 | Ga0070659_100104689 | |||
| 1065 | Ga0070659_100297361 | |||
| 1066 | Ga0070709_10102125 | |||
| 1067 | Ga0070709_10106861 | |||
| 1068 | Ga0070709_10139929 | |||
| 1069 | Ga0070709_10384252 | |||
| 1070 | Ga0070714_100006361 | |||
| 1071 | Ga0070714_100027611 | |||
| 1072 | Ga0070714_100439123 | |||
| 1073 | Ga0070713_100046229 | |||
| 1074 | Ga0070713_100163717 | |||
| 1075 | Ga0070710_10024620 | |||
| 1076 | Ga0070710_10055042 | |||
| 1077 | Ga0070710_10365305 | |||
| 1078 | Ga0070701_10074375 | |||
| 1079 | Ga0070701_10322995 | |||
| 1080 | Ga0070701_10374607 | |||
| 1081 | Ga0070711_100031456 | |||
| 1082 | Ga0070711_100151483 | |||
| 1083 | Ga0070705_100016331 | |||
| 1084 | Ga0070705_100126314 | |||
| 1085 | Ga0070705_100166789 | |||
| 1086 | Ga0070700_100258893 | |||
| 1087 | Ga0070694_100129494 | |||
| 1088 | Ga0070694_100312771 | |||
| 1089 | Ga0070694_100315843 | |||
| 1090 | Ga0070708_100111799 | |||
| 1091 | Ga0070663_100463186 | |||
| 1092 | Ga0070678_100047065 | |||
| 1093 | Ga0070678_100120198 | |||
| 1094 | Ga0070662_100025843 | |||
| 1095 | Ga0070662_100047877 | |||
| 1096 | Ga0070662_100049741 | |||
| 1097 | Ga0070681_10010646 | |||
| 1098 | Ga0070681_10072510 | |||
| 1099 | Ga0070681_10109385 | |||
| 1100 | Ga0070681_10111208 | |||
| 1101 | Ga0070681_10157304 | |||
| 1102 | Ga0070681_10525567 | |||
| 1103 | Ga0068867_100125736 | |||
| 1104 | Ga0068867_100368487 | |||
| 1105 | Ga0068867_100600759 | |||
| 1106 | Ga0070685_10079141 | |||
| 1107 | Ga0070706_100079668 | |||
| 1108 | Ga0070706_100417551 | |||
| 1109 | Ga0070707_100045152 | |||
| 1110 | Ga0070707_100576395 | |||
| 1111 | Ga0070698_100003809 | |||
| 1112 | Ga0070698_100093669 | |||
| 1113 | Ga0070698_100165592 | |||
| 1114 | Ga0070699_100018076 | |||
| 1115 | Ga0070699_100129624 | |||
| 1116 | Ga0070699_100346905 | |||
| 1117 | Ga0070679_100019573 | |||
| 1118 | Ga0070679_100079277 | |||
| 1119 | Ga0070684_100032413 | |||
| 1120 | Ga0070684_100054320 | |||
| 1121 | Ga0070684_100058008 | |||
| 1122 | Ga0070684_100064221 | |||
| 1123 | Ga0070684_100108152 | |||
| 1124 | Ga0070684_100146967 | |||
| 1125 | Ga0070684_100150315 | |||
| 1126 | Ga0070684_100363746 | |||
| 1127 | Ga0070697_100449917 | |||
| 1128 | Ga0068853_100238839 | |||
| 1129 | Ga0068853_100462979 | |||
| 1130 | Ga0070672_100052860 | |||
| 1131 | Ga0070672_100133499 | |||
| 1132 | Ga0070686_100036145 | |||
| 1133 | Ga0070686_100096566 | |||
| 1134 | Ga0070686_100270999 | |||
| 1135 | Ga0070695_100037784 | |||
| 1136 | Ga0070696_100102904 | |||
| 1137 | Ga0070696_100104935 | |||
| 1138 | Ga0070696_100140374 | |||
| 1139 | Ga0070696_100221629 | |||
| 1140 | Ga0070696_100281641 | |||
| 1141 | Ga0070696_100298038 | |||
| 1142 | Ga0070693_100020916 | |||
| 1143 | Ga0070693_100042085 | |||
| 1144 | Ga0070693_100055327 | |||
| 1145 | Ga0070665_100005986 | |||
| 1146 | Ga0070665_100517631 | |||
| 1147 | Ga0070704_100054906 | |||
| 1148 | Ga0070704_100456241 | |||
| 1149 | Ga0070704_100687007 | |||
| 1150 | Ga0068855_100042188 | |||
| 1151 | Ga0068855_100060313 | |||
| 1152 | Ga0068855_100060464 | |||
| 1153 | Ga0068855_100180637 | |||
| 1154 | Ga0068855_100218143 | |||
| 1155 | Ga0070664_100015002 | |||
| 1156 | Ga0070664_100018297 | |||
| 1157 | Ga0070664_100098010 | |||
| 1158 | Ga0070664_100186476 | |||
| 1159 | Ga0070664_100249567 | |||
| 1160 | Ga0068857_100080037 | |||
| 1161 | Ga0068857_100237502 | |||
| 1162 | Ga0068857_100608227 | |||
| 1163 | Ga0068854_100069129 | |||
| 1164 | Ga0068856_100013325 | |||
| 1165 | Ga0068856_100043524 | |||
| 1166 | Ga0068856_100094581 | |||
| 1167 | Ga0068856_100228427 | |||
| 1168 | Ga0068856_100265400 | |||
| 1169 | Ga0068856_100274019 | |||
| 1170 | Ga0070702_100040560 | |||
| 1171 | Ga0070702_100122272 | |||
| 1172 | Ga0070702_100162239 | |||
| 1173 | Ga0068852_100032201 | |||
| 1174 | Ga0068852_100057505 | |||
| 1175 | Ga0068852_100194564 | |||
| 1176 | Ga0068859_100048871 | |||
| 1177 | Ga0068864_100015513 | |||
| 1178 | Ga0068864_100151816 | |||
| 1179 | Ga0068866_10361364 | |||
| 1180 | Ga0068861_100024868 | |||
| 1181 | Ga0068861_100216134 | |||
| 1182 | Ga0068861_100407148 | |||
| 1183 | Ga0068863_100331038 | |||
| 1184 | Ga0068863_100426302 | |||
| 1185 | Ga0068863_100431081 | |||
| 1186 | Ga0068860_100243658 | |||
| 1187 | Ga0081455_10027092 | |||
| 1188 | Ga0081455_10046689 | |||
| 1189 | Ga0081455_10090237 | |||
| 1190 | Ga0081538_10000076 | |||
| 1191 | Ga0081538_10000300 | |||
| 1192 | Ga0081538_10026055 | |||
| 1193 | Ga0081538_10048346 | |||
| 1194 | Ga0081538_10051989 | |||
| 1195 | Ga0081540_1003715 | |||
| 1196 | Ga0081540_1005515 | |||
| 1197 | Ga0081540_1063637 | |||
| 1198 | Ga0070717_10011361 | |||
| 1199 | Ga0070717_10094777 | |||
| 1200 | Ga0075365_10066531 | |||
| 1201 | Ga0075364_10086130 | |||
| 1202 | Ga0070716_100292805 | |||
| 1203 | Ga0070712_100008629 | |||
| 1204 | Ga0070712_100083956 | |||
| 1205 | Ga0075367_10017839 | |||
| 1206 | Ga0097621_100485250 | |||
| 1207 | Ga0068871_100053405 | |||
| 1208 | Ga0068871_100629787 | |||
| 1209 | Ga0075428_100136001 | |||
| 1210 | Ga0075430_100082750 | |||
| 1211 | Ga0075431_100296531 | |||
| 1212 | Ga0075431_100576961 | |||
| 1213 | Ga0075431_100960151 | |||
| 1214 | Ga0075433_10140395 | |||
| 1215 | Ga0075433_10142622 | |||
| 1216 | Ga0075433_10440588 | |||
| 1217 | Ga0075434_100025155 | |||
| 1218 | Ga0075434_100026803 | |||
| 1219 | Ga0075434_100186900 | |||
| 1220 | Ga0075434_100858593 | |||
| 1221 | Ga0068865_100124461 | |||
| 1222 | Ga0075436_100093264 | |||
| 1223 | Ga0097620_100048873 | |||
| 1224 | Ga0075435_100018197 | |||
| 1225 | Ga0075435_100080322 | |||
| 1226 | Ga0105244_10064564 | |||
| 1227 | Ga0105240_10519878 | |||
| 1228 | Ga0111539_10056105 | |||
| 1229 | Ga0111539_10072315 | |||
| 1230 | Ga0111539_10132468 | |||
| 1231 | Ga0111539_10155021 | |||
| 1232 | Ga0111539_10158252 | |||
| 1233 | Ga0111539_10160340 | |||
| 1234 | Ga0111539_10250665 | |||
| 1235 | Ga0111539_11136095 | |||
| 1236 | Ga0105245_10005762 | |||
| 1237 | Ga0105245_10068041 | |||
| 1238 | Ga0105245_10073128 | |||
| 1239 | Ga0105245_10102412 | |||
| 1240 | Ga0105245_10108727 | |||
| 1241 | Ga0105245_10167952 | |||
| 1242 | Ga0105245_10224154 | |||
| 1243 | Ga0105247_10041847 | |||
| 1244 | Ga0114129_10024803 | |||
| 1245 | Ga0114129_10141735 | |||
| 1246 | Ga0114129_10157542 | |||
| 1247 | Ga0114129_10327665 | |||
| 1248 | Ga0114129_10696914 | |||
| 1249 | Ga0114129_11054611 | |||
| 1250 | Ga0114129_11254601 | |||
| 1251 | Ga0105243_10004817 | |||
| 1252 | Ga0105243_10131101 | |||
| 1253 | Ga0105243_10234139 | |||
| 1254 | Ga0105241_10074465 | |||
| 1255 | Ga0105242_10020716 | |||
| 1256 | Ga0105242_10043812 | |||
| 1257 | Ga0105242_10066830 | |||
| 1258 | Ga0105242_10519592 | |||
| 1259 | Ga0105242_10578191 | |||
| 1260 | Ga0105248_10034523 | |||
| 1261 | Ga0105248_10679717 | |||
| 1262 | Ga0105237_10214426 | |||
| 1263 | Ga0105237_10772343 | |||
| 1264 | Ga0105238_10107501 | |||
| 1265 | Ga0105238_10166990 | |||
| 1266 | Ga0105249_10005728 | |||
| 1267 | Ga0105249_10382062 | |||
| 1268 | Ga0105239_10011273 | |||
| 1269 | Ga0105239_10040782 | |||
| 1270 | Ga0105239_10055777 | |||
| 1271 | Ga0105239_10118833 | |||
| 1272 | Ga0105239_10142102 | |||
| 1273 | Ga0105246_10018147 | |||
| 1274 | Ga0105246_10509397 | |||
| 1275 | Ga0157314_1011093 | |||
| 1276 | Ga0157373_10076066 | |||
| 1277 | Ga0157371_10014451 | |||
| 1278 | Ga0157371_10407839 | |||
| 1279 | Ga0157371_10414982 | |||
| 1280 | Ga0157370_10147976 | |||
| 1281 | Ga0157369_10011625 | |||
| 1282 | Ga0157369_10057246 | |||
| 1283 | Ga0157369_10527492 | |||
| 1284 | Ga0157374_10093309 | |||
| 1285 | Ga0157378_10096674 | |||
| 1286 | Ga0163162_10186609 | |||
| 1287 | Ga0163162_10267808 | |||
| 1288 | Ga0163162_10590259 | |||
| 1289 | Ga0157372_10132768 | |||
| 1290 | Ga0157372_10399051 | |||
| 1291 | Ga0157372_10479918 | |||
| 1292 | Ga0157372_10756652 | |||
| 1293 | Ga0157372_10853533 | |||
| 1294 | Ga0157375_10033349 | |||
| 1295 | Ga0157375_10090847 | |||
| 1296 | Ga0157375_10308447 | |||
| 1297 | Ga0157375_10651570 | |||
| 1298 | Ga0157380_10177687 | |||
| 1299 | Ga0157380_10374611 | |||
| 1300 | Ga0182008_10123316 | |||
| 1301 | Ga0157377_10003642 | |||
| 1302 | Ga0157377_10008029 | |||
| 1303 | Ga0157377_10010514 | |||
| 1304 | Ga0157377_10404594 | |||
| 1305 | Ga0157379_10018230 | |||
| 1306 | Ga0157376_10214912 | |||
| 1307 | Ga0163161_10116736 | |||
| 1308 | Ga0163161_10125777 | |||
| 1309 | Ga0213871_10010655 | |||
| 1310 | Ga0207656_10094560 | |||
| 1311 | Ga0207692_10012888 | |||
| 1312 | Ga0207642_10048351 | |||
| 1313 | Ga0207642_10283007 | |||
| 1314 | Ga0207710_10044172 | |||
| 1315 | Ga0207688_10003730 | |||
| 1316 | Ga0207688_10017875 | |||
| 1317 | Ga0207688_10033778 | |||
| 1318 | Ga0207647_10082493 | |||
| 1319 | Ga0207685_10091519 | |||
| 1320 | Ga0207699_10083295 | |||
| 1321 | Ga0207699_10305052 | |||
| 1322 | Ga0207699_10435918 | |||
| 1323 | Ga0207645_10068502 | |||
| 1324 | Ga0207645_10148234 | |||
| 1325 | Ga0207643_10012440 | |||
| 1326 | Ga0207684_10115414 | |||
| 1327 | Ga0207707_10063261 | |||
| 1328 | Ga0207707_10180597 | |||
| 1329 | Ga0207707_10575366 | |||
| 1330 | Ga0207707_10599383 | |||
| 1331 | Ga0207695_10550267 | |||
| 1332 | Ga0207671_10328029 | |||
| 1333 | Ga0207693_10000576 | |||
| 1334 | Ga0207693_10008025 | |||
| 1335 | Ga0207693_10053620 | |||
| 1336 | Ga0207693_10133673 | |||
| 1337 | Ga0207663_10003164 | |||
| 1338 | Ga0207663_10099633 | |||
| 1339 | Ga0207660_10116957 | |||
| 1340 | Ga0207662_10047174 | |||
| 1341 | Ga0207662_10231916 | |||
| 1342 | Ga0207657_10004578 | |||
| 1343 | Ga0207657_10023123 | |||
| 1344 | Ga0207657_10071551 | |||
| 1345 | Ga0207657_10122606 | |||
| 1346 | Ga0207652_10016442 | |||
| 1347 | Ga0207652_10138059 | |||
| 1348 | Ga0207652_10176264 | |||
| 1349 | Ga0207652_10856779 | |||
| 1350 | Ga0207646_10001540 | |||
| 1351 | Ga0207646_10012924 | |||
| 1352 | Ga0207646_10276679 | |||
| 1353 | Ga0207681_10187593 | |||
| 1354 | Ga0207681_10411870 | |||
| 1355 | Ga0207681_10459448 | |||
| 1356 | Ga0207694_10075943 | |||
| 1357 | Ga0207650_10393815 | |||
| 1358 | Ga0207659_10293672 | |||
| 1359 | Ga0207659_10555281 | |||
| 1360 | Ga0207687_10010823 | |||
| 1361 | Ga0207687_10020460 | |||
| 1362 | Ga0207687_10034840 | |||
| 1363 | Ga0207687_10064593 | |||
| 1364 | Ga0207687_10105718 | |||
| 1365 | Ga0207687_10367497 | |||
| 1366 | Ga0207700_10126602 | |||
| 1367 | Ga0207700_10127263 | |||
| 1368 | Ga0207700_10177384 | |||
| 1369 | Ga0207664_10014478 | |||
| 1370 | Ga0207664_10030449 | |||
| 1371 | Ga0207644_10073448 | |||
| 1372 | Ga0207644_10285008 | |||
| 1373 | Ga0207690_10128471 | |||
| 1374 | Ga0207706_10004721 | |||
| 1375 | Ga0207706_10013517 | |||
| 1376 | Ga0207706_10060822 | |||
| 1377 | Ga0207706_10061263 | |||
| 1378 | Ga0207686_10247532 | |||
| 1379 | Ga0207686_10534999 | |||
| 1380 | Ga0207709_10011368 | |||
| 1381 | Ga0207709_10664862 | |||
| 1382 | Ga0207669_10011806 | |||
| 1383 | Ga0207669_10241208 | |||
| 1384 | Ga0207669_10497768 | |||
| 1385 | Ga0207669_10573348 | |||
| 1386 | Ga0207665_10009724 | |||
| 1387 | Ga0207665_10065530 | |||
| 1388 | Ga0207665_10398255 | |||
| 1389 | Ga0207691_10045494 | |||
| 1390 | Ga0207691_10060473 | |||
| 1391 | Ga0207691_10751816 | |||
| 1392 | Ga0207711_10640946 | |||
| 1393 | Ga0207711_10774224 | |||
| 1394 | Ga0207689_10034038 | |||
| 1395 | Ga0207689_10154754 | |||
| 1396 | Ga0207661_10000830 | |||
| 1397 | Ga0207661_10016847 | |||
| 1398 | Ga0207661_10023423 | |||
| 1399 | Ga0207661_10029103 | |||
| 1400 | Ga0207661_10049324 | |||
| 1401 | Ga0207661_10082592 | |||
| 1402 | Ga0207661_10578391 | |||
| 1403 | Ga0207661_10822703 | |||
| 1404 | Ga0207679_10096985 | |||
| 1405 | Ga0207679_10247459 | |||
| 1406 | Ga0207679_10276545 | |||
| 1407 | Ga0207679_10625353 | |||
| 1408 | Ga0207667_10040231 | |||
| 1409 | Ga0207667_10125515 | |||
| 1410 | Ga0207651_10401240 | |||
| 1411 | Ga0207712_10053891 | |||
| 1412 | Ga0207668_10101542 | |||
| 1413 | Ga0207640_10031394 | |||
| 1414 | Ga0207640_10068885 | |||
| 1415 | Ga0207640_10395191 | |||
| 1416 | Ga0207658_10071913 | |||
| 1417 | Ga0207677_10095392 | |||
| 1418 | Ga0207677_10167403 | |||
| 1419 | Ga0207703_10382441 | |||
| 1420 | Ga0207639_10042771 | |||
| 1421 | Ga0207678_10064647 | |||
| 1422 | Ga0207678_10078022 | |||
| 1423 | Ga0207678_10112999 | |||
| 1424 | Ga0207708_10001284 | |||
| 1425 | Ga0207708_10029296 | |||
| 1426 | Ga0207708_10081901 | |||
| 1427 | Ga0207708_10098610 | |||
| 1428 | Ga0207702_10032325 | |||
| 1429 | Ga0207702_10056494 | |||
| 1430 | Ga0207702_10110418 | |||
| 1431 | Ga0207702_10417827 | |||
| 1432 | Ga0207702_10540710 | |||
| 1433 | Ga0207641_10117834 | |||
| 1434 | Ga0207641_10300625 | |||
| 1435 | Ga0207648_10008265 | |||
| 1436 | Ga0207648_10175589 | |||
| 1437 | Ga0207676_10130276 | |||
| 1438 | Ga0207676_10143690 | |||
| 1439 | Ga0207676_10666462 | |||
| 1440 | Ga0207674_10055272 | |||
| 1441 | Ga0207674_10098354 | |||
| 1442 | Ga0207674_10247760 | |||
| 1443 | Ga0207675_100000792 | |||
| 1444 | Ga0207675_100007683 | |||
| 1445 | Ga0207675_100052001 | |||
| 1446 | Ga0207683_10000898 | |||
| 1447 | Ga0207683_10063501 | |||
| 1448 | Ga0207683_10263121 | |||
| 1449 | Ga0207683_10349106 | |||
| 1450 | Ga0207698_10343875 | |||
| 1451 | Ga0207698_10615290 | |||
| 1452 | Ga0207428_10013003 | |||
| 1453 | Ga0207428_10402711 | |||
| 1454 | Ga0268266_10548620 | |||
| 1455 | Ga0268265_10237570 | |||
| 1456 | Ga0265338_10004598 | |||
| 1457 | Ga0265338_10006450 | |||
| 1458 | Ga0265338_10011093 | |||
| 1459 | Ga0265338_10029240 | |||
| 1460 | Ga0265320_10023981 | |||
| 1461 | Ga0265339_10028524 | |||
| 1462 | Ga0265327_10044202 | |||
| 1463 | Ga0265327_10201583 | |||
| 1464 | Ga0265316_10053799 | |||
| 1465 | Ga0265314_10020439 | |||
| 1466 | Ga0307410_10083699 | |||
| 1467 | Ga0307412_10243138 | |||
| 1468 | Ga0307409_100079707 | |||
| 1469 | Ga0373930_0041076 | |||
| 1470 | Ga0373948_0017891 | |||
| 1471 | Ga0373959_0006484 | |||
| 1472 | Ga0373944_0028793 | |||
| 1473 | Ga0373944_0065560 | |||
| 1474 | Ga0373952_0015088 | |||
| 1475 | Ga0373932_0008243 | |||
| 1476 | Ga0373936_0038087 | |||
| 1477 | Ga0373939_0037580 | |||
| 1478 | Ga0373941_0043517 | |||
| 1479 | Ga0373945_0015864 | |||
| 1480 | Ga0373943_0006250 | |||
| 1481 | Ga0373943_0011455 | |||
| 1482 | Ga0373943_0021180 | |||
| 1483 | Ga0373946_0019592 | |||
| 1484 | Ga0373946_0180973 | |||
| 1485 | Ga0373961_0009301 | |||
| 1486 | Ga0373961_0051566 | |||
| 1487 | Ga0373962_0056646 | |||
| 1488 | Ga0373931_0419401 | |||
| 1489 | Ga0373935_0003142 | |||
| 1490 | Ga0373935_0098036 | |||
| 1491 | Ga0373935_0143669 | |||
| 1492 | Ga0373927_0044249 | |||
| 1493 | Ga0373927_0139482 | |||
| 1494 | Ga0373947_0005913 | |||
| 1495 | Ga0373947_0035992 | |||
| 1496 | Ga0373947_0071012 | |||
| 1497 | Ga0373947_0134731 | |||
| 1498 | Ga0373947_0498335 | |||
| 1499 | Ga0373937_0064158 | |||
| 1500 | Ga0373937_0104136 | |||
| 1501 | Ga0373925_0002557 | |||
| 1502 | Ga0373925_0103583 | |||
| 1503 | Ga0373925_0176254 | |||
| 1504 | Ga0395899_0003978 | |||
| 1505 | Ga0395899_0004636 | |||
| 1506 | Ga0395899_0005711 | |||
| 1507 | Ga0395899_0005949 | |||
| 1508 | Ga0395899_0043736 | |||
| 1509 | Ga0395899_0062943 | |||
| 1510 | Ga0395899_0162380 | |||
| 1511 | Ga0395900_0001538 | |||
| 1512 | Ga0395900_0002131 | |||
| 1513 | Ga0395900_0017645 | |||
| 1514 | Ga0395900_0032901 | |||
| 1515 | Ga0395900_0039455 | |||
| 1516 | Ga0395900_0074450 | |||
| 1517 | Ga0395900_0106737 | |||
| 1518 | Ga0395900_0155628 | |||
| 1519 | Ga0395900_0295472 | |||
| 1520 | Ga0395900_0726084 | |||
| 1521 | Ga0395898_0001713 | |||
| 1522 | Ga0395898_0006214 | |||
| 1523 | Ga0395898_0007822 | |||
| 1524 | Ga0395898_0013668 | |||
| 1525 | Ga0395898_0019994 | |||
| 1526 | Ga0395898_0022082 | |||
| 1527 | Ga0395898_0042127 | |||
| 1528 | Ga0395898_0068826 | |||
| 1529 | Ga0395898_0123763 | |||
| 1530 | Ga0395898_0139205 | |||
| 1531 | Ga0395898_0139418 | |||
| 1532 | Ga0395898_0217029 | |||
| 1533 | Ga0395898_0679637 | |||
| 1534 | Ga0395905_0000568 | |||
| 1535 | Ga0395905_0003732 | |||
| 1536 | Ga0395905_0016012 | |||
| 1537 | Ga0395905_0018371 | |||
| 1538 | Ga0395905_0135514 | |||
| 1539 | Ga0395905_0194296 | |||
| 1540 | Ga0395905_0500715 | |||
| 1541 | Ga0395901_0009430 | |||
| 1542 | Ga0395901_0017370 | |||
| 1543 | Ga0395901_0018641 | |||
| 1544 | Ga0395901_0020467 | |||
| 1545 | Ga0395901_0026136 | |||
| 1546 | Ga0395901_0069980 | |||
| 1547 | Ga0395901_0076085 | |||
| 1548 | Ga0395901_0085143 | |||
| 1549 | Ga0395901_0213821 | |||
| 1550 | Ga0395901_0264320 | |||
| 1551 | Ga0395901_0339255 | |||
| 1552 | Ga0436360_0031091 | |||
| 1553 | Ga0436360_1357140 | |||
| 1554 | Ga0451833_0356990 | |||
| 1555 | Ga0451853_0568896 | |||
| 1556 | Ga0439448_0024436 | |||
| 1557 | Ga0439448_0106799 | |||
| 1558 | Ga0450916_003096 | |||
| 1559 | Ga0466965_0050569 | |||
| 1560 | Ga0466965_0063514 | |||
| 1561 | Ga0466961_0105175 | |||
| 1562 | Ga0466963_0000078 | |||
| 1563 | Ga0466963_0011463 | |||
| 1564 | Ga0466963_0016740 | |||
| 1565 | Ga0466963_0021180 | |||
| 1566 | Ga0466963_0028613 | |||
| 1567 | Ga0466963_0041189 | |||
| 1568 | Ga0466963_0041747 | |||
| 1569 | Ga0466964_0002212 | |||
| 1570 | Ga0466964_0006461 | |||
| 1571 | Ga0466964_0014756 | |||
| 1572 | Ga0466964_0025021 | |||
| 1573 | Ga0466971_0031655 | |||
| 1574 | Ga0466968_0001161 | |||
| 1575 | Ga0466968_0019006 | |||
| 1576 | Ga0466968_0038202 | |||
| 1577 | Ga0466970_0005539 | |||
| 1578 | Ga0466957_0017365 | |||
| 1579 | Ga0466957_0018612 | |||
| 1580 | Ga0466957_0024965 | |||
| 1581 | Ga0466960_0004248 | |||
| 1582 | Ga0466959_0003883 | |||
| 1583 | Ga0451576_0042487 | |||
| 1584 | Ga0466958_0005370 | |||
| 1585 | Ga0466958_0021049 | |||
| 1586 | Ga0466958_0035475 | |||
| 1587 | Ga0466958_0047614 | |||
| 1588 | Ga0466967_0001286 | |||
| 1589 | Ga0466967_0015711 | |||
| 1590 | Ga0466967_0017616 | |||
| 1591 | Ga0466967_0058874 | |||
| 1592 | Ga0466967_0085623 | |||
| 1593 | Ga0466967_0172295 | |||
| 1594 | Ga0466967_0226828 | |||
| 1595 | Ga0466967_0357259 | |||
| 1596 | Ga0466967_0454653 | |||
| 1597 | Ga0466967_0494239 | |||
| 1598 | Ga0466967_0589405 | |||
| 1599 | Ga0495617_082333 | |||
| 1600 | Ga0495592_0001100 | |||
| 1601 | Ga0495592_0150679 | |||
| 1602 | Ga0495603_0001085 | |||
| 1603 | Ga0495603_0021259 | |||
| 1604 | Ga0495603_0235373 | |||
| 1605 | Ga0495629_0031019 | |||
| 1606 | Ga0495629_0096666 | |||
| 1607 | Ga0495629_0117051 | |||
| 1608 | Ga0495641_0006376 | |||
| 1609 | Ga0495641_0007577 | |||
| 1610 | Ga0495641_0015690 | |||
| 1611 | Ga0495641_0065788 | |||
| 1612 | Ga0495641_0171947 | |||
| 1613 | Ga0495641_0251006 | |||
| 1614 | Ga0495651_0000008 | |||
| 1615 | Ga0495651_0367769 | |||
| 1616 | Ga0495653_0000897 | |||
| 1617 | Ga0495653_0020261 | |||
| 1618 | Ga0495653_0253515 | |||
| 1619 | Ga0495580_0006136 | |||
| 1620 | Ga0495582_0009374 | |||
| 1621 | Ga0495582_0024199 | |||
| 1622 | Ga0495582_0055400 | |||
| 1623 | Ga0495582_0057706 | |||
| 1624 | Ga0495582_0112155 | |||
| 1625 | Ga0495582_0122001 | |||
| 1626 | Ga0495605_0067662 | |||
| 1627 | Ga0495605_0080990 | |||
| 1628 | Ga0495605_0088248 | |||
| 1629 | Ga0495605_0098368 | |||
| 1630 | Ga0495639_0000501 | |||
| 1631 | Ga0495639_0221951 | |||
| 1632 | Ga0495662_0001886 | |||
| 1633 | Ga0495664_0002065 | |||
| 1634 | Ga0495664_0128889 | |||
| 1635 | Ga0495664_0190698 | |||
| 1636 | Ga0495664_0323347 | |||
| 1637 | Ga0495584_0066994 | |||
| 1638 | Ga0495584_0214495 | |||
| 1639 | Ga0495594_0062163 | |||
| 1640 | Ga0495608_0002739 | |||
| 1641 | Ga0495608_0034644 | |||
| 1642 | Ga0495608_0125010 | |||
| 1643 | Ga0495618_0005615 | |||
| 1644 | Ga0495618_0034614 | |||
| 1645 | Ga0495618_0088301 | |||
| 1646 | Ga0495618_0131883 | |||
| 1647 | Ga0495618_0178829 | |||
| 1648 | Ga0495628_0000016 | |||
| 1649 | Ga0495628_0059003 | |||
| 1650 | Ga0495628_0134071 | |||
| 1651 | Ga0495628_0138982 | |||
| 1652 | Ga0495630_0002033 | |||
| 1653 | Ga0495630_0024442 | |||
| 1654 | Ga0495630_0300069 | |||
| 1655 | Ga0495644_0008508 | |||
| 1656 | Ga0495663_0015359 | |||
| 1657 | Ga0495663_0151074 | |||
| 1658 | Ga0495642_0067778 | |||
| 1659 | Ga0495652_0000045 | |||
| 1660 | Ga0495652_0042153 | |||
| 1661 | Ga0495652_0053980 | |||
| 1662 | Ga0495652_0094719 | |||
| 1663 | Ga0495652_0103526 | |||
| 1664 | Ga0495652_0117373 | |||
| 1665 | Ga0495665_0001055 | |||
| 1666 | Ga0495665_0041667 | |||
| 1667 | Ga0495665_0092438 | |||
| 1668 | Ga0495640_0013846 | |||
| 1669 | Ga0495586_0003415 | |||
| 1670 | Ga0495586_0167880 | |||
| 1671 | Ga0495587_0000275 | |||
| 1672 | Ga0495609_0047591 | |||
| 1673 | Ga0495645_0000068 | |||
| 1674 | Ga0495645_0039361 | |||
| 1675 | Ga0495633_0167924 | |||
| 1676 | Ga0495667_0135084 | |||
| 1677 | Ga0495667_0194273 | |||
| 1678 | Ga0495667_0281579 | |||
| 1679 | Ga0495667_0290741 | |||
| 1680 | Ga0495656_0013736 | |||
| 1681 | Ga0495634_0008960 | |||
| 1682 | Ga0495634_0025336 | |||
| 1683 | Ga0495634_0084281 | |||
| 1684 | Ga0495635_0011230 | |||
| 1685 | Ga0495635_0072700 | |||
| 1686 | Ga0495635_0321520 | |||
| 1687 | Ga0495588_0023673 | |||
| 1688 | Ga0495657_0034070 | |||
| 1689 | Ga0495657_0065711 | |||
| 1690 | Ga0495657_0160855 | |||
| 1691 | Ga0495599_0187364 | |||
| 1692 | Ga0495623_0000418 | |||
| 1693 | Ga0495623_0026350 | |||
| 1694 | Ga0495646_0042520 | |||
| 1695 | Ga0495647_0000727 | |||
| 1696 | Ga0495647_0030306 | |||
| 1697 | Ga0495658_0000785 | |||
| 1698 | Ga0495658_0046801 | |||
| 1699 | Ga0495658_0183985 | |||
| 1700 | Ga0495613_0026907 | |||
| 1701 | Ga0495613_0087313 | |||
| 1702 | Ga0495613_0111817 | |||
| 1703 | Ga0495613_0116148 | |||
| 1704 | Ga0495613_0433742 | |||
| 1705 | Ga0495624_0008642 | |||
| 1706 | Ga0495624_0027399 | |||
| 1707 | Ga0495624_0364988 | |||
| 1708 | Ga0495600_0076415 | |||
| 1709 | Ga0495660_0048675 | |||
| 1710 | Ga0495581_0005357 | |||
| 1711 | Ga0495581_0042870 | |||
| 1712 | Ga0495604_0000111 | |||
| 1713 | Ga0495604_0195457 | |||
| 1714 | Ga0495636_0193453 | |||
| 1715 | Ga0495674_0039026 | |||
| 1716 | Ga0495674_0039406 | |||
| 1717 | Ga0495674_0077523 | |||
| 1718 | Ga0495676_0007744 | |||
| 1719 | Ga0495676_0023091 | |||
| 1720 | Ga0495676_0041233 | |||
| 1721 | Ga0495680_0019156 | |||
| 1722 | Ga0495680_0035061 | |||
| 1723 | Ga0495680_0035134 | |||
| 1724 | Ga0495680_0101234 | |||
| 1725 | Ga0495675_0000269 | |||
| 1726 | Ga0495685_051438 | |||
| 1727 | Ga0495685_156318 | |||
| 1728 | Ga0495684_0007069 | |||
| 1729 | Ga0495684_0019190 | |||
| 1730 | Ga0495684_0028360 | |||
| 1731 | Ga0495684_0072972 | |||
| 1732 | Ga0495593_0001801 | |||
| 1733 | Ga0495602_0006456 | |||
| 1734 | Ga0495602_0058330 | |||
| 1735 | Ga0495602_0276630 | |||
| 1736 | Ga0495614_0001124 | |||
| 1737 | Ga0495614_0086288 | |||
| 1738 | Ga0496100_0081197 | |||
| 1739 | Ga0496100_0155982 | |||
| 1740 | Ga0496101_0054399 | |||
| 1741 | Ga0496101_0063607 | |||
| 1742 | Ga0496101_0291893 | |||
| 1743 | Ga0496101_0308477 | |||
| 1744 | Ga0496102_0042738 | |||
| 1745 | Ga0496102_0113738 | |||
| 1746 | Ga0496102_0276811 | |||
| 1747 | Ga0496103_0025317 | |||
| 1748 | Ga0496104_0006439 | |||
| 1749 | Ga0496104_0028580 | |||
| 1750 | Ga0496104_0036322 | |||
| 1751 | Ga0496104_0118833 | |||
| 1752 | Ga0496104_0388266 | |||
| 1753 | Ga0496105_0001401 | |||
| 1754 | Ga0496105_0011337 | |||
| 1755 | Ga0496105_0043302 | |||
| 1756 | Ga0496105_0048667 | |||
| 1757 | Ga0496106_0019249 | |||
| 1758 | Ga0496106_0148408 | |||
| 1759 | Ga0496106_0544241 | |||
| 1760 | Ga0496107_0105074 | |||
| 1761 | Ga0496107_0121564 | |||
| 1762 | Ga0496107_0394022 | |||
| 1763 | Ga0496107_0414886 | |||
| 1764 | Ga0496107_0438241 | |||
| 1765 | Ga0496107_0527720 | |||
| 1766 | Ga0496108_0015080 | |||
| 1767 | Ga0496108_0062022 | |||
| 1768 | Ga0496108_0098698 | |||
| 1769 | Ga0496108_0111143 | |||
| 1770 | Ga0496108_0380606 | |||
| 1771 | Ga0496108_0750480 | |||
| 1772 | Ga0496109_0007539 | |||
| 1773 | Ga0496109_0024995 | |||
| 1774 | Ga0496109_0025340 | |||
| 1775 | Ga0496109_0034439 | |||
| 1776 | Ga0496109_0037616 | |||
| 1777 | Ga0496109_0056106 | |||
| 1778 | Ga0496109_0540410 | |||
| 1779 | Ga0496110_0001330 | |||
| 1780 | Ga0496110_0004457 | |||
| 1781 | Ga0496110_0014989 | |||
| 1782 | Ga0496110_0126452 | |||
| 1783 | Ga0496110_0178148 | |||
| 1784 | Ga0496110_0200048 | |||
| 1785 | Ga0496110_0221527 | |||
| 1786 | Ga0496110_0339570 | |||
| 1787 | Ga0496110_0648437 | |||
| 1788 | Ga0496111_0000032 | |||
| 1789 | Ga0496111_0068765 | |||
| 1790 | Ga0496111_0175602 | |||
| 1791 | Ga0496112_0062538 | |||
| 1792 | Ga0496112_0080458 | |||
| 1793 | Ga0496112_0127978 | |||
| 1794 | Ga0496112_0266672 | |||
| 1795 | Ga0496113_0002660 | |||
| 1796 | Ga0496113_0066603 | |||
| 1797 | Ga0496113_0135654 | |||
| 1798 | Ga0496113_0572661 | |||
| 1799 | Ga0496114_0020590 | |||
| 1800 | Ga0496114_0030412 | |||
| 1801 | Ga0496114_0101522 | |||
| 1802 | Ga0496114_0145592 | |||
| 1803 | Ga0496114_0223164 | |||
| 1804 | Ga0496114_0255138 | |||
| 1805 | Ga0496115_0033089 | |||
| 1806 | Ga0496115_0046857 | |||
| 1807 | Ga0496115_0067297 | |||
| 1808 | Ga0496115_0136910 | |||
| 1809 | Ga0501031_0004130 | |||
| 1810 | Ga0501031_0021989 | |||
| 1811 | Ga0501031_0031234 | |||
| 1812 | Ga0501031_0145221 | |||
| 1813 | Ga0501031_0190213 | |||
| 1814 | Ga0501031_0302569 | |||
| 1815 | Ga0501032_0025748 | |||
| 1816 | Ga0501033_0024673 | |||
| 1817 | Ga0501033_0153308 | |||
| 1818 | Ga0501033_0425716 | |||
| 1819 | Ga0501034_0147911 | |||
| 1820 | Ga0501034_0180252 | |||
| 1821 | Ga0501036_0008004 | |||
| 1822 | Ga0501036_0016593 | |||
| 1823 | Ga0501036_0024991 | |||
| 1824 | Ga0501036_0025945 | |||
| 1825 | Ga0501036_0190515 | |||
| 1826 | Ga0501036_0262728 | |||
| 1827 | Ga0501037_0198657 | |||
| 1828 | Ga0501038_0007786 | |||
| 1829 | Ga0501038_0022966 | |||
| 1830 | Ga0501038_0027466 | |||
| 1831 | Ga0501038_0057562 | |||
| 1832 | Ga0501038_0215717 | |||
| 1833 | Ga0501039_0012132 | |||
| 1834 | Ga0501039_0015380 | |||
| 1835 | Ga0501039_0015712 | |||
| 1836 | Ga0501039_0143576 | |||
| 1837 | Ga0501039_0192535 | |||
| 1838 | Ga0501040_0004395 | |||
| 1839 | Ga0501040_0010534 | |||
| 1840 | Ga0501040_0013989 | |||
| 1841 | Ga0501040_0014456 | |||
| 1842 | Ga0501040_0015141 | |||
| 1843 | Ga0501040_0044449 | |||
| 1844 | Ga0501040_0605599 | |||
| 1845 | Ga0501041_0009218 | |||
| 1846 | Ga0501041_0017314 | |||
| 1847 | Ga0501041_0027728 | |||
| 1848 | Ga0501041_0087337 | |||
| 1849 | Ga0501042_0027464 | |||
| 1850 | Ga0501042_0062802 | |||
| 1851 | Ga0501042_0078920 | |||
| 1852 | Ga0501042_0097272 | |||
| 1853 | Ga0501042_0120088 | |||
| 1854 | Ga0501042_0141559 | |||
| 1855 | Ga0501043_0068441 | |||
| 1856 | Ga0501043_0189854 | |||
| 1857 | Ga0501046_0095509 | |||
| 1858 | Ga0501046_0103821 | |||
| 1859 | Ga0501046_0105497 | |||
| 1860 | Ga0501046_0118277 | |||
| 1861 | Ga0501046_0133899 | |||
| 1862 | Ga0501046_0179797 | |||
| 1863 | Ga0501046_0395322 | |||
| 1864 | Ga0501048_0091882 | |||
| 1865 | Ga0501048_0110777 | |||
| 1866 | Ga0501048_0117411 | |||
| 1867 | Ga0501048_0121674 | |||
| 1868 | Ga0501067_0004259 | |||
| 1869 | Ga0501067_0091179 | |||
| 1870 | Ga0501068_0003825 | |||
| 1871 | Ga0501068_0012024 | |||
| 1872 | Ga0501068_0022024 | |||
| 1873 | Ga0501068_0234268 | |||
| 1874 | Ga0501069_0006559 | |||
| 1875 | Ga0501069_0108936 | |||
| 1876 | Ga0501070_0057731 | |||
| 1877 | Ga0501070_0112778 | |||
| 1878 | Ga0501070_0171936 | |||
| 1879 | Ga0501070_0553486 | |||
| 1880 | Ga0501071_0000662 | |||
| 1881 | Ga0501071_0002358 | |||
| 1882 | Ga0501071_0003764 | |||
| 1883 | Ga0501071_0017605 | |||
| 1884 | Ga0501071_0109438 | |||
| 1885 | Ga0501071_0124740 | |||
| 1886 | Ga0501072_0009405 | |||
| 1887 | Ga0501072_0014926 | |||
| 1888 | Ga0501072_0043954 | |||
| 1889 | Ga0501072_0165441 | |||
| 1890 | Ga0501072_0746376 | |||
| 1891 | Ga0501073_0017993 | |||
| 1892 | Ga0501073_0028772 | |||
| 1893 | Ga0501073_0121910 | |||
| 1894 | Ga0501074_0025399 | |||
| 1895 | Ga0501074_0054282 | |||
| 1896 | Ga0501074_0202049 | |||
| 1897 | Ga0501075_0006475 | |||
| 1898 | Ga0501075_0009784 | |||
| 1899 | Ga0501075_0021498 | |||
| 1900 | Ga0501075_0141940 | |||
| 1901 | Ga0501075_0302866 | |||
| 1902 | Ga0501075_0305890 | |||
| 1903 | Ga0501076_0002743 | |||
| 1904 | Ga0501076_0004119 | |||
| 1905 | Ga0501076_0008503 | |||
| 1906 | Ga0501076_0022464 | |||
| 1907 | Ga0501076_0034678 | |||
| 1908 | Ga0501076_0131669 | |||
| 1909 | Ga0501077_0011297 | |||
| 1910 | Ga0501077_0011863 | |||
| 1911 | Ga0501077_0013786 | |||
| 1912 | Ga0501077_0015480 | |||
| 1913 | Ga0501077_0059599 | |||
| 1914 | Ga0501077_0116353 | |||
| 1915 | Ga0501079_0001035 | |||
| 1916 | Ga0501079_0006655 | |||
| 1917 | Ga0501079_0019804 | |||
| 1918 | Ga0501079_0030888 | |||
| 1919 | Ga0501079_0124106 | |||
| 1920 | Ga0501079_0698593 | |||
| 1921 | Ga0501080_0003647 | |||
| 1922 | Ga0501080_0029574 | |||
| 1923 | Ga0501080_0040480 | |||
| 1924 | Ga0501080_0051488 | |||
| 1925 | Ga0501080_0102925 | |||
| 1926 | Ga0501080_0244698 | |||
| 1927 | Ga0501081_0013919 | |||
| 1928 | Ga0501081_0048542 | |||
| 1929 | Ga0501081_0063891 | |||
| 1930 | Ga0501081_0099746 | |||
| 1931 | Ga0501081_0099892 | |||
| 1932 | Ga0501081_0120340 | |||
| 1933 | Ga0501081_0125495 | |||
| 1934 | Ga0501081_0130527 | |||
| 1935 | Ga0501081_0471520 | |||
| 1936 | Ga0501083_0016349 | |||
| 1937 | Ga0501083_0048521 | |||
| 1938 | Ga0501083_0104507 | |||
| 1939 | Ga0501035_0011508 | |||
| 1940 | Ga0501035_0036848 | |||
| 1941 | Ga0501035_0586551 | |||
| 1942 | Ga0501044_0659558 | |||
| 1943 | Ga0501045_0012025 | |||
| 1944 | Ga0501045_0045550 | |||
| 1945 | Ga0501045_0100698 | |||
| 1946 | Ga0501045_0134883 | |||
| 1947 | Ga0501045_0375467 | |||
| 1948 | nmdc:mga00v17_151205_c1 | |||
| 1949 | nmdc:mga0yw44_13142_c1 | |||
| 1950 | nmdc:mga0yw44_486881_c1 | |||
| 1951 | nmdc:mga05p37_33357_c1 | |||
| 1952 | nmdc:mga05p37_468043_c1 | |||
| 1953 | nmdc:mga05p37_828795_c1 | |||
| 1954 | nmdc:mga0qj67_81380_c1 | |||
| 1955 | nmdc:mga06r32_623040_c1 | |||
| 1956 | nmdc:mga06r32_664645_c1 | |||
| 1957 | nmdc:mga08y16_220279_c1 | |||
| 1958 | nmdc:mga08y16_226420_c1 | |||
| 1959 | nmdc:mga08y16_301178_c1 | |||
| 1960 | nmdc:mga08y16_71033_c1 | |||
| 1961 | nmdc:mga08y16_80438_c1 | |||
| 1962 | nmdc:mga0n895_1025339_c1 | |||
| 1963 | nmdc:mga0n895_180440_c1 | |||
| 1964 | nmdc:mga0n895_18289_c1 | |||
| 1965 | nmdc:mga0n895_25870_c1 | |||
| 1966 | nmdc:mga0rr50_13713_c1 | |||
| 1967 | nmdc:mga0rr50_37076_c1 | |||
| 1968 | nmdc:mga0rr50_3765_c2 | |||
| 1969 | nmdc:mga0rr50_41479_c1 | |||
| 1970 | nmdc:mga0rr50_635422_c1 | |||
| 1971 | nmdc:mga08x19_661623_c1 | |||
| 1972 | nmdc:mga08x19_9687_c1 | |||
| 1973 | nmdc:mga0a205_130345_c1 | |||
| 1974 | nmdc:mga0a205_35285_c1 | |||
| 1975 | nmdc:mga0a205_615979_c1 | |||
| 1976 | nmdc:mga0a205_85268_c1 | |||
| 1977 | Ga0495601_0000390 | |||
| 1978 | Ga0495601_0001759 | |||
| 1979 | Ga0495601_0030181 | |||
| 1980 | Ga0495601_0162919 | |||
| 1981 | Ga0495601_0247728 | |||
| 1982 | Ga0495612_0001906 | |||
| 1983 | Ga0495612_0016196 | |||
| 1984 | Ga0495595_0011388 | |||
| 1985 | Ga0495595_0024017 | |||
| 1986 | Ga0495595_0028065 | |||
| 1987 | Ga0495595_0127114 | |||
| 1988 | Ga0495595_0263214 | |||
| 1989 | Ga0495595_0335714 | |||
| 1990 | Ga0495619_0004098 | |||
| 1991 | Ga0495619_0038421 | |||
| 1992 | Ga0495619_0111793 | |||
| 1993 | Ga0495619_0139034 | |||
| 1994 | Ga0501084_0004616 | |||
| 1995 | Ga0501084_0027772 | |||
| 1996 | Ga0501084_0095950 | |||
| 1997 | Ga0501084_0125126 | |||
| 1998 | Ga0501084_0146704 | |||
| 1999 | Ga0501084_0153509 | |||
| 2000 | Ga0501084_0736170 | |||
| 2001 | Ga0501082_0006621 | |||
| 2002 | Ga0501082_0016686 | |||
| 2003 | Ga0501082_0024304 | |||
| 2004 | Ga0501082_0026950 | |||
| 2005 | Ga0501082_0086289 | |||
| 2006 | Ga0530510_0017996 | |||
| 2007 | Ga0530510_0117033 | |||
| 2008 | Ga0530510_0118013 | |||
| 2009 | Ga0530510_0259018 | |||
| 2010 | Ga0530510_0578857 | |||
| 2011 | Ga0530510_0614558 | |||
| 2012 | 2870789797 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gz8-assembly2.cif.gz_D | cocrystal structure of nudix domain of shewanella oneidensis nrtr complexed with adp ribose | 0.8806 | 2 | 122 |
| 5bs6-assembly2.cif.gz_D | apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi | 0.8557 | 2 | 194 |
| 5bs6-assembly1.cif.gz_B | apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi | 0.8546 | 2 | 194 |
| 3gz6-assembly1.cif.gz_B | crystal structure of shewanella oneidensis nrtr complexed with a 27mer dna | 0.8125 | 2 | 212 |
| 5deq-assembly1.cif.gz_A | crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose | 0.8026 | 2 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06597_8_150_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9778 | 2 | 128 | 3.90.79.10 |
| af_O06597_151_228_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9206 | 130 | 206 | 1.10.10.10 |
| af_O06597_151_228_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8986 | 130 | 206 | 1.10.10.10 |
| 3gz8B01 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8799 | 2 | 122 | 3.90.79.10 |
| af_O06597_8_150_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.864 | 2 | 128 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538HUN0-F1-model_v4 | NUDIX hydrolase | 0.985 | 2 | 180 |
GO:0016787
|
| AF-V7L1B1-F1-model_v4 | deleted | 0.9801 | 8 | 154 |
|
| AF-A0A7V8XN31-F1-model_v4 | NUDIX hydrolase | 0.9791 | 2 | 174 |
GO:0016787
|
| AF-A0A4V3HYK6-F1-model_v4 | Bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase | 0.9704 | 8 | 212 |
GO:0016779
|
| AF-A0A0B8NF13-F1-model_v4 | Nudix hydrolase | 0.97 | 8 | 212 |
GO:0016787
|