F488022

General Info

Members Datasets Scaffolds Average Seq Length
1007 440 2014 274

Family's Representative Sequence

Representative Sequence 3300002704|JGI25155J39150_1000042|JGI25155J39150_100004218
Length 316
Sequence MRFPPRGPLRLRPGEAGSAAPTCMWEISGRSLLCLPITSLEYAMTAVLNAPVFADVPVREFQPGPAGTHITIRGLTKYFAGWPLYEDFNLDIPKHKIVSVFGPNGCGKSTLINMIAGLIPIDAGEILFDGKSLKDTKIGYVFQNYREAMFPWMRTIDNIAYPLKLEGKSKAEVDRRMAELVASFDVKFDLNRYPYELSGGQQQTASIMRALAPNPEVLFLDEPFSALDFEMTLFIREKLQEVFMQTGTTMLLVSHDLEEAVYLADQVLLLTKRPTRVAEILPYGDARPRTVETLSEASFIRTKKLSLEIFQREVRR

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
104 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
121 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
142 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
150 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
219 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
221 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
226 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
227 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
228 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
229 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
230 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
231 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
232 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
233 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
234 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
235 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
236 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
239 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
242 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
248 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
254 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
267 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
268 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
269 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
270 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
271 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
272 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
273 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
274 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
275 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
276 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
277 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
278 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
281 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
282 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
287 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
292 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
295 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
296 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
346 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
347 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
348 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
349 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
350 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
351 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
353 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
356 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
357 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
358 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
359 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
360 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
361 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
362 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
363 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
364 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
365 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
366 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
367 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
368 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
369 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
370 2643221569 Achromobacter sp. Root565 Isolate Unclassified
371 2643221585 Pelomonas sp. Root662 Isolate Unclassified
372 2643221594 Achromobacter sp. Root170 Isolate Unclassified
373 2643221609 Acidovorax sp. Root217 Isolate Unclassified
374 2643221611 Acidovorax sp. Root219 Isolate Unclassified
375 2643221621 Achromobacter sp. Root83 Isolate Unclassified
376 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
377 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
378 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
379 2643221656 Pelomonas sp. Root405 Isolate Unclassified
380 2643221672 Variovorax sp. Root434 Isolate Unclassified
381 2738541277 Variovorax sp. GV051 Isolate Unclassified
382 2738541307 Variovorax sp. GV008 Isolate Unclassified
383 2738543012 Acidovorax sp. CF301 Isolate Unclassified
384 2738543013 Variovorax sp. BT01 Isolate Unclassified
385 2738543019 Variovorax sp. GV040 Isolate Unclassified
386 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
387 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
388 2816332133 Acidovorax radicis 2721A Isolate Unclassified
389 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
390 2818991446 Variovorax sp. 1180 Isolate Unclassified
391 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
392 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
393 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
394 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
395 2842677519 Variovorax sp. R-72495 Isolate Unclassified
396 2842733646 Variovorax sp. R-72446 Isolate Unclassified
397 2842747753 Variovorax sp. R-72060 Isolate Unclassified
398 2855730933 Achromobacter sp. HZ28 Isolate Nodule
399 2855767633 Achromobacter sp. HZ34 Isolate Nodule
400 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
401 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
402 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
403 2858950400 Achromobacter sp. K91 Isolate Unclassified
404 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
405 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
406 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
407 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
408 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
409 2885198086 Variovorax sp. 679 Isolate Unclassified
410 2885211737 Variovorax sp. 553 Isolate Unclassified
411 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
412 2899924645 Variovorax sp. 369 Isolate Unclassified
413 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
414 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
415 2904456579 Variovorax sp. 2002 Isolate Unclassified
416 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
417 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
418 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
419 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
420 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
421 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
422 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
423 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
424 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
425 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
426 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
427 2928037797 Variovorax sp. 1126 Isolate Unclassified
428 2928044640 Variovorax sp. 1128 Isolate Unclassified
429 2928051484 Variovorax sp. 1133 Isolate Unclassified
430 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
431 2928070936 Variovorax gossypii 1167 Isolate Unclassified
432 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
433 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
434 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
435 2929520902 Variovorax beijingensis 502 Isolate Unclassified
436 2941479691
437 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
438 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
439 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
440 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.56
Metatranscriptomes 0
Isolates 8.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.47
Nodule 0.99
Rhizoplane 1.49
Rhizosphere 63.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000042 3300002704 Bacteria 88585
2 JGI24740J21852_10010263 3300001979 Bacteria 3618
3 JGI24739J22299_10015867 3300001989 Bacteria 2733
4 JGI25155J39150_1000651 3300002704 Bacteria 6849
5 JGI25155J39150_1001094 3300002704 Bacteria 2726
6 JGI25156J39149_1000053 3300002705 Bacteria 88796
7 JGI25156J39149_1000170 3300002705 Bacteria 47634
8 JGI25156J39149_1001869 3300002705 Bacteria 8231
9 JGI25156J39149_1007194 3300002705 Bacteria 2953
10 JGI25162J39368_1003814 3300002737 Bacteria 3981
11 JGI25154J39366_1000082 3300002738 Bacteria 88767
12 JGI25154J39366_1000306 3300002738 Bacteria 28725
13 JGI25154J39366_1000455 3300002738 Bacteria 21495
14 JGI25157J39369_1000072 3300002741 Bacteria 88796
15 JGI25157J39369_1000170 3300002741 Bacteria 54809
16 JGI25159J45721_1002106 3300002987 Bacteria 7812
17 JGI25159J45721_1010517 3300002987 Bacteria 2348
18 JGI25151J46595_10000301 3300003187 Bacteria 54192
19 JGI25151J46595_10011183 3300003187 Bacteria 4134
20 JGI25153J46596_10012010 3300003215 Bacteria 3781
21 rootL2_10017868 3300003322 Bacteria 14919
22 rootH1_10005172 3300003323 Bacteria 2973
23 JGI25160J50197_1000227 3300003354 Bacteria 44493
24 JGI25161J50226_1000007 3300003374 Bacteria 256181
25 Ga0055538_1000013 3300003751 Bacteria 348596
26 Ga0055539_1000018 3300003752 Bacteria 348596
27 Ga0055533_1000022 3300003756 Bacteria 348596
28 Ga0055532_1000017 3300003758 Bacteria 306880
29 Ga0055525_1000024 3300003759 Bacteria 348596
30 Ga0055535_1000260 3300003761 Bacteria 55578
31 Ga0055535_1005719 3300003761 Bacteria 2661
32 Ga0055542_1000013 3300003762 Bacteria 387560
33 Ga0055526_1021281 3300003771 Bacteria 2263
34 Ga0055537_1002740 3300003773 Bacteria 5717
35 Ga0055524_1000052 3300003775 Bacteria 144959
36 Ga0055524_1001441 3300003775 Bacteria 13654
37 Ga0055536_1004462 3300003781 Bacteria 7148
38 Ga0055534_1001477 3300003784 Bacteria 9327
39 Ga0055534_1002933 3300003784 Bacteria 5651
40 Ga0055534_1006234 3300003784 Bacteria 3040
41 Ga0055530_10003439 3300003791 Bacteria 8999
42 Ga0055530_10004911 3300003791 Bacteria 6630
43 Ga0055530_10018827 3300003791 Bacteria 2114
44 Ga0055540_1000123 3300003792 Bacteria 80351
45 Ga0055540_1002288 3300003792 Bacteria 10318
46 Ga0055540_1013297 3300003792 Bacteria 2524
47 Ga0055531_10000740 3300003794 Bacteria 27497
48 Ga0055531_10001116 3300003794 Bacteria 20815
49 Ga0055531_10016084 3300003794 Bacteria 3251
50 Ga0055541_1000013 3300003841 Bacteria 348596
51 Ga0055543_1000386 3300004625 Bacteria 28622
52 Ga0065165_1013879 3300005262 Bacteria 3166
53 Ga0065704_10000444 3300005289 Bacteria 86255
54 Ga0065715_10020215 3300005293 Bacteria 2452
55 Ga0065715_10035108 3300005293 Bacteria 1466
56 Ga0065715_10125321 3300005293 Bacteria 2133
57 Ga0070658_10224146 3300005327 Bacteria 1591
58 Ga0070676_10002668 3300005328 Bacteria 9187
59 Ga0070676_10277204 3300005328 Bacteria 1128
60 Ga0070683_100129404 3300005329 Bacteria 2388
61 Ga0070683_100647230 3300005329 Bacteria 1012
62 Ga0070690_100031929 3300005330 Bacteria 3284
63 Ga0070670_100001971 3300005331 Bacteria 16798
64 Ga0070670_100014554 3300005331 Bacteria 6754
65 Ga0070670_100029888 3300005331 Bacteria 4693
66 Ga0070670_100037645 3300005331 Bacteria 4161
67 Ga0070670_100043346 3300005331 Bacteria 3868
68 Ga0070670_100089726 3300005331 Bacteria 2642
69 Ga0070670_100119461 3300005331 Bacteria 2273
70 Ga0070670_100188056 3300005331 Bacteria 1793
71 Ga0070670_100328284 3300005331 Bacteria 1341
72 Ga0070677_10006417 3300005333 Bacteria 3907
73 Ga0070677_10009189 3300005333 Bacteria 3350
74 Ga0070677_10010076 3300005333 Bacteria 3221
75 Ga0068869_100041131 3300005334 Bacteria 3309
76 Ga0068869_100402150 3300005334 Bacteria 1127
77 Ga0070666_10000758 3300005335 Bacteria 19568
78 Ga0070666_10002174 3300005335 Bacteria 11914
79 Ga0070666_10079624 3300005335 Bacteria 2238
80 Ga0070666_10363788 3300005335 Bacteria 1037
81 Ga0068868_100001290 3300005338 Bacteria 17256
82 Ga0068868_100011821 3300005338 Bacteria 6365
83 Ga0068868_100045446 3300005338 Bacteria 3435
84 Ga0068868_100100646 3300005338 Bacteria 2338
85 Ga0068868_100123985 3300005338 Bacteria 2109
86 Ga0070689_100008704 3300005340 Bacteria 7162
87 Ga0070689_100186212 3300005340 Bacteria 1688
88 Ga0070689_100335959 3300005340 Bacteria 1265
89 Ga0070687_100192273 3300005343 Bacteria 1230
90 Ga0070661_100298968 3300005344 Bacteria 1252
91 Ga0070661_100345298 3300005344 Bacteria 1167
92 Ga0070668_100003834 3300005347 Bacteria 11107
93 Ga0070668_100036636 3300005347 Bacteria 3744
94 Ga0070668_100133019 3300005347 Bacteria 1998
95 Ga0070668_100412093 3300005347 Bacteria 1155
96 Ga0070668_100510634 3300005347 Bacteria 1042
97 Ga0070669_100094824 3300005353 Bacteria 2243
98 Ga0070669_100108307 3300005353 Bacteria 2106
99 Ga0070675_100001026 3300005354 Bacteria 20075
100 Ga0070675_100011870 3300005354 Bacteria 6826
101 Ga0070675_100014529 3300005354 Bacteria 6210
102 Ga0070675_100022217 3300005354 Bacteria 5067
103 Ga0070675_100060263 3300005354 Bacteria 3133
104 Ga0070675_100617966 3300005354 Bacteria 983
105 Ga0070671_100010647 3300005355 Bacteria 7381
106 Ga0070671_100043160 3300005355 Bacteria 3748
107 Ga0070671_100067899 3300005355 Bacteria 2973
108 Ga0070671_100075846 3300005355 Bacteria 2809
109 Ga0070671_100079613 3300005355 Bacteria 2739
110 Ga0070671_100129197 3300005355 Bacteria 2127
111 Ga0070671_100186048 3300005355 Bacteria 1760
112 Ga0070671_100220387 3300005355 Bacteria 1609
113 Ga0070674_100000094 3300005356 Bacteria 41372
114 Ga0070674_100017248 3300005356 Bacteria 4538
115 Ga0070674_100036756 3300005356 Bacteria 3290
116 Ga0070674_100064418 3300005356 Bacteria 2568
117 Ga0070673_100000679 3300005364 Bacteria 18764
118 Ga0070673_100000753 3300005364 Bacteria 17978
119 Ga0070673_100056321 3300005364 Bacteria 3101
120 Ga0070673_100061005 3300005364 Bacteria 2990
121 Ga0070673_100070739 3300005364 Bacteria 2801
122 Ga0070673_100086055 3300005364 Bacteria 2560
123 Ga0070688_100027851 3300005365 Bacteria 3367
124 Ga0070659_100310018 3300005366 Bacteria 1318
125 Ga0070667_100001746 3300005367 Bacteria 19433
126 Ga0070667_100009087 3300005367 Bacteria 8223
127 Ga0070667_100059026 3300005367 Bacteria 3245
128 Ga0070667_100063129 3300005367 Bacteria 3138
129 Ga0070667_100089857 3300005367 Bacteria 2639
130 Ga0070667_100153304 3300005367 Bacteria 2026
131 Ga0070667_100201356 3300005367 Bacteria 1767
132 Ga0070667_100474046 3300005367 Bacteria 1145
133 Ga0070667_100580873 3300005367 Bacteria 1031
134 Ga0070705_100361539 3300005440 Bacteria 1062
135 Ga0070708_100458382 3300005445 Bacteria 1203
136 Ga0070663_100010261 3300005455 Bacteria 5835
137 Ga0070663_100032973 3300005455 Bacteria 3575
138 Ga0070663_100060857 3300005455 Bacteria 2717
139 Ga0070678_100000409 3300005456 Bacteria 20280
140 Ga0070678_100015011 3300005456 Bacteria 4906
141 Ga0070678_100022737 3300005456 Bacteria 4161
142 Ga0070678_100030734 3300005456 Bacteria 3695
143 Ga0070678_100136716 3300005456 Bacteria 1955
144 Ga0070678_100153175 3300005456 Bacteria 1859
145 Ga0070678_100179796 3300005456 Bacteria 1730
146 Ga0070678_100213423 3300005456 Bacteria 1601
147 Ga0070678_100325069 3300005456 Bacteria 1314
148 Ga0070662_100004880 3300005457 Bacteria 8510
149 Ga0070662_100036562 3300005457 Bacteria 3474
150 Ga0070662_100104882 3300005457 Bacteria 2145
151 Ga0070662_100440947 3300005457 Bacteria 1079
152 Ga0068867_100001043 3300005459 Bacteria 18890
153 Ga0068867_100008620 3300005459 Bacteria 7200
154 Ga0068867_100012008 3300005459 Bacteria 6118
155 Ga0068867_100017264 3300005459 Bacteria 5125
156 Ga0068867_100021275 3300005459 Bacteria 4629
157 Ga0068867_100049323 3300005459 Bacteria 3099
158 Ga0068867_100069565 3300005459 Bacteria 2629
159 Ga0068867_100153326 3300005459 Bacteria 1811
160 Ga0070706_100002539 3300005467 Bacteria 18347
161 Ga0070707_100036814 3300005468 Bacteria 4670
162 Ga0070684_100049524 3300005535 Bacteria 3646
163 Ga0068853_100072987 3300005539 Bacteria 2991
164 Ga0068853_100454005 3300005539 Bacteria 1206
165 Ga0070672_100000552 3300005543 Bacteria 22019
166 Ga0070672_100010312 3300005543 Bacteria 6477
167 Ga0070672_100047920 3300005543 Bacteria 3318
168 Ga0070672_100056675 3300005543 Bacteria 3074
169 Ga0070672_100067655 3300005543 Bacteria 2831
170 Ga0070672_100137156 3300005543 Bacteria 2015
171 Ga0070672_100200596 3300005543 Bacteria 1668
172 Ga0070672_100242749 3300005543 Bacteria 1515
173 Ga0070696_100061266 3300005546 Bacteria 2632
174 Ga0070665_100002419 3300005548 Bacteria 20581
175 Ga0070665_100004291 3300005548 Bacteria 14986
176 Ga0070665_100243262 3300005548 Bacteria 1800
177 Ga0070665_100414457 3300005548 Bacteria 1356
178 Ga0068855_100011166 3300005563 Bacteria 10845
179 Ga0068855_100068193 3300005563 Bacteria 4141
180 Ga0070664_100026043 3300005564 Bacteria 4849
181 Ga0070664_100072613 3300005564 Bacteria 2951
182 Ga0070664_100074036 3300005564 Bacteria 2922
183 Ga0070664_100175452 3300005564 Bacteria 1902
184 Ga0070664_100196192 3300005564 Bacteria 1800
185 Ga0068857_100017408 3300005577 Bacteria 6297
186 Ga0068857_100157826 3300005577 Bacteria 2057
187 Ga0068857_100159525 3300005577 Bacteria 2046
188 Ga0068857_100330635 3300005577 Bacteria 1408
189 Ga0068854_100052677 3300005578 Bacteria 2919
190 Ga0068854_100072045 3300005578 Bacteria 2529
191 Ga0068854_100110195 3300005578 Bacteria 2075
192 Ga0068854_100352732 3300005578 Bacteria 1205
193 Ga0068856_100151917 3300005614 Bacteria 2325
194 Ga0070702_100059433 3300005615 Bacteria 2218
195 Ga0070702_100199324 3300005615 Bacteria 1324
196 Ga0070702_100309120 3300005615 Bacteria 1097
197 Ga0068852_100027996 3300005616 Bacteria 4604
198 Ga0068852_100042319 3300005616 Bacteria 3856
199 Ga0068852_100063421 3300005616 Bacteria 3217
200 Ga0068852_100084077 3300005616 Bacteria 2831
201 Ga0068852_100161780 3300005616 Bacteria 2091
202 Ga0068852_100209190 3300005616 Bacteria 1850
203 Ga0068859_100023045 3300005617 Bacteria 6243
204 Ga0068859_100098576 3300005617 Bacteria 2977
205 Ga0068859_100121412 3300005617 Bacteria 2679
206 Ga0068859_100473170 3300005617 Bacteria 1348
207 Ga0068864_100000845 3300005618 Bacteria 25824
208 Ga0068864_100021018 3300005618 Bacteria 5465
209 Ga0068864_100024185 3300005618 Bacteria 5107
210 Ga0068864_100044697 3300005618 Bacteria 3798
211 Ga0068864_100071385 3300005618 Bacteria 3023
212 Ga0068864_100078936 3300005618 Bacteria 2881
213 Ga0068864_100096415 3300005618 Bacteria 2617
214 Ga0068864_100184809 3300005618 Bacteria 1907
215 Ga0068861_100105393 3300005719 Bacteria 2251
216 Ga0068861_100393112 3300005719 Bacteria 1228
217 Ga0068861_100460110 3300005719 Bacteria 1142
218 Ga0068851_10000843 3300005834 Bacteria 13213
219 Ga0068870_10065494 3300005840 Bacteria 1966
220 Ga0068863_100002048 3300005841 Bacteria 19982
221 Ga0068863_100034799 3300005841 Bacteria 4797
222 Ga0068863_100071222 3300005841 Bacteria 3289
223 Ga0068863_100107675 3300005841 Bacteria 2652
224 Ga0068863_100119529 3300005841 Bacteria 2512
225 Ga0068863_100152090 3300005841 Bacteria 2214
226 Ga0068863_100152743 3300005841 Bacteria 2210
227 Ga0068863_100154405 3300005841 Bacteria 2197
228 Ga0068858_100002570 3300005842 Bacteria 18284
229 Ga0068858_100252112 3300005842 Bacteria 1677
230 Ga0068858_100266980 3300005842 Bacteria 1628
231 Ga0068858_100325491 3300005842 Bacteria 1469
232 Ga0068858_100539810 3300005842 Bacteria 1129
233 Ga0068860_100008382 3300005843 Bacteria 10293
234 Ga0068860_100012965 3300005843 Bacteria 8187
235 Ga0068860_100057346 3300005843 Bacteria 3702
236 Ga0068860_100075322 3300005843 Bacteria 3210
237 Ga0068862_100113099 3300005844 Bacteria 2385
238 Ga0068862_100145352 3300005844 Bacteria 2107
239 Ga0068862_100154254 3300005844 Bacteria 2046
240 Ga0068862_100173498 3300005844 Bacteria 1931
241 Ga0068862_100634976 3300005844 Bacteria 1028
242 Ga0070717_10179449 3300006028 Bacteria 1845
243 Ga0075365_10162457 3300006038 Bacteria 1557
244 Ga0075365_10299676 3300006038 Bacteria 1131
245 Ga0075368_10114950 3300006042 Bacteria 1111
246 Ga0075363_100036983 3300006048 Bacteria 2562
247 Ga0075364_10109509 3300006051 Bacteria 1842
248 Ga0075364_10161447 3300006051 Bacteria 1513
249 Ga0075364_10302949 3300006051 Bacteria 1088
250 Ga0075364_10350918 3300006051 Bacteria 1006
251 Ga0075362_10062690 3300006177 Bacteria 1685
252 Ga0075367_10010982 3300006178 Bacteria 4774
253 Ga0075367_10018189 3300006178 Bacteria 3873
254 Ga0075367_10166400 3300006178 Bacteria 1372
255 Ga0075369_10009596 3300006186 Bacteria 3764
256 Ga0075369_10059355 3300006186 Bacteria 1666
257 Ga0075369_10086249 3300006186 Bacteria 1397
258 Ga0075369_10205939 3300006186 Bacteria 908
259 Ga0075366_10002787 3300006195 Bacteria 9038
260 Ga0075366_10015678 3300006195 Bacteria 4349
261 Ga0075366_10064729 3300006195 Bacteria 2174
262 Ga0075366_10143252 3300006195 Bacteria 1445
263 Ga0075366_10210536 3300006195 Bacteria 1183
264 Ga0097621_100007338 3300006237 Bacteria 7881
265 Ga0097621_100037524 3300006237 Bacteria 3884
266 Ga0097621_100140720 3300006237 Bacteria 2061
267 Ga0097621_100241368 3300006237 Bacteria 1579
268 Ga0097621_100404665 3300006237 Bacteria 1222
269 Ga0097621_100450408 3300006237 Bacteria 1160
270 Ga0097621_100558114 3300006237 Bacteria 1043
271 Ga0075370_10006766 3300006353 Bacteria 5792
272 Ga0075370_10024220 3300006353 Bacteria 3351
273 Ga0075370_10027723 3300006353 Bacteria 3145
274 Ga0075370_10063075 3300006353 Bacteria 2112
275 Ga0075370_10070550 3300006353 Bacteria 1998
276 Ga0075370_10127002 3300006353 Bacteria 1487
277 Ga0068871_100064731 3300006358 Bacteria 2993
278 Ga0068871_100230418 3300006358 Bacteria 1608
279 Ga0068871_100473496 3300006358 Bacteria 1126
280 Ga0075428_100101687 3300006844 Bacteria 3133
281 Ga0075430_100034456 3300006846 Bacteria 4297
282 Ga0075430_100109091 3300006846 Bacteria 2309
283 Ga0075431_100034361 3300006847 Bacteria 5223
284 Ga0075431_100052328 3300006847 Bacteria 4211
285 Ga0075429_100029093 3300006880 Bacteria 4799
286 Ga0075429_100193894 3300006880 Bacteria 1780
287 Ga0068865_100006221 3300006881 Bacteria 7277
288 Ga0068865_100022991 3300006881 Bacteria 4075
289 Ga0068865_100041947 3300006881 Bacteria 3117
290 Ga0068865_100114232 3300006881 Bacteria 1997
291 Ga0068865_100426501 3300006881 Bacteria 1091
292 Ga0097620_100023045 3300006931 Bacteria 6243
293 Ga0097620_100098578 3300006931 Bacteria 2977
294 Ga0097620_100121412 3300006931 Bacteria 2679
295 Ga0097620_100473176 3300006931 Bacteria 1348
296 Ga0079104_1000206 3300006946 Bacteria 82424
297 Ga0099826_10000021 3300006948 Bacteria 173580
298 Ga0105251_10159709 3300009011 Bacteria 1016
299 Ga0105244_10000031 3300009036 Bacteria 177606
300 Ga0105244_10003602 3300009036 Bacteria 11001
301 Ga0105240_10008920 3300009093 Bacteria 14257
302 Ga0105240_10041470 3300009093 Bacteria 5875
303 Ga0105240_10059308 3300009093 Bacteria 4776
304 Ga0105240_10112031 3300009093 Bacteria 3299
305 Ga0105240_10290611 3300009093 Bacteria 1874
306 Ga0111539_10058487 3300009094 Bacteria 4573
307 Ga0105245_10105475 3300009098 Bacteria 2614
308 Ga0105247_10353938 3300009101 Bacteria 1033
309 Ga0105243_10000765 3300009148 Bacteria 30835
310 Ga0105243_10024959 3300009148 Bacteria 4564
311 Ga0105243_10041298 3300009148 Bacteria 3607
312 Ga0105243_10251968 3300009148 Bacteria 1577
313 Ga0105243_10438575 3300009148 Bacteria 1222
314 Ga0105241_10165743 3300009174 Bacteria 1821
315 Ga0105242_10090130 3300009176 Bacteria 2579
316 Ga0105242_10448469 3300009176 Bacteria 1216
317 Ga0105248_10086277 3300009177 Bacteria 3532
318 Ga0105248_10116526 3300009177 Bacteria 3013
319 Ga0105248_10119263 3300009177 Bacteria 2976
320 Ga0105248_10268583 3300009177 Bacteria 1921
321 Ga0105248_10285586 3300009177 Bacteria 1858
322 Ga0105237_10051964 3300009545 Bacteria 4116
323 Ga0105237_10103567 3300009545 Bacteria 2838
324 Ga0105237_10175171 3300009545 Bacteria 2145
325 Ga0105237_10279165 3300009545 Bacteria 1673
326 Ga0105238_10000065 3300009551 Bacteria 121196
327 Ga0105238_10063764 3300009551 Bacteria 3686
328 Ga0105238_10196657 3300009551 Bacteria 1992
329 Ga0105249_10086300 3300009553 Bacteria 2927
330 Ga0105249_10091395 3300009553 Bacteria 2848
331 Ga0105239_10054735 3300010375 Bacteria 4377
332 Ga0105239_10063942 3300010375 Bacteria 4040
333 Ga0105239_10159772 3300010375 Bacteria 2517
334 Ga0105239_10709275 3300010375 Bacteria 1150
335 Ga0105246_10165345 3300011119 Bacteria 1689
336 Ga0105246_10402965 3300011119 Bacteria 1136
337 Ga0157319_1000695 3300012497 Bacteria 1560
338 Ga0157339_1001068 3300012505 Bacteria 1581
339 Ga0157371_10045298 3300013102 Bacteria 3130
340 Ga0157370_10002003 3300013104 Bacteria 25038
341 Ga0157370_10310879 3300013104 Bacteria 1454
342 Ga0157369_10035810 3300013105 Bacteria 5441
343 Ga0157374_10050728 3300013296 Bacteria 3858
344 Ga0157374_10110971 3300013296 Bacteria 2638
345 Ga0157374_10146904 3300013296 Bacteria 2290
346 Ga0157374_10446048 3300013296 Bacteria 1295
347 Ga0157374_10482189 3300013296 Bacteria 1243
348 Ga0157374_10606869 3300013296 Bacteria 1104
349 Ga0157378_10040681 3300013297 Bacteria 4123
350 Ga0157378_10070198 3300013297 Bacteria 3144
351 Ga0157378_10240961 3300013297 Bacteria 1727
352 Ga0157378_10378962 3300013297 Bacteria 1389
353 Ga0157378_10508236 3300013297 Bacteria 1205
354 Ga0157378_10516439 3300013297 Bacteria 1195
355 Ga0163162_10047977 3300013306 Bacteria 4279
356 Ga0163162_10077315 3300013306 Bacteria 3391
357 Ga0163162_10115597 3300013306 Bacteria 2783
358 Ga0163162_10122403 3300013306 Bacteria 2706
359 Ga0163162_10221744 3300013306 Bacteria 2021
360 Ga0163162_10599824 3300013306 Bacteria 1227
361 Ga0157372_10060900 3300013307 Bacteria 4224
362 Ga0157375_10011762 3300013308 Bacteria 7738
363 Ga0157375_10035622 3300013308 Bacteria 4752
364 Ga0157375_10049483 3300013308 Bacteria 4118
365 Ga0157375_10059297 3300013308 Bacteria 3791
366 Ga0157375_10064588 3300013308 Bacteria 3645
367 Ga0157375_10219009 3300013308 Bacteria 2062
368 Ga0157375_10233301 3300013308 Bacteria 1999
369 Ga0157375_10451319 3300013308 Bacteria 1451
370 Ga0163163_10217309 3300014325 Bacteria 1960
371 Ga0163163_10218492 3300014325 Bacteria 1954
372 Ga0157380_10009058 3300014326 Bacteria 7112
373 Ga0182008_10024475 3300014497 Bacteria 3075
374 Ga0182008_10037502 3300014497 Bacteria 2425
375 Ga0182008_10053291 3300014497 Bacteria 2003
376 Ga0182008_10079655 3300014497 Bacteria 1612
377 Ga0157377_10000016 3300014745 Bacteria 190613
378 Ga0157379_10008726 3300014968 Bacteria 8833
379 Ga0157379_10048728 3300014968 Bacteria 3782
380 Ga0157379_10049079 3300014968 Bacteria 3768
381 Ga0157379_10281376 3300014968 Bacteria 1514
382 Ga0157376_10106693 3300014969 Bacteria 2458
383 Ga0157376_10215134 3300014969 Bacteria 1776
384 Ga0157376_10328135 3300014969 Bacteria 1457
385 Ga0182006_1002966 3300015261 Bacteria 8953
386 Ga0182006_1014559 3300015261 Bacteria 3387
387 Ga0182007_10002108 3300015262 Bacteria 10177
388 Ga0182007_10016980 3300015262 Bacteria 2670
389 Ga0183362_10004 3300015683 Bacteria 569303
390 Ga0163161_10032312 3300017792 Bacteria 3736
391 Ga0163161_10040898 3300017792 Bacteria 3330
392 Ga0163161_10141036 3300017792 Bacteria 1825
393 Ga0163161_10155206 3300017792 Bacteria 1742
394 Ga0163161_10233374 3300017792 Bacteria 1428
395 Ga0163161_10272017 3300017792 Bacteria 1326
396 Ga0213872_10016125 3300021361 Bacteria 3469
397 Ga0209435_100015 3300025206 Bacteria 321177
398 Ga0209435_100019 3300025206 Bacteria 260989
399 Ga0209435_100290 3300025206 Bacteria 12177
400 Ga0209436_104004 3300025208 Bacteria 3726
401 Ga0209436_105266 3300025208 Bacteria 3005
402 Ga0209784_100005 3300025224 Bacteria 1040422
403 Ga0209566_100005 3300025225 Bacteria 1040422
404 Ga0209674_100009 3300025226 Bacteria 1040422
405 Ga0209672_102201 3300025228 Bacteria 5090
406 Ga0209147_100004 3300025229 Bacteria 1371850
407 Ga0209147_100843 3300025229 Bacteria 14406
408 Ga0209563_100012 3300025230 Bacteria 1040422
409 Ga0209437_100758 3300025233 Bacteria 15571
410 Ga0209258_100020 3300025242 Bacteria 565241
411 Ga0209258_100226 3300025242 Bacteria 106588
412 Ga0207425_1000814 3300025245 Bacteria 15617
413 Ga0209646_1000020 3300025246 Bacteria 462204
414 Ga0209646_1000038 3300025246 Bacteria 353982
415 Ga0209646_1000040 3300025246 Bacteria 347867
416 Ga0209026_1000034 3300025250 Bacteria 306953
417 Ga0209026_1000048 3300025250 Bacteria 257264
418 Ga0209026_1003765 3300025250 Bacteria 4808
419 Ga0209677_100006 3300025253 Bacteria 1040422
420 Ga0209148_1000031 3300025254 Bacteria 564601
421 Ga0209759_1000038 3300025256 Bacteria 257264
422 Ga0209759_1000049 3300025256 Bacteria 221692
423 Ga0209759_1000357 3300025256 Bacteria 59208
424 Ga0209129_1000055 3300025258 Bacteria 261708
425 Ga0209129_1006666 3300025258 Bacteria 3660
426 Ga0209565_1000078 3300025263 Bacteria 160838
427 Ga0209565_1000310 3300025263 Bacteria 45322
428 Ga0209565_1000615 3300025263 Bacteria 23470
429 Ga0209565_1001707 3300025263 Bacteria 9041
430 Ga0209565_1016361 3300025263 Bacteria 1651
431 Ga0209673_1000170 3300025273 Bacteria 133933
432 Ga0209673_1001531 3300025273 Bacteria 21069
433 Ga0209673_1002628 3300025273 Bacteria 12057
434 Ga0209673_1011259 3300025273 Bacteria 3700
435 Ga0209673_1026678 3300025273 Bacteria 1892
436 Ga0209673_1027129 3300025273 Bacteria 1868
437 Ga0209130_1000289 3300025284 Bacteria 61485
438 Ga0209130_1000807 3300025284 Bacteria 26513
439 Ga0209130_1001274 3300025284 Bacteria 17481
440 Ga0209130_1011749 3300025284 Bacteria 2329
441 Ga0209130_1012738 3300025284 Bacteria 2184
442 Ga0209675_1000055 3300025291 Bacteria 193129
443 Ga0209675_1001778 3300025291 Bacteria 11775
444 Ga0209675_1002139 3300025291 Bacteria 10421
445 Ga0209675_1010406 3300025291 Bacteria 3179
446 Ga0209675_1016325 3300025291 Bacteria 2168
447 Ga0209675_1018963 3300025291 Bacteria 1908
448 Ga0209676_1000040 3300025292 Bacteria 438184
449 Ga0209676_1003179 3300025292 Bacteria 10438
450 Ga0209676_1011949 3300025292 Bacteria 3455
451 Ga0209676_1013043 3300025292 Bacteria 3219
452 Ga0209676_1017739 3300025292 Bacteria 2507
453 Ga0209025_1000003 3300025294 Bacteria 1366495
454 Ga0209025_1000409 3300025294 Bacteria 86577
455 Ga0209025_1001751 3300025294 Bacteria 26059
456 Ga0209025_1009368 3300025294 Bacteria 6843
457 Ga0209025_1010755 3300025294 Bacteria 6151
458 Ga0209025_1018466 3300025294 Bacteria 3947
459 Ga0209025_1051447 3300025294 Bacteria 1636
460 Ga0209564_1000157 3300025295 Bacteria 164758
461 Ga0209564_1000806 3300025295 Bacteria 42875
462 Ga0209564_1001767 3300025295 Bacteria 20130
463 Ga0209564_1002258 3300025295 Bacteria 15792
464 Ga0209758_1000042 3300025297 Bacteria 407145
465 Ga0209758_1005953 3300025297 Bacteria 9040
466 Ga0209758_1040043 3300025297 Bacteria 1773
467 Ga0209050_1000021 3300025298 Bacteria 574406
468 Ga0209050_1000760 3300025298 Bacteria 46346
469 Ga0209050_1003967 3300025298 Bacteria 10438
470 Ga0209050_1004794 3300025298 Bacteria 8911
471 Ga0209050_1015628 3300025298 Bacteria 3170
472 Ga0209050_1041968 3300025298 Bacteria 1255
473 Ga0209256_1000036 3300025299 Bacteria 386664
474 Ga0209256_1000056 3300025299 Bacteria 283044
475 Ga0209256_1000124 3300025299 Bacteria 165390
476 Ga0209256_1000127 3300025299 Bacteria 164393
477 Ga0209256_1000906 3300025299 Bacteria 36323
478 Ga0207426_1000055 3300025302 Bacteria 374450
479 Ga0207426_1000079 3300025302 Bacteria 314709
480 Ga0207426_1000091 3300025302 Bacteria 280561
481 Ga0209051_1000025 3300025303 Bacteria 415397
482 Ga0209051_1000068 3300025303 Bacteria 220063
483 Ga0209051_1000351 3300025303 Bacteria 68445
484 Ga0209051_1000423 3300025303 Bacteria 58174
485 Ga0209051_1000446 3300025303 Bacteria 55218
486 Ga0209051_1000530 3300025303 Bacteria 47308
487 Ga0209051_1008921 3300025303 Bacteria 5237
488 Ga0209051_1013428 3300025303 Bacteria 3898
489 Ga0209051_1015139 3300025303 Bacteria 3562
490 Ga0209257_1000015 3300025304 Bacteria 908141
491 Ga0209257_1000039 3300025304 Bacteria 591694
492 Ga0209257_1000043 3300025304 Bacteria 512127
493 Ga0209257_1001377 3300025304 Bacteria 29185
494 Ga0209257_1003725 3300025304 Bacteria 12653
495 Ga0209257_1013914 3300025304 Bacteria 3516
496 Ga0209257_1024395 3300025304 Bacteria 2094
497 Ga0207697_10020918 3300025315 Bacteria 2679
498 Ga0207656_10087638 3300025321 Bacteria 1408
499 Ga0207656_10170628 3300025321 Bacteria 1040
500 Ga0207655_1000029 3300025728 Bacteria 432187
501 Ga0207655_1005080 3300025728 Bacteria 9094
502 Ga0207682_10001047 3300025893 Bacteria 12739
503 Ga0207682_10006237 3300025893 Bacteria 4818
504 Ga0207682_10095522 3300025893 Bacteria 1294
505 Ga0207642_10044161 3300025899 Bacteria 1971
506 Ga0207642_10136047 3300025899 Bacteria 1289
507 Ga0207688_10043780 3300025901 Bacteria 2494
508 Ga0207680_10001068 3300025903 Bacteria 12931
509 Ga0207680_10039848 3300025903 Bacteria 2729
510 Ga0207680_10056911 3300025903 Bacteria 2364
511 Ga0207680_10424525 3300025903 Bacteria 942
512 Ga0207645_10004706 3300025907 Bacteria 10041
513 Ga0207645_10014655 3300025907 Bacteria 5235
514 Ga0207645_10071087 3300025907 Bacteria 2227
515 Ga0207645_10094840 3300025907 Bacteria 1921
516 Ga0207645_10095900 3300025907 Bacteria 1910
517 Ga0207643_10017706 3300025908 Bacteria 3899
518 Ga0207643_10042663 3300025908 Bacteria 2558
519 Ga0207643_10080252 3300025908 Bacteria 1890
520 Ga0207684_10023176 3300025910 Bacteria 5302
521 Ga0207695_10002732 3300025913 Bacteria 25730
522 Ga0207695_10007216 3300025913 Bacteria 14208
523 Ga0207695_10082478 3300025913 Bacteria 3250
524 Ga0207695_10123453 3300025913 Bacteria 2555
525 Ga0207695_10178105 3300025913 Bacteria 2048
526 Ga0207695_10628475 3300025913 Bacteria 955
527 Ga0207671_10002693 3300025914 Bacteria 18627
528 Ga0207671_10061344 3300025914 Bacteria 2790
529 Ga0207671_10126738 3300025914 Bacteria 1956
530 Ga0207671_10214023 3300025914 Bacteria 1508
531 Ga0207662_10027183 3300025918 Bacteria 3303
532 Ga0207662_10199852 3300025918 Bacteria 1293
533 Ga0207657_10255358 3300025919 Bacteria 1396
534 Ga0207649_10324495 3300025920 Bacteria 1132
535 Ga0207681_10006325 3300025923 Bacteria 7268
536 Ga0207681_10079980 3300025923 Bacteria 2304
537 Ga0207681_10098926 3300025923 Bacteria 2099
538 Ga0207694_10000977 3300025924 Bacteria 25038
539 Ga0207694_10281387 3300025924 Bacteria 1366
540 Ga0207694_10349242 3300025924 Bacteria 1224
541 Ga0207650_10000710 3300025925 Bacteria 25994
542 Ga0207650_10009975 3300025925 Bacteria 6501
543 Ga0207650_10028205 3300025925 Bacteria 4023
544 Ga0207650_10046048 3300025925 Bacteria 3211
545 Ga0207650_10066503 3300025925 Bacteria 2703
546 Ga0207650_10067275 3300025925 Bacteria 2688
547 Ga0207650_10101393 3300025925 Bacteria 2216
548 Ga0207650_10164554 3300025925 Bacteria 1759
549 Ga0207659_10000322 3300025926 Bacteria 28877
550 Ga0207659_10008216 3300025926 Bacteria 6469
551 Ga0207659_10008726 3300025926 Bacteria 6309
552 Ga0207659_10015561 3300025926 Bacteria 4932
553 Ga0207659_10065728 3300025926 Bacteria 2629
554 Ga0207659_10165010 3300025926 Bacteria 1742
555 Ga0207659_10240214 3300025926 Bacteria 1465
556 Ga0207644_10001344 3300025931 Bacteria 15805
557 Ga0207644_10001677 3300025931 Bacteria 14280
558 Ga0207644_10032216 3300025931 Bacteria 3655
559 Ga0207644_10087523 3300025931 Bacteria 2315
560 Ga0207644_10104089 3300025931 Bacteria 2136
561 Ga0207644_10129888 3300025931 Bacteria 1927
562 Ga0207690_10313305 3300025932 Bacteria 1231
563 Ga0207706_10003941 3300025933 Bacteria 14064
564 Ga0207706_10102503 3300025933 Bacteria 2518
565 Ga0207706_10115153 3300025933 Bacteria 2364
566 Ga0207706_10348057 3300025933 Bacteria 1289
567 Ga0207709_10000602 3300025935 Bacteria 29841
568 Ga0207709_10022513 3300025935 Bacteria 3574
569 Ga0207709_10040350 3300025935 Bacteria 2795
570 Ga0207670_10011674 3300025936 Bacteria 5110
571 Ga0207670_10048461 3300025936 Bacteria 2835
572 Ga0207669_10003485 3300025937 Bacteria 6803
573 Ga0207669_10003984 3300025937 Bacteria 6454
574 Ga0207669_10343979 3300025937 Bacteria 1149
575 Ga0207691_10000018 3300025940 Bacteria 134343
576 Ga0207691_10012940 3300025940 Bacteria 7991
577 Ga0207691_10028725 3300025940 Bacteria 5204
578 Ga0207691_10182602 3300025940 Bacteria 1833
579 Ga0207691_10186128 3300025940 Bacteria 1813
580 Ga0207691_10214481 3300025940 Bacteria 1671
581 Ga0207691_10234077 3300025940 Bacteria 1590
582 Ga0207691_10270263 3300025940 Bacteria 1464
583 Ga0207691_10419650 3300025940 Bacteria 1140
584 Ga0207691_10446115 3300025940 Bacteria 1101
585 Ga0207711_10005256 3300025941 Bacteria 10975
586 Ga0207711_10042630 3300025941 Bacteria 3867
587 Ga0207711_10089412 3300025941 Bacteria 2706
588 Ga0207711_10211901 3300025941 Bacteria 1770
589 Ga0207711_10435873 3300025941 Bacteria 1219
590 Ga0207689_10006735 3300025942 Bacteria 10132
591 Ga0207689_10007284 3300025942 Bacteria 9712
592 Ga0207689_10061475 3300025942 Bacteria 3089
593 Ga0207689_10167766 3300025942 Bacteria 1809
594 Ga0207689_10367962 3300025942 Bacteria 1196
595 Ga0207689_10472244 3300025942 Bacteria 1050
596 Ga0207661_10192549 3300025944 Bacteria 1788
597 Ga0207679_10042747 3300025945 Bacteria 3259
598 Ga0207679_10065938 3300025945 Bacteria 2711
599 Ga0207679_10091344 3300025945 Bacteria 2356
600 Ga0207679_10132589 3300025945 Bacteria 2001
601 Ga0207667_10011582 3300025949 Bacteria 10240
602 Ga0207667_10016772 3300025949 Bacteria 8264
603 Ga0207667_10433859 3300025949 Bacteria 1336
604 Ga0207667_10644054 3300025949 Bacteria 1066
605 Ga0207651_10003638 3300025960 Bacteria 7603
606 Ga0207651_10037982 3300025960 Bacteria 3159
607 Ga0207651_10150357 3300025960 Bacteria 1811
608 Ga0207651_10192900 3300025960 Bacteria 1626
609 Ga0207712_10076268 3300025961 Bacteria 2426
610 Ga0207668_10020765 3300025972 Bacteria 4180
611 Ga0207668_10211799 3300025972 Bacteria 1550
612 Ga0207668_10287717 3300025972 Bacteria 1351
613 Ga0207640_10211336 3300025981 Bacteria 1478
614 Ga0207640_10234350 3300025981 Bacteria 1414
615 Ga0207640_10291698 3300025981 Bacteria 1286
616 Ga0207658_10006133 3300025986 Bacteria 8204
617 Ga0207658_10023598 3300025986 Bacteria 4295
618 Ga0207658_10032603 3300025986 Bacteria 3709
619 Ga0207658_10050765 3300025986 Bacteria 3054
620 Ga0207658_10118246 3300025986 Bacteria 2108
621 Ga0207658_10267976 3300025986 Bacteria 1458
622 Ga0207677_10004386 3300026023 Bacteria 7561
623 Ga0207677_10006410 3300026023 Bacteria 6452
624 Ga0207677_10006484 3300026023 Bacteria 6427
625 Ga0207677_10012052 3300026023 Bacteria 4952
626 Ga0207677_10195210 3300026023 Bacteria 1604
627 Ga0207677_10433020 3300026023 Bacteria 1123
628 Ga0207703_10000817 3300026035 Bacteria 30675
629 Ga0207703_10047463 3300026035 Bacteria 3463
630 Ga0207703_10085234 3300026035 Bacteria 2643
631 Ga0207639_10009051 3300026041 Bacteria 6860
632 Ga0207678_10048631 3300026067 Bacteria 3665
633 Ga0207641_10005073 3300026088 Bacteria 11290
634 Ga0207641_10049395 3300026088 Bacteria 3555
635 Ga0207641_10074666 3300026088 Bacteria 2925
636 Ga0207641_10083149 3300026088 Bacteria 2783
637 Ga0207641_10182140 3300026088 Bacteria 1925
638 Ga0207648_10000515 3300026089 Bacteria 43207
639 Ga0207648_10026670 3300026089 Bacteria 5132
640 Ga0207648_10032136 3300026089 Bacteria 4637
641 Ga0207648_10052000 3300026089 Bacteria 3581
642 Ga0207648_10077196 3300026089 Bacteria 2903
643 Ga0207648_10086284 3300026089 Bacteria 2738
644 Ga0207648_10124194 3300026089 Bacteria 2270
645 Ga0207648_10135345 3300026089 Bacteria 2170
646 Ga0207648_10148502 3300026089 Bacteria 2068
647 Ga0207648_10244922 3300026089 Bacteria 1597
648 Ga0207676_10001475 3300026095 Bacteria 17445
649 Ga0207676_10010532 3300026095 Bacteria 6588
650 Ga0207676_10011558 3300026095 Bacteria 6314
651 Ga0207676_10017436 3300026095 Bacteria 5203
652 Ga0207676_10019636 3300026095 Bacteria 4933
653 Ga0207676_10078691 3300026095 Bacteria 2671
654 Ga0207676_10112667 3300026095 Bacteria 2279
655 Ga0207676_10250526 3300026095 Bacteria 1594
656 Ga0207674_10012362 3300026116 Bacteria 9542
657 Ga0207674_10016088 3300026116 Bacteria 8193
658 Ga0207674_10050876 3300026116 Bacteria 4230
659 Ga0207674_10076115 3300026116 Bacteria 3365
660 Ga0207674_10202405 3300026116 Bacteria 1935
661 Ga0207674_10217177 3300026116 Bacteria 1860
662 Ga0207675_100004701 3300026118 Bacteria 13140
663 Ga0207675_100024107 3300026118 Bacteria 5657
664 Ga0207675_100030188 3300026118 Bacteria 5049
665 Ga0207675_100049796 3300026118 Bacteria 3909
666 Ga0207675_100057248 3300026118 Bacteria 3637
667 Ga0207675_100225865 3300026118 Bacteria 1805
668 Ga0207683_10000020 3300026121 Bacteria 118805
669 Ga0207683_10024111 3300026121 Bacteria 5236
670 Ga0207683_10044935 3300026121 Bacteria 3862
671 Ga0207683_10089845 3300026121 Bacteria 2734
672 Ga0207683_10104296 3300026121 Bacteria 2534
673 Ga0207683_10113807 3300026121 Bacteria 2424
674 Ga0207683_10219993 3300026121 Bacteria 1730
675 Ga0207683_10396596 3300026121 Bacteria 1269
676 Ga0207698_10007168 3300026142 Bacteria 6981
677 Ga0207698_10038539 3300026142 Bacteria 3532
678 Ga0207698_10146995 3300026142 Bacteria 2040
679 Ga0207698_10253160 3300026142 Bacteria 1613
680 Ga0209281_1000259 3300027111 Bacteria 101905
681 Ga0209970_1000196 3300027614 Bacteria 9671
682 Ga0209282_1000019 3300027666 Bacteria 184034
683 Ga0209282_1000139 3300027666 Bacteria 42847
684 Ga0209813_10024788 3300027866 Bacteria 1719
685 Ga0268266_10018522 3300028379 Bacteria 5933
686 Ga0268266_10024477 3300028379 Bacteria 5133
687 Ga0268266_10040123 3300028379 Bacteria 3989
688 Ga0268266_10271557 3300028379 Bacteria 1574
689 Ga0268265_10011207 3300028380 Bacteria 6060
690 Ga0268265_10029780 3300028380 Bacteria 3924
691 Ga0268265_10137561 3300028380 Bacteria 2040
692 Ga0268265_10298618 3300028380 Bacteria 1449
693 Ga0268264_10003598 3300028381 Bacteria 13341
694 Ga0268264_10052836 3300028381 Bacteria 3389
695 Ga0268264_10086924 3300028381 Bacteria 2687
696 Ga0307517_10002655 3300028786 Bacteria 28561
697 Ga0307515_10000138 3300028794 Bacteria 173220
698 Ga0307515_10000322 3300028794 Bacteria 118563
699 Ga0307515_10001193 3300028794 Bacteria 59425
700 Ga0307515_10002234 3300028794 Bacteria 42472
701 Ga0307515_10023840 3300028794 Bacteria 10697
702 Ga0307515_10041898 3300028794 Bacteria 7183
703 Ga0307515_10067248 3300028794 Bacteria 4946
704 Ga0307515_10094964 3300028794 Bacteria 3676
705 Ga0307515_10096814 3300028794 Bacteria 3614
706 Ga0307515_10135512 3300028794 Bacteria 2680
707 Ga0307515_10146542 3300028794 Bacteria 2496
708 Ga0307512_10066347 3300030522 Bacteria 2727
709 Ga0316176_1141751 3300030732 Bacteria 1968
710 Ga0314311_1073339 3300030733 Bacteria 2422
711 Ga0316179_1111618 3300030734 Bacteria 1462
712 Ga0316183_1025835 3300030742 Bacteria 2932
713 Ga0265330_10014274 3300031235 Bacteria 3687
714 Ga0265330_10047066 3300031235 Bacteria 1899
715 Ga0265332_10035841 3300031238 Bacteria 2154
716 Ga0265329_10011414 3300031242 Bacteria 3228
717 Ga0265331_10043380 3300031250 Bacteria 2179
718 Ga0265327_10003094 3300031251 Bacteria 16421
719 Ga0265327_10005552 3300031251 Bacteria 10473
720 Ga0265316_10199220 3300031344 Bacteria 1485
721 Ga0307513_10000013 3300031456 Bacteria 325682
722 Ga0307513_10000246 3300031456 Bacteria 78455
723 Ga0307513_10007912 3300031456 Bacteria 13688
724 Ga0307513_10027457 3300031456 Bacteria 6536
725 Ga0307513_10075694 3300031456 Bacteria 3494
726 Ga0307513_10104696 3300031456 Bacteria 2842
727 Ga0307513_10122436 3300031456 Bacteria 2565
728 Ga0307513_10270462 3300031456 Bacteria 1483
729 Ga0307513_10325978 3300031456 Bacteria 1292
730 Ga0307509_10007099 3300031507 Bacteria 14778
731 Ga0307509_10019271 3300031507 Bacteria 7789
732 Ga0307509_10033367 3300031507 Bacteria 5666
733 Ga0307509_10164667 3300031507 Bacteria 2108
734 Ga0307408_100000008 3300031548 Bacteria 456355
735 Ga0307408_100006968 3300031548 Bacteria 7479
736 Ga0307408_100054021 3300031548 Bacteria 2903
737 Ga0307408_100086583 3300031548 Bacteria 2355
738 Ga0307408_100111446 3300031548 Bacteria 2102
739 Ga0307408_100152716 3300031548 Bacteria 1824
740 Ga0307508_10000450 3300031616 Bacteria 49283
741 Ga0307508_10008054 3300031616 Bacteria 9770
742 Ga0307508_10055717 3300031616 Bacteria 3501
743 Ga0307514_10001030 3300031649 Bacteria 40201
744 Ga0307514_10004889 3300031649 Bacteria 12181
745 Ga0307514_10008692 3300031649 Bacteria 8613
746 Ga0307514_10009061 3300031649 Bacteria 8406
747 Ga0307514_10109370 3300031649 Bacteria 1963
748 Ga0307514_10156290 3300031649 Bacteria 1520
749 Ga0265314_10008574 3300031711 Bacteria 8741
750 Ga0265314_10038564 3300031711 Bacteria 3450
751 Ga0265342_10038530 3300031712 Bacteria 2910
752 Ga0307516_10008482 3300031730 Bacteria 11617
753 Ga0307516_10077658 3300031730 Bacteria 3168
754 Ga0307516_10353428 3300031730 Bacteria 1135
755 Ga0307405_10252917 3300031731 Bacteria 1312
756 Ga0307518_10244042 3300031838 Bacteria 1149
757 Ga0307518_10330066 3300031838 Bacteria 904
758 Ga0307406_10004336 3300031901 Bacteria 7719
759 Ga0307406_10012119 3300031901 Bacteria 4907
760 Ga0307412_10000392 3300031911 Bacteria 27005
761 Ga0307412_10008739 3300031911 Bacteria 5795
762 Ga0307412_10193682 3300031911 Bacteria 1538
763 Ga0307412_10357730 3300031911 Bacteria 1174
764 Ga0307412_10517187 3300031911 Bacteria 996
765 Ga0307414_10115733 3300032004 Bacteria 2051
766 Ga0307414_10293586 3300032004 Bacteria 1371
767 Ga0307411_10002080 3300032005 Bacteria 8618
768 Ga0307415_100694203 3300032126 Bacteria 918
769 Ga0307510_10034007 3300033180 Bacteria 5714
770 Ga0373936_0043270 3300035113 Bacteria 1810
771 Ga0373957_0028893 3300035120 Bacteria 2023
772 Ga0373955_0292472 3300035172 Bacteria 981
773 Ga0373931_0025968 3300035691 Bacteria 2976
774 Ga0373933_0190358 3300035724 Bacteria 1310
775 Ga0373937_0040657 3300036401 Bacteria 4239
776 Ga0373925_0461305 3300037068 Bacteria 1041
777 Ga0395905_0052780 3300037471 Bacteria 3805
778 Ga0395901_0111180 3300038443 Bacteria 2877
779 Ga0436360_1081132 3300039438 Bacteria 1138
780 Ga0436361_0032066 3300039447 Bacteria 3843
781 Ga0436361_0206607 3300039447 Bacteria 3756
782 Ga0436363_0171481 3300039450 Bacteria 1096
783 Ga0439439_0003401 3300041406 Bacteria 3510
784 Ga0439466_0002610 3300041411 Bacteria 7054
785 Ga0439466_0020082 3300041411 Bacteria 2386
786 Ga0451839_0601462 3300041496 Bacteria 870
787 Ga0439445_0001509 3300042004 Bacteria 5056
788 Ga0439432_002290 3300042006 Bacteria 7216
789 Ga0439449_0000753 3300042007 Bacteria 12445
790 Ga0439449_0004213 3300042007 Bacteria 5558
791 Ga0439452_002755 3300042010 Bacteria 6353
792 Ga0450923_031374 3300042125 Bacteria 1085
793 Ga0450898_003737 3300042134 Bacteria 2203
794 Ga0450909_011691 3300042185 Bacteria 1286
795 Ga0439434_0001757 3300042435 Bacteria 6291
796 Ga0450918_002439 3300042531 Bacteria 3517
797 Ga0466972_0000880 3300044658 Bacteria 14429
798 Ga0466965_0002203 3300044683 Bacteria 8200
799 Ga0466964_0007106 3300044706 Bacteria 4188
800 Ga0466964_0012803 3300044706 Bacteria 3177
801 Ga0453684_0391028 3300044712 Bacteria 1560
802 Ga0466968_0008025 3300044735 Bacteria 4035
803 Ga0451576_0019302 3300045051 Bacteria 7442
804 Ga0451576_0039018 3300045051 Bacteria 5026
805 Ga0495638_0077305 3300046460 Bacteria 2027
806 Ga0495585_0074205 3300046492 Bacteria 1851
807 Ga0495596_0000064 3300046500 Bacteria 77744
808 Ga0495607_0000507 3300046501 Bacteria 38608
809 Ga0495610_0001367 3300046512 Bacteria 21670
810 Ga0495610_0019846 3300046512 Bacteria 3748
811 Ga0495616_0000866 3300046513 Bacteria 21983
812 Ga0495620_0051816 3300046515 Bacteria 1745
813 Ga0495632_0112483 3300046519 Bacteria 1277
814 Ga0495637_0005420 3300046520 Bacteria 6507
815 Ga0495648_0110383 3300046524 Bacteria 1498
816 Ga0495642_0033322 3300046528 Bacteria 2071
817 Ga0495642_0057359 3300046528 Bacteria 1610
818 Ga0495654_0000834 3300046530 Bacteria 23400
819 Ga0495609_0000244 3300046538 Bacteria 51384
820 Ga0495656_0000365 3300046615 Bacteria 15165
821 Ga0495625_0010498 3300046660 Bacteria 7655
822 Ga0495661_0008722 3300046665 Bacteria 6997
823 Ga0495588_0097715 3300046674 Bacteria 1541
824 Ga0495671_0000453 3300046692 Bacteria 32377
825 Ga0495649_0004212 3300046694 Bacteria 9435
826 Ga0495660_0031902 3300046810 Bacteria 2960
827 Ga0495672_0032883 3300047320 Bacteria 3219
828 Ga0495676_0089794 3300047321 Bacteria 2301
829 Ga0495687_027112 3300047443 Bacteria 2685
830 Ga0495685_001488 3300047447 Bacteria 7169
831 Ga0495686_0241770 3300047472 Bacteria 1018
832 Ga0495593_0037115 3300047673 Bacteria 2638
833 Ga0495614_0107705 3300048089 Bacteria 1222
834 Ga0496101_0379158 3300048904 Bacteria 1113
835 Ga0496102_0206626 3300048905 Bacteria 1851
836 Ga0496103_0084378 3300048906 Bacteria 2001
837 Ga0496104_0032473 3300048907 Bacteria 4859
838 Ga0496105_0012904 3300048908 Bacteria 6622
839 Ga0496106_0284822 3300048909 Bacteria 1324
840 Ga0496108_0452077 3300048911 Bacteria 1122
841 Ga0496109_0058519 3300048912 Bacteria 3520
842 Ga0496110_0537597 3300048913 Bacteria 1063
843 Ga0496114_0186150 3300048917 Bacteria 1815
844 Ga0496115_0025937 3300048918 Bacteria 4568
845 Ga0496116_0001004 3300048919 Bacteria 34438
846 Ga0496116_0011864 3300048919 Bacteria 7170
847 Ga0496116_0013245 3300048919 Bacteria 6667
848 Ga0496116_0067024 3300048919 Bacteria 2294
849 Ga0496116_0081581 3300048919 Bacteria 2004
850 Ga0496116_0125457 3300048919 Bacteria 1475
851 Ga0496117_0068338 3300048920 Bacteria 2399
852 Ga0496118_0019857 3300048921 Bacteria 5988
853 Ga0496118_0053756 3300048921 Bacteria 3057
854 Ga0496118_0085109 3300048921 Bacteria 2203
855 Ga0496119_0003325 3300048922 Bacteria 16773
856 Ga0496120_0003204 3300048923 Bacteria 15214
857 Ga0496121_0001404 3300048924 Bacteria 40784
858 Ga0496121_0005640 3300048924 Bacteria 15922
859 Ga0496121_0143282 3300048924 Bacteria 1769
860 Ga0496121_0218094 3300048924 Bacteria 1346
861 Ga0496121_0232548 3300048924 Bacteria 1290
862 Ga0496122_0000029 3300048925 Bacteria 336396
863 Ga0496122_0000317 3300048925 Bacteria 105883
864 Ga0496122_0004249 3300048925 Bacteria 17968
865 Ga0496122_0004463 3300048925 Bacteria 17342
866 Ga0496123_0000124 3300048926 Bacteria 158327
867 Ga0496123_0000531 3300048926 Bacteria 65624
868 Ga0496123_0001487 3300048926 Bacteria 32545
869 Ga0496123_0001761 3300048926 Bacteria 28565
870 Ga0496123_0003891 3300048926 Bacteria 16246
871 Ga0496124_0000024 3300048927 Bacteria 414291
872 Ga0496124_0004949 3300048927 Bacteria 15271
873 Ga0496124_0034977 3300048927 Bacteria 4399
874 Ga0496124_0122058 3300048927 Bacteria 2080
875 Ga0496124_0149259 3300048927 Bacteria 1836
876 Ga0496124_0223673 3300048927 Bacteria 1413
877 Ga0496125_0000244 3300048928 Bacteria 111663
878 Ga0496125_0015625 3300048928 Bacteria 7326
879 Ga0496125_0030924 3300048928 Bacteria 4779
880 Ga0496126_0043446 3300048929 Bacteria 4146
881 Ga0495682_0000003 3300049460 Bacteria 515787
882 Ga0501048_0160292 3300049582 Bacteria 1592
883 nmdc:mga00v17_56590_c1 3300050491 Bacteria 2398
884 nmdc:mga0yw44_243798_c1 3300050492 Bacteria 1195
885 nmdc:mga0k408_247959_c1 3300050493 Bacteria 1063
886 nmdc:mga0k408_254840_c1 3300050493 Bacteria 1048
887 nmdc:mga0k408_26319_c1 3300050493 Bacteria 3298
888 nmdc:mga0k408_4891_c2 3300050493 Bacteria 4094
889 nmdc:mga0k408_7822_c1 3300050493 Bacteria 5715
890 nmdc:mga07m45_10453_c1 3300050496 Bacteria 4848
891 nmdc:mga07m45_122_c1 3300050496 Bacteria 24374
892 nmdc:mga07m45_15544_c1 3300050496 Bacteria 4064
893 nmdc:mga07m45_196634_c1 3300050496 Bacteria 1173
894 nmdc:mga07m45_4239_c1 3300050496 Bacteria 7019
895 nmdc:mga07m45_93670_c1 3300050496 Bacteria 1722
896 nmdc:mga05p37_92917_c1 3300050507 Bacteria 3718
897 nmdc:mga09592_68309_c1 3300050508 Bacteria 3014
898 nmdc:mga09592_70483_c1 3300050508 Bacteria 2966
899 nmdc:mga0qj67_99755_c1 3300050509 Bacteria 2340
900 nmdc:mga06r32_51310_c1 3300050510 Bacteria 3947
901 nmdc:mga06r32_752362_c1 3300050510 Bacteria 938
902 nmdc:mga0sz30_123992_c1 3300050516 Bacteria 1136
903 nmdc:mga0sz30_147099_c1 3300050516 Bacteria 1041
904 nmdc:mga0sz30_15597_c1 3300050516 Bacteria 2709
905 Ga0495601_0156569 3300053077 Bacteria 1488
906 Ga0500610_0003992 3300053079 Bacteria 5774
907 Ga0500644_0000575 3300053088 Bacteria 14233
908 Ga0500571_006720 3300053110 Bacteria 6233
909 Ga0500593_000414 3300053117 Bacteria 16854
910 Ga0500593_003241 3300053117 Bacteria 6120
911 Ga0500594_0017153 3300053118 Bacteria 1768
912 Ga0500595_000002 3300053119 Bacteria 1074388
913 Ga0500618_002619 3300053125 Bacteria 6628
914 Ga0500658_0002081 3300053134 Bacteria 7784
915 Ga0500559_0000047 3300053136 Bacteria 95447
916 Ga0500568_0061648 3300053139 Bacteria 1450
917 Ga0500574_011876 3300053141 Bacteria 1978
918 Ga0500616_0000002 3300053153 Bacteria 1611257
919 Ga0500619_000077 3300053154 Bacteria 27224
920 Ga0500634_0013275 3300053161 Bacteria 4317
921 Ga0500636_0083949 3300053177 Bacteria 1832
922 Ga0500587_002315 3300053739 Bacteria 2709
923 2511250033 2511231003 Bacteria 5606035
924 2521557336 2521172590 Bacteria 5047645
925 2553005314 2551306416 Bacteria 6152985
926 2587759442 2585428062 Bacteria 6842168
927 2599622444 2599185214 Bacteria 8209958
928 2599674464 2599185226 Bacteria 8233575
929 2599680149 2599185227 Bacteria 8246414
930 2599692165 2599185229 Bacteria 8216126
931 2599906620 2599185292 Bacteria 6290804
932 2643860823 2643221569 Bacteria 6064337
933 2643936098 2643221585 Bacteria 5812563
934 2643981333 2643221594 Bacteria 5811388
935 2644060571 2643221609 Bacteria 6756331
936 2644073899 2643221611 Bacteria 6820941
937 2644124117 2643221621 Bacteria 6212786
938 2644160849 2643221628 Bacteria 5745828
939 2644221861 2643221639 Bacteria 6649903
940 2644257345 2643221646 Bacteria 6433402
941 2644316743 2643221656 Bacteria 5809961
942 2644396904 2643221672 Bacteria 6322190
943 2738719305 2738541277 Bacteria 7458140
944 2738883349 2738541307 Bacteria 8606193
945 2739242601 2738543012 Bacteria 7115078
946 2739247375 2738543013 Bacteria 5618633
947 2739282964 2738543019 Bacteria 7459457
948 2765568462 2765235838 Bacteria 5445269
949 2809035250 2808606395 Bacteria 6020352
950 2816473078 2816332133 Bacteria 7249298
951 2819592017 2818991445 Bacteria 4955017
952 2819599144 2818991446 Bacteria 7757362
953 2819617670 2818991449 Bacteria 5518009
954 2831270925 2831265667 Bacteria 7184833
955 2838058972 2838054893 Bacteria 7451788
956 2839095299 2839094727 Bacteria 5534556
957 2842679286 2842677519 Bacteria 5615038
958 2842737764 2842733646 Bacteria 5716726
959 2842738290 2842733646 Bacteria 5716726
960 2842750713 2842747753 Bacteria 5578255
961 2855731335 2855730933 Bacteria 7047938
962 2855768041 2855767633 Bacteria 7049357
963 2857542285 2857537821 Bacteria 5248181
964 2857545049 2857542790 Bacteria 5326616
965 2857577018 2857576091 Bacteria 5465855
966 2858953573 2858950400 Bacteria 6783797
967 2881413781 2881412998 Bacteria 6492157
968 2884814033 2884811622 Bacteria 5552861
969 2884840567 2884836552 Bacteria 5219991
970 2884855824 2884852848 Bacteria 5221161
971 2885193976 2885192300 Bacteria 5882526
972 2885202258 2885198086 Bacteria 7212419
973 2885215911 2885211737 Bacteria 7212420
974 2896157251 2896154374 Bacteria 5221518
975 2899929968 2899924645 Bacteria 7487985
976 2904439929 2904439833 Bacteria 5931679
977 2904451618 2904449895 Bacteria 6927402
978 2904453000 2904449895 Bacteria 6927402
979 2904459962 2904456579 Bacteria 6819253
980 2904461893 2904456579 Bacteria 6819253
981 2904482326 2904479285 Bacteria 5073931
982 2904531126 2904530477 Bacteria 5876334
983 2904543295 2904541872 Bacteria 8915136
984 2904587229 2904584206 Bacteria 6028872
985 2904592736 2904589729 Bacteria 6113573
986 2904604481 2904601388 Bacteria 5884906
987 2919050246 2919046199 Bacteria 5567169
988 2919082303 2919079590 Bacteria 5946433
989 2919464482 2919462493 Bacteria 5817112
990 2919706843 2919704043 Bacteria 5560311
991 2923515996 2923510766 Bacteria 5926163
992 2928043503 2928037797 Bacteria 7273642
993 2928049867 2928044640 Bacteria 7271509
994 2928054442 2928051484 Bacteria 7773759
995 2928070028 2928064002 Bacteria 7419480
996 2928074353 2928070936 Bacteria 8062541
997 2928086591 2928084124 Bacteria 7159212
998 2928118845 2928115317 Bacteria 6477646
999 2929160527 2929160207 Bacteria 9075316
1000 2929525959 2929520902 Bacteria 6765052
1001 2929526537 2929520902 Bacteria 6765052
1002 2941484660
1003 2945915519 2945909444 Bacteria 7065066
1004 2945974136 2945972063 Bacteria 6086495
1005 2945974897 2945972063 Bacteria 6086495
1006 2945989083 2945984333 Bacteria 7358892
1007 8003405435 8003400568 Bacteria 5535898
1008 JGI25155J39150_1000042
1009 JGI24740J21852_10010263
1010 JGI24739J22299_10015867
1011 JGI25155J39150_1000651
1012 JGI25155J39150_1001094
1013 JGI25156J39149_1000053
1014 JGI25156J39149_1000170
1015 JGI25156J39149_1001869
1016 JGI25156J39149_1007194
1017 JGI25162J39368_1003814
1018 JGI25154J39366_1000082
1019 JGI25154J39366_1000306
1020 JGI25154J39366_1000455
1021 JGI25157J39369_1000072
1022 JGI25157J39369_1000170
1023 JGI25159J45721_1002106
1024 JGI25159J45721_1010517
1025 JGI25151J46595_10000301
1026 JGI25151J46595_10011183
1027 JGI25153J46596_10012010
1028 rootL2_10017868
1029 rootH1_10005172
1030 JGI25160J50197_1000227
1031 JGI25161J50226_1000007
1032 Ga0055538_1000013
1033 Ga0055539_1000018
1034 Ga0055533_1000022
1035 Ga0055532_1000017
1036 Ga0055525_1000024
1037 Ga0055535_1000260
1038 Ga0055535_1005719
1039 Ga0055542_1000013
1040 Ga0055526_1021281
1041 Ga0055537_1002740
1042 Ga0055524_1000052
1043 Ga0055524_1001441
1044 Ga0055536_1004462
1045 Ga0055534_1001477
1046 Ga0055534_1002933
1047 Ga0055534_1006234
1048 Ga0055530_10003439
1049 Ga0055530_10004911
1050 Ga0055530_10018827
1051 Ga0055540_1000123
1052 Ga0055540_1002288
1053 Ga0055540_1013297
1054 Ga0055531_10000740
1055 Ga0055531_10001116
1056 Ga0055531_10016084
1057 Ga0055541_1000013
1058 Ga0055543_1000386
1059 Ga0065165_1013879
1060 Ga0065704_10000444
1061 Ga0065715_10020215
1062 Ga0065715_10035108
1063 Ga0065715_10125321
1064 Ga0070658_10224146
1065 Ga0070676_10002668
1066 Ga0070676_10277204
1067 Ga0070683_100129404
1068 Ga0070683_100647230
1069 Ga0070690_100031929
1070 Ga0070670_100001971
1071 Ga0070670_100014554
1072 Ga0070670_100029888
1073 Ga0070670_100037645
1074 Ga0070670_100043346
1075 Ga0070670_100089726
1076 Ga0070670_100119461
1077 Ga0070670_100188056
1078 Ga0070670_100328284
1079 Ga0070677_10006417
1080 Ga0070677_10009189
1081 Ga0070677_10010076
1082 Ga0068869_100041131
1083 Ga0068869_100402150
1084 Ga0070666_10000758
1085 Ga0070666_10002174
1086 Ga0070666_10079624
1087 Ga0070666_10363788
1088 Ga0068868_100001290
1089 Ga0068868_100011821
1090 Ga0068868_100045446
1091 Ga0068868_100100646
1092 Ga0068868_100123985
1093 Ga0070689_100008704
1094 Ga0070689_100186212
1095 Ga0070689_100335959
1096 Ga0070687_100192273
1097 Ga0070661_100298968
1098 Ga0070661_100345298
1099 Ga0070668_100003834
1100 Ga0070668_100036636
1101 Ga0070668_100133019
1102 Ga0070668_100412093
1103 Ga0070668_100510634
1104 Ga0070669_100094824
1105 Ga0070669_100108307
1106 Ga0070675_100001026
1107 Ga0070675_100011870
1108 Ga0070675_100014529
1109 Ga0070675_100022217
1110 Ga0070675_100060263
1111 Ga0070675_100617966
1112 Ga0070671_100010647
1113 Ga0070671_100043160
1114 Ga0070671_100067899
1115 Ga0070671_100075846
1116 Ga0070671_100079613
1117 Ga0070671_100129197
1118 Ga0070671_100186048
1119 Ga0070671_100220387
1120 Ga0070674_100000094
1121 Ga0070674_100017248
1122 Ga0070674_100036756
1123 Ga0070674_100064418
1124 Ga0070673_100000679
1125 Ga0070673_100000753
1126 Ga0070673_100056321
1127 Ga0070673_100061005
1128 Ga0070673_100070739
1129 Ga0070673_100086055
1130 Ga0070688_100027851
1131 Ga0070659_100310018
1132 Ga0070667_100001746
1133 Ga0070667_100009087
1134 Ga0070667_100059026
1135 Ga0070667_100063129
1136 Ga0070667_100089857
1137 Ga0070667_100153304
1138 Ga0070667_100201356
1139 Ga0070667_100474046
1140 Ga0070667_100580873
1141 Ga0070705_100361539
1142 Ga0070708_100458382
1143 Ga0070663_100010261
1144 Ga0070663_100032973
1145 Ga0070663_100060857
1146 Ga0070678_100000409
1147 Ga0070678_100015011
1148 Ga0070678_100022737
1149 Ga0070678_100030734
1150 Ga0070678_100136716
1151 Ga0070678_100153175
1152 Ga0070678_100179796
1153 Ga0070678_100213423
1154 Ga0070678_100325069
1155 Ga0070662_100004880
1156 Ga0070662_100036562
1157 Ga0070662_100104882
1158 Ga0070662_100440947
1159 Ga0068867_100001043
1160 Ga0068867_100008620
1161 Ga0068867_100012008
1162 Ga0068867_100017264
1163 Ga0068867_100021275
1164 Ga0068867_100049323
1165 Ga0068867_100069565
1166 Ga0068867_100153326
1167 Ga0070706_100002539
1168 Ga0070707_100036814
1169 Ga0070684_100049524
1170 Ga0068853_100072987
1171 Ga0068853_100454005
1172 Ga0070672_100000552
1173 Ga0070672_100010312
1174 Ga0070672_100047920
1175 Ga0070672_100056675
1176 Ga0070672_100067655
1177 Ga0070672_100137156
1178 Ga0070672_100200596
1179 Ga0070672_100242749
1180 Ga0070696_100061266
1181 Ga0070665_100002419
1182 Ga0070665_100004291
1183 Ga0070665_100243262
1184 Ga0070665_100414457
1185 Ga0068855_100011166
1186 Ga0068855_100068193
1187 Ga0070664_100026043
1188 Ga0070664_100072613
1189 Ga0070664_100074036
1190 Ga0070664_100175452
1191 Ga0070664_100196192
1192 Ga0068857_100017408
1193 Ga0068857_100157826
1194 Ga0068857_100159525
1195 Ga0068857_100330635
1196 Ga0068854_100052677
1197 Ga0068854_100072045
1198 Ga0068854_100110195
1199 Ga0068854_100352732
1200 Ga0068856_100151917
1201 Ga0070702_100059433
1202 Ga0070702_100199324
1203 Ga0070702_100309120
1204 Ga0068852_100027996
1205 Ga0068852_100042319
1206 Ga0068852_100063421
1207 Ga0068852_100084077
1208 Ga0068852_100161780
1209 Ga0068852_100209190
1210 Ga0068859_100023045
1211 Ga0068859_100098576
1212 Ga0068859_100121412
1213 Ga0068859_100473170
1214 Ga0068864_100000845
1215 Ga0068864_100021018
1216 Ga0068864_100024185
1217 Ga0068864_100044697
1218 Ga0068864_100071385
1219 Ga0068864_100078936
1220 Ga0068864_100096415
1221 Ga0068864_100184809
1222 Ga0068861_100105393
1223 Ga0068861_100393112
1224 Ga0068861_100460110
1225 Ga0068851_10000843
1226 Ga0068870_10065494
1227 Ga0068863_100002048
1228 Ga0068863_100034799
1229 Ga0068863_100071222
1230 Ga0068863_100107675
1231 Ga0068863_100119529
1232 Ga0068863_100152090
1233 Ga0068863_100152743
1234 Ga0068863_100154405
1235 Ga0068858_100002570
1236 Ga0068858_100252112
1237 Ga0068858_100266980
1238 Ga0068858_100325491
1239 Ga0068858_100539810
1240 Ga0068860_100008382
1241 Ga0068860_100012965
1242 Ga0068860_100057346
1243 Ga0068860_100075322
1244 Ga0068862_100113099
1245 Ga0068862_100145352
1246 Ga0068862_100154254
1247 Ga0068862_100173498
1248 Ga0068862_100634976
1249 Ga0070717_10179449
1250 Ga0075365_10162457
1251 Ga0075365_10299676
1252 Ga0075368_10114950
1253 Ga0075363_100036983
1254 Ga0075364_10109509
1255 Ga0075364_10161447
1256 Ga0075364_10302949
1257 Ga0075364_10350918
1258 Ga0075362_10062690
1259 Ga0075367_10010982
1260 Ga0075367_10018189
1261 Ga0075367_10166400
1262 Ga0075369_10009596
1263 Ga0075369_10059355
1264 Ga0075369_10086249
1265 Ga0075369_10205939
1266 Ga0075366_10002787
1267 Ga0075366_10015678
1268 Ga0075366_10064729
1269 Ga0075366_10143252
1270 Ga0075366_10210536
1271 Ga0097621_100007338
1272 Ga0097621_100037524
1273 Ga0097621_100140720
1274 Ga0097621_100241368
1275 Ga0097621_100404665
1276 Ga0097621_100450408
1277 Ga0097621_100558114
1278 Ga0075370_10006766
1279 Ga0075370_10024220
1280 Ga0075370_10027723
1281 Ga0075370_10063075
1282 Ga0075370_10070550
1283 Ga0075370_10127002
1284 Ga0068871_100064731
1285 Ga0068871_100230418
1286 Ga0068871_100473496
1287 Ga0075428_100101687
1288 Ga0075430_100034456
1289 Ga0075430_100109091
1290 Ga0075431_100034361
1291 Ga0075431_100052328
1292 Ga0075429_100029093
1293 Ga0075429_100193894
1294 Ga0068865_100006221
1295 Ga0068865_100022991
1296 Ga0068865_100041947
1297 Ga0068865_100114232
1298 Ga0068865_100426501
1299 Ga0097620_100023045
1300 Ga0097620_100098578
1301 Ga0097620_100121412
1302 Ga0097620_100473176
1303 Ga0079104_1000206
1304 Ga0099826_10000021
1305 Ga0105251_10159709
1306 Ga0105244_10000031
1307 Ga0105244_10003602
1308 Ga0105240_10008920
1309 Ga0105240_10041470
1310 Ga0105240_10059308
1311 Ga0105240_10112031
1312 Ga0105240_10290611
1313 Ga0111539_10058487
1314 Ga0105245_10105475
1315 Ga0105247_10353938
1316 Ga0105243_10000765
1317 Ga0105243_10024959
1318 Ga0105243_10041298
1319 Ga0105243_10251968
1320 Ga0105243_10438575
1321 Ga0105241_10165743
1322 Ga0105242_10090130
1323 Ga0105242_10448469
1324 Ga0105248_10086277
1325 Ga0105248_10116526
1326 Ga0105248_10119263
1327 Ga0105248_10268583
1328 Ga0105248_10285586
1329 Ga0105237_10051964
1330 Ga0105237_10103567
1331 Ga0105237_10175171
1332 Ga0105237_10279165
1333 Ga0105238_10000065
1334 Ga0105238_10063764
1335 Ga0105238_10196657
1336 Ga0105249_10086300
1337 Ga0105249_10091395
1338 Ga0105239_10054735
1339 Ga0105239_10063942
1340 Ga0105239_10159772
1341 Ga0105239_10709275
1342 Ga0105246_10165345
1343 Ga0105246_10402965
1344 Ga0157319_1000695
1345 Ga0157339_1001068
1346 Ga0157371_10045298
1347 Ga0157370_10002003
1348 Ga0157370_10310879
1349 Ga0157369_10035810
1350 Ga0157374_10050728
1351 Ga0157374_10110971
1352 Ga0157374_10146904
1353 Ga0157374_10446048
1354 Ga0157374_10482189
1355 Ga0157374_10606869
1356 Ga0157378_10040681
1357 Ga0157378_10070198
1358 Ga0157378_10240961
1359 Ga0157378_10378962
1360 Ga0157378_10508236
1361 Ga0157378_10516439
1362 Ga0163162_10047977
1363 Ga0163162_10077315
1364 Ga0163162_10115597
1365 Ga0163162_10122403
1366 Ga0163162_10221744
1367 Ga0163162_10599824
1368 Ga0157372_10060900
1369 Ga0157375_10011762
1370 Ga0157375_10035622
1371 Ga0157375_10049483
1372 Ga0157375_10059297
1373 Ga0157375_10064588
1374 Ga0157375_10219009
1375 Ga0157375_10233301
1376 Ga0157375_10451319
1377 Ga0163163_10217309
1378 Ga0163163_10218492
1379 Ga0157380_10009058
1380 Ga0182008_10024475
1381 Ga0182008_10037502
1382 Ga0182008_10053291
1383 Ga0182008_10079655
1384 Ga0157377_10000016
1385 Ga0157379_10008726
1386 Ga0157379_10048728
1387 Ga0157379_10049079
1388 Ga0157379_10281376
1389 Ga0157376_10106693
1390 Ga0157376_10215134
1391 Ga0157376_10328135
1392 Ga0182006_1002966
1393 Ga0182006_1014559
1394 Ga0182007_10002108
1395 Ga0182007_10016980
1396 Ga0183362_10004
1397 Ga0163161_10032312
1398 Ga0163161_10040898
1399 Ga0163161_10141036
1400 Ga0163161_10155206
1401 Ga0163161_10233374
1402 Ga0163161_10272017
1403 Ga0213872_10016125
1404 Ga0209435_100015
1405 Ga0209435_100019
1406 Ga0209435_100290
1407 Ga0209436_104004
1408 Ga0209436_105266
1409 Ga0209784_100005
1410 Ga0209566_100005
1411 Ga0209674_100009
1412 Ga0209672_102201
1413 Ga0209147_100004
1414 Ga0209147_100843
1415 Ga0209563_100012
1416 Ga0209437_100758
1417 Ga0209258_100020
1418 Ga0209258_100226
1419 Ga0207425_1000814
1420 Ga0209646_1000020
1421 Ga0209646_1000038
1422 Ga0209646_1000040
1423 Ga0209026_1000034
1424 Ga0209026_1000048
1425 Ga0209026_1003765
1426 Ga0209677_100006
1427 Ga0209148_1000031
1428 Ga0209759_1000038
1429 Ga0209759_1000049
1430 Ga0209759_1000357
1431 Ga0209129_1000055
1432 Ga0209129_1006666
1433 Ga0209565_1000078
1434 Ga0209565_1000310
1435 Ga0209565_1000615
1436 Ga0209565_1001707
1437 Ga0209565_1016361
1438 Ga0209673_1000170
1439 Ga0209673_1001531
1440 Ga0209673_1002628
1441 Ga0209673_1011259
1442 Ga0209673_1026678
1443 Ga0209673_1027129
1444 Ga0209130_1000289
1445 Ga0209130_1000807
1446 Ga0209130_1001274
1447 Ga0209130_1011749
1448 Ga0209130_1012738
1449 Ga0209675_1000055
1450 Ga0209675_1001778
1451 Ga0209675_1002139
1452 Ga0209675_1010406
1453 Ga0209675_1016325
1454 Ga0209675_1018963
1455 Ga0209676_1000040
1456 Ga0209676_1003179
1457 Ga0209676_1011949
1458 Ga0209676_1013043
1459 Ga0209676_1017739
1460 Ga0209025_1000003
1461 Ga0209025_1000409
1462 Ga0209025_1001751
1463 Ga0209025_1009368
1464 Ga0209025_1010755
1465 Ga0209025_1018466
1466 Ga0209025_1051447
1467 Ga0209564_1000157
1468 Ga0209564_1000806
1469 Ga0209564_1001767
1470 Ga0209564_1002258
1471 Ga0209758_1000042
1472 Ga0209758_1005953
1473 Ga0209758_1040043
1474 Ga0209050_1000021
1475 Ga0209050_1000760
1476 Ga0209050_1003967
1477 Ga0209050_1004794
1478 Ga0209050_1015628
1479 Ga0209050_1041968
1480 Ga0209256_1000036
1481 Ga0209256_1000056
1482 Ga0209256_1000124
1483 Ga0209256_1000127
1484 Ga0209256_1000906
1485 Ga0207426_1000055
1486 Ga0207426_1000079
1487 Ga0207426_1000091
1488 Ga0209051_1000025
1489 Ga0209051_1000068
1490 Ga0209051_1000351
1491 Ga0209051_1000423
1492 Ga0209051_1000446
1493 Ga0209051_1000530
1494 Ga0209051_1008921
1495 Ga0209051_1013428
1496 Ga0209051_1015139
1497 Ga0209257_1000015
1498 Ga0209257_1000039
1499 Ga0209257_1000043
1500 Ga0209257_1001377
1501 Ga0209257_1003725
1502 Ga0209257_1013914
1503 Ga0209257_1024395
1504 Ga0207697_10020918
1505 Ga0207656_10087638
1506 Ga0207656_10170628
1507 Ga0207655_1000029
1508 Ga0207655_1005080
1509 Ga0207682_10001047
1510 Ga0207682_10006237
1511 Ga0207682_10095522
1512 Ga0207642_10044161
1513 Ga0207642_10136047
1514 Ga0207688_10043780
1515 Ga0207680_10001068
1516 Ga0207680_10039848
1517 Ga0207680_10056911
1518 Ga0207680_10424525
1519 Ga0207645_10004706
1520 Ga0207645_10014655
1521 Ga0207645_10071087
1522 Ga0207645_10094840
1523 Ga0207645_10095900
1524 Ga0207643_10017706
1525 Ga0207643_10042663
1526 Ga0207643_10080252
1527 Ga0207684_10023176
1528 Ga0207695_10002732
1529 Ga0207695_10007216
1530 Ga0207695_10082478
1531 Ga0207695_10123453
1532 Ga0207695_10178105
1533 Ga0207695_10628475
1534 Ga0207671_10002693
1535 Ga0207671_10061344
1536 Ga0207671_10126738
1537 Ga0207671_10214023
1538 Ga0207662_10027183
1539 Ga0207662_10199852
1540 Ga0207657_10255358
1541 Ga0207649_10324495
1542 Ga0207681_10006325
1543 Ga0207681_10079980
1544 Ga0207681_10098926
1545 Ga0207694_10000977
1546 Ga0207694_10281387
1547 Ga0207694_10349242
1548 Ga0207650_10000710
1549 Ga0207650_10009975
1550 Ga0207650_10028205
1551 Ga0207650_10046048
1552 Ga0207650_10066503
1553 Ga0207650_10067275
1554 Ga0207650_10101393
1555 Ga0207650_10164554
1556 Ga0207659_10000322
1557 Ga0207659_10008216
1558 Ga0207659_10008726
1559 Ga0207659_10015561
1560 Ga0207659_10065728
1561 Ga0207659_10165010
1562 Ga0207659_10240214
1563 Ga0207644_10001344
1564 Ga0207644_10001677
1565 Ga0207644_10032216
1566 Ga0207644_10087523
1567 Ga0207644_10104089
1568 Ga0207644_10129888
1569 Ga0207690_10313305
1570 Ga0207706_10003941
1571 Ga0207706_10102503
1572 Ga0207706_10115153
1573 Ga0207706_10348057
1574 Ga0207709_10000602
1575 Ga0207709_10022513
1576 Ga0207709_10040350
1577 Ga0207670_10011674
1578 Ga0207670_10048461
1579 Ga0207669_10003485
1580 Ga0207669_10003984
1581 Ga0207669_10343979
1582 Ga0207691_10000018
1583 Ga0207691_10012940
1584 Ga0207691_10028725
1585 Ga0207691_10182602
1586 Ga0207691_10186128
1587 Ga0207691_10214481
1588 Ga0207691_10234077
1589 Ga0207691_10270263
1590 Ga0207691_10419650
1591 Ga0207691_10446115
1592 Ga0207711_10005256
1593 Ga0207711_10042630
1594 Ga0207711_10089412
1595 Ga0207711_10211901
1596 Ga0207711_10435873
1597 Ga0207689_10006735
1598 Ga0207689_10007284
1599 Ga0207689_10061475
1600 Ga0207689_10167766
1601 Ga0207689_10367962
1602 Ga0207689_10472244
1603 Ga0207661_10192549
1604 Ga0207679_10042747
1605 Ga0207679_10065938
1606 Ga0207679_10091344
1607 Ga0207679_10132589
1608 Ga0207667_10011582
1609 Ga0207667_10016772
1610 Ga0207667_10433859
1611 Ga0207667_10644054
1612 Ga0207651_10003638
1613 Ga0207651_10037982
1614 Ga0207651_10150357
1615 Ga0207651_10192900
1616 Ga0207712_10076268
1617 Ga0207668_10020765
1618 Ga0207668_10211799
1619 Ga0207668_10287717
1620 Ga0207640_10211336
1621 Ga0207640_10234350
1622 Ga0207640_10291698
1623 Ga0207658_10006133
1624 Ga0207658_10023598
1625 Ga0207658_10032603
1626 Ga0207658_10050765
1627 Ga0207658_10118246
1628 Ga0207658_10267976
1629 Ga0207677_10004386
1630 Ga0207677_10006410
1631 Ga0207677_10006484
1632 Ga0207677_10012052
1633 Ga0207677_10195210
1634 Ga0207677_10433020
1635 Ga0207703_10000817
1636 Ga0207703_10047463
1637 Ga0207703_10085234
1638 Ga0207639_10009051
1639 Ga0207678_10048631
1640 Ga0207641_10005073
1641 Ga0207641_10049395
1642 Ga0207641_10074666
1643 Ga0207641_10083149
1644 Ga0207641_10182140
1645 Ga0207648_10000515
1646 Ga0207648_10026670
1647 Ga0207648_10032136
1648 Ga0207648_10052000
1649 Ga0207648_10077196
1650 Ga0207648_10086284
1651 Ga0207648_10124194
1652 Ga0207648_10135345
1653 Ga0207648_10148502
1654 Ga0207648_10244922
1655 Ga0207676_10001475
1656 Ga0207676_10010532
1657 Ga0207676_10011558
1658 Ga0207676_10017436
1659 Ga0207676_10019636
1660 Ga0207676_10078691
1661 Ga0207676_10112667
1662 Ga0207676_10250526
1663 Ga0207674_10012362
1664 Ga0207674_10016088
1665 Ga0207674_10050876
1666 Ga0207674_10076115
1667 Ga0207674_10202405
1668 Ga0207674_10217177
1669 Ga0207675_100004701
1670 Ga0207675_100024107
1671 Ga0207675_100030188
1672 Ga0207675_100049796
1673 Ga0207675_100057248
1674 Ga0207675_100225865
1675 Ga0207683_10000020
1676 Ga0207683_10024111
1677 Ga0207683_10044935
1678 Ga0207683_10089845
1679 Ga0207683_10104296
1680 Ga0207683_10113807
1681 Ga0207683_10219993
1682 Ga0207683_10396596
1683 Ga0207698_10007168
1684 Ga0207698_10038539
1685 Ga0207698_10146995
1686 Ga0207698_10253160
1687 Ga0209281_1000259
1688 Ga0209970_1000196
1689 Ga0209282_1000019
1690 Ga0209282_1000139
1691 Ga0209813_10024788
1692 Ga0268266_10018522
1693 Ga0268266_10024477
1694 Ga0268266_10040123
1695 Ga0268266_10271557
1696 Ga0268265_10011207
1697 Ga0268265_10029780
1698 Ga0268265_10137561
1699 Ga0268265_10298618
1700 Ga0268264_10003598
1701 Ga0268264_10052836
1702 Ga0268264_10086924
1703 Ga0307517_10002655
1704 Ga0307515_10000138
1705 Ga0307515_10000322
1706 Ga0307515_10001193
1707 Ga0307515_10002234
1708 Ga0307515_10023840
1709 Ga0307515_10041898
1710 Ga0307515_10067248
1711 Ga0307515_10094964
1712 Ga0307515_10096814
1713 Ga0307515_10135512
1714 Ga0307515_10146542
1715 Ga0307512_10066347
1716 Ga0316176_1141751
1717 Ga0314311_1073339
1718 Ga0316179_1111618
1719 Ga0316183_1025835
1720 Ga0265330_10014274
1721 Ga0265330_10047066
1722 Ga0265332_10035841
1723 Ga0265329_10011414
1724 Ga0265331_10043380
1725 Ga0265327_10003094
1726 Ga0265327_10005552
1727 Ga0265316_10199220
1728 Ga0307513_10000013
1729 Ga0307513_10000246
1730 Ga0307513_10007912
1731 Ga0307513_10027457
1732 Ga0307513_10075694
1733 Ga0307513_10104696
1734 Ga0307513_10122436
1735 Ga0307513_10270462
1736 Ga0307513_10325978
1737 Ga0307509_10007099
1738 Ga0307509_10019271
1739 Ga0307509_10033367
1740 Ga0307509_10164667
1741 Ga0307408_100000008
1742 Ga0307408_100006968
1743 Ga0307408_100054021
1744 Ga0307408_100086583
1745 Ga0307408_100111446
1746 Ga0307408_100152716
1747 Ga0307508_10000450
1748 Ga0307508_10008054
1749 Ga0307508_10055717
1750 Ga0307514_10001030
1751 Ga0307514_10004889
1752 Ga0307514_10008692
1753 Ga0307514_10009061
1754 Ga0307514_10109370
1755 Ga0307514_10156290
1756 Ga0265314_10008574
1757 Ga0265314_10038564
1758 Ga0265342_10038530
1759 Ga0307516_10008482
1760 Ga0307516_10077658
1761 Ga0307516_10353428
1762 Ga0307405_10252917
1763 Ga0307518_10244042
1764 Ga0307518_10330066
1765 Ga0307406_10004336
1766 Ga0307406_10012119
1767 Ga0307412_10000392
1768 Ga0307412_10008739
1769 Ga0307412_10193682
1770 Ga0307412_10357730
1771 Ga0307412_10517187
1772 Ga0307414_10115733
1773 Ga0307414_10293586
1774 Ga0307411_10002080
1775 Ga0307415_100694203
1776 Ga0307510_10034007
1777 Ga0373936_0043270
1778 Ga0373957_0028893
1779 Ga0373955_0292472
1780 Ga0373931_0025968
1781 Ga0373933_0190358
1782 Ga0373937_0040657
1783 Ga0373925_0461305
1784 Ga0395905_0052780
1785 Ga0395901_0111180
1786 Ga0436360_1081132
1787 Ga0436361_0032066
1788 Ga0436361_0206607
1789 Ga0436363_0171481
1790 Ga0439439_0003401
1791 Ga0439466_0002610
1792 Ga0439466_0020082
1793 Ga0451839_0601462
1794 Ga0439445_0001509
1795 Ga0439432_002290
1796 Ga0439449_0000753
1797 Ga0439449_0004213
1798 Ga0439452_002755
1799 Ga0450923_031374
1800 Ga0450898_003737
1801 Ga0450909_011691
1802 Ga0439434_0001757
1803 Ga0450918_002439
1804 Ga0466972_0000880
1805 Ga0466965_0002203
1806 Ga0466964_0007106
1807 Ga0466964_0012803
1808 Ga0453684_0391028
1809 Ga0466968_0008025
1810 Ga0451576_0019302
1811 Ga0451576_0039018
1812 Ga0495638_0077305
1813 Ga0495585_0074205
1814 Ga0495596_0000064
1815 Ga0495607_0000507
1816 Ga0495610_0001367
1817 Ga0495610_0019846
1818 Ga0495616_0000866
1819 Ga0495620_0051816
1820 Ga0495632_0112483
1821 Ga0495637_0005420
1822 Ga0495648_0110383
1823 Ga0495642_0033322
1824 Ga0495642_0057359
1825 Ga0495654_0000834
1826 Ga0495609_0000244
1827 Ga0495656_0000365
1828 Ga0495625_0010498
1829 Ga0495661_0008722
1830 Ga0495588_0097715
1831 Ga0495671_0000453
1832 Ga0495649_0004212
1833 Ga0495660_0031902
1834 Ga0495672_0032883
1835 Ga0495676_0089794
1836 Ga0495687_027112
1837 Ga0495685_001488
1838 Ga0495686_0241770
1839 Ga0495593_0037115
1840 Ga0495614_0107705
1841 Ga0496101_0379158
1842 Ga0496102_0206626
1843 Ga0496103_0084378
1844 Ga0496104_0032473
1845 Ga0496105_0012904
1846 Ga0496106_0284822
1847 Ga0496108_0452077
1848 Ga0496109_0058519
1849 Ga0496110_0537597
1850 Ga0496114_0186150
1851 Ga0496115_0025937
1852 Ga0496116_0001004
1853 Ga0496116_0011864
1854 Ga0496116_0013245
1855 Ga0496116_0067024
1856 Ga0496116_0081581
1857 Ga0496116_0125457
1858 Ga0496117_0068338
1859 Ga0496118_0019857
1860 Ga0496118_0053756
1861 Ga0496118_0085109
1862 Ga0496119_0003325
1863 Ga0496120_0003204
1864 Ga0496121_0001404
1865 Ga0496121_0005640
1866 Ga0496121_0143282
1867 Ga0496121_0218094
1868 Ga0496121_0232548
1869 Ga0496122_0000029
1870 Ga0496122_0000317
1871 Ga0496122_0004249
1872 Ga0496122_0004463
1873 Ga0496123_0000124
1874 Ga0496123_0000531
1875 Ga0496123_0001487
1876 Ga0496123_0001761
1877 Ga0496123_0003891
1878 Ga0496124_0000024
1879 Ga0496124_0004949
1880 Ga0496124_0034977
1881 Ga0496124_0122058
1882 Ga0496124_0149259
1883 Ga0496124_0223673
1884 Ga0496125_0000244
1885 Ga0496125_0015625
1886 Ga0496125_0030924
1887 Ga0496126_0043446
1888 Ga0495682_0000003
1889 Ga0501048_0160292
1890 nmdc:mga00v17_56590_c1
1891 nmdc:mga0yw44_243798_c1
1892 nmdc:mga0k408_247959_c1
1893 nmdc:mga0k408_254840_c1
1894 nmdc:mga0k408_26319_c1
1895 nmdc:mga0k408_4891_c2
1896 nmdc:mga0k408_7822_c1
1897 nmdc:mga07m45_10453_c1
1898 nmdc:mga07m45_122_c1
1899 nmdc:mga07m45_15544_c1
1900 nmdc:mga07m45_196634_c1
1901 nmdc:mga07m45_4239_c1
1902 nmdc:mga07m45_93670_c1
1903 nmdc:mga05p37_92917_c1
1904 nmdc:mga09592_68309_c1
1905 nmdc:mga09592_70483_c1
1906 nmdc:mga0qj67_99755_c1
1907 nmdc:mga06r32_51310_c1
1908 nmdc:mga06r32_752362_c1
1909 nmdc:mga0sz30_123992_c1
1910 nmdc:mga0sz30_147099_c1
1911 nmdc:mga0sz30_15597_c1
1912 Ga0495601_0156569
1913 Ga0500610_0003992
1914 Ga0500644_0000575
1915 Ga0500571_006720
1916 Ga0500593_000414
1917 Ga0500593_003241
1918 Ga0500594_0017153
1919 Ga0500595_000002
1920 Ga0500618_002619
1921 Ga0500658_0002081
1922 Ga0500559_0000047
1923 Ga0500568_0061648
1924 Ga0500574_011876
1925 Ga0500616_0000002
1926 Ga0500619_000077
1927 Ga0500634_0013275
1928 Ga0500636_0083949
1929 Ga0500587_002315
1930 2511250033
1931 2521557336
1932 2553005314
1933 2587759442
1934 2599622444
1935 2599674464
1936 2599680149
1937 2599692165
1938 2599906620
1939 2643860823
1940 2643936098
1941 2643981333
1942 2644060571
1943 2644073899
1944 2644124117
1945 2644160849
1946 2644221861
1947 2644257345
1948 2644316743
1949 2644396904
1950 2738719305
1951 2738883349
1952 2739242601
1953 2739247375
1954 2739282964
1955 2765568462
1956 2809035250
1957 2816473078
1958 2819592017
1959 2819599144
1960 2819617670
1961 2831270925
1962 2838058972
1963 2839095299
1964 2842679286
1965 2842737764
1966 2842738290
1967 2842750713
1968 2855731335
1969 2855768041
1970 2857542285
1971 2857545049
1972 2857577018
1973 2858953573
1974 2881413781
1975 2884814033
1976 2884840567
1977 2884855824
1978 2885193976
1979 2885202258
1980 2885215911
1981 2896157251
1982 2899929968
1983 2904439929
1984 2904451618
1985 2904453000
1986 2904459962
1987 2904461893
1988 2904482326
1989 2904531126
1990 2904543295
1991 2904587229
1992 2904592736
1993 2904604481
1994 2919050246
1995 2919082303
1996 2919464482
1997 2919706843
1998 2923515996
1999 2928043503
2000 2928049867
2001 2928054442
2002 2928070028
2003 2928074353
2004 2928086591
2005 2928118845
2006 2929160527
2007 2929525959
2008 2929526537
2009 2941484660
2010 2945915519
2011 2945974136
2012 2945974897
2013 2945989083
2014 8003405435

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

85

225

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9147 29 245
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9133 30 241
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9128 29 241
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9127 30 243
5jsz-assembly1.cif.gz_A folate ecf transporter: apo state 0.9124 28 243
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9327 30 268 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.923 29 243 3.40.50.300
af_Q2FW34_4_263_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.92 28 243 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9191 29 243 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9188 28 241 3.40.50.300
ID Description Score Start End GO Terms
AF-K8E236-F1-model_v4 ABC transporter family protein 0.9335 102 243 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-K1SC20-F1-model_v4 ABC superfamily ATP binding cassette transporter, ABC protein 0.9327 29 217 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.9285 29 221 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A524B8W3-F1-model_v4 ABC transporter 0.927 30 230 GO:0005524
GO:0016887
AF-K0DB19-F1-model_v4 ABC transporter ATP binding protein 0.9255 29 243 GO:0005524
GO:0016887
GO:0042626
GO:0043190

Map