F488022
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1007 | 440 | 2014 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300002704|JGI25155J39150_1000042|JGI25155J39150_100004218 |
| Length | 316 |
| Sequence | MRFPPRGPLRLRPGEAGSAAPTCMWEISGRSLLCLPITSLEYAMTAVLNAPVFADVPVREFQPGPAGTHITIRGLTKYFAGWPLYEDFNLDIPKHKIVSVFGPNGCGKSTLINMIAGLIPIDAGEILFDGKSLKDTKIGYVFQNYREAMFPWMRTIDNIAYPLKLEGKSKAEVDRRMAELVASFDVKFDLNRYPYELSGGQQQTASIMRALAPNPEVLFLDEPFSALDFEMTLFIREKLQEVFMQTGTTMLLVSHDLEEAVYLADQVLLLTKRPTRVAEILPYGDARPRTVETLSEASFIRTKKLSLEIFQREVRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 104 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 121 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 226 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 227 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 228 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 229 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 230 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 231 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 232 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 242 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 248 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 251 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 252 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 253 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 267 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 268 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 269 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 270 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 271 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 272 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 273 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 274 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 275 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 276 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 277 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 278 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 279 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 280 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 281 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 282 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 326 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 327 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 328 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 329 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 330 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 331 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 336 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 338 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 349 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 350 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 351 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 354 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 356 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 357 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 359 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 361 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 362 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 363 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 364 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 365 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 366 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 367 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 368 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 369 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 370 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 371 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 372 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 373 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 374 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 375 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 376 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 377 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 378 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 379 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 380 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 381 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 382 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 383 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 384 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 385 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 386 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 387 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 388 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 389 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 390 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 391 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 392 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 393 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 394 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 395 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 396 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 397 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 398 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 399 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 400 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 401 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 402 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 403 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 404 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 405 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 406 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 407 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 408 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 409 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 410 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 411 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 412 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 413 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 414 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 415 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 416 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 417 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 418 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 419 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 420 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 421 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 422 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 423 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 424 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 425 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 426 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 427 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 428 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 429 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 430 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 431 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 432 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 433 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 434 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 435 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 436 | 2941479691 | |||
| 437 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 438 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 439 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 440 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.56 |
| Metatranscriptomes | 0 |
| Isolates | 8.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.47 |
| Nodule | 0.99 |
| Rhizoplane | 1.49 |
| Rhizosphere | 63.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000042 | 3300002704 | Bacteria | 88585 |
| 2 | JGI24740J21852_10010263 | 3300001979 | Bacteria | 3618 |
| 3 | JGI24739J22299_10015867 | 3300001989 | Bacteria | 2733 |
| 4 | JGI25155J39150_1000651 | 3300002704 | Bacteria | 6849 |
| 5 | JGI25155J39150_1001094 | 3300002704 | Bacteria | 2726 |
| 6 | JGI25156J39149_1000053 | 3300002705 | Bacteria | 88796 |
| 7 | JGI25156J39149_1000170 | 3300002705 | Bacteria | 47634 |
| 8 | JGI25156J39149_1001869 | 3300002705 | Bacteria | 8231 |
| 9 | JGI25156J39149_1007194 | 3300002705 | Bacteria | 2953 |
| 10 | JGI25162J39368_1003814 | 3300002737 | Bacteria | 3981 |
| 11 | JGI25154J39366_1000082 | 3300002738 | Bacteria | 88767 |
| 12 | JGI25154J39366_1000306 | 3300002738 | Bacteria | 28725 |
| 13 | JGI25154J39366_1000455 | 3300002738 | Bacteria | 21495 |
| 14 | JGI25157J39369_1000072 | 3300002741 | Bacteria | 88796 |
| 15 | JGI25157J39369_1000170 | 3300002741 | Bacteria | 54809 |
| 16 | JGI25159J45721_1002106 | 3300002987 | Bacteria | 7812 |
| 17 | JGI25159J45721_1010517 | 3300002987 | Bacteria | 2348 |
| 18 | JGI25151J46595_10000301 | 3300003187 | Bacteria | 54192 |
| 19 | JGI25151J46595_10011183 | 3300003187 | Bacteria | 4134 |
| 20 | JGI25153J46596_10012010 | 3300003215 | Bacteria | 3781 |
| 21 | rootL2_10017868 | 3300003322 | Bacteria | 14919 |
| 22 | rootH1_10005172 | 3300003323 | Bacteria | 2973 |
| 23 | JGI25160J50197_1000227 | 3300003354 | Bacteria | 44493 |
| 24 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 25 | Ga0055538_1000013 | 3300003751 | Bacteria | 348596 |
| 26 | Ga0055539_1000018 | 3300003752 | Bacteria | 348596 |
| 27 | Ga0055533_1000022 | 3300003756 | Bacteria | 348596 |
| 28 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 29 | Ga0055525_1000024 | 3300003759 | Bacteria | 348596 |
| 30 | Ga0055535_1000260 | 3300003761 | Bacteria | 55578 |
| 31 | Ga0055535_1005719 | 3300003761 | Bacteria | 2661 |
| 32 | Ga0055542_1000013 | 3300003762 | Bacteria | 387560 |
| 33 | Ga0055526_1021281 | 3300003771 | Bacteria | 2263 |
| 34 | Ga0055537_1002740 | 3300003773 | Bacteria | 5717 |
| 35 | Ga0055524_1000052 | 3300003775 | Bacteria | 144959 |
| 36 | Ga0055524_1001441 | 3300003775 | Bacteria | 13654 |
| 37 | Ga0055536_1004462 | 3300003781 | Bacteria | 7148 |
| 38 | Ga0055534_1001477 | 3300003784 | Bacteria | 9327 |
| 39 | Ga0055534_1002933 | 3300003784 | Bacteria | 5651 |
| 40 | Ga0055534_1006234 | 3300003784 | Bacteria | 3040 |
| 41 | Ga0055530_10003439 | 3300003791 | Bacteria | 8999 |
| 42 | Ga0055530_10004911 | 3300003791 | Bacteria | 6630 |
| 43 | Ga0055530_10018827 | 3300003791 | Bacteria | 2114 |
| 44 | Ga0055540_1000123 | 3300003792 | Bacteria | 80351 |
| 45 | Ga0055540_1002288 | 3300003792 | Bacteria | 10318 |
| 46 | Ga0055540_1013297 | 3300003792 | Bacteria | 2524 |
| 47 | Ga0055531_10000740 | 3300003794 | Bacteria | 27497 |
| 48 | Ga0055531_10001116 | 3300003794 | Bacteria | 20815 |
| 49 | Ga0055531_10016084 | 3300003794 | Bacteria | 3251 |
| 50 | Ga0055541_1000013 | 3300003841 | Bacteria | 348596 |
| 51 | Ga0055543_1000386 | 3300004625 | Bacteria | 28622 |
| 52 | Ga0065165_1013879 | 3300005262 | Bacteria | 3166 |
| 53 | Ga0065704_10000444 | 3300005289 | Bacteria | 86255 |
| 54 | Ga0065715_10020215 | 3300005293 | Bacteria | 2452 |
| 55 | Ga0065715_10035108 | 3300005293 | Bacteria | 1466 |
| 56 | Ga0065715_10125321 | 3300005293 | Bacteria | 2133 |
| 57 | Ga0070658_10224146 | 3300005327 | Bacteria | 1591 |
| 58 | Ga0070676_10002668 | 3300005328 | Bacteria | 9187 |
| 59 | Ga0070676_10277204 | 3300005328 | Bacteria | 1128 |
| 60 | Ga0070683_100129404 | 3300005329 | Bacteria | 2388 |
| 61 | Ga0070683_100647230 | 3300005329 | Bacteria | 1012 |
| 62 | Ga0070690_100031929 | 3300005330 | Bacteria | 3284 |
| 63 | Ga0070670_100001971 | 3300005331 | Bacteria | 16798 |
| 64 | Ga0070670_100014554 | 3300005331 | Bacteria | 6754 |
| 65 | Ga0070670_100029888 | 3300005331 | Bacteria | 4693 |
| 66 | Ga0070670_100037645 | 3300005331 | Bacteria | 4161 |
| 67 | Ga0070670_100043346 | 3300005331 | Bacteria | 3868 |
| 68 | Ga0070670_100089726 | 3300005331 | Bacteria | 2642 |
| 69 | Ga0070670_100119461 | 3300005331 | Bacteria | 2273 |
| 70 | Ga0070670_100188056 | 3300005331 | Bacteria | 1793 |
| 71 | Ga0070670_100328284 | 3300005331 | Bacteria | 1341 |
| 72 | Ga0070677_10006417 | 3300005333 | Bacteria | 3907 |
| 73 | Ga0070677_10009189 | 3300005333 | Bacteria | 3350 |
| 74 | Ga0070677_10010076 | 3300005333 | Bacteria | 3221 |
| 75 | Ga0068869_100041131 | 3300005334 | Bacteria | 3309 |
| 76 | Ga0068869_100402150 | 3300005334 | Bacteria | 1127 |
| 77 | Ga0070666_10000758 | 3300005335 | Bacteria | 19568 |
| 78 | Ga0070666_10002174 | 3300005335 | Bacteria | 11914 |
| 79 | Ga0070666_10079624 | 3300005335 | Bacteria | 2238 |
| 80 | Ga0070666_10363788 | 3300005335 | Bacteria | 1037 |
| 81 | Ga0068868_100001290 | 3300005338 | Bacteria | 17256 |
| 82 | Ga0068868_100011821 | 3300005338 | Bacteria | 6365 |
| 83 | Ga0068868_100045446 | 3300005338 | Bacteria | 3435 |
| 84 | Ga0068868_100100646 | 3300005338 | Bacteria | 2338 |
| 85 | Ga0068868_100123985 | 3300005338 | Bacteria | 2109 |
| 86 | Ga0070689_100008704 | 3300005340 | Bacteria | 7162 |
| 87 | Ga0070689_100186212 | 3300005340 | Bacteria | 1688 |
| 88 | Ga0070689_100335959 | 3300005340 | Bacteria | 1265 |
| 89 | Ga0070687_100192273 | 3300005343 | Bacteria | 1230 |
| 90 | Ga0070661_100298968 | 3300005344 | Bacteria | 1252 |
| 91 | Ga0070661_100345298 | 3300005344 | Bacteria | 1167 |
| 92 | Ga0070668_100003834 | 3300005347 | Bacteria | 11107 |
| 93 | Ga0070668_100036636 | 3300005347 | Bacteria | 3744 |
| 94 | Ga0070668_100133019 | 3300005347 | Bacteria | 1998 |
| 95 | Ga0070668_100412093 | 3300005347 | Bacteria | 1155 |
| 96 | Ga0070668_100510634 | 3300005347 | Bacteria | 1042 |
| 97 | Ga0070669_100094824 | 3300005353 | Bacteria | 2243 |
| 98 | Ga0070669_100108307 | 3300005353 | Bacteria | 2106 |
| 99 | Ga0070675_100001026 | 3300005354 | Bacteria | 20075 |
| 100 | Ga0070675_100011870 | 3300005354 | Bacteria | 6826 |
| 101 | Ga0070675_100014529 | 3300005354 | Bacteria | 6210 |
| 102 | Ga0070675_100022217 | 3300005354 | Bacteria | 5067 |
| 103 | Ga0070675_100060263 | 3300005354 | Bacteria | 3133 |
| 104 | Ga0070675_100617966 | 3300005354 | Bacteria | 983 |
| 105 | Ga0070671_100010647 | 3300005355 | Bacteria | 7381 |
| 106 | Ga0070671_100043160 | 3300005355 | Bacteria | 3748 |
| 107 | Ga0070671_100067899 | 3300005355 | Bacteria | 2973 |
| 108 | Ga0070671_100075846 | 3300005355 | Bacteria | 2809 |
| 109 | Ga0070671_100079613 | 3300005355 | Bacteria | 2739 |
| 110 | Ga0070671_100129197 | 3300005355 | Bacteria | 2127 |
| 111 | Ga0070671_100186048 | 3300005355 | Bacteria | 1760 |
| 112 | Ga0070671_100220387 | 3300005355 | Bacteria | 1609 |
| 113 | Ga0070674_100000094 | 3300005356 | Bacteria | 41372 |
| 114 | Ga0070674_100017248 | 3300005356 | Bacteria | 4538 |
| 115 | Ga0070674_100036756 | 3300005356 | Bacteria | 3290 |
| 116 | Ga0070674_100064418 | 3300005356 | Bacteria | 2568 |
| 117 | Ga0070673_100000679 | 3300005364 | Bacteria | 18764 |
| 118 | Ga0070673_100000753 | 3300005364 | Bacteria | 17978 |
| 119 | Ga0070673_100056321 | 3300005364 | Bacteria | 3101 |
| 120 | Ga0070673_100061005 | 3300005364 | Bacteria | 2990 |
| 121 | Ga0070673_100070739 | 3300005364 | Bacteria | 2801 |
| 122 | Ga0070673_100086055 | 3300005364 | Bacteria | 2560 |
| 123 | Ga0070688_100027851 | 3300005365 | Bacteria | 3367 |
| 124 | Ga0070659_100310018 | 3300005366 | Bacteria | 1318 |
| 125 | Ga0070667_100001746 | 3300005367 | Bacteria | 19433 |
| 126 | Ga0070667_100009087 | 3300005367 | Bacteria | 8223 |
| 127 | Ga0070667_100059026 | 3300005367 | Bacteria | 3245 |
| 128 | Ga0070667_100063129 | 3300005367 | Bacteria | 3138 |
| 129 | Ga0070667_100089857 | 3300005367 | Bacteria | 2639 |
| 130 | Ga0070667_100153304 | 3300005367 | Bacteria | 2026 |
| 131 | Ga0070667_100201356 | 3300005367 | Bacteria | 1767 |
| 132 | Ga0070667_100474046 | 3300005367 | Bacteria | 1145 |
| 133 | Ga0070667_100580873 | 3300005367 | Bacteria | 1031 |
| 134 | Ga0070705_100361539 | 3300005440 | Bacteria | 1062 |
| 135 | Ga0070708_100458382 | 3300005445 | Bacteria | 1203 |
| 136 | Ga0070663_100010261 | 3300005455 | Bacteria | 5835 |
| 137 | Ga0070663_100032973 | 3300005455 | Bacteria | 3575 |
| 138 | Ga0070663_100060857 | 3300005455 | Bacteria | 2717 |
| 139 | Ga0070678_100000409 | 3300005456 | Bacteria | 20280 |
| 140 | Ga0070678_100015011 | 3300005456 | Bacteria | 4906 |
| 141 | Ga0070678_100022737 | 3300005456 | Bacteria | 4161 |
| 142 | Ga0070678_100030734 | 3300005456 | Bacteria | 3695 |
| 143 | Ga0070678_100136716 | 3300005456 | Bacteria | 1955 |
| 144 | Ga0070678_100153175 | 3300005456 | Bacteria | 1859 |
| 145 | Ga0070678_100179796 | 3300005456 | Bacteria | 1730 |
| 146 | Ga0070678_100213423 | 3300005456 | Bacteria | 1601 |
| 147 | Ga0070678_100325069 | 3300005456 | Bacteria | 1314 |
| 148 | Ga0070662_100004880 | 3300005457 | Bacteria | 8510 |
| 149 | Ga0070662_100036562 | 3300005457 | Bacteria | 3474 |
| 150 | Ga0070662_100104882 | 3300005457 | Bacteria | 2145 |
| 151 | Ga0070662_100440947 | 3300005457 | Bacteria | 1079 |
| 152 | Ga0068867_100001043 | 3300005459 | Bacteria | 18890 |
| 153 | Ga0068867_100008620 | 3300005459 | Bacteria | 7200 |
| 154 | Ga0068867_100012008 | 3300005459 | Bacteria | 6118 |
| 155 | Ga0068867_100017264 | 3300005459 | Bacteria | 5125 |
| 156 | Ga0068867_100021275 | 3300005459 | Bacteria | 4629 |
| 157 | Ga0068867_100049323 | 3300005459 | Bacteria | 3099 |
| 158 | Ga0068867_100069565 | 3300005459 | Bacteria | 2629 |
| 159 | Ga0068867_100153326 | 3300005459 | Bacteria | 1811 |
| 160 | Ga0070706_100002539 | 3300005467 | Bacteria | 18347 |
| 161 | Ga0070707_100036814 | 3300005468 | Bacteria | 4670 |
| 162 | Ga0070684_100049524 | 3300005535 | Bacteria | 3646 |
| 163 | Ga0068853_100072987 | 3300005539 | Bacteria | 2991 |
| 164 | Ga0068853_100454005 | 3300005539 | Bacteria | 1206 |
| 165 | Ga0070672_100000552 | 3300005543 | Bacteria | 22019 |
| 166 | Ga0070672_100010312 | 3300005543 | Bacteria | 6477 |
| 167 | Ga0070672_100047920 | 3300005543 | Bacteria | 3318 |
| 168 | Ga0070672_100056675 | 3300005543 | Bacteria | 3074 |
| 169 | Ga0070672_100067655 | 3300005543 | Bacteria | 2831 |
| 170 | Ga0070672_100137156 | 3300005543 | Bacteria | 2015 |
| 171 | Ga0070672_100200596 | 3300005543 | Bacteria | 1668 |
| 172 | Ga0070672_100242749 | 3300005543 | Bacteria | 1515 |
| 173 | Ga0070696_100061266 | 3300005546 | Bacteria | 2632 |
| 174 | Ga0070665_100002419 | 3300005548 | Bacteria | 20581 |
| 175 | Ga0070665_100004291 | 3300005548 | Bacteria | 14986 |
| 176 | Ga0070665_100243262 | 3300005548 | Bacteria | 1800 |
| 177 | Ga0070665_100414457 | 3300005548 | Bacteria | 1356 |
| 178 | Ga0068855_100011166 | 3300005563 | Bacteria | 10845 |
| 179 | Ga0068855_100068193 | 3300005563 | Bacteria | 4141 |
| 180 | Ga0070664_100026043 | 3300005564 | Bacteria | 4849 |
| 181 | Ga0070664_100072613 | 3300005564 | Bacteria | 2951 |
| 182 | Ga0070664_100074036 | 3300005564 | Bacteria | 2922 |
| 183 | Ga0070664_100175452 | 3300005564 | Bacteria | 1902 |
| 184 | Ga0070664_100196192 | 3300005564 | Bacteria | 1800 |
| 185 | Ga0068857_100017408 | 3300005577 | Bacteria | 6297 |
| 186 | Ga0068857_100157826 | 3300005577 | Bacteria | 2057 |
| 187 | Ga0068857_100159525 | 3300005577 | Bacteria | 2046 |
| 188 | Ga0068857_100330635 | 3300005577 | Bacteria | 1408 |
| 189 | Ga0068854_100052677 | 3300005578 | Bacteria | 2919 |
| 190 | Ga0068854_100072045 | 3300005578 | Bacteria | 2529 |
| 191 | Ga0068854_100110195 | 3300005578 | Bacteria | 2075 |
| 192 | Ga0068854_100352732 | 3300005578 | Bacteria | 1205 |
| 193 | Ga0068856_100151917 | 3300005614 | Bacteria | 2325 |
| 194 | Ga0070702_100059433 | 3300005615 | Bacteria | 2218 |
| 195 | Ga0070702_100199324 | 3300005615 | Bacteria | 1324 |
| 196 | Ga0070702_100309120 | 3300005615 | Bacteria | 1097 |
| 197 | Ga0068852_100027996 | 3300005616 | Bacteria | 4604 |
| 198 | Ga0068852_100042319 | 3300005616 | Bacteria | 3856 |
| 199 | Ga0068852_100063421 | 3300005616 | Bacteria | 3217 |
| 200 | Ga0068852_100084077 | 3300005616 | Bacteria | 2831 |
| 201 | Ga0068852_100161780 | 3300005616 | Bacteria | 2091 |
| 202 | Ga0068852_100209190 | 3300005616 | Bacteria | 1850 |
| 203 | Ga0068859_100023045 | 3300005617 | Bacteria | 6243 |
| 204 | Ga0068859_100098576 | 3300005617 | Bacteria | 2977 |
| 205 | Ga0068859_100121412 | 3300005617 | Bacteria | 2679 |
| 206 | Ga0068859_100473170 | 3300005617 | Bacteria | 1348 |
| 207 | Ga0068864_100000845 | 3300005618 | Bacteria | 25824 |
| 208 | Ga0068864_100021018 | 3300005618 | Bacteria | 5465 |
| 209 | Ga0068864_100024185 | 3300005618 | Bacteria | 5107 |
| 210 | Ga0068864_100044697 | 3300005618 | Bacteria | 3798 |
| 211 | Ga0068864_100071385 | 3300005618 | Bacteria | 3023 |
| 212 | Ga0068864_100078936 | 3300005618 | Bacteria | 2881 |
| 213 | Ga0068864_100096415 | 3300005618 | Bacteria | 2617 |
| 214 | Ga0068864_100184809 | 3300005618 | Bacteria | 1907 |
| 215 | Ga0068861_100105393 | 3300005719 | Bacteria | 2251 |
| 216 | Ga0068861_100393112 | 3300005719 | Bacteria | 1228 |
| 217 | Ga0068861_100460110 | 3300005719 | Bacteria | 1142 |
| 218 | Ga0068851_10000843 | 3300005834 | Bacteria | 13213 |
| 219 | Ga0068870_10065494 | 3300005840 | Bacteria | 1966 |
| 220 | Ga0068863_100002048 | 3300005841 | Bacteria | 19982 |
| 221 | Ga0068863_100034799 | 3300005841 | Bacteria | 4797 |
| 222 | Ga0068863_100071222 | 3300005841 | Bacteria | 3289 |
| 223 | Ga0068863_100107675 | 3300005841 | Bacteria | 2652 |
| 224 | Ga0068863_100119529 | 3300005841 | Bacteria | 2512 |
| 225 | Ga0068863_100152090 | 3300005841 | Bacteria | 2214 |
| 226 | Ga0068863_100152743 | 3300005841 | Bacteria | 2210 |
| 227 | Ga0068863_100154405 | 3300005841 | Bacteria | 2197 |
| 228 | Ga0068858_100002570 | 3300005842 | Bacteria | 18284 |
| 229 | Ga0068858_100252112 | 3300005842 | Bacteria | 1677 |
| 230 | Ga0068858_100266980 | 3300005842 | Bacteria | 1628 |
| 231 | Ga0068858_100325491 | 3300005842 | Bacteria | 1469 |
| 232 | Ga0068858_100539810 | 3300005842 | Bacteria | 1129 |
| 233 | Ga0068860_100008382 | 3300005843 | Bacteria | 10293 |
| 234 | Ga0068860_100012965 | 3300005843 | Bacteria | 8187 |
| 235 | Ga0068860_100057346 | 3300005843 | Bacteria | 3702 |
| 236 | Ga0068860_100075322 | 3300005843 | Bacteria | 3210 |
| 237 | Ga0068862_100113099 | 3300005844 | Bacteria | 2385 |
| 238 | Ga0068862_100145352 | 3300005844 | Bacteria | 2107 |
| 239 | Ga0068862_100154254 | 3300005844 | Bacteria | 2046 |
| 240 | Ga0068862_100173498 | 3300005844 | Bacteria | 1931 |
| 241 | Ga0068862_100634976 | 3300005844 | Bacteria | 1028 |
| 242 | Ga0070717_10179449 | 3300006028 | Bacteria | 1845 |
| 243 | Ga0075365_10162457 | 3300006038 | Bacteria | 1557 |
| 244 | Ga0075365_10299676 | 3300006038 | Bacteria | 1131 |
| 245 | Ga0075368_10114950 | 3300006042 | Bacteria | 1111 |
| 246 | Ga0075363_100036983 | 3300006048 | Bacteria | 2562 |
| 247 | Ga0075364_10109509 | 3300006051 | Bacteria | 1842 |
| 248 | Ga0075364_10161447 | 3300006051 | Bacteria | 1513 |
| 249 | Ga0075364_10302949 | 3300006051 | Bacteria | 1088 |
| 250 | Ga0075364_10350918 | 3300006051 | Bacteria | 1006 |
| 251 | Ga0075362_10062690 | 3300006177 | Bacteria | 1685 |
| 252 | Ga0075367_10010982 | 3300006178 | Bacteria | 4774 |
| 253 | Ga0075367_10018189 | 3300006178 | Bacteria | 3873 |
| 254 | Ga0075367_10166400 | 3300006178 | Bacteria | 1372 |
| 255 | Ga0075369_10009596 | 3300006186 | Bacteria | 3764 |
| 256 | Ga0075369_10059355 | 3300006186 | Bacteria | 1666 |
| 257 | Ga0075369_10086249 | 3300006186 | Bacteria | 1397 |
| 258 | Ga0075369_10205939 | 3300006186 | Bacteria | 908 |
| 259 | Ga0075366_10002787 | 3300006195 | Bacteria | 9038 |
| 260 | Ga0075366_10015678 | 3300006195 | Bacteria | 4349 |
| 261 | Ga0075366_10064729 | 3300006195 | Bacteria | 2174 |
| 262 | Ga0075366_10143252 | 3300006195 | Bacteria | 1445 |
| 263 | Ga0075366_10210536 | 3300006195 | Bacteria | 1183 |
| 264 | Ga0097621_100007338 | 3300006237 | Bacteria | 7881 |
| 265 | Ga0097621_100037524 | 3300006237 | Bacteria | 3884 |
| 266 | Ga0097621_100140720 | 3300006237 | Bacteria | 2061 |
| 267 | Ga0097621_100241368 | 3300006237 | Bacteria | 1579 |
| 268 | Ga0097621_100404665 | 3300006237 | Bacteria | 1222 |
| 269 | Ga0097621_100450408 | 3300006237 | Bacteria | 1160 |
| 270 | Ga0097621_100558114 | 3300006237 | Bacteria | 1043 |
| 271 | Ga0075370_10006766 | 3300006353 | Bacteria | 5792 |
| 272 | Ga0075370_10024220 | 3300006353 | Bacteria | 3351 |
| 273 | Ga0075370_10027723 | 3300006353 | Bacteria | 3145 |
| 274 | Ga0075370_10063075 | 3300006353 | Bacteria | 2112 |
| 275 | Ga0075370_10070550 | 3300006353 | Bacteria | 1998 |
| 276 | Ga0075370_10127002 | 3300006353 | Bacteria | 1487 |
| 277 | Ga0068871_100064731 | 3300006358 | Bacteria | 2993 |
| 278 | Ga0068871_100230418 | 3300006358 | Bacteria | 1608 |
| 279 | Ga0068871_100473496 | 3300006358 | Bacteria | 1126 |
| 280 | Ga0075428_100101687 | 3300006844 | Bacteria | 3133 |
| 281 | Ga0075430_100034456 | 3300006846 | Bacteria | 4297 |
| 282 | Ga0075430_100109091 | 3300006846 | Bacteria | 2309 |
| 283 | Ga0075431_100034361 | 3300006847 | Bacteria | 5223 |
| 284 | Ga0075431_100052328 | 3300006847 | Bacteria | 4211 |
| 285 | Ga0075429_100029093 | 3300006880 | Bacteria | 4799 |
| 286 | Ga0075429_100193894 | 3300006880 | Bacteria | 1780 |
| 287 | Ga0068865_100006221 | 3300006881 | Bacteria | 7277 |
| 288 | Ga0068865_100022991 | 3300006881 | Bacteria | 4075 |
| 289 | Ga0068865_100041947 | 3300006881 | Bacteria | 3117 |
| 290 | Ga0068865_100114232 | 3300006881 | Bacteria | 1997 |
| 291 | Ga0068865_100426501 | 3300006881 | Bacteria | 1091 |
| 292 | Ga0097620_100023045 | 3300006931 | Bacteria | 6243 |
| 293 | Ga0097620_100098578 | 3300006931 | Bacteria | 2977 |
| 294 | Ga0097620_100121412 | 3300006931 | Bacteria | 2679 |
| 295 | Ga0097620_100473176 | 3300006931 | Bacteria | 1348 |
| 296 | Ga0079104_1000206 | 3300006946 | Bacteria | 82424 |
| 297 | Ga0099826_10000021 | 3300006948 | Bacteria | 173580 |
| 298 | Ga0105251_10159709 | 3300009011 | Bacteria | 1016 |
| 299 | Ga0105244_10000031 | 3300009036 | Bacteria | 177606 |
| 300 | Ga0105244_10003602 | 3300009036 | Bacteria | 11001 |
| 301 | Ga0105240_10008920 | 3300009093 | Bacteria | 14257 |
| 302 | Ga0105240_10041470 | 3300009093 | Bacteria | 5875 |
| 303 | Ga0105240_10059308 | 3300009093 | Bacteria | 4776 |
| 304 | Ga0105240_10112031 | 3300009093 | Bacteria | 3299 |
| 305 | Ga0105240_10290611 | 3300009093 | Bacteria | 1874 |
| 306 | Ga0111539_10058487 | 3300009094 | Bacteria | 4573 |
| 307 | Ga0105245_10105475 | 3300009098 | Bacteria | 2614 |
| 308 | Ga0105247_10353938 | 3300009101 | Bacteria | 1033 |
| 309 | Ga0105243_10000765 | 3300009148 | Bacteria | 30835 |
| 310 | Ga0105243_10024959 | 3300009148 | Bacteria | 4564 |
| 311 | Ga0105243_10041298 | 3300009148 | Bacteria | 3607 |
| 312 | Ga0105243_10251968 | 3300009148 | Bacteria | 1577 |
| 313 | Ga0105243_10438575 | 3300009148 | Bacteria | 1222 |
| 314 | Ga0105241_10165743 | 3300009174 | Bacteria | 1821 |
| 315 | Ga0105242_10090130 | 3300009176 | Bacteria | 2579 |
| 316 | Ga0105242_10448469 | 3300009176 | Bacteria | 1216 |
| 317 | Ga0105248_10086277 | 3300009177 | Bacteria | 3532 |
| 318 | Ga0105248_10116526 | 3300009177 | Bacteria | 3013 |
| 319 | Ga0105248_10119263 | 3300009177 | Bacteria | 2976 |
| 320 | Ga0105248_10268583 | 3300009177 | Bacteria | 1921 |
| 321 | Ga0105248_10285586 | 3300009177 | Bacteria | 1858 |
| 322 | Ga0105237_10051964 | 3300009545 | Bacteria | 4116 |
| 323 | Ga0105237_10103567 | 3300009545 | Bacteria | 2838 |
| 324 | Ga0105237_10175171 | 3300009545 | Bacteria | 2145 |
| 325 | Ga0105237_10279165 | 3300009545 | Bacteria | 1673 |
| 326 | Ga0105238_10000065 | 3300009551 | Bacteria | 121196 |
| 327 | Ga0105238_10063764 | 3300009551 | Bacteria | 3686 |
| 328 | Ga0105238_10196657 | 3300009551 | Bacteria | 1992 |
| 329 | Ga0105249_10086300 | 3300009553 | Bacteria | 2927 |
| 330 | Ga0105249_10091395 | 3300009553 | Bacteria | 2848 |
| 331 | Ga0105239_10054735 | 3300010375 | Bacteria | 4377 |
| 332 | Ga0105239_10063942 | 3300010375 | Bacteria | 4040 |
| 333 | Ga0105239_10159772 | 3300010375 | Bacteria | 2517 |
| 334 | Ga0105239_10709275 | 3300010375 | Bacteria | 1150 |
| 335 | Ga0105246_10165345 | 3300011119 | Bacteria | 1689 |
| 336 | Ga0105246_10402965 | 3300011119 | Bacteria | 1136 |
| 337 | Ga0157319_1000695 | 3300012497 | Bacteria | 1560 |
| 338 | Ga0157339_1001068 | 3300012505 | Bacteria | 1581 |
| 339 | Ga0157371_10045298 | 3300013102 | Bacteria | 3130 |
| 340 | Ga0157370_10002003 | 3300013104 | Bacteria | 25038 |
| 341 | Ga0157370_10310879 | 3300013104 | Bacteria | 1454 |
| 342 | Ga0157369_10035810 | 3300013105 | Bacteria | 5441 |
| 343 | Ga0157374_10050728 | 3300013296 | Bacteria | 3858 |
| 344 | Ga0157374_10110971 | 3300013296 | Bacteria | 2638 |
| 345 | Ga0157374_10146904 | 3300013296 | Bacteria | 2290 |
| 346 | Ga0157374_10446048 | 3300013296 | Bacteria | 1295 |
| 347 | Ga0157374_10482189 | 3300013296 | Bacteria | 1243 |
| 348 | Ga0157374_10606869 | 3300013296 | Bacteria | 1104 |
| 349 | Ga0157378_10040681 | 3300013297 | Bacteria | 4123 |
| 350 | Ga0157378_10070198 | 3300013297 | Bacteria | 3144 |
| 351 | Ga0157378_10240961 | 3300013297 | Bacteria | 1727 |
| 352 | Ga0157378_10378962 | 3300013297 | Bacteria | 1389 |
| 353 | Ga0157378_10508236 | 3300013297 | Bacteria | 1205 |
| 354 | Ga0157378_10516439 | 3300013297 | Bacteria | 1195 |
| 355 | Ga0163162_10047977 | 3300013306 | Bacteria | 4279 |
| 356 | Ga0163162_10077315 | 3300013306 | Bacteria | 3391 |
| 357 | Ga0163162_10115597 | 3300013306 | Bacteria | 2783 |
| 358 | Ga0163162_10122403 | 3300013306 | Bacteria | 2706 |
| 359 | Ga0163162_10221744 | 3300013306 | Bacteria | 2021 |
| 360 | Ga0163162_10599824 | 3300013306 | Bacteria | 1227 |
| 361 | Ga0157372_10060900 | 3300013307 | Bacteria | 4224 |
| 362 | Ga0157375_10011762 | 3300013308 | Bacteria | 7738 |
| 363 | Ga0157375_10035622 | 3300013308 | Bacteria | 4752 |
| 364 | Ga0157375_10049483 | 3300013308 | Bacteria | 4118 |
| 365 | Ga0157375_10059297 | 3300013308 | Bacteria | 3791 |
| 366 | Ga0157375_10064588 | 3300013308 | Bacteria | 3645 |
| 367 | Ga0157375_10219009 | 3300013308 | Bacteria | 2062 |
| 368 | Ga0157375_10233301 | 3300013308 | Bacteria | 1999 |
| 369 | Ga0157375_10451319 | 3300013308 | Bacteria | 1451 |
| 370 | Ga0163163_10217309 | 3300014325 | Bacteria | 1960 |
| 371 | Ga0163163_10218492 | 3300014325 | Bacteria | 1954 |
| 372 | Ga0157380_10009058 | 3300014326 | Bacteria | 7112 |
| 373 | Ga0182008_10024475 | 3300014497 | Bacteria | 3075 |
| 374 | Ga0182008_10037502 | 3300014497 | Bacteria | 2425 |
| 375 | Ga0182008_10053291 | 3300014497 | Bacteria | 2003 |
| 376 | Ga0182008_10079655 | 3300014497 | Bacteria | 1612 |
| 377 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 378 | Ga0157379_10008726 | 3300014968 | Bacteria | 8833 |
| 379 | Ga0157379_10048728 | 3300014968 | Bacteria | 3782 |
| 380 | Ga0157379_10049079 | 3300014968 | Bacteria | 3768 |
| 381 | Ga0157379_10281376 | 3300014968 | Bacteria | 1514 |
| 382 | Ga0157376_10106693 | 3300014969 | Bacteria | 2458 |
| 383 | Ga0157376_10215134 | 3300014969 | Bacteria | 1776 |
| 384 | Ga0157376_10328135 | 3300014969 | Bacteria | 1457 |
| 385 | Ga0182006_1002966 | 3300015261 | Bacteria | 8953 |
| 386 | Ga0182006_1014559 | 3300015261 | Bacteria | 3387 |
| 387 | Ga0182007_10002108 | 3300015262 | Bacteria | 10177 |
| 388 | Ga0182007_10016980 | 3300015262 | Bacteria | 2670 |
| 389 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 390 | Ga0163161_10032312 | 3300017792 | Bacteria | 3736 |
| 391 | Ga0163161_10040898 | 3300017792 | Bacteria | 3330 |
| 392 | Ga0163161_10141036 | 3300017792 | Bacteria | 1825 |
| 393 | Ga0163161_10155206 | 3300017792 | Bacteria | 1742 |
| 394 | Ga0163161_10233374 | 3300017792 | Bacteria | 1428 |
| 395 | Ga0163161_10272017 | 3300017792 | Bacteria | 1326 |
| 396 | Ga0213872_10016125 | 3300021361 | Bacteria | 3469 |
| 397 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 398 | Ga0209435_100019 | 3300025206 | Bacteria | 260989 |
| 399 | Ga0209435_100290 | 3300025206 | Bacteria | 12177 |
| 400 | Ga0209436_104004 | 3300025208 | Bacteria | 3726 |
| 401 | Ga0209436_105266 | 3300025208 | Bacteria | 3005 |
| 402 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 403 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 404 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 405 | Ga0209672_102201 | 3300025228 | Bacteria | 5090 |
| 406 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 407 | Ga0209147_100843 | 3300025229 | Bacteria | 14406 |
| 408 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 409 | Ga0209437_100758 | 3300025233 | Bacteria | 15571 |
| 410 | Ga0209258_100020 | 3300025242 | Bacteria | 565241 |
| 411 | Ga0209258_100226 | 3300025242 | Bacteria | 106588 |
| 412 | Ga0207425_1000814 | 3300025245 | Bacteria | 15617 |
| 413 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 414 | Ga0209646_1000038 | 3300025246 | Bacteria | 353982 |
| 415 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 416 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 417 | Ga0209026_1000048 | 3300025250 | Bacteria | 257264 |
| 418 | Ga0209026_1003765 | 3300025250 | Bacteria | 4808 |
| 419 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 420 | Ga0209148_1000031 | 3300025254 | Bacteria | 564601 |
| 421 | Ga0209759_1000038 | 3300025256 | Bacteria | 257264 |
| 422 | Ga0209759_1000049 | 3300025256 | Bacteria | 221692 |
| 423 | Ga0209759_1000357 | 3300025256 | Bacteria | 59208 |
| 424 | Ga0209129_1000055 | 3300025258 | Bacteria | 261708 |
| 425 | Ga0209129_1006666 | 3300025258 | Bacteria | 3660 |
| 426 | Ga0209565_1000078 | 3300025263 | Bacteria | 160838 |
| 427 | Ga0209565_1000310 | 3300025263 | Bacteria | 45322 |
| 428 | Ga0209565_1000615 | 3300025263 | Bacteria | 23470 |
| 429 | Ga0209565_1001707 | 3300025263 | Bacteria | 9041 |
| 430 | Ga0209565_1016361 | 3300025263 | Bacteria | 1651 |
| 431 | Ga0209673_1000170 | 3300025273 | Bacteria | 133933 |
| 432 | Ga0209673_1001531 | 3300025273 | Bacteria | 21069 |
| 433 | Ga0209673_1002628 | 3300025273 | Bacteria | 12057 |
| 434 | Ga0209673_1011259 | 3300025273 | Bacteria | 3700 |
| 435 | Ga0209673_1026678 | 3300025273 | Bacteria | 1892 |
| 436 | Ga0209673_1027129 | 3300025273 | Bacteria | 1868 |
| 437 | Ga0209130_1000289 | 3300025284 | Bacteria | 61485 |
| 438 | Ga0209130_1000807 | 3300025284 | Bacteria | 26513 |
| 439 | Ga0209130_1001274 | 3300025284 | Bacteria | 17481 |
| 440 | Ga0209130_1011749 | 3300025284 | Bacteria | 2329 |
| 441 | Ga0209130_1012738 | 3300025284 | Bacteria | 2184 |
| 442 | Ga0209675_1000055 | 3300025291 | Bacteria | 193129 |
| 443 | Ga0209675_1001778 | 3300025291 | Bacteria | 11775 |
| 444 | Ga0209675_1002139 | 3300025291 | Bacteria | 10421 |
| 445 | Ga0209675_1010406 | 3300025291 | Bacteria | 3179 |
| 446 | Ga0209675_1016325 | 3300025291 | Bacteria | 2168 |
| 447 | Ga0209675_1018963 | 3300025291 | Bacteria | 1908 |
| 448 | Ga0209676_1000040 | 3300025292 | Bacteria | 438184 |
| 449 | Ga0209676_1003179 | 3300025292 | Bacteria | 10438 |
| 450 | Ga0209676_1011949 | 3300025292 | Bacteria | 3455 |
| 451 | Ga0209676_1013043 | 3300025292 | Bacteria | 3219 |
| 452 | Ga0209676_1017739 | 3300025292 | Bacteria | 2507 |
| 453 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 454 | Ga0209025_1000409 | 3300025294 | Bacteria | 86577 |
| 455 | Ga0209025_1001751 | 3300025294 | Bacteria | 26059 |
| 456 | Ga0209025_1009368 | 3300025294 | Bacteria | 6843 |
| 457 | Ga0209025_1010755 | 3300025294 | Bacteria | 6151 |
| 458 | Ga0209025_1018466 | 3300025294 | Bacteria | 3947 |
| 459 | Ga0209025_1051447 | 3300025294 | Bacteria | 1636 |
| 460 | Ga0209564_1000157 | 3300025295 | Bacteria | 164758 |
| 461 | Ga0209564_1000806 | 3300025295 | Bacteria | 42875 |
| 462 | Ga0209564_1001767 | 3300025295 | Bacteria | 20130 |
| 463 | Ga0209564_1002258 | 3300025295 | Bacteria | 15792 |
| 464 | Ga0209758_1000042 | 3300025297 | Bacteria | 407145 |
| 465 | Ga0209758_1005953 | 3300025297 | Bacteria | 9040 |
| 466 | Ga0209758_1040043 | 3300025297 | Bacteria | 1773 |
| 467 | Ga0209050_1000021 | 3300025298 | Bacteria | 574406 |
| 468 | Ga0209050_1000760 | 3300025298 | Bacteria | 46346 |
| 469 | Ga0209050_1003967 | 3300025298 | Bacteria | 10438 |
| 470 | Ga0209050_1004794 | 3300025298 | Bacteria | 8911 |
| 471 | Ga0209050_1015628 | 3300025298 | Bacteria | 3170 |
| 472 | Ga0209050_1041968 | 3300025298 | Bacteria | 1255 |
| 473 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 474 | Ga0209256_1000056 | 3300025299 | Bacteria | 283044 |
| 475 | Ga0209256_1000124 | 3300025299 | Bacteria | 165390 |
| 476 | Ga0209256_1000127 | 3300025299 | Bacteria | 164393 |
| 477 | Ga0209256_1000906 | 3300025299 | Bacteria | 36323 |
| 478 | Ga0207426_1000055 | 3300025302 | Bacteria | 374450 |
| 479 | Ga0207426_1000079 | 3300025302 | Bacteria | 314709 |
| 480 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 481 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 482 | Ga0209051_1000068 | 3300025303 | Bacteria | 220063 |
| 483 | Ga0209051_1000351 | 3300025303 | Bacteria | 68445 |
| 484 | Ga0209051_1000423 | 3300025303 | Bacteria | 58174 |
| 485 | Ga0209051_1000446 | 3300025303 | Bacteria | 55218 |
| 486 | Ga0209051_1000530 | 3300025303 | Bacteria | 47308 |
| 487 | Ga0209051_1008921 | 3300025303 | Bacteria | 5237 |
| 488 | Ga0209051_1013428 | 3300025303 | Bacteria | 3898 |
| 489 | Ga0209051_1015139 | 3300025303 | Bacteria | 3562 |
| 490 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 491 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 492 | Ga0209257_1000043 | 3300025304 | Bacteria | 512127 |
| 493 | Ga0209257_1001377 | 3300025304 | Bacteria | 29185 |
| 494 | Ga0209257_1003725 | 3300025304 | Bacteria | 12653 |
| 495 | Ga0209257_1013914 | 3300025304 | Bacteria | 3516 |
| 496 | Ga0209257_1024395 | 3300025304 | Bacteria | 2094 |
| 497 | Ga0207697_10020918 | 3300025315 | Bacteria | 2679 |
| 498 | Ga0207656_10087638 | 3300025321 | Bacteria | 1408 |
| 499 | Ga0207656_10170628 | 3300025321 | Bacteria | 1040 |
| 500 | Ga0207655_1000029 | 3300025728 | Bacteria | 432187 |
| 501 | Ga0207655_1005080 | 3300025728 | Bacteria | 9094 |
| 502 | Ga0207682_10001047 | 3300025893 | Bacteria | 12739 |
| 503 | Ga0207682_10006237 | 3300025893 | Bacteria | 4818 |
| 504 | Ga0207682_10095522 | 3300025893 | Bacteria | 1294 |
| 505 | Ga0207642_10044161 | 3300025899 | Bacteria | 1971 |
| 506 | Ga0207642_10136047 | 3300025899 | Bacteria | 1289 |
| 507 | Ga0207688_10043780 | 3300025901 | Bacteria | 2494 |
| 508 | Ga0207680_10001068 | 3300025903 | Bacteria | 12931 |
| 509 | Ga0207680_10039848 | 3300025903 | Bacteria | 2729 |
| 510 | Ga0207680_10056911 | 3300025903 | Bacteria | 2364 |
| 511 | Ga0207680_10424525 | 3300025903 | Bacteria | 942 |
| 512 | Ga0207645_10004706 | 3300025907 | Bacteria | 10041 |
| 513 | Ga0207645_10014655 | 3300025907 | Bacteria | 5235 |
| 514 | Ga0207645_10071087 | 3300025907 | Bacteria | 2227 |
| 515 | Ga0207645_10094840 | 3300025907 | Bacteria | 1921 |
| 516 | Ga0207645_10095900 | 3300025907 | Bacteria | 1910 |
| 517 | Ga0207643_10017706 | 3300025908 | Bacteria | 3899 |
| 518 | Ga0207643_10042663 | 3300025908 | Bacteria | 2558 |
| 519 | Ga0207643_10080252 | 3300025908 | Bacteria | 1890 |
| 520 | Ga0207684_10023176 | 3300025910 | Bacteria | 5302 |
| 521 | Ga0207695_10002732 | 3300025913 | Bacteria | 25730 |
| 522 | Ga0207695_10007216 | 3300025913 | Bacteria | 14208 |
| 523 | Ga0207695_10082478 | 3300025913 | Bacteria | 3250 |
| 524 | Ga0207695_10123453 | 3300025913 | Bacteria | 2555 |
| 525 | Ga0207695_10178105 | 3300025913 | Bacteria | 2048 |
| 526 | Ga0207695_10628475 | 3300025913 | Bacteria | 955 |
| 527 | Ga0207671_10002693 | 3300025914 | Bacteria | 18627 |
| 528 | Ga0207671_10061344 | 3300025914 | Bacteria | 2790 |
| 529 | Ga0207671_10126738 | 3300025914 | Bacteria | 1956 |
| 530 | Ga0207671_10214023 | 3300025914 | Bacteria | 1508 |
| 531 | Ga0207662_10027183 | 3300025918 | Bacteria | 3303 |
| 532 | Ga0207662_10199852 | 3300025918 | Bacteria | 1293 |
| 533 | Ga0207657_10255358 | 3300025919 | Bacteria | 1396 |
| 534 | Ga0207649_10324495 | 3300025920 | Bacteria | 1132 |
| 535 | Ga0207681_10006325 | 3300025923 | Bacteria | 7268 |
| 536 | Ga0207681_10079980 | 3300025923 | Bacteria | 2304 |
| 537 | Ga0207681_10098926 | 3300025923 | Bacteria | 2099 |
| 538 | Ga0207694_10000977 | 3300025924 | Bacteria | 25038 |
| 539 | Ga0207694_10281387 | 3300025924 | Bacteria | 1366 |
| 540 | Ga0207694_10349242 | 3300025924 | Bacteria | 1224 |
| 541 | Ga0207650_10000710 | 3300025925 | Bacteria | 25994 |
| 542 | Ga0207650_10009975 | 3300025925 | Bacteria | 6501 |
| 543 | Ga0207650_10028205 | 3300025925 | Bacteria | 4023 |
| 544 | Ga0207650_10046048 | 3300025925 | Bacteria | 3211 |
| 545 | Ga0207650_10066503 | 3300025925 | Bacteria | 2703 |
| 546 | Ga0207650_10067275 | 3300025925 | Bacteria | 2688 |
| 547 | Ga0207650_10101393 | 3300025925 | Bacteria | 2216 |
| 548 | Ga0207650_10164554 | 3300025925 | Bacteria | 1759 |
| 549 | Ga0207659_10000322 | 3300025926 | Bacteria | 28877 |
| 550 | Ga0207659_10008216 | 3300025926 | Bacteria | 6469 |
| 551 | Ga0207659_10008726 | 3300025926 | Bacteria | 6309 |
| 552 | Ga0207659_10015561 | 3300025926 | Bacteria | 4932 |
| 553 | Ga0207659_10065728 | 3300025926 | Bacteria | 2629 |
| 554 | Ga0207659_10165010 | 3300025926 | Bacteria | 1742 |
| 555 | Ga0207659_10240214 | 3300025926 | Bacteria | 1465 |
| 556 | Ga0207644_10001344 | 3300025931 | Bacteria | 15805 |
| 557 | Ga0207644_10001677 | 3300025931 | Bacteria | 14280 |
| 558 | Ga0207644_10032216 | 3300025931 | Bacteria | 3655 |
| 559 | Ga0207644_10087523 | 3300025931 | Bacteria | 2315 |
| 560 | Ga0207644_10104089 | 3300025931 | Bacteria | 2136 |
| 561 | Ga0207644_10129888 | 3300025931 | Bacteria | 1927 |
| 562 | Ga0207690_10313305 | 3300025932 | Bacteria | 1231 |
| 563 | Ga0207706_10003941 | 3300025933 | Bacteria | 14064 |
| 564 | Ga0207706_10102503 | 3300025933 | Bacteria | 2518 |
| 565 | Ga0207706_10115153 | 3300025933 | Bacteria | 2364 |
| 566 | Ga0207706_10348057 | 3300025933 | Bacteria | 1289 |
| 567 | Ga0207709_10000602 | 3300025935 | Bacteria | 29841 |
| 568 | Ga0207709_10022513 | 3300025935 | Bacteria | 3574 |
| 569 | Ga0207709_10040350 | 3300025935 | Bacteria | 2795 |
| 570 | Ga0207670_10011674 | 3300025936 | Bacteria | 5110 |
| 571 | Ga0207670_10048461 | 3300025936 | Bacteria | 2835 |
| 572 | Ga0207669_10003485 | 3300025937 | Bacteria | 6803 |
| 573 | Ga0207669_10003984 | 3300025937 | Bacteria | 6454 |
| 574 | Ga0207669_10343979 | 3300025937 | Bacteria | 1149 |
| 575 | Ga0207691_10000018 | 3300025940 | Bacteria | 134343 |
| 576 | Ga0207691_10012940 | 3300025940 | Bacteria | 7991 |
| 577 | Ga0207691_10028725 | 3300025940 | Bacteria | 5204 |
| 578 | Ga0207691_10182602 | 3300025940 | Bacteria | 1833 |
| 579 | Ga0207691_10186128 | 3300025940 | Bacteria | 1813 |
| 580 | Ga0207691_10214481 | 3300025940 | Bacteria | 1671 |
| 581 | Ga0207691_10234077 | 3300025940 | Bacteria | 1590 |
| 582 | Ga0207691_10270263 | 3300025940 | Bacteria | 1464 |
| 583 | Ga0207691_10419650 | 3300025940 | Bacteria | 1140 |
| 584 | Ga0207691_10446115 | 3300025940 | Bacteria | 1101 |
| 585 | Ga0207711_10005256 | 3300025941 | Bacteria | 10975 |
| 586 | Ga0207711_10042630 | 3300025941 | Bacteria | 3867 |
| 587 | Ga0207711_10089412 | 3300025941 | Bacteria | 2706 |
| 588 | Ga0207711_10211901 | 3300025941 | Bacteria | 1770 |
| 589 | Ga0207711_10435873 | 3300025941 | Bacteria | 1219 |
| 590 | Ga0207689_10006735 | 3300025942 | Bacteria | 10132 |
| 591 | Ga0207689_10007284 | 3300025942 | Bacteria | 9712 |
| 592 | Ga0207689_10061475 | 3300025942 | Bacteria | 3089 |
| 593 | Ga0207689_10167766 | 3300025942 | Bacteria | 1809 |
| 594 | Ga0207689_10367962 | 3300025942 | Bacteria | 1196 |
| 595 | Ga0207689_10472244 | 3300025942 | Bacteria | 1050 |
| 596 | Ga0207661_10192549 | 3300025944 | Bacteria | 1788 |
| 597 | Ga0207679_10042747 | 3300025945 | Bacteria | 3259 |
| 598 | Ga0207679_10065938 | 3300025945 | Bacteria | 2711 |
| 599 | Ga0207679_10091344 | 3300025945 | Bacteria | 2356 |
| 600 | Ga0207679_10132589 | 3300025945 | Bacteria | 2001 |
| 601 | Ga0207667_10011582 | 3300025949 | Bacteria | 10240 |
| 602 | Ga0207667_10016772 | 3300025949 | Bacteria | 8264 |
| 603 | Ga0207667_10433859 | 3300025949 | Bacteria | 1336 |
| 604 | Ga0207667_10644054 | 3300025949 | Bacteria | 1066 |
| 605 | Ga0207651_10003638 | 3300025960 | Bacteria | 7603 |
| 606 | Ga0207651_10037982 | 3300025960 | Bacteria | 3159 |
| 607 | Ga0207651_10150357 | 3300025960 | Bacteria | 1811 |
| 608 | Ga0207651_10192900 | 3300025960 | Bacteria | 1626 |
| 609 | Ga0207712_10076268 | 3300025961 | Bacteria | 2426 |
| 610 | Ga0207668_10020765 | 3300025972 | Bacteria | 4180 |
| 611 | Ga0207668_10211799 | 3300025972 | Bacteria | 1550 |
| 612 | Ga0207668_10287717 | 3300025972 | Bacteria | 1351 |
| 613 | Ga0207640_10211336 | 3300025981 | Bacteria | 1478 |
| 614 | Ga0207640_10234350 | 3300025981 | Bacteria | 1414 |
| 615 | Ga0207640_10291698 | 3300025981 | Bacteria | 1286 |
| 616 | Ga0207658_10006133 | 3300025986 | Bacteria | 8204 |
| 617 | Ga0207658_10023598 | 3300025986 | Bacteria | 4295 |
| 618 | Ga0207658_10032603 | 3300025986 | Bacteria | 3709 |
| 619 | Ga0207658_10050765 | 3300025986 | Bacteria | 3054 |
| 620 | Ga0207658_10118246 | 3300025986 | Bacteria | 2108 |
| 621 | Ga0207658_10267976 | 3300025986 | Bacteria | 1458 |
| 622 | Ga0207677_10004386 | 3300026023 | Bacteria | 7561 |
| 623 | Ga0207677_10006410 | 3300026023 | Bacteria | 6452 |
| 624 | Ga0207677_10006484 | 3300026023 | Bacteria | 6427 |
| 625 | Ga0207677_10012052 | 3300026023 | Bacteria | 4952 |
| 626 | Ga0207677_10195210 | 3300026023 | Bacteria | 1604 |
| 627 | Ga0207677_10433020 | 3300026023 | Bacteria | 1123 |
| 628 | Ga0207703_10000817 | 3300026035 | Bacteria | 30675 |
| 629 | Ga0207703_10047463 | 3300026035 | Bacteria | 3463 |
| 630 | Ga0207703_10085234 | 3300026035 | Bacteria | 2643 |
| 631 | Ga0207639_10009051 | 3300026041 | Bacteria | 6860 |
| 632 | Ga0207678_10048631 | 3300026067 | Bacteria | 3665 |
| 633 | Ga0207641_10005073 | 3300026088 | Bacteria | 11290 |
| 634 | Ga0207641_10049395 | 3300026088 | Bacteria | 3555 |
| 635 | Ga0207641_10074666 | 3300026088 | Bacteria | 2925 |
| 636 | Ga0207641_10083149 | 3300026088 | Bacteria | 2783 |
| 637 | Ga0207641_10182140 | 3300026088 | Bacteria | 1925 |
| 638 | Ga0207648_10000515 | 3300026089 | Bacteria | 43207 |
| 639 | Ga0207648_10026670 | 3300026089 | Bacteria | 5132 |
| 640 | Ga0207648_10032136 | 3300026089 | Bacteria | 4637 |
| 641 | Ga0207648_10052000 | 3300026089 | Bacteria | 3581 |
| 642 | Ga0207648_10077196 | 3300026089 | Bacteria | 2903 |
| 643 | Ga0207648_10086284 | 3300026089 | Bacteria | 2738 |
| 644 | Ga0207648_10124194 | 3300026089 | Bacteria | 2270 |
| 645 | Ga0207648_10135345 | 3300026089 | Bacteria | 2170 |
| 646 | Ga0207648_10148502 | 3300026089 | Bacteria | 2068 |
| 647 | Ga0207648_10244922 | 3300026089 | Bacteria | 1597 |
| 648 | Ga0207676_10001475 | 3300026095 | Bacteria | 17445 |
| 649 | Ga0207676_10010532 | 3300026095 | Bacteria | 6588 |
| 650 | Ga0207676_10011558 | 3300026095 | Bacteria | 6314 |
| 651 | Ga0207676_10017436 | 3300026095 | Bacteria | 5203 |
| 652 | Ga0207676_10019636 | 3300026095 | Bacteria | 4933 |
| 653 | Ga0207676_10078691 | 3300026095 | Bacteria | 2671 |
| 654 | Ga0207676_10112667 | 3300026095 | Bacteria | 2279 |
| 655 | Ga0207676_10250526 | 3300026095 | Bacteria | 1594 |
| 656 | Ga0207674_10012362 | 3300026116 | Bacteria | 9542 |
| 657 | Ga0207674_10016088 | 3300026116 | Bacteria | 8193 |
| 658 | Ga0207674_10050876 | 3300026116 | Bacteria | 4230 |
| 659 | Ga0207674_10076115 | 3300026116 | Bacteria | 3365 |
| 660 | Ga0207674_10202405 | 3300026116 | Bacteria | 1935 |
| 661 | Ga0207674_10217177 | 3300026116 | Bacteria | 1860 |
| 662 | Ga0207675_100004701 | 3300026118 | Bacteria | 13140 |
| 663 | Ga0207675_100024107 | 3300026118 | Bacteria | 5657 |
| 664 | Ga0207675_100030188 | 3300026118 | Bacteria | 5049 |
| 665 | Ga0207675_100049796 | 3300026118 | Bacteria | 3909 |
| 666 | Ga0207675_100057248 | 3300026118 | Bacteria | 3637 |
| 667 | Ga0207675_100225865 | 3300026118 | Bacteria | 1805 |
| 668 | Ga0207683_10000020 | 3300026121 | Bacteria | 118805 |
| 669 | Ga0207683_10024111 | 3300026121 | Bacteria | 5236 |
| 670 | Ga0207683_10044935 | 3300026121 | Bacteria | 3862 |
| 671 | Ga0207683_10089845 | 3300026121 | Bacteria | 2734 |
| 672 | Ga0207683_10104296 | 3300026121 | Bacteria | 2534 |
| 673 | Ga0207683_10113807 | 3300026121 | Bacteria | 2424 |
| 674 | Ga0207683_10219993 | 3300026121 | Bacteria | 1730 |
| 675 | Ga0207683_10396596 | 3300026121 | Bacteria | 1269 |
| 676 | Ga0207698_10007168 | 3300026142 | Bacteria | 6981 |
| 677 | Ga0207698_10038539 | 3300026142 | Bacteria | 3532 |
| 678 | Ga0207698_10146995 | 3300026142 | Bacteria | 2040 |
| 679 | Ga0207698_10253160 | 3300026142 | Bacteria | 1613 |
| 680 | Ga0209281_1000259 | 3300027111 | Bacteria | 101905 |
| 681 | Ga0209970_1000196 | 3300027614 | Bacteria | 9671 |
| 682 | Ga0209282_1000019 | 3300027666 | Bacteria | 184034 |
| 683 | Ga0209282_1000139 | 3300027666 | Bacteria | 42847 |
| 684 | Ga0209813_10024788 | 3300027866 | Bacteria | 1719 |
| 685 | Ga0268266_10018522 | 3300028379 | Bacteria | 5933 |
| 686 | Ga0268266_10024477 | 3300028379 | Bacteria | 5133 |
| 687 | Ga0268266_10040123 | 3300028379 | Bacteria | 3989 |
| 688 | Ga0268266_10271557 | 3300028379 | Bacteria | 1574 |
| 689 | Ga0268265_10011207 | 3300028380 | Bacteria | 6060 |
| 690 | Ga0268265_10029780 | 3300028380 | Bacteria | 3924 |
| 691 | Ga0268265_10137561 | 3300028380 | Bacteria | 2040 |
| 692 | Ga0268265_10298618 | 3300028380 | Bacteria | 1449 |
| 693 | Ga0268264_10003598 | 3300028381 | Bacteria | 13341 |
| 694 | Ga0268264_10052836 | 3300028381 | Bacteria | 3389 |
| 695 | Ga0268264_10086924 | 3300028381 | Bacteria | 2687 |
| 696 | Ga0307517_10002655 | 3300028786 | Bacteria | 28561 |
| 697 | Ga0307515_10000138 | 3300028794 | Bacteria | 173220 |
| 698 | Ga0307515_10000322 | 3300028794 | Bacteria | 118563 |
| 699 | Ga0307515_10001193 | 3300028794 | Bacteria | 59425 |
| 700 | Ga0307515_10002234 | 3300028794 | Bacteria | 42472 |
| 701 | Ga0307515_10023840 | 3300028794 | Bacteria | 10697 |
| 702 | Ga0307515_10041898 | 3300028794 | Bacteria | 7183 |
| 703 | Ga0307515_10067248 | 3300028794 | Bacteria | 4946 |
| 704 | Ga0307515_10094964 | 3300028794 | Bacteria | 3676 |
| 705 | Ga0307515_10096814 | 3300028794 | Bacteria | 3614 |
| 706 | Ga0307515_10135512 | 3300028794 | Bacteria | 2680 |
| 707 | Ga0307515_10146542 | 3300028794 | Bacteria | 2496 |
| 708 | Ga0307512_10066347 | 3300030522 | Bacteria | 2727 |
| 709 | Ga0316176_1141751 | 3300030732 | Bacteria | 1968 |
| 710 | Ga0314311_1073339 | 3300030733 | Bacteria | 2422 |
| 711 | Ga0316179_1111618 | 3300030734 | Bacteria | 1462 |
| 712 | Ga0316183_1025835 | 3300030742 | Bacteria | 2932 |
| 713 | Ga0265330_10014274 | 3300031235 | Bacteria | 3687 |
| 714 | Ga0265330_10047066 | 3300031235 | Bacteria | 1899 |
| 715 | Ga0265332_10035841 | 3300031238 | Bacteria | 2154 |
| 716 | Ga0265329_10011414 | 3300031242 | Bacteria | 3228 |
| 717 | Ga0265331_10043380 | 3300031250 | Bacteria | 2179 |
| 718 | Ga0265327_10003094 | 3300031251 | Bacteria | 16421 |
| 719 | Ga0265327_10005552 | 3300031251 | Bacteria | 10473 |
| 720 | Ga0265316_10199220 | 3300031344 | Bacteria | 1485 |
| 721 | Ga0307513_10000013 | 3300031456 | Bacteria | 325682 |
| 722 | Ga0307513_10000246 | 3300031456 | Bacteria | 78455 |
| 723 | Ga0307513_10007912 | 3300031456 | Bacteria | 13688 |
| 724 | Ga0307513_10027457 | 3300031456 | Bacteria | 6536 |
| 725 | Ga0307513_10075694 | 3300031456 | Bacteria | 3494 |
| 726 | Ga0307513_10104696 | 3300031456 | Bacteria | 2842 |
| 727 | Ga0307513_10122436 | 3300031456 | Bacteria | 2565 |
| 728 | Ga0307513_10270462 | 3300031456 | Bacteria | 1483 |
| 729 | Ga0307513_10325978 | 3300031456 | Bacteria | 1292 |
| 730 | Ga0307509_10007099 | 3300031507 | Bacteria | 14778 |
| 731 | Ga0307509_10019271 | 3300031507 | Bacteria | 7789 |
| 732 | Ga0307509_10033367 | 3300031507 | Bacteria | 5666 |
| 733 | Ga0307509_10164667 | 3300031507 | Bacteria | 2108 |
| 734 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 735 | Ga0307408_100006968 | 3300031548 | Bacteria | 7479 |
| 736 | Ga0307408_100054021 | 3300031548 | Bacteria | 2903 |
| 737 | Ga0307408_100086583 | 3300031548 | Bacteria | 2355 |
| 738 | Ga0307408_100111446 | 3300031548 | Bacteria | 2102 |
| 739 | Ga0307408_100152716 | 3300031548 | Bacteria | 1824 |
| 740 | Ga0307508_10000450 | 3300031616 | Bacteria | 49283 |
| 741 | Ga0307508_10008054 | 3300031616 | Bacteria | 9770 |
| 742 | Ga0307508_10055717 | 3300031616 | Bacteria | 3501 |
| 743 | Ga0307514_10001030 | 3300031649 | Bacteria | 40201 |
| 744 | Ga0307514_10004889 | 3300031649 | Bacteria | 12181 |
| 745 | Ga0307514_10008692 | 3300031649 | Bacteria | 8613 |
| 746 | Ga0307514_10009061 | 3300031649 | Bacteria | 8406 |
| 747 | Ga0307514_10109370 | 3300031649 | Bacteria | 1963 |
| 748 | Ga0307514_10156290 | 3300031649 | Bacteria | 1520 |
| 749 | Ga0265314_10008574 | 3300031711 | Bacteria | 8741 |
| 750 | Ga0265314_10038564 | 3300031711 | Bacteria | 3450 |
| 751 | Ga0265342_10038530 | 3300031712 | Bacteria | 2910 |
| 752 | Ga0307516_10008482 | 3300031730 | Bacteria | 11617 |
| 753 | Ga0307516_10077658 | 3300031730 | Bacteria | 3168 |
| 754 | Ga0307516_10353428 | 3300031730 | Bacteria | 1135 |
| 755 | Ga0307405_10252917 | 3300031731 | Bacteria | 1312 |
| 756 | Ga0307518_10244042 | 3300031838 | Bacteria | 1149 |
| 757 | Ga0307518_10330066 | 3300031838 | Bacteria | 904 |
| 758 | Ga0307406_10004336 | 3300031901 | Bacteria | 7719 |
| 759 | Ga0307406_10012119 | 3300031901 | Bacteria | 4907 |
| 760 | Ga0307412_10000392 | 3300031911 | Bacteria | 27005 |
| 761 | Ga0307412_10008739 | 3300031911 | Bacteria | 5795 |
| 762 | Ga0307412_10193682 | 3300031911 | Bacteria | 1538 |
| 763 | Ga0307412_10357730 | 3300031911 | Bacteria | 1174 |
| 764 | Ga0307412_10517187 | 3300031911 | Bacteria | 996 |
| 765 | Ga0307414_10115733 | 3300032004 | Bacteria | 2051 |
| 766 | Ga0307414_10293586 | 3300032004 | Bacteria | 1371 |
| 767 | Ga0307411_10002080 | 3300032005 | Bacteria | 8618 |
| 768 | Ga0307415_100694203 | 3300032126 | Bacteria | 918 |
| 769 | Ga0307510_10034007 | 3300033180 | Bacteria | 5714 |
| 770 | Ga0373936_0043270 | 3300035113 | Bacteria | 1810 |
| 771 | Ga0373957_0028893 | 3300035120 | Bacteria | 2023 |
| 772 | Ga0373955_0292472 | 3300035172 | Bacteria | 981 |
| 773 | Ga0373931_0025968 | 3300035691 | Bacteria | 2976 |
| 774 | Ga0373933_0190358 | 3300035724 | Bacteria | 1310 |
| 775 | Ga0373937_0040657 | 3300036401 | Bacteria | 4239 |
| 776 | Ga0373925_0461305 | 3300037068 | Bacteria | 1041 |
| 777 | Ga0395905_0052780 | 3300037471 | Bacteria | 3805 |
| 778 | Ga0395901_0111180 | 3300038443 | Bacteria | 2877 |
| 779 | Ga0436360_1081132 | 3300039438 | Bacteria | 1138 |
| 780 | Ga0436361_0032066 | 3300039447 | Bacteria | 3843 |
| 781 | Ga0436361_0206607 | 3300039447 | Bacteria | 3756 |
| 782 | Ga0436363_0171481 | 3300039450 | Bacteria | 1096 |
| 783 | Ga0439439_0003401 | 3300041406 | Bacteria | 3510 |
| 784 | Ga0439466_0002610 | 3300041411 | Bacteria | 7054 |
| 785 | Ga0439466_0020082 | 3300041411 | Bacteria | 2386 |
| 786 | Ga0451839_0601462 | 3300041496 | Bacteria | 870 |
| 787 | Ga0439445_0001509 | 3300042004 | Bacteria | 5056 |
| 788 | Ga0439432_002290 | 3300042006 | Bacteria | 7216 |
| 789 | Ga0439449_0000753 | 3300042007 | Bacteria | 12445 |
| 790 | Ga0439449_0004213 | 3300042007 | Bacteria | 5558 |
| 791 | Ga0439452_002755 | 3300042010 | Bacteria | 6353 |
| 792 | Ga0450923_031374 | 3300042125 | Bacteria | 1085 |
| 793 | Ga0450898_003737 | 3300042134 | Bacteria | 2203 |
| 794 | Ga0450909_011691 | 3300042185 | Bacteria | 1286 |
| 795 | Ga0439434_0001757 | 3300042435 | Bacteria | 6291 |
| 796 | Ga0450918_002439 | 3300042531 | Bacteria | 3517 |
| 797 | Ga0466972_0000880 | 3300044658 | Bacteria | 14429 |
| 798 | Ga0466965_0002203 | 3300044683 | Bacteria | 8200 |
| 799 | Ga0466964_0007106 | 3300044706 | Bacteria | 4188 |
| 800 | Ga0466964_0012803 | 3300044706 | Bacteria | 3177 |
| 801 | Ga0453684_0391028 | 3300044712 | Bacteria | 1560 |
| 802 | Ga0466968_0008025 | 3300044735 | Bacteria | 4035 |
| 803 | Ga0451576_0019302 | 3300045051 | Bacteria | 7442 |
| 804 | Ga0451576_0039018 | 3300045051 | Bacteria | 5026 |
| 805 | Ga0495638_0077305 | 3300046460 | Bacteria | 2027 |
| 806 | Ga0495585_0074205 | 3300046492 | Bacteria | 1851 |
| 807 | Ga0495596_0000064 | 3300046500 | Bacteria | 77744 |
| 808 | Ga0495607_0000507 | 3300046501 | Bacteria | 38608 |
| 809 | Ga0495610_0001367 | 3300046512 | Bacteria | 21670 |
| 810 | Ga0495610_0019846 | 3300046512 | Bacteria | 3748 |
| 811 | Ga0495616_0000866 | 3300046513 | Bacteria | 21983 |
| 812 | Ga0495620_0051816 | 3300046515 | Bacteria | 1745 |
| 813 | Ga0495632_0112483 | 3300046519 | Bacteria | 1277 |
| 814 | Ga0495637_0005420 | 3300046520 | Bacteria | 6507 |
| 815 | Ga0495648_0110383 | 3300046524 | Bacteria | 1498 |
| 816 | Ga0495642_0033322 | 3300046528 | Bacteria | 2071 |
| 817 | Ga0495642_0057359 | 3300046528 | Bacteria | 1610 |
| 818 | Ga0495654_0000834 | 3300046530 | Bacteria | 23400 |
| 819 | Ga0495609_0000244 | 3300046538 | Bacteria | 51384 |
| 820 | Ga0495656_0000365 | 3300046615 | Bacteria | 15165 |
| 821 | Ga0495625_0010498 | 3300046660 | Bacteria | 7655 |
| 822 | Ga0495661_0008722 | 3300046665 | Bacteria | 6997 |
| 823 | Ga0495588_0097715 | 3300046674 | Bacteria | 1541 |
| 824 | Ga0495671_0000453 | 3300046692 | Bacteria | 32377 |
| 825 | Ga0495649_0004212 | 3300046694 | Bacteria | 9435 |
| 826 | Ga0495660_0031902 | 3300046810 | Bacteria | 2960 |
| 827 | Ga0495672_0032883 | 3300047320 | Bacteria | 3219 |
| 828 | Ga0495676_0089794 | 3300047321 | Bacteria | 2301 |
| 829 | Ga0495687_027112 | 3300047443 | Bacteria | 2685 |
| 830 | Ga0495685_001488 | 3300047447 | Bacteria | 7169 |
| 831 | Ga0495686_0241770 | 3300047472 | Bacteria | 1018 |
| 832 | Ga0495593_0037115 | 3300047673 | Bacteria | 2638 |
| 833 | Ga0495614_0107705 | 3300048089 | Bacteria | 1222 |
| 834 | Ga0496101_0379158 | 3300048904 | Bacteria | 1113 |
| 835 | Ga0496102_0206626 | 3300048905 | Bacteria | 1851 |
| 836 | Ga0496103_0084378 | 3300048906 | Bacteria | 2001 |
| 837 | Ga0496104_0032473 | 3300048907 | Bacteria | 4859 |
| 838 | Ga0496105_0012904 | 3300048908 | Bacteria | 6622 |
| 839 | Ga0496106_0284822 | 3300048909 | Bacteria | 1324 |
| 840 | Ga0496108_0452077 | 3300048911 | Bacteria | 1122 |
| 841 | Ga0496109_0058519 | 3300048912 | Bacteria | 3520 |
| 842 | Ga0496110_0537597 | 3300048913 | Bacteria | 1063 |
| 843 | Ga0496114_0186150 | 3300048917 | Bacteria | 1815 |
| 844 | Ga0496115_0025937 | 3300048918 | Bacteria | 4568 |
| 845 | Ga0496116_0001004 | 3300048919 | Bacteria | 34438 |
| 846 | Ga0496116_0011864 | 3300048919 | Bacteria | 7170 |
| 847 | Ga0496116_0013245 | 3300048919 | Bacteria | 6667 |
| 848 | Ga0496116_0067024 | 3300048919 | Bacteria | 2294 |
| 849 | Ga0496116_0081581 | 3300048919 | Bacteria | 2004 |
| 850 | Ga0496116_0125457 | 3300048919 | Bacteria | 1475 |
| 851 | Ga0496117_0068338 | 3300048920 | Bacteria | 2399 |
| 852 | Ga0496118_0019857 | 3300048921 | Bacteria | 5988 |
| 853 | Ga0496118_0053756 | 3300048921 | Bacteria | 3057 |
| 854 | Ga0496118_0085109 | 3300048921 | Bacteria | 2203 |
| 855 | Ga0496119_0003325 | 3300048922 | Bacteria | 16773 |
| 856 | Ga0496120_0003204 | 3300048923 | Bacteria | 15214 |
| 857 | Ga0496121_0001404 | 3300048924 | Bacteria | 40784 |
| 858 | Ga0496121_0005640 | 3300048924 | Bacteria | 15922 |
| 859 | Ga0496121_0143282 | 3300048924 | Bacteria | 1769 |
| 860 | Ga0496121_0218094 | 3300048924 | Bacteria | 1346 |
| 861 | Ga0496121_0232548 | 3300048924 | Bacteria | 1290 |
| 862 | Ga0496122_0000029 | 3300048925 | Bacteria | 336396 |
| 863 | Ga0496122_0000317 | 3300048925 | Bacteria | 105883 |
| 864 | Ga0496122_0004249 | 3300048925 | Bacteria | 17968 |
| 865 | Ga0496122_0004463 | 3300048925 | Bacteria | 17342 |
| 866 | Ga0496123_0000124 | 3300048926 | Bacteria | 158327 |
| 867 | Ga0496123_0000531 | 3300048926 | Bacteria | 65624 |
| 868 | Ga0496123_0001487 | 3300048926 | Bacteria | 32545 |
| 869 | Ga0496123_0001761 | 3300048926 | Bacteria | 28565 |
| 870 | Ga0496123_0003891 | 3300048926 | Bacteria | 16246 |
| 871 | Ga0496124_0000024 | 3300048927 | Bacteria | 414291 |
| 872 | Ga0496124_0004949 | 3300048927 | Bacteria | 15271 |
| 873 | Ga0496124_0034977 | 3300048927 | Bacteria | 4399 |
| 874 | Ga0496124_0122058 | 3300048927 | Bacteria | 2080 |
| 875 | Ga0496124_0149259 | 3300048927 | Bacteria | 1836 |
| 876 | Ga0496124_0223673 | 3300048927 | Bacteria | 1413 |
| 877 | Ga0496125_0000244 | 3300048928 | Bacteria | 111663 |
| 878 | Ga0496125_0015625 | 3300048928 | Bacteria | 7326 |
| 879 | Ga0496125_0030924 | 3300048928 | Bacteria | 4779 |
| 880 | Ga0496126_0043446 | 3300048929 | Bacteria | 4146 |
| 881 | Ga0495682_0000003 | 3300049460 | Bacteria | 515787 |
| 882 | Ga0501048_0160292 | 3300049582 | Bacteria | 1592 |
| 883 | nmdc:mga00v17_56590_c1 | 3300050491 | Bacteria | 2398 |
| 884 | nmdc:mga0yw44_243798_c1 | 3300050492 | Bacteria | 1195 |
| 885 | nmdc:mga0k408_247959_c1 | 3300050493 | Bacteria | 1063 |
| 886 | nmdc:mga0k408_254840_c1 | 3300050493 | Bacteria | 1048 |
| 887 | nmdc:mga0k408_26319_c1 | 3300050493 | Bacteria | 3298 |
| 888 | nmdc:mga0k408_4891_c2 | 3300050493 | Bacteria | 4094 |
| 889 | nmdc:mga0k408_7822_c1 | 3300050493 | Bacteria | 5715 |
| 890 | nmdc:mga07m45_10453_c1 | 3300050496 | Bacteria | 4848 |
| 891 | nmdc:mga07m45_122_c1 | 3300050496 | Bacteria | 24374 |
| 892 | nmdc:mga07m45_15544_c1 | 3300050496 | Bacteria | 4064 |
| 893 | nmdc:mga07m45_196634_c1 | 3300050496 | Bacteria | 1173 |
| 894 | nmdc:mga07m45_4239_c1 | 3300050496 | Bacteria | 7019 |
| 895 | nmdc:mga07m45_93670_c1 | 3300050496 | Bacteria | 1722 |
| 896 | nmdc:mga05p37_92917_c1 | 3300050507 | Bacteria | 3718 |
| 897 | nmdc:mga09592_68309_c1 | 3300050508 | Bacteria | 3014 |
| 898 | nmdc:mga09592_70483_c1 | 3300050508 | Bacteria | 2966 |
| 899 | nmdc:mga0qj67_99755_c1 | 3300050509 | Bacteria | 2340 |
| 900 | nmdc:mga06r32_51310_c1 | 3300050510 | Bacteria | 3947 |
| 901 | nmdc:mga06r32_752362_c1 | 3300050510 | Bacteria | 938 |
| 902 | nmdc:mga0sz30_123992_c1 | 3300050516 | Bacteria | 1136 |
| 903 | nmdc:mga0sz30_147099_c1 | 3300050516 | Bacteria | 1041 |
| 904 | nmdc:mga0sz30_15597_c1 | 3300050516 | Bacteria | 2709 |
| 905 | Ga0495601_0156569 | 3300053077 | Bacteria | 1488 |
| 906 | Ga0500610_0003992 | 3300053079 | Bacteria | 5774 |
| 907 | Ga0500644_0000575 | 3300053088 | Bacteria | 14233 |
| 908 | Ga0500571_006720 | 3300053110 | Bacteria | 6233 |
| 909 | Ga0500593_000414 | 3300053117 | Bacteria | 16854 |
| 910 | Ga0500593_003241 | 3300053117 | Bacteria | 6120 |
| 911 | Ga0500594_0017153 | 3300053118 | Bacteria | 1768 |
| 912 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 913 | Ga0500618_002619 | 3300053125 | Bacteria | 6628 |
| 914 | Ga0500658_0002081 | 3300053134 | Bacteria | 7784 |
| 915 | Ga0500559_0000047 | 3300053136 | Bacteria | 95447 |
| 916 | Ga0500568_0061648 | 3300053139 | Bacteria | 1450 |
| 917 | Ga0500574_011876 | 3300053141 | Bacteria | 1978 |
| 918 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 919 | Ga0500619_000077 | 3300053154 | Bacteria | 27224 |
| 920 | Ga0500634_0013275 | 3300053161 | Bacteria | 4317 |
| 921 | Ga0500636_0083949 | 3300053177 | Bacteria | 1832 |
| 922 | Ga0500587_002315 | 3300053739 | Bacteria | 2709 |
| 923 | 2511250033 | 2511231003 | Bacteria | 5606035 |
| 924 | 2521557336 | 2521172590 | Bacteria | 5047645 |
| 925 | 2553005314 | 2551306416 | Bacteria | 6152985 |
| 926 | 2587759442 | 2585428062 | Bacteria | 6842168 |
| 927 | 2599622444 | 2599185214 | Bacteria | 8209958 |
| 928 | 2599674464 | 2599185226 | Bacteria | 8233575 |
| 929 | 2599680149 | 2599185227 | Bacteria | 8246414 |
| 930 | 2599692165 | 2599185229 | Bacteria | 8216126 |
| 931 | 2599906620 | 2599185292 | Bacteria | 6290804 |
| 932 | 2643860823 | 2643221569 | Bacteria | 6064337 |
| 933 | 2643936098 | 2643221585 | Bacteria | 5812563 |
| 934 | 2643981333 | 2643221594 | Bacteria | 5811388 |
| 935 | 2644060571 | 2643221609 | Bacteria | 6756331 |
| 936 | 2644073899 | 2643221611 | Bacteria | 6820941 |
| 937 | 2644124117 | 2643221621 | Bacteria | 6212786 |
| 938 | 2644160849 | 2643221628 | Bacteria | 5745828 |
| 939 | 2644221861 | 2643221639 | Bacteria | 6649903 |
| 940 | 2644257345 | 2643221646 | Bacteria | 6433402 |
| 941 | 2644316743 | 2643221656 | Bacteria | 5809961 |
| 942 | 2644396904 | 2643221672 | Bacteria | 6322190 |
| 943 | 2738719305 | 2738541277 | Bacteria | 7458140 |
| 944 | 2738883349 | 2738541307 | Bacteria | 8606193 |
| 945 | 2739242601 | 2738543012 | Bacteria | 7115078 |
| 946 | 2739247375 | 2738543013 | Bacteria | 5618633 |
| 947 | 2739282964 | 2738543019 | Bacteria | 7459457 |
| 948 | 2765568462 | 2765235838 | Bacteria | 5445269 |
| 949 | 2809035250 | 2808606395 | Bacteria | 6020352 |
| 950 | 2816473078 | 2816332133 | Bacteria | 7249298 |
| 951 | 2819592017 | 2818991445 | Bacteria | 4955017 |
| 952 | 2819599144 | 2818991446 | Bacteria | 7757362 |
| 953 | 2819617670 | 2818991449 | Bacteria | 5518009 |
| 954 | 2831270925 | 2831265667 | Bacteria | 7184833 |
| 955 | 2838058972 | 2838054893 | Bacteria | 7451788 |
| 956 | 2839095299 | 2839094727 | Bacteria | 5534556 |
| 957 | 2842679286 | 2842677519 | Bacteria | 5615038 |
| 958 | 2842737764 | 2842733646 | Bacteria | 5716726 |
| 959 | 2842738290 | 2842733646 | Bacteria | 5716726 |
| 960 | 2842750713 | 2842747753 | Bacteria | 5578255 |
| 961 | 2855731335 | 2855730933 | Bacteria | 7047938 |
| 962 | 2855768041 | 2855767633 | Bacteria | 7049357 |
| 963 | 2857542285 | 2857537821 | Bacteria | 5248181 |
| 964 | 2857545049 | 2857542790 | Bacteria | 5326616 |
| 965 | 2857577018 | 2857576091 | Bacteria | 5465855 |
| 966 | 2858953573 | 2858950400 | Bacteria | 6783797 |
| 967 | 2881413781 | 2881412998 | Bacteria | 6492157 |
| 968 | 2884814033 | 2884811622 | Bacteria | 5552861 |
| 969 | 2884840567 | 2884836552 | Bacteria | 5219991 |
| 970 | 2884855824 | 2884852848 | Bacteria | 5221161 |
| 971 | 2885193976 | 2885192300 | Bacteria | 5882526 |
| 972 | 2885202258 | 2885198086 | Bacteria | 7212419 |
| 973 | 2885215911 | 2885211737 | Bacteria | 7212420 |
| 974 | 2896157251 | 2896154374 | Bacteria | 5221518 |
| 975 | 2899929968 | 2899924645 | Bacteria | 7487985 |
| 976 | 2904439929 | 2904439833 | Bacteria | 5931679 |
| 977 | 2904451618 | 2904449895 | Bacteria | 6927402 |
| 978 | 2904453000 | 2904449895 | Bacteria | 6927402 |
| 979 | 2904459962 | 2904456579 | Bacteria | 6819253 |
| 980 | 2904461893 | 2904456579 | Bacteria | 6819253 |
| 981 | 2904482326 | 2904479285 | Bacteria | 5073931 |
| 982 | 2904531126 | 2904530477 | Bacteria | 5876334 |
| 983 | 2904543295 | 2904541872 | Bacteria | 8915136 |
| 984 | 2904587229 | 2904584206 | Bacteria | 6028872 |
| 985 | 2904592736 | 2904589729 | Bacteria | 6113573 |
| 986 | 2904604481 | 2904601388 | Bacteria | 5884906 |
| 987 | 2919050246 | 2919046199 | Bacteria | 5567169 |
| 988 | 2919082303 | 2919079590 | Bacteria | 5946433 |
| 989 | 2919464482 | 2919462493 | Bacteria | 5817112 |
| 990 | 2919706843 | 2919704043 | Bacteria | 5560311 |
| 991 | 2923515996 | 2923510766 | Bacteria | 5926163 |
| 992 | 2928043503 | 2928037797 | Bacteria | 7273642 |
| 993 | 2928049867 | 2928044640 | Bacteria | 7271509 |
| 994 | 2928054442 | 2928051484 | Bacteria | 7773759 |
| 995 | 2928070028 | 2928064002 | Bacteria | 7419480 |
| 996 | 2928074353 | 2928070936 | Bacteria | 8062541 |
| 997 | 2928086591 | 2928084124 | Bacteria | 7159212 |
| 998 | 2928118845 | 2928115317 | Bacteria | 6477646 |
| 999 | 2929160527 | 2929160207 | Bacteria | 9075316 |
| 1000 | 2929525959 | 2929520902 | Bacteria | 6765052 |
| 1001 | 2929526537 | 2929520902 | Bacteria | 6765052 |
| 1002 | 2941484660 | |||
| 1003 | 2945915519 | 2945909444 | Bacteria | 7065066 |
| 1004 | 2945974136 | 2945972063 | Bacteria | 6086495 |
| 1005 | 2945974897 | 2945972063 | Bacteria | 6086495 |
| 1006 | 2945989083 | 2945984333 | Bacteria | 7358892 |
| 1007 | 8003405435 | 8003400568 | Bacteria | 5535898 |
| 1008 | JGI25155J39150_1000042 | |||
| 1009 | JGI24740J21852_10010263 | |||
| 1010 | JGI24739J22299_10015867 | |||
| 1011 | JGI25155J39150_1000651 | |||
| 1012 | JGI25155J39150_1001094 | |||
| 1013 | JGI25156J39149_1000053 | |||
| 1014 | JGI25156J39149_1000170 | |||
| 1015 | JGI25156J39149_1001869 | |||
| 1016 | JGI25156J39149_1007194 | |||
| 1017 | JGI25162J39368_1003814 | |||
| 1018 | JGI25154J39366_1000082 | |||
| 1019 | JGI25154J39366_1000306 | |||
| 1020 | JGI25154J39366_1000455 | |||
| 1021 | JGI25157J39369_1000072 | |||
| 1022 | JGI25157J39369_1000170 | |||
| 1023 | JGI25159J45721_1002106 | |||
| 1024 | JGI25159J45721_1010517 | |||
| 1025 | JGI25151J46595_10000301 | |||
| 1026 | JGI25151J46595_10011183 | |||
| 1027 | JGI25153J46596_10012010 | |||
| 1028 | rootL2_10017868 | |||
| 1029 | rootH1_10005172 | |||
| 1030 | JGI25160J50197_1000227 | |||
| 1031 | JGI25161J50226_1000007 | |||
| 1032 | Ga0055538_1000013 | |||
| 1033 | Ga0055539_1000018 | |||
| 1034 | Ga0055533_1000022 | |||
| 1035 | Ga0055532_1000017 | |||
| 1036 | Ga0055525_1000024 | |||
| 1037 | Ga0055535_1000260 | |||
| 1038 | Ga0055535_1005719 | |||
| 1039 | Ga0055542_1000013 | |||
| 1040 | Ga0055526_1021281 | |||
| 1041 | Ga0055537_1002740 | |||
| 1042 | Ga0055524_1000052 | |||
| 1043 | Ga0055524_1001441 | |||
| 1044 | Ga0055536_1004462 | |||
| 1045 | Ga0055534_1001477 | |||
| 1046 | Ga0055534_1002933 | |||
| 1047 | Ga0055534_1006234 | |||
| 1048 | Ga0055530_10003439 | |||
| 1049 | Ga0055530_10004911 | |||
| 1050 | Ga0055530_10018827 | |||
| 1051 | Ga0055540_1000123 | |||
| 1052 | Ga0055540_1002288 | |||
| 1053 | Ga0055540_1013297 | |||
| 1054 | Ga0055531_10000740 | |||
| 1055 | Ga0055531_10001116 | |||
| 1056 | Ga0055531_10016084 | |||
| 1057 | Ga0055541_1000013 | |||
| 1058 | Ga0055543_1000386 | |||
| 1059 | Ga0065165_1013879 | |||
| 1060 | Ga0065704_10000444 | |||
| 1061 | Ga0065715_10020215 | |||
| 1062 | Ga0065715_10035108 | |||
| 1063 | Ga0065715_10125321 | |||
| 1064 | Ga0070658_10224146 | |||
| 1065 | Ga0070676_10002668 | |||
| 1066 | Ga0070676_10277204 | |||
| 1067 | Ga0070683_100129404 | |||
| 1068 | Ga0070683_100647230 | |||
| 1069 | Ga0070690_100031929 | |||
| 1070 | Ga0070670_100001971 | |||
| 1071 | Ga0070670_100014554 | |||
| 1072 | Ga0070670_100029888 | |||
| 1073 | Ga0070670_100037645 | |||
| 1074 | Ga0070670_100043346 | |||
| 1075 | Ga0070670_100089726 | |||
| 1076 | Ga0070670_100119461 | |||
| 1077 | Ga0070670_100188056 | |||
| 1078 | Ga0070670_100328284 | |||
| 1079 | Ga0070677_10006417 | |||
| 1080 | Ga0070677_10009189 | |||
| 1081 | Ga0070677_10010076 | |||
| 1082 | Ga0068869_100041131 | |||
| 1083 | Ga0068869_100402150 | |||
| 1084 | Ga0070666_10000758 | |||
| 1085 | Ga0070666_10002174 | |||
| 1086 | Ga0070666_10079624 | |||
| 1087 | Ga0070666_10363788 | |||
| 1088 | Ga0068868_100001290 | |||
| 1089 | Ga0068868_100011821 | |||
| 1090 | Ga0068868_100045446 | |||
| 1091 | Ga0068868_100100646 | |||
| 1092 | Ga0068868_100123985 | |||
| 1093 | Ga0070689_100008704 | |||
| 1094 | Ga0070689_100186212 | |||
| 1095 | Ga0070689_100335959 | |||
| 1096 | Ga0070687_100192273 | |||
| 1097 | Ga0070661_100298968 | |||
| 1098 | Ga0070661_100345298 | |||
| 1099 | Ga0070668_100003834 | |||
| 1100 | Ga0070668_100036636 | |||
| 1101 | Ga0070668_100133019 | |||
| 1102 | Ga0070668_100412093 | |||
| 1103 | Ga0070668_100510634 | |||
| 1104 | Ga0070669_100094824 | |||
| 1105 | Ga0070669_100108307 | |||
| 1106 | Ga0070675_100001026 | |||
| 1107 | Ga0070675_100011870 | |||
| 1108 | Ga0070675_100014529 | |||
| 1109 | Ga0070675_100022217 | |||
| 1110 | Ga0070675_100060263 | |||
| 1111 | Ga0070675_100617966 | |||
| 1112 | Ga0070671_100010647 | |||
| 1113 | Ga0070671_100043160 | |||
| 1114 | Ga0070671_100067899 | |||
| 1115 | Ga0070671_100075846 | |||
| 1116 | Ga0070671_100079613 | |||
| 1117 | Ga0070671_100129197 | |||
| 1118 | Ga0070671_100186048 | |||
| 1119 | Ga0070671_100220387 | |||
| 1120 | Ga0070674_100000094 | |||
| 1121 | Ga0070674_100017248 | |||
| 1122 | Ga0070674_100036756 | |||
| 1123 | Ga0070674_100064418 | |||
| 1124 | Ga0070673_100000679 | |||
| 1125 | Ga0070673_100000753 | |||
| 1126 | Ga0070673_100056321 | |||
| 1127 | Ga0070673_100061005 | |||
| 1128 | Ga0070673_100070739 | |||
| 1129 | Ga0070673_100086055 | |||
| 1130 | Ga0070688_100027851 | |||
| 1131 | Ga0070659_100310018 | |||
| 1132 | Ga0070667_100001746 | |||
| 1133 | Ga0070667_100009087 | |||
| 1134 | Ga0070667_100059026 | |||
| 1135 | Ga0070667_100063129 | |||
| 1136 | Ga0070667_100089857 | |||
| 1137 | Ga0070667_100153304 | |||
| 1138 | Ga0070667_100201356 | |||
| 1139 | Ga0070667_100474046 | |||
| 1140 | Ga0070667_100580873 | |||
| 1141 | Ga0070705_100361539 | |||
| 1142 | Ga0070708_100458382 | |||
| 1143 | Ga0070663_100010261 | |||
| 1144 | Ga0070663_100032973 | |||
| 1145 | Ga0070663_100060857 | |||
| 1146 | Ga0070678_100000409 | |||
| 1147 | Ga0070678_100015011 | |||
| 1148 | Ga0070678_100022737 | |||
| 1149 | Ga0070678_100030734 | |||
| 1150 | Ga0070678_100136716 | |||
| 1151 | Ga0070678_100153175 | |||
| 1152 | Ga0070678_100179796 | |||
| 1153 | Ga0070678_100213423 | |||
| 1154 | Ga0070678_100325069 | |||
| 1155 | Ga0070662_100004880 | |||
| 1156 | Ga0070662_100036562 | |||
| 1157 | Ga0070662_100104882 | |||
| 1158 | Ga0070662_100440947 | |||
| 1159 | Ga0068867_100001043 | |||
| 1160 | Ga0068867_100008620 | |||
| 1161 | Ga0068867_100012008 | |||
| 1162 | Ga0068867_100017264 | |||
| 1163 | Ga0068867_100021275 | |||
| 1164 | Ga0068867_100049323 | |||
| 1165 | Ga0068867_100069565 | |||
| 1166 | Ga0068867_100153326 | |||
| 1167 | Ga0070706_100002539 | |||
| 1168 | Ga0070707_100036814 | |||
| 1169 | Ga0070684_100049524 | |||
| 1170 | Ga0068853_100072987 | |||
| 1171 | Ga0068853_100454005 | |||
| 1172 | Ga0070672_100000552 | |||
| 1173 | Ga0070672_100010312 | |||
| 1174 | Ga0070672_100047920 | |||
| 1175 | Ga0070672_100056675 | |||
| 1176 | Ga0070672_100067655 | |||
| 1177 | Ga0070672_100137156 | |||
| 1178 | Ga0070672_100200596 | |||
| 1179 | Ga0070672_100242749 | |||
| 1180 | Ga0070696_100061266 | |||
| 1181 | Ga0070665_100002419 | |||
| 1182 | Ga0070665_100004291 | |||
| 1183 | Ga0070665_100243262 | |||
| 1184 | Ga0070665_100414457 | |||
| 1185 | Ga0068855_100011166 | |||
| 1186 | Ga0068855_100068193 | |||
| 1187 | Ga0070664_100026043 | |||
| 1188 | Ga0070664_100072613 | |||
| 1189 | Ga0070664_100074036 | |||
| 1190 | Ga0070664_100175452 | |||
| 1191 | Ga0070664_100196192 | |||
| 1192 | Ga0068857_100017408 | |||
| 1193 | Ga0068857_100157826 | |||
| 1194 | Ga0068857_100159525 | |||
| 1195 | Ga0068857_100330635 | |||
| 1196 | Ga0068854_100052677 | |||
| 1197 | Ga0068854_100072045 | |||
| 1198 | Ga0068854_100110195 | |||
| 1199 | Ga0068854_100352732 | |||
| 1200 | Ga0068856_100151917 | |||
| 1201 | Ga0070702_100059433 | |||
| 1202 | Ga0070702_100199324 | |||
| 1203 | Ga0070702_100309120 | |||
| 1204 | Ga0068852_100027996 | |||
| 1205 | Ga0068852_100042319 | |||
| 1206 | Ga0068852_100063421 | |||
| 1207 | Ga0068852_100084077 | |||
| 1208 | Ga0068852_100161780 | |||
| 1209 | Ga0068852_100209190 | |||
| 1210 | Ga0068859_100023045 | |||
| 1211 | Ga0068859_100098576 | |||
| 1212 | Ga0068859_100121412 | |||
| 1213 | Ga0068859_100473170 | |||
| 1214 | Ga0068864_100000845 | |||
| 1215 | Ga0068864_100021018 | |||
| 1216 | Ga0068864_100024185 | |||
| 1217 | Ga0068864_100044697 | |||
| 1218 | Ga0068864_100071385 | |||
| 1219 | Ga0068864_100078936 | |||
| 1220 | Ga0068864_100096415 | |||
| 1221 | Ga0068864_100184809 | |||
| 1222 | Ga0068861_100105393 | |||
| 1223 | Ga0068861_100393112 | |||
| 1224 | Ga0068861_100460110 | |||
| 1225 | Ga0068851_10000843 | |||
| 1226 | Ga0068870_10065494 | |||
| 1227 | Ga0068863_100002048 | |||
| 1228 | Ga0068863_100034799 | |||
| 1229 | Ga0068863_100071222 | |||
| 1230 | Ga0068863_100107675 | |||
| 1231 | Ga0068863_100119529 | |||
| 1232 | Ga0068863_100152090 | |||
| 1233 | Ga0068863_100152743 | |||
| 1234 | Ga0068863_100154405 | |||
| 1235 | Ga0068858_100002570 | |||
| 1236 | Ga0068858_100252112 | |||
| 1237 | Ga0068858_100266980 | |||
| 1238 | Ga0068858_100325491 | |||
| 1239 | Ga0068858_100539810 | |||
| 1240 | Ga0068860_100008382 | |||
| 1241 | Ga0068860_100012965 | |||
| 1242 | Ga0068860_100057346 | |||
| 1243 | Ga0068860_100075322 | |||
| 1244 | Ga0068862_100113099 | |||
| 1245 | Ga0068862_100145352 | |||
| 1246 | Ga0068862_100154254 | |||
| 1247 | Ga0068862_100173498 | |||
| 1248 | Ga0068862_100634976 | |||
| 1249 | Ga0070717_10179449 | |||
| 1250 | Ga0075365_10162457 | |||
| 1251 | Ga0075365_10299676 | |||
| 1252 | Ga0075368_10114950 | |||
| 1253 | Ga0075363_100036983 | |||
| 1254 | Ga0075364_10109509 | |||
| 1255 | Ga0075364_10161447 | |||
| 1256 | Ga0075364_10302949 | |||
| 1257 | Ga0075364_10350918 | |||
| 1258 | Ga0075362_10062690 | |||
| 1259 | Ga0075367_10010982 | |||
| 1260 | Ga0075367_10018189 | |||
| 1261 | Ga0075367_10166400 | |||
| 1262 | Ga0075369_10009596 | |||
| 1263 | Ga0075369_10059355 | |||
| 1264 | Ga0075369_10086249 | |||
| 1265 | Ga0075369_10205939 | |||
| 1266 | Ga0075366_10002787 | |||
| 1267 | Ga0075366_10015678 | |||
| 1268 | Ga0075366_10064729 | |||
| 1269 | Ga0075366_10143252 | |||
| 1270 | Ga0075366_10210536 | |||
| 1271 | Ga0097621_100007338 | |||
| 1272 | Ga0097621_100037524 | |||
| 1273 | Ga0097621_100140720 | |||
| 1274 | Ga0097621_100241368 | |||
| 1275 | Ga0097621_100404665 | |||
| 1276 | Ga0097621_100450408 | |||
| 1277 | Ga0097621_100558114 | |||
| 1278 | Ga0075370_10006766 | |||
| 1279 | Ga0075370_10024220 | |||
| 1280 | Ga0075370_10027723 | |||
| 1281 | Ga0075370_10063075 | |||
| 1282 | Ga0075370_10070550 | |||
| 1283 | Ga0075370_10127002 | |||
| 1284 | Ga0068871_100064731 | |||
| 1285 | Ga0068871_100230418 | |||
| 1286 | Ga0068871_100473496 | |||
| 1287 | Ga0075428_100101687 | |||
| 1288 | Ga0075430_100034456 | |||
| 1289 | Ga0075430_100109091 | |||
| 1290 | Ga0075431_100034361 | |||
| 1291 | Ga0075431_100052328 | |||
| 1292 | Ga0075429_100029093 | |||
| 1293 | Ga0075429_100193894 | |||
| 1294 | Ga0068865_100006221 | |||
| 1295 | Ga0068865_100022991 | |||
| 1296 | Ga0068865_100041947 | |||
| 1297 | Ga0068865_100114232 | |||
| 1298 | Ga0068865_100426501 | |||
| 1299 | Ga0097620_100023045 | |||
| 1300 | Ga0097620_100098578 | |||
| 1301 | Ga0097620_100121412 | |||
| 1302 | Ga0097620_100473176 | |||
| 1303 | Ga0079104_1000206 | |||
| 1304 | Ga0099826_10000021 | |||
| 1305 | Ga0105251_10159709 | |||
| 1306 | Ga0105244_10000031 | |||
| 1307 | Ga0105244_10003602 | |||
| 1308 | Ga0105240_10008920 | |||
| 1309 | Ga0105240_10041470 | |||
| 1310 | Ga0105240_10059308 | |||
| 1311 | Ga0105240_10112031 | |||
| 1312 | Ga0105240_10290611 | |||
| 1313 | Ga0111539_10058487 | |||
| 1314 | Ga0105245_10105475 | |||
| 1315 | Ga0105247_10353938 | |||
| 1316 | Ga0105243_10000765 | |||
| 1317 | Ga0105243_10024959 | |||
| 1318 | Ga0105243_10041298 | |||
| 1319 | Ga0105243_10251968 | |||
| 1320 | Ga0105243_10438575 | |||
| 1321 | Ga0105241_10165743 | |||
| 1322 | Ga0105242_10090130 | |||
| 1323 | Ga0105242_10448469 | |||
| 1324 | Ga0105248_10086277 | |||
| 1325 | Ga0105248_10116526 | |||
| 1326 | Ga0105248_10119263 | |||
| 1327 | Ga0105248_10268583 | |||
| 1328 | Ga0105248_10285586 | |||
| 1329 | Ga0105237_10051964 | |||
| 1330 | Ga0105237_10103567 | |||
| 1331 | Ga0105237_10175171 | |||
| 1332 | Ga0105237_10279165 | |||
| 1333 | Ga0105238_10000065 | |||
| 1334 | Ga0105238_10063764 | |||
| 1335 | Ga0105238_10196657 | |||
| 1336 | Ga0105249_10086300 | |||
| 1337 | Ga0105249_10091395 | |||
| 1338 | Ga0105239_10054735 | |||
| 1339 | Ga0105239_10063942 | |||
| 1340 | Ga0105239_10159772 | |||
| 1341 | Ga0105239_10709275 | |||
| 1342 | Ga0105246_10165345 | |||
| 1343 | Ga0105246_10402965 | |||
| 1344 | Ga0157319_1000695 | |||
| 1345 | Ga0157339_1001068 | |||
| 1346 | Ga0157371_10045298 | |||
| 1347 | Ga0157370_10002003 | |||
| 1348 | Ga0157370_10310879 | |||
| 1349 | Ga0157369_10035810 | |||
| 1350 | Ga0157374_10050728 | |||
| 1351 | Ga0157374_10110971 | |||
| 1352 | Ga0157374_10146904 | |||
| 1353 | Ga0157374_10446048 | |||
| 1354 | Ga0157374_10482189 | |||
| 1355 | Ga0157374_10606869 | |||
| 1356 | Ga0157378_10040681 | |||
| 1357 | Ga0157378_10070198 | |||
| 1358 | Ga0157378_10240961 | |||
| 1359 | Ga0157378_10378962 | |||
| 1360 | Ga0157378_10508236 | |||
| 1361 | Ga0157378_10516439 | |||
| 1362 | Ga0163162_10047977 | |||
| 1363 | Ga0163162_10077315 | |||
| 1364 | Ga0163162_10115597 | |||
| 1365 | Ga0163162_10122403 | |||
| 1366 | Ga0163162_10221744 | |||
| 1367 | Ga0163162_10599824 | |||
| 1368 | Ga0157372_10060900 | |||
| 1369 | Ga0157375_10011762 | |||
| 1370 | Ga0157375_10035622 | |||
| 1371 | Ga0157375_10049483 | |||
| 1372 | Ga0157375_10059297 | |||
| 1373 | Ga0157375_10064588 | |||
| 1374 | Ga0157375_10219009 | |||
| 1375 | Ga0157375_10233301 | |||
| 1376 | Ga0157375_10451319 | |||
| 1377 | Ga0163163_10217309 | |||
| 1378 | Ga0163163_10218492 | |||
| 1379 | Ga0157380_10009058 | |||
| 1380 | Ga0182008_10024475 | |||
| 1381 | Ga0182008_10037502 | |||
| 1382 | Ga0182008_10053291 | |||
| 1383 | Ga0182008_10079655 | |||
| 1384 | Ga0157377_10000016 | |||
| 1385 | Ga0157379_10008726 | |||
| 1386 | Ga0157379_10048728 | |||
| 1387 | Ga0157379_10049079 | |||
| 1388 | Ga0157379_10281376 | |||
| 1389 | Ga0157376_10106693 | |||
| 1390 | Ga0157376_10215134 | |||
| 1391 | Ga0157376_10328135 | |||
| 1392 | Ga0182006_1002966 | |||
| 1393 | Ga0182006_1014559 | |||
| 1394 | Ga0182007_10002108 | |||
| 1395 | Ga0182007_10016980 | |||
| 1396 | Ga0183362_10004 | |||
| 1397 | Ga0163161_10032312 | |||
| 1398 | Ga0163161_10040898 | |||
| 1399 | Ga0163161_10141036 | |||
| 1400 | Ga0163161_10155206 | |||
| 1401 | Ga0163161_10233374 | |||
| 1402 | Ga0163161_10272017 | |||
| 1403 | Ga0213872_10016125 | |||
| 1404 | Ga0209435_100015 | |||
| 1405 | Ga0209435_100019 | |||
| 1406 | Ga0209435_100290 | |||
| 1407 | Ga0209436_104004 | |||
| 1408 | Ga0209436_105266 | |||
| 1409 | Ga0209784_100005 | |||
| 1410 | Ga0209566_100005 | |||
| 1411 | Ga0209674_100009 | |||
| 1412 | Ga0209672_102201 | |||
| 1413 | Ga0209147_100004 | |||
| 1414 | Ga0209147_100843 | |||
| 1415 | Ga0209563_100012 | |||
| 1416 | Ga0209437_100758 | |||
| 1417 | Ga0209258_100020 | |||
| 1418 | Ga0209258_100226 | |||
| 1419 | Ga0207425_1000814 | |||
| 1420 | Ga0209646_1000020 | |||
| 1421 | Ga0209646_1000038 | |||
| 1422 | Ga0209646_1000040 | |||
| 1423 | Ga0209026_1000034 | |||
| 1424 | Ga0209026_1000048 | |||
| 1425 | Ga0209026_1003765 | |||
| 1426 | Ga0209677_100006 | |||
| 1427 | Ga0209148_1000031 | |||
| 1428 | Ga0209759_1000038 | |||
| 1429 | Ga0209759_1000049 | |||
| 1430 | Ga0209759_1000357 | |||
| 1431 | Ga0209129_1000055 | |||
| 1432 | Ga0209129_1006666 | |||
| 1433 | Ga0209565_1000078 | |||
| 1434 | Ga0209565_1000310 | |||
| 1435 | Ga0209565_1000615 | |||
| 1436 | Ga0209565_1001707 | |||
| 1437 | Ga0209565_1016361 | |||
| 1438 | Ga0209673_1000170 | |||
| 1439 | Ga0209673_1001531 | |||
| 1440 | Ga0209673_1002628 | |||
| 1441 | Ga0209673_1011259 | |||
| 1442 | Ga0209673_1026678 | |||
| 1443 | Ga0209673_1027129 | |||
| 1444 | Ga0209130_1000289 | |||
| 1445 | Ga0209130_1000807 | |||
| 1446 | Ga0209130_1001274 | |||
| 1447 | Ga0209130_1011749 | |||
| 1448 | Ga0209130_1012738 | |||
| 1449 | Ga0209675_1000055 | |||
| 1450 | Ga0209675_1001778 | |||
| 1451 | Ga0209675_1002139 | |||
| 1452 | Ga0209675_1010406 | |||
| 1453 | Ga0209675_1016325 | |||
| 1454 | Ga0209675_1018963 | |||
| 1455 | Ga0209676_1000040 | |||
| 1456 | Ga0209676_1003179 | |||
| 1457 | Ga0209676_1011949 | |||
| 1458 | Ga0209676_1013043 | |||
| 1459 | Ga0209676_1017739 | |||
| 1460 | Ga0209025_1000003 | |||
| 1461 | Ga0209025_1000409 | |||
| 1462 | Ga0209025_1001751 | |||
| 1463 | Ga0209025_1009368 | |||
| 1464 | Ga0209025_1010755 | |||
| 1465 | Ga0209025_1018466 | |||
| 1466 | Ga0209025_1051447 | |||
| 1467 | Ga0209564_1000157 | |||
| 1468 | Ga0209564_1000806 | |||
| 1469 | Ga0209564_1001767 | |||
| 1470 | Ga0209564_1002258 | |||
| 1471 | Ga0209758_1000042 | |||
| 1472 | Ga0209758_1005953 | |||
| 1473 | Ga0209758_1040043 | |||
| 1474 | Ga0209050_1000021 | |||
| 1475 | Ga0209050_1000760 | |||
| 1476 | Ga0209050_1003967 | |||
| 1477 | Ga0209050_1004794 | |||
| 1478 | Ga0209050_1015628 | |||
| 1479 | Ga0209050_1041968 | |||
| 1480 | Ga0209256_1000036 | |||
| 1481 | Ga0209256_1000056 | |||
| 1482 | Ga0209256_1000124 | |||
| 1483 | Ga0209256_1000127 | |||
| 1484 | Ga0209256_1000906 | |||
| 1485 | Ga0207426_1000055 | |||
| 1486 | Ga0207426_1000079 | |||
| 1487 | Ga0207426_1000091 | |||
| 1488 | Ga0209051_1000025 | |||
| 1489 | Ga0209051_1000068 | |||
| 1490 | Ga0209051_1000351 | |||
| 1491 | Ga0209051_1000423 | |||
| 1492 | Ga0209051_1000446 | |||
| 1493 | Ga0209051_1000530 | |||
| 1494 | Ga0209051_1008921 | |||
| 1495 | Ga0209051_1013428 | |||
| 1496 | Ga0209051_1015139 | |||
| 1497 | Ga0209257_1000015 | |||
| 1498 | Ga0209257_1000039 | |||
| 1499 | Ga0209257_1000043 | |||
| 1500 | Ga0209257_1001377 | |||
| 1501 | Ga0209257_1003725 | |||
| 1502 | Ga0209257_1013914 | |||
| 1503 | Ga0209257_1024395 | |||
| 1504 | Ga0207697_10020918 | |||
| 1505 | Ga0207656_10087638 | |||
| 1506 | Ga0207656_10170628 | |||
| 1507 | Ga0207655_1000029 | |||
| 1508 | Ga0207655_1005080 | |||
| 1509 | Ga0207682_10001047 | |||
| 1510 | Ga0207682_10006237 | |||
| 1511 | Ga0207682_10095522 | |||
| 1512 | Ga0207642_10044161 | |||
| 1513 | Ga0207642_10136047 | |||
| 1514 | Ga0207688_10043780 | |||
| 1515 | Ga0207680_10001068 | |||
| 1516 | Ga0207680_10039848 | |||
| 1517 | Ga0207680_10056911 | |||
| 1518 | Ga0207680_10424525 | |||
| 1519 | Ga0207645_10004706 | |||
| 1520 | Ga0207645_10014655 | |||
| 1521 | Ga0207645_10071087 | |||
| 1522 | Ga0207645_10094840 | |||
| 1523 | Ga0207645_10095900 | |||
| 1524 | Ga0207643_10017706 | |||
| 1525 | Ga0207643_10042663 | |||
| 1526 | Ga0207643_10080252 | |||
| 1527 | Ga0207684_10023176 | |||
| 1528 | Ga0207695_10002732 | |||
| 1529 | Ga0207695_10007216 | |||
| 1530 | Ga0207695_10082478 | |||
| 1531 | Ga0207695_10123453 | |||
| 1532 | Ga0207695_10178105 | |||
| 1533 | Ga0207695_10628475 | |||
| 1534 | Ga0207671_10002693 | |||
| 1535 | Ga0207671_10061344 | |||
| 1536 | Ga0207671_10126738 | |||
| 1537 | Ga0207671_10214023 | |||
| 1538 | Ga0207662_10027183 | |||
| 1539 | Ga0207662_10199852 | |||
| 1540 | Ga0207657_10255358 | |||
| 1541 | Ga0207649_10324495 | |||
| 1542 | Ga0207681_10006325 | |||
| 1543 | Ga0207681_10079980 | |||
| 1544 | Ga0207681_10098926 | |||
| 1545 | Ga0207694_10000977 | |||
| 1546 | Ga0207694_10281387 | |||
| 1547 | Ga0207694_10349242 | |||
| 1548 | Ga0207650_10000710 | |||
| 1549 | Ga0207650_10009975 | |||
| 1550 | Ga0207650_10028205 | |||
| 1551 | Ga0207650_10046048 | |||
| 1552 | Ga0207650_10066503 | |||
| 1553 | Ga0207650_10067275 | |||
| 1554 | Ga0207650_10101393 | |||
| 1555 | Ga0207650_10164554 | |||
| 1556 | Ga0207659_10000322 | |||
| 1557 | Ga0207659_10008216 | |||
| 1558 | Ga0207659_10008726 | |||
| 1559 | Ga0207659_10015561 | |||
| 1560 | Ga0207659_10065728 | |||
| 1561 | Ga0207659_10165010 | |||
| 1562 | Ga0207659_10240214 | |||
| 1563 | Ga0207644_10001344 | |||
| 1564 | Ga0207644_10001677 | |||
| 1565 | Ga0207644_10032216 | |||
| 1566 | Ga0207644_10087523 | |||
| 1567 | Ga0207644_10104089 | |||
| 1568 | Ga0207644_10129888 | |||
| 1569 | Ga0207690_10313305 | |||
| 1570 | Ga0207706_10003941 | |||
| 1571 | Ga0207706_10102503 | |||
| 1572 | Ga0207706_10115153 | |||
| 1573 | Ga0207706_10348057 | |||
| 1574 | Ga0207709_10000602 | |||
| 1575 | Ga0207709_10022513 | |||
| 1576 | Ga0207709_10040350 | |||
| 1577 | Ga0207670_10011674 | |||
| 1578 | Ga0207670_10048461 | |||
| 1579 | Ga0207669_10003485 | |||
| 1580 | Ga0207669_10003984 | |||
| 1581 | Ga0207669_10343979 | |||
| 1582 | Ga0207691_10000018 | |||
| 1583 | Ga0207691_10012940 | |||
| 1584 | Ga0207691_10028725 | |||
| 1585 | Ga0207691_10182602 | |||
| 1586 | Ga0207691_10186128 | |||
| 1587 | Ga0207691_10214481 | |||
| 1588 | Ga0207691_10234077 | |||
| 1589 | Ga0207691_10270263 | |||
| 1590 | Ga0207691_10419650 | |||
| 1591 | Ga0207691_10446115 | |||
| 1592 | Ga0207711_10005256 | |||
| 1593 | Ga0207711_10042630 | |||
| 1594 | Ga0207711_10089412 | |||
| 1595 | Ga0207711_10211901 | |||
| 1596 | Ga0207711_10435873 | |||
| 1597 | Ga0207689_10006735 | |||
| 1598 | Ga0207689_10007284 | |||
| 1599 | Ga0207689_10061475 | |||
| 1600 | Ga0207689_10167766 | |||
| 1601 | Ga0207689_10367962 | |||
| 1602 | Ga0207689_10472244 | |||
| 1603 | Ga0207661_10192549 | |||
| 1604 | Ga0207679_10042747 | |||
| 1605 | Ga0207679_10065938 | |||
| 1606 | Ga0207679_10091344 | |||
| 1607 | Ga0207679_10132589 | |||
| 1608 | Ga0207667_10011582 | |||
| 1609 | Ga0207667_10016772 | |||
| 1610 | Ga0207667_10433859 | |||
| 1611 | Ga0207667_10644054 | |||
| 1612 | Ga0207651_10003638 | |||
| 1613 | Ga0207651_10037982 | |||
| 1614 | Ga0207651_10150357 | |||
| 1615 | Ga0207651_10192900 | |||
| 1616 | Ga0207712_10076268 | |||
| 1617 | Ga0207668_10020765 | |||
| 1618 | Ga0207668_10211799 | |||
| 1619 | Ga0207668_10287717 | |||
| 1620 | Ga0207640_10211336 | |||
| 1621 | Ga0207640_10234350 | |||
| 1622 | Ga0207640_10291698 | |||
| 1623 | Ga0207658_10006133 | |||
| 1624 | Ga0207658_10023598 | |||
| 1625 | Ga0207658_10032603 | |||
| 1626 | Ga0207658_10050765 | |||
| 1627 | Ga0207658_10118246 | |||
| 1628 | Ga0207658_10267976 | |||
| 1629 | Ga0207677_10004386 | |||
| 1630 | Ga0207677_10006410 | |||
| 1631 | Ga0207677_10006484 | |||
| 1632 | Ga0207677_10012052 | |||
| 1633 | Ga0207677_10195210 | |||
| 1634 | Ga0207677_10433020 | |||
| 1635 | Ga0207703_10000817 | |||
| 1636 | Ga0207703_10047463 | |||
| 1637 | Ga0207703_10085234 | |||
| 1638 | Ga0207639_10009051 | |||
| 1639 | Ga0207678_10048631 | |||
| 1640 | Ga0207641_10005073 | |||
| 1641 | Ga0207641_10049395 | |||
| 1642 | Ga0207641_10074666 | |||
| 1643 | Ga0207641_10083149 | |||
| 1644 | Ga0207641_10182140 | |||
| 1645 | Ga0207648_10000515 | |||
| 1646 | Ga0207648_10026670 | |||
| 1647 | Ga0207648_10032136 | |||
| 1648 | Ga0207648_10052000 | |||
| 1649 | Ga0207648_10077196 | |||
| 1650 | Ga0207648_10086284 | |||
| 1651 | Ga0207648_10124194 | |||
| 1652 | Ga0207648_10135345 | |||
| 1653 | Ga0207648_10148502 | |||
| 1654 | Ga0207648_10244922 | |||
| 1655 | Ga0207676_10001475 | |||
| 1656 | Ga0207676_10010532 | |||
| 1657 | Ga0207676_10011558 | |||
| 1658 | Ga0207676_10017436 | |||
| 1659 | Ga0207676_10019636 | |||
| 1660 | Ga0207676_10078691 | |||
| 1661 | Ga0207676_10112667 | |||
| 1662 | Ga0207676_10250526 | |||
| 1663 | Ga0207674_10012362 | |||
| 1664 | Ga0207674_10016088 | |||
| 1665 | Ga0207674_10050876 | |||
| 1666 | Ga0207674_10076115 | |||
| 1667 | Ga0207674_10202405 | |||
| 1668 | Ga0207674_10217177 | |||
| 1669 | Ga0207675_100004701 | |||
| 1670 | Ga0207675_100024107 | |||
| 1671 | Ga0207675_100030188 | |||
| 1672 | Ga0207675_100049796 | |||
| 1673 | Ga0207675_100057248 | |||
| 1674 | Ga0207675_100225865 | |||
| 1675 | Ga0207683_10000020 | |||
| 1676 | Ga0207683_10024111 | |||
| 1677 | Ga0207683_10044935 | |||
| 1678 | Ga0207683_10089845 | |||
| 1679 | Ga0207683_10104296 | |||
| 1680 | Ga0207683_10113807 | |||
| 1681 | Ga0207683_10219993 | |||
| 1682 | Ga0207683_10396596 | |||
| 1683 | Ga0207698_10007168 | |||
| 1684 | Ga0207698_10038539 | |||
| 1685 | Ga0207698_10146995 | |||
| 1686 | Ga0207698_10253160 | |||
| 1687 | Ga0209281_1000259 | |||
| 1688 | Ga0209970_1000196 | |||
| 1689 | Ga0209282_1000019 | |||
| 1690 | Ga0209282_1000139 | |||
| 1691 | Ga0209813_10024788 | |||
| 1692 | Ga0268266_10018522 | |||
| 1693 | Ga0268266_10024477 | |||
| 1694 | Ga0268266_10040123 | |||
| 1695 | Ga0268266_10271557 | |||
| 1696 | Ga0268265_10011207 | |||
| 1697 | Ga0268265_10029780 | |||
| 1698 | Ga0268265_10137561 | |||
| 1699 | Ga0268265_10298618 | |||
| 1700 | Ga0268264_10003598 | |||
| 1701 | Ga0268264_10052836 | |||
| 1702 | Ga0268264_10086924 | |||
| 1703 | Ga0307517_10002655 | |||
| 1704 | Ga0307515_10000138 | |||
| 1705 | Ga0307515_10000322 | |||
| 1706 | Ga0307515_10001193 | |||
| 1707 | Ga0307515_10002234 | |||
| 1708 | Ga0307515_10023840 | |||
| 1709 | Ga0307515_10041898 | |||
| 1710 | Ga0307515_10067248 | |||
| 1711 | Ga0307515_10094964 | |||
| 1712 | Ga0307515_10096814 | |||
| 1713 | Ga0307515_10135512 | |||
| 1714 | Ga0307515_10146542 | |||
| 1715 | Ga0307512_10066347 | |||
| 1716 | Ga0316176_1141751 | |||
| 1717 | Ga0314311_1073339 | |||
| 1718 | Ga0316179_1111618 | |||
| 1719 | Ga0316183_1025835 | |||
| 1720 | Ga0265330_10014274 | |||
| 1721 | Ga0265330_10047066 | |||
| 1722 | Ga0265332_10035841 | |||
| 1723 | Ga0265329_10011414 | |||
| 1724 | Ga0265331_10043380 | |||
| 1725 | Ga0265327_10003094 | |||
| 1726 | Ga0265327_10005552 | |||
| 1727 | Ga0265316_10199220 | |||
| 1728 | Ga0307513_10000013 | |||
| 1729 | Ga0307513_10000246 | |||
| 1730 | Ga0307513_10007912 | |||
| 1731 | Ga0307513_10027457 | |||
| 1732 | Ga0307513_10075694 | |||
| 1733 | Ga0307513_10104696 | |||
| 1734 | Ga0307513_10122436 | |||
| 1735 | Ga0307513_10270462 | |||
| 1736 | Ga0307513_10325978 | |||
| 1737 | Ga0307509_10007099 | |||
| 1738 | Ga0307509_10019271 | |||
| 1739 | Ga0307509_10033367 | |||
| 1740 | Ga0307509_10164667 | |||
| 1741 | Ga0307408_100000008 | |||
| 1742 | Ga0307408_100006968 | |||
| 1743 | Ga0307408_100054021 | |||
| 1744 | Ga0307408_100086583 | |||
| 1745 | Ga0307408_100111446 | |||
| 1746 | Ga0307408_100152716 | |||
| 1747 | Ga0307508_10000450 | |||
| 1748 | Ga0307508_10008054 | |||
| 1749 | Ga0307508_10055717 | |||
| 1750 | Ga0307514_10001030 | |||
| 1751 | Ga0307514_10004889 | |||
| 1752 | Ga0307514_10008692 | |||
| 1753 | Ga0307514_10009061 | |||
| 1754 | Ga0307514_10109370 | |||
| 1755 | Ga0307514_10156290 | |||
| 1756 | Ga0265314_10008574 | |||
| 1757 | Ga0265314_10038564 | |||
| 1758 | Ga0265342_10038530 | |||
| 1759 | Ga0307516_10008482 | |||
| 1760 | Ga0307516_10077658 | |||
| 1761 | Ga0307516_10353428 | |||
| 1762 | Ga0307405_10252917 | |||
| 1763 | Ga0307518_10244042 | |||
| 1764 | Ga0307518_10330066 | |||
| 1765 | Ga0307406_10004336 | |||
| 1766 | Ga0307406_10012119 | |||
| 1767 | Ga0307412_10000392 | |||
| 1768 | Ga0307412_10008739 | |||
| 1769 | Ga0307412_10193682 | |||
| 1770 | Ga0307412_10357730 | |||
| 1771 | Ga0307412_10517187 | |||
| 1772 | Ga0307414_10115733 | |||
| 1773 | Ga0307414_10293586 | |||
| 1774 | Ga0307411_10002080 | |||
| 1775 | Ga0307415_100694203 | |||
| 1776 | Ga0307510_10034007 | |||
| 1777 | Ga0373936_0043270 | |||
| 1778 | Ga0373957_0028893 | |||
| 1779 | Ga0373955_0292472 | |||
| 1780 | Ga0373931_0025968 | |||
| 1781 | Ga0373933_0190358 | |||
| 1782 | Ga0373937_0040657 | |||
| 1783 | Ga0373925_0461305 | |||
| 1784 | Ga0395905_0052780 | |||
| 1785 | Ga0395901_0111180 | |||
| 1786 | Ga0436360_1081132 | |||
| 1787 | Ga0436361_0032066 | |||
| 1788 | Ga0436361_0206607 | |||
| 1789 | Ga0436363_0171481 | |||
| 1790 | Ga0439439_0003401 | |||
| 1791 | Ga0439466_0002610 | |||
| 1792 | Ga0439466_0020082 | |||
| 1793 | Ga0451839_0601462 | |||
| 1794 | Ga0439445_0001509 | |||
| 1795 | Ga0439432_002290 | |||
| 1796 | Ga0439449_0000753 | |||
| 1797 | Ga0439449_0004213 | |||
| 1798 | Ga0439452_002755 | |||
| 1799 | Ga0450923_031374 | |||
| 1800 | Ga0450898_003737 | |||
| 1801 | Ga0450909_011691 | |||
| 1802 | Ga0439434_0001757 | |||
| 1803 | Ga0450918_002439 | |||
| 1804 | Ga0466972_0000880 | |||
| 1805 | Ga0466965_0002203 | |||
| 1806 | Ga0466964_0007106 | |||
| 1807 | Ga0466964_0012803 | |||
| 1808 | Ga0453684_0391028 | |||
| 1809 | Ga0466968_0008025 | |||
| 1810 | Ga0451576_0019302 | |||
| 1811 | Ga0451576_0039018 | |||
| 1812 | Ga0495638_0077305 | |||
| 1813 | Ga0495585_0074205 | |||
| 1814 | Ga0495596_0000064 | |||
| 1815 | Ga0495607_0000507 | |||
| 1816 | Ga0495610_0001367 | |||
| 1817 | Ga0495610_0019846 | |||
| 1818 | Ga0495616_0000866 | |||
| 1819 | Ga0495620_0051816 | |||
| 1820 | Ga0495632_0112483 | |||
| 1821 | Ga0495637_0005420 | |||
| 1822 | Ga0495648_0110383 | |||
| 1823 | Ga0495642_0033322 | |||
| 1824 | Ga0495642_0057359 | |||
| 1825 | Ga0495654_0000834 | |||
| 1826 | Ga0495609_0000244 | |||
| 1827 | Ga0495656_0000365 | |||
| 1828 | Ga0495625_0010498 | |||
| 1829 | Ga0495661_0008722 | |||
| 1830 | Ga0495588_0097715 | |||
| 1831 | Ga0495671_0000453 | |||
| 1832 | Ga0495649_0004212 | |||
| 1833 | Ga0495660_0031902 | |||
| 1834 | Ga0495672_0032883 | |||
| 1835 | Ga0495676_0089794 | |||
| 1836 | Ga0495687_027112 | |||
| 1837 | Ga0495685_001488 | |||
| 1838 | Ga0495686_0241770 | |||
| 1839 | Ga0495593_0037115 | |||
| 1840 | Ga0495614_0107705 | |||
| 1841 | Ga0496101_0379158 | |||
| 1842 | Ga0496102_0206626 | |||
| 1843 | Ga0496103_0084378 | |||
| 1844 | Ga0496104_0032473 | |||
| 1845 | Ga0496105_0012904 | |||
| 1846 | Ga0496106_0284822 | |||
| 1847 | Ga0496108_0452077 | |||
| 1848 | Ga0496109_0058519 | |||
| 1849 | Ga0496110_0537597 | |||
| 1850 | Ga0496114_0186150 | |||
| 1851 | Ga0496115_0025937 | |||
| 1852 | Ga0496116_0001004 | |||
| 1853 | Ga0496116_0011864 | |||
| 1854 | Ga0496116_0013245 | |||
| 1855 | Ga0496116_0067024 | |||
| 1856 | Ga0496116_0081581 | |||
| 1857 | Ga0496116_0125457 | |||
| 1858 | Ga0496117_0068338 | |||
| 1859 | Ga0496118_0019857 | |||
| 1860 | Ga0496118_0053756 | |||
| 1861 | Ga0496118_0085109 | |||
| 1862 | Ga0496119_0003325 | |||
| 1863 | Ga0496120_0003204 | |||
| 1864 | Ga0496121_0001404 | |||
| 1865 | Ga0496121_0005640 | |||
| 1866 | Ga0496121_0143282 | |||
| 1867 | Ga0496121_0218094 | |||
| 1868 | Ga0496121_0232548 | |||
| 1869 | Ga0496122_0000029 | |||
| 1870 | Ga0496122_0000317 | |||
| 1871 | Ga0496122_0004249 | |||
| 1872 | Ga0496122_0004463 | |||
| 1873 | Ga0496123_0000124 | |||
| 1874 | Ga0496123_0000531 | |||
| 1875 | Ga0496123_0001487 | |||
| 1876 | Ga0496123_0001761 | |||
| 1877 | Ga0496123_0003891 | |||
| 1878 | Ga0496124_0000024 | |||
| 1879 | Ga0496124_0004949 | |||
| 1880 | Ga0496124_0034977 | |||
| 1881 | Ga0496124_0122058 | |||
| 1882 | Ga0496124_0149259 | |||
| 1883 | Ga0496124_0223673 | |||
| 1884 | Ga0496125_0000244 | |||
| 1885 | Ga0496125_0015625 | |||
| 1886 | Ga0496125_0030924 | |||
| 1887 | Ga0496126_0043446 | |||
| 1888 | Ga0495682_0000003 | |||
| 1889 | Ga0501048_0160292 | |||
| 1890 | nmdc:mga00v17_56590_c1 | |||
| 1891 | nmdc:mga0yw44_243798_c1 | |||
| 1892 | nmdc:mga0k408_247959_c1 | |||
| 1893 | nmdc:mga0k408_254840_c1 | |||
| 1894 | nmdc:mga0k408_26319_c1 | |||
| 1895 | nmdc:mga0k408_4891_c2 | |||
| 1896 | nmdc:mga0k408_7822_c1 | |||
| 1897 | nmdc:mga07m45_10453_c1 | |||
| 1898 | nmdc:mga07m45_122_c1 | |||
| 1899 | nmdc:mga07m45_15544_c1 | |||
| 1900 | nmdc:mga07m45_196634_c1 | |||
| 1901 | nmdc:mga07m45_4239_c1 | |||
| 1902 | nmdc:mga07m45_93670_c1 | |||
| 1903 | nmdc:mga05p37_92917_c1 | |||
| 1904 | nmdc:mga09592_68309_c1 | |||
| 1905 | nmdc:mga09592_70483_c1 | |||
| 1906 | nmdc:mga0qj67_99755_c1 | |||
| 1907 | nmdc:mga06r32_51310_c1 | |||
| 1908 | nmdc:mga06r32_752362_c1 | |||
| 1909 | nmdc:mga0sz30_123992_c1 | |||
| 1910 | nmdc:mga0sz30_147099_c1 | |||
| 1911 | nmdc:mga0sz30_15597_c1 | |||
| 1912 | Ga0495601_0156569 | |||
| 1913 | Ga0500610_0003992 | |||
| 1914 | Ga0500644_0000575 | |||
| 1915 | Ga0500571_006720 | |||
| 1916 | Ga0500593_000414 | |||
| 1917 | Ga0500593_003241 | |||
| 1918 | Ga0500594_0017153 | |||
| 1919 | Ga0500595_000002 | |||
| 1920 | Ga0500618_002619 | |||
| 1921 | Ga0500658_0002081 | |||
| 1922 | Ga0500559_0000047 | |||
| 1923 | Ga0500568_0061648 | |||
| 1924 | Ga0500574_011876 | |||
| 1925 | Ga0500616_0000002 | |||
| 1926 | Ga0500619_000077 | |||
| 1927 | Ga0500634_0013275 | |||
| 1928 | Ga0500636_0083949 | |||
| 1929 | Ga0500587_002315 | |||
| 1930 | 2511250033 | |||
| 1931 | 2521557336 | |||
| 1932 | 2553005314 | |||
| 1933 | 2587759442 | |||
| 1934 | 2599622444 | |||
| 1935 | 2599674464 | |||
| 1936 | 2599680149 | |||
| 1937 | 2599692165 | |||
| 1938 | 2599906620 | |||
| 1939 | 2643860823 | |||
| 1940 | 2643936098 | |||
| 1941 | 2643981333 | |||
| 1942 | 2644060571 | |||
| 1943 | 2644073899 | |||
| 1944 | 2644124117 | |||
| 1945 | 2644160849 | |||
| 1946 | 2644221861 | |||
| 1947 | 2644257345 | |||
| 1948 | 2644316743 | |||
| 1949 | 2644396904 | |||
| 1950 | 2738719305 | |||
| 1951 | 2738883349 | |||
| 1952 | 2739242601 | |||
| 1953 | 2739247375 | |||
| 1954 | 2739282964 | |||
| 1955 | 2765568462 | |||
| 1956 | 2809035250 | |||
| 1957 | 2816473078 | |||
| 1958 | 2819592017 | |||
| 1959 | 2819599144 | |||
| 1960 | 2819617670 | |||
| 1961 | 2831270925 | |||
| 1962 | 2838058972 | |||
| 1963 | 2839095299 | |||
| 1964 | 2842679286 | |||
| 1965 | 2842737764 | |||
| 1966 | 2842738290 | |||
| 1967 | 2842750713 | |||
| 1968 | 2855731335 | |||
| 1969 | 2855768041 | |||
| 1970 | 2857542285 | |||
| 1971 | 2857545049 | |||
| 1972 | 2857577018 | |||
| 1973 | 2858953573 | |||
| 1974 | 2881413781 | |||
| 1975 | 2884814033 | |||
| 1976 | 2884840567 | |||
| 1977 | 2884855824 | |||
| 1978 | 2885193976 | |||
| 1979 | 2885202258 | |||
| 1980 | 2885215911 | |||
| 1981 | 2896157251 | |||
| 1982 | 2899929968 | |||
| 1983 | 2904439929 | |||
| 1984 | 2904451618 | |||
| 1985 | 2904453000 | |||
| 1986 | 2904459962 | |||
| 1987 | 2904461893 | |||
| 1988 | 2904482326 | |||
| 1989 | 2904531126 | |||
| 1990 | 2904543295 | |||
| 1991 | 2904587229 | |||
| 1992 | 2904592736 | |||
| 1993 | 2904604481 | |||
| 1994 | 2919050246 | |||
| 1995 | 2919082303 | |||
| 1996 | 2919464482 | |||
| 1997 | 2919706843 | |||
| 1998 | 2923515996 | |||
| 1999 | 2928043503 | |||
| 2000 | 2928049867 | |||
| 2001 | 2928054442 | |||
| 2002 | 2928070028 | |||
| 2003 | 2928074353 | |||
| 2004 | 2928086591 | |||
| 2005 | 2928118845 | |||
| 2006 | 2929160527 | |||
| 2007 | 2929525959 | |||
| 2008 | 2929526537 | |||
| 2009 | 2941484660 | |||
| 2010 | 2945915519 | |||
| 2011 | 2945974136 | |||
| 2012 | 2945974897 | |||
| 2013 | 2945989083 | |||
| 2014 | 8003405435 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9147 | 29 | 245 |
| 7caf-assembly1.cif.gz_C | mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state | 0.9133 | 30 | 241 |
| 7cha-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with amppnp | 0.9128 | 29 | 241 |
| 7cad-assembly1.cif.gz_D | mycobacterium smegmatis sugabc complex | 0.9127 | 30 | 243 |
| 5jsz-assembly1.cif.gz_A | folate ecf transporter: apo state | 0.9124 | 28 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9327 | 30 | 268 | 3.40.50.300 |
| af_P63386_5_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.923 | 29 | 243 | 3.40.50.300 |
| af_Q2FW34_4_263_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.92 | 28 | 243 | 3.40.50.300 |
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9191 | 29 | 243 | 3.40.50.300 |
| af_Q9XW49_1237_1482_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9188 | 28 | 241 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K8E236-F1-model_v4 | ABC transporter family protein | 0.9335 | 102 | 243 |
GO:0005524
GO:0016887 GO:0042626 GO:0043190 |
| AF-K1SC20-F1-model_v4 | ABC superfamily ATP binding cassette transporter, ABC protein | 0.9327 | 29 | 217 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A382Y1F8-F1-model_v4 | ABC transporter domain-containing protein | 0.9285 | 29 | 221 |
GO:0001407
GO:0005524 GO:0008643 GO:0015794 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A524B8W3-F1-model_v4 | ABC transporter | 0.927 | 30 | 230 |
GO:0005524
GO:0016887 |
| AF-K0DB19-F1-model_v4 | ABC transporter ATP binding protein | 0.9255 | 29 | 243 |
GO:0005524
GO:0016887 GO:0042626 GO:0043190 |