F488035

General Info

Members Datasets Scaffolds Average Seq Length
1007 431 2014 311

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10019811|Ga0157369_100198112
Length 340
Sequence LGGHELRYPLIAPRPAPAGVFMPFAFVFPGQGSQSIGMMAKLAASGPVIRETFDEASAVLGYDLWQVVENGPAEKLNSTEVTQPAMLAAGIATWRLWQQRDGARPSVVAGHSLGEFTALVCAEALDFGPAIDLVRFRGKVMQEAAPAGTGAMAAVLGLSEADIELACREAAQGEVVQAVNFNSPGQIVIAGHAGAVQRAIEAAKARGAKRAVLLALSVPSHSSLMQPAAKRLEERLADIELRTPRIRYVSAVDAAAHQAPEDIRALLVRQVASPVRWTDTVTALAGNDISAVIECGPGKVLMGLSRRIVQREGLTYMALEDPDSVTAALAASAPGGAAHA

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
115 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
180 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
190 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
206 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
210 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
211 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
220 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
221 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
222 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
224 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
236 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
237 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
238 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
239 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
240 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
241 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
246 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
247 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
248 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
252 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
253 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
254 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
271 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
281 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
282 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
283 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
284 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
285 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
286 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
291 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
292 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
295 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
296 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
307 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
308 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
309 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
331 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
340 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
341 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
342 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
345 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
346 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
347 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
364 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
365 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
366 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
367 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
368 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
369 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
374 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
375 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
383 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
384 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
385 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
386 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
387 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
388 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
389 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
390 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
391 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
392 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
393 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
394 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
395 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
396 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
402 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
403 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
404 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
405 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
406 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
407 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
408 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
409 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
410 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
411 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
412 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
413 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
414 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
415 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
417 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
418 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
419 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
420 2643221556 Massilia sp. Root1485 Isolate Unclassified
421 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
422 2643221684 Massilia sp. Root133 Isolate Unclassified
423 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
424 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
425 2818991436 Collimonas arenae 515 Isolate Unclassified
426 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
427 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
428 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
429 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
430 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
431 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 1.39
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0.1
Rhizoplane 2.78
Rhizosphere 84.11
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10019811 3300013105 Bacteria 7529
2 JGI25156J39149_1004435 3300002705 Bacteria 4274
3 JGI25162J39368_1000036 3300002737 Bacteria 180433
4 JGI25154J39366_1002733 3300002738 Bacteria 4282
5 JGI25150J39212_1005125 3300002774 Bacteria 2829
6 JGI25165J46597_1000022 3300003214 Bacteria 357959
7 rootL2_10014064 3300003322 Bacteria 12412
8 rootL2_10091680 3300003322 Bacteria 3922
9 Ga0007410J51695_1012750 3300003574 Bacteria 9424
10 Ga0007409J51694_1006362 3300003575 Bacteria 11752
11 Ga0007416J51690_1012585 3300003577 Bacteria 9861
12 Ga0032354_1023937 3300003693 Bacteria 8937
13 Ga0055538_1000011 3300003751 Bacteria 357959
14 Ga0055539_1000016 3300003752 Bacteria 358248
15 Ga0055533_1000019 3300003756 Bacteria 357959
16 Ga0055525_1000001 3300003759 Bacteria 1016948
17 Ga0055525_1000042 3300003759 Bacteria 279804
18 Ga0055542_1010239 3300003762 Bacteria 1723
19 Ga0055541_1000017 3300003841 Bacteria 286811
20 Ga0065707_10082492 3300005295 Bacteria 14544
21 Ga0070676_10102203 3300005328 Bacteria 1773
22 Ga0070683_100016811 3300005329 Bacteria 6455
23 Ga0070670_100000001 3300005331 Bacteria 728788
24 Ga0070670_100025491 3300005331 Bacteria 5086
25 Ga0070670_100127161 3300005331 Bacteria 2200
26 Ga0068869_100040075 3300005334 Bacteria 3347
27 Ga0068869_100087511 3300005334 Bacteria 2337
28 Ga0068869_100182469 3300005334 Bacteria 1646
29 Ga0068869_100450708 3300005334 Bacteria 1066
30 Ga0070666_10015694 3300005335 Bacteria 4834
31 Ga0070666_10036180 3300005335 Bacteria 3275
32 Ga0070666_10049131 3300005335 Bacteria 2834
33 Ga0070680_100026542 3300005336 Bacteria 4632
34 Ga0070680_100085042 3300005336 Bacteria 2613
35 Ga0070682_100003924 3300005337 Bacteria 8253
36 Ga0070660_100014318 3300005339 Bacteria 5713
37 Ga0070660_100041122 3300005339 Bacteria 3522
38 Ga0070689_100008006 3300005340 Bacteria 7417
39 Ga0070689_100016914 3300005340 Bacteria 5345
40 Ga0070687_100160380 3300005343 Bacteria 1329
41 Ga0070661_100000813 3300005344 Bacteria 22437
42 Ga0070661_100036959 3300005344 Bacteria 3551
43 Ga0070661_100175855 3300005344 Bacteria 1627
44 Ga0070668_100023143 3300005347 Bacteria 4696
45 Ga0070669_100046626 3300005353 Bacteria 3161
46 Ga0070669_100164633 3300005353 Bacteria 1725
47 Ga0070675_100024523 3300005354 Bacteria 4830
48 Ga0070675_100031692 3300005354 Bacteria 4276
49 Ga0070675_100057275 3300005354 Bacteria 3212
50 Ga0070675_100177229 3300005354 Bacteria 1841
51 Ga0070671_100000018 3300005355 Bacteria 147427
52 Ga0070671_100010483 3300005355 Bacteria 7437
53 Ga0070674_100003565 3300005356 Bacteria 8749
54 Ga0070674_100013910 3300005356 Bacteria 4989
55 Ga0070673_100060284 3300005364 Bacteria 3006
56 Ga0070688_100004521 3300005365 Bacteria 7253
57 Ga0070688_100099691 3300005365 Bacteria 1913
58 Ga0070659_100053692 3300005366 Bacteria 3172
59 Ga0070659_100070043 3300005366 Bacteria 2785
60 Ga0070667_100000026 3300005367 Bacteria 183244
61 Ga0070667_100020275 3300005367 Bacteria 5519
62 Ga0070667_100049400 3300005367 Bacteria 3543
63 Ga0070667_100247902 3300005367 Bacteria 1592
64 Ga0070713_100212468 3300005436 Bacteria 1752
65 Ga0070713_100230531 3300005436 Bacteria 1683
66 Ga0070701_10052915 3300005438 Bacteria 2111
67 Ga0070701_10058065 3300005438 Bacteria 2030
68 Ga0070705_100009205 3300005440 Bacteria 4905
69 Ga0070663_100079890 3300005455 Bacteria 2401
70 Ga0070663_100240090 3300005455 Bacteria 1430
71 Ga0070678_100025418 3300005456 Bacteria 3983
72 Ga0070662_100014371 3300005457 Bacteria 5287
73 Ga0070662_100038172 3300005457 Bacteria 3410
74 Ga0070681_10005499 3300005458 Bacteria 12241
75 Ga0070681_10229940 3300005458 Bacteria 1769
76 Ga0068867_100005237 3300005459 Bacteria 9153
77 Ga0068867_100032317 3300005459 Bacteria 3784
78 Ga0068867_100034852 3300005459 Bacteria 3649
79 Ga0068867_100113656 3300005459 Bacteria 2084
80 Ga0070685_10000007 3300005466 Bacteria 180539
81 Ga0070685_10159859 3300005466 Bacteria 1435
82 Ga0070706_100140325 3300005467 Bacteria 2256
83 Ga0070679_100008554 3300005530 Bacteria 9641
84 Ga0070679_100046729 3300005530 Bacteria 4316
85 Ga0070679_100422533 3300005530 Bacteria 1278
86 Ga0070684_100005117 3300005535 Bacteria 10018
87 Ga0068853_100099084 3300005539 Bacteria 2574
88 Ga0070672_100019627 3300005543 Bacteria 4910
89 Ga0070672_100034611 3300005543 Bacteria 3835
90 Ga0070672_100118028 3300005543 Bacteria 2169
91 Ga0070672_100308130 3300005543 Bacteria 1343
92 Ga0070686_100009512 3300005544 Bacteria 5465
93 Ga0070686_100027798 3300005544 Bacteria 3425
94 Ga0070696_100031637 3300005546 Bacteria 3627
95 Ga0070696_100087225 3300005546 Bacteria 2217
96 Ga0070665_100044195 3300005548 Bacteria 4474
97 Ga0070665_100068997 3300005548 Bacteria 3543
98 Ga0070665_100567097 3300005548 Bacteria 1148
99 Ga0070704_100032448 3300005549 Bacteria 3523
100 Ga0070704_100135283 3300005549 Bacteria 1916
101 Ga0070704_100321259 3300005549 Bacteria 1297
102 Ga0068855_100008719 3300005563 Bacteria 12260
103 Ga0068855_100031837 3300005563 Bacteria 6296
104 Ga0068855_100220292 3300005563 Bacteria 2128
105 Ga0070664_100012001 3300005564 Bacteria 7036
106 Ga0070664_100014812 3300005564 Bacteria 6365
107 Ga0070664_100065531 3300005564 Bacteria 3099
108 Ga0070664_100216824 3300005564 Bacteria 1711
109 Ga0068857_100006850 3300005577 Bacteria 9807
110 Ga0068857_100140938 3300005577 Bacteria 2179
111 Ga0068857_100396467 3300005577 Bacteria 1284
112 Ga0068857_100463351 3300005577 Bacteria 1186
113 Ga0068854_100005152 3300005578 Bacteria 8239
114 Ga0068856_100016323 3300005614 Bacteria 7186
115 Ga0068856_100092120 3300005614 Bacteria 3015
116 Ga0070702_100017140 3300005615 Bacteria 3730
117 Ga0068852_100001206 3300005616 Bacteria 17155
118 Ga0068852_100095514 3300005616 Bacteria 2669
119 Ga0068859_100001745 3300005617 Bacteria 22159
120 Ga0068859_100007685 3300005617 Bacteria 10950
121 Ga0068859_100080974 3300005617 Bacteria 3289
122 Ga0068859_100115963 3300005617 Bacteria 2743
123 Ga0068859_100150062 3300005617 Bacteria 2406
124 Ga0068859_100223012 3300005617 Bacteria 1973
125 Ga0068864_100000012 3300005618 Bacteria 335070
126 Ga0068864_100037858 3300005618 Bacteria 4118
127 Ga0068866_10150941 3300005718 Bacteria 1345
128 Ga0068861_100000962 3300005719 Bacteria 17544
129 Ga0068861_100074083 3300005719 Bacteria 2647
130 Ga0068861_100101784 3300005719 Bacteria 2286
131 Ga0068861_100208178 3300005719 Bacteria 1646
132 Ga0068861_100335508 3300005719 Bacteria 1322
133 Ga0068863_100008065 3300005841 Bacteria 10283
134 Ga0068863_100017541 3300005841 Bacteria 6862
135 Ga0068858_100001018 3300005842 Bacteria 28907
136 Ga0068858_100016226 3300005842 Bacteria 6997
137 Ga0068858_100017352 3300005842 Bacteria 6752
138 Ga0068858_100428549 3300005842 Bacteria 1272
139 Ga0068860_100004168 3300005843 Bacteria 14825
140 Ga0068860_100007832 3300005843 Bacteria 10665
141 Ga0068862_100001146 3300005844 Bacteria 25101
142 Ga0068862_100033113 3300005844 Bacteria 4366
143 Ga0068862_100036344 3300005844 Bacteria 4176
144 Ga0068862_100209238 3300005844 Bacteria 1762
145 Ga0075363_100002122 3300006048 Bacteria 7961
146 Ga0075367_10013597 3300006178 Bacteria 4381
147 Ga0075369_10064583 3300006186 Bacteria 1603
148 Ga0075366_10123535 3300006195 Bacteria 1560
149 Ga0097621_100068678 3300006237 Bacteria 2924
150 Ga0068871_100100355 3300006358 Bacteria 2424
151 Ga0075430_100011821 3300006846 Bacteria 7428
152 Ga0075431_100035076 3300006847 Bacteria 5167
153 Ga0075431_100104471 3300006847 Bacteria 2923
154 Ga0068865_100008565 3300006881 Bacteria 6322
155 Ga0068865_100023560 3300006881 Bacteria 4032
156 Ga0068865_100278869 3300006881 Bacteria 1330
157 Ga0097620_100001745 3300006931 Bacteria 22159
158 Ga0097620_100007685 3300006931 Bacteria 10950
159 Ga0097620_100080966 3300006931 Bacteria 3289
160 Ga0097620_100115964 3300006931 Bacteria 2743
161 Ga0097620_100150062 3300006931 Bacteria 2406
162 Ga0097620_100223007 3300006931 Bacteria 1973
163 Ga0099795_10000014 3300007788 Bacteria 67566
164 Ga0105240_10019812 3300009093 Bacteria 8986
165 Ga0105240_10038598 3300009093 Bacteria 6124
166 Ga0105240_10059153 3300009093 Bacteria 4783
167 Ga0105240_10328511 3300009093 Bacteria 1741
168 Ga0111539_10012880 3300009094 Bacteria 10466
169 Ga0111539_10429433 3300009094 Bacteria 1538
170 Ga0105247_10001941 3300009101 Bacteria 14376
171 Ga0105247_10018455 3300009101 Bacteria 4184
172 Ga0105247_10202911 3300009101 Bacteria 1333
173 Ga0105243_10216785 3300009148 Bacteria 1689
174 Ga0105241_10044133 3300009174 Bacteria 3377
175 Ga0105241_10082865 3300009174 Bacteria 2515
176 Ga0105242_10030398 3300009176 Bacteria 4313
177 Ga0105242_10045340 3300009176 Bacteria 3563
178 Ga0105242_10054998 3300009176 Bacteria 3255
179 Ga0105248_10123619 3300009177 Bacteria 2919
180 Ga0105248_10263891 3300009177 Bacteria 1939
181 Ga0105237_10023342 3300009545 Bacteria 6339
182 Ga0105237_10310823 3300009545 Bacteria 1579
183 Ga0105238_10003217 3300009551 Bacteria 16314
184 Ga0105238_10049013 3300009551 Bacteria 4255
185 Ga0105238_10371117 3300009551 Bacteria 1421
186 Ga0105249_10070890 3300009553 Bacteria 3218
187 Ga0105249_10086586 3300009553 Bacteria 2922
188 Ga0105249_10103644 3300009553 Bacteria 2680
189 Ga0105249_10263908 3300009553 Bacteria 1712
190 Ga0099796_10000054 3300010159 Bacteria 20546
191 Ga0157373_10006638 3300013100 Bacteria 8623
192 Ga0157371_10000078 3300013102 Bacteria 154095
193 Ga0157370_10031830 3300013104 Bacteria 5156
194 Ga0157369_10001598 3300013105 Bacteria 27722
195 Ga0157369_10004689 3300013105 Bacteria 16077
196 Ga0157374_10265654 3300013296 Bacteria 1691
197 Ga0157378_10012175 3300013297 Bacteria 7532
198 Ga0163162_10002139 3300013306 Bacteria 18531
199 Ga0163162_10012636 3300013306 Bacteria 8244
200 Ga0163162_10021561 3300013306 Bacteria 6346
201 Ga0163162_10033867 3300013306 Bacteria 5079
202 Ga0157372_10020911 3300013307 Bacteria 7064
203 Ga0157372_10124114 3300013307 Bacteria 2968
204 Ga0157372_10651454 3300013307 Bacteria 1226
205 Ga0157375_10088560 3300013308 Bacteria 3151
206 Ga0157375_10160315 3300013308 Bacteria 2391
207 Ga0157375_10171726 3300013308 Bacteria 2316
208 Ga0157375_10310817 3300013308 Bacteria 1740
209 Ga0163163_10000051 3300014325 Bacteria 128275
210 Ga0163163_10089960 3300014325 Bacteria 3083
211 Ga0163163_10144606 3300014325 Bacteria 2421
212 Ga0157380_10020523 3300014326 Bacteria 4939
213 Ga0157380_10080085 3300014326 Bacteria 2669
214 Ga0157380_10189332 3300014326 Bacteria 1815
215 Ga0182008_10103316 3300014497 Bacteria 1409
216 Ga0182008_10117790 3300014497 Bacteria 1318
217 Ga0157379_10006122 3300014968 Bacteria 10357
218 Ga0157379_10034926 3300014968 Bacteria 4482
219 Ga0157379_10247486 3300014968 Bacteria 1618
220 Ga0157379_10704311 3300014968 Bacteria 948
221 Ga0157376_10222159 3300014969 Bacteria 1750
222 Ga0157376_10396632 3300014969 Bacteria 1333
223 Ga0182006_1010763 3300015261 Bacteria 4051
224 Ga0182007_10021648 3300015262 Bacteria 2279
225 Ga0182005_1000307 3300015265 Bacteria 29530
226 Ga0163161_10012670 3300017792 Bacteria 5856
227 Ga0163161_10165647 3300017792 Bacteria 1687
228 Ga0213872_10000263 3300021361 Bacteria 45483
229 Ga0213872_10001047 3300021361 Bacteria 19247
230 Ga0213872_10011598 3300021361 Bacteria 4166
231 Ga0213872_10012586 3300021361 Bacteria 3979
232 Ga0213874_10066299 3300021377 Unclassified 1142
233 Ga0213876_10107712 3300021384 Bacteria 1479
234 Ga0209435_100716 3300025206 Bacteria 5582
235 Ga0209784_100019 3300025224 Bacteria 453558
236 Ga0209566_100017 3300025225 Bacteria 453558
237 Ga0209674_100031 3300025226 Bacteria 453558
238 Ga0209672_106450 3300025228 Bacteria 1903
239 Ga0209563_100007 3300025230 Bacteria 1579402
240 Ga0209563_100035 3300025230 Bacteria 453558
241 Ga0207427_100255 3300025231 Bacteria 41856
242 Ga0209437_100038 3300025233 Bacteria 453558
243 Ga0207425_1001639 3300025245 Bacteria 9024
244 Ga0209646_1000872 3300025246 Bacteria 10050
245 Ga0209026_1003950 3300025250 Bacteria 4633
246 Ga0209677_100020 3300025253 Bacteria 453558
247 Ga0209148_1000992 3300025254 Bacteria 18267
248 Ga0209759_1000359 3300025256 Bacteria 58766
249 Ga0209233_1000049 3300025261 Bacteria 453558
250 Ga0209025_1016263 3300025294 Bacteria 4408
251 Ga0209758_1002044 3300025297 Bacteria 21637
252 Ga0207682_10000363 3300025893 Bacteria 20824
253 Ga0207682_10000537 3300025893 Bacteria 17474
254 Ga0207682_10004847 3300025893 Bacteria 5566
255 Ga0207642_10030040 3300025899 Bacteria 2258
256 Ga0207642_10081710 3300025899 Bacteria 1571
257 Ga0207710_10000230 3300025900 Bacteria 48621
258 Ga0207710_10070795 3300025900 Bacteria 1599
259 Ga0207680_10004217 3300025903 Bacteria 6806
260 Ga0207680_10041684 3300025903 Bacteria 2681
261 Ga0207645_10000178 3300025907 Bacteria 50810
262 Ga0207645_10008955 3300025907 Bacteria 6949
263 Ga0207645_10144605 3300025907 Bacteria 1550
264 Ga0207643_10020654 3300025908 Bacteria 3615
265 Ga0207643_10035424 3300025908 Bacteria 2799
266 Ga0207643_10174565 3300025908 Bacteria 1298
267 Ga0207705_10023618 3300025909 Bacteria 4386
268 Ga0207654_10280643 3300025911 Bacteria 1127
269 Ga0207707_10024558 3300025912 Bacteria 5275
270 Ga0207707_10045689 3300025912 Bacteria 3816
271 Ga0207695_10018572 3300025913 Bacteria 8033
272 Ga0207695_10032578 3300025913 Bacteria 5700
273 Ga0207695_10073110 3300025913 Bacteria 3495
274 Ga0207695_10109895 3300025913 Bacteria 2738
275 Ga0207695_10235923 3300025913 Bacteria 1732
276 Ga0207671_10182076 3300025914 Bacteria 1635
277 Ga0207660_10027094 3300025917 Bacteria 3907
278 Ga0207660_10094123 3300025917 Bacteria 2227
279 Ga0207662_10015635 3300025918 Bacteria 4272
280 Ga0207662_10109919 3300025918 Bacteria 1718
281 Ga0207657_10019066 3300025919 Bacteria 6527
282 Ga0207657_10037258 3300025919 Bacteria 4344
283 Ga0207649_10000924 3300025920 Bacteria 18501
284 Ga0207649_10035200 3300025920 Bacteria 3008
285 Ga0207652_10375354 3300025921 Bacteria 1284
286 Ga0207694_10003088 3300025924 Bacteria 13330
287 Ga0207694_10015470 3300025924 Bacteria 5754
288 Ga0207694_10040729 3300025924 Bacteria 3578
289 Ga0207694_10260318 3300025924 Bacteria 1421
290 Ga0207650_10000002 3300025925 Bacteria 1439222
291 Ga0207650_10123907 3300025925 Bacteria 2015
292 Ga0207659_10036008 3300025926 Bacteria 3425
293 Ga0207659_10413336 3300025926 Bacteria 1130
294 Ga0207700_10135931 3300025928 Bacteria 2014
295 Ga0207700_10247189 3300025928 Bacteria 1522
296 Ga0207664_10015733 3300025929 Bacteria 5501
297 Ga0207644_10000026 3300025931 Bacteria 147255
298 Ga0207644_10001003 3300025931 Bacteria 18047
299 Ga0207644_10036298 3300025931 Bacteria 3459
300 Ga0207644_10150659 3300025931 Bacteria 1799
301 Ga0207706_10000721 3300025933 Bacteria 34533
302 Ga0207706_10007741 3300025933 Bacteria 9917
303 Ga0207706_10023309 3300025933 Bacteria 5560
304 Ga0207706_10070140 3300025933 Bacteria 3082
305 Ga0207686_10049440 3300025934 Bacteria 2610
306 Ga0207686_10076906 3300025934 Bacteria 2166
307 Ga0207709_10040362 3300025935 Bacteria 2794
308 Ga0207669_10100246 3300025937 Bacteria 1912
309 Ga0207704_10020566 3300025938 Bacteria 3495
310 Ga0207691_10003757 3300025940 Bacteria 14732
311 Ga0207691_10007249 3300025940 Bacteria 10697
312 Ga0207691_10032022 3300025940 Bacteria 4905
313 Ga0207691_10058407 3300025940 Bacteria 3509
314 Ga0207691_10092587 3300025940 Bacteria 2707
315 Ga0207691_10191110 3300025940 Bacteria 1785
316 Ga0207711_10000279 3300025941 Bacteria 55112
317 Ga0207689_10012093 3300025942 Bacteria 7391
318 Ga0207689_10043003 3300025942 Bacteria 3735
319 Ga0207689_10100862 3300025942 Bacteria 2371
320 Ga0207689_10185344 3300025942 Bacteria 1716
321 Ga0207679_10004443 3300025945 Bacteria 8736
322 Ga0207679_10066044 3300025945 Bacteria 2709
323 Ga0207679_10069762 3300025945 Bacteria 2646
324 Ga0207679_10159090 3300025945 Bacteria 1847
325 Ga0207679_10167752 3300025945 Bacteria 1804
326 Ga0207667_10013878 3300025949 Bacteria 9203
327 Ga0207667_10019236 3300025949 Bacteria 7634
328 Ga0207651_10543326 3300025960 Bacteria 1009
329 Ga0207668_10220837 3300025972 Bacteria 1522
330 Ga0207640_10207290 3300025981 Bacteria 1490
331 Ga0207658_10000001 3300025986 Bacteria 1439333
332 Ga0207658_10021308 3300025986 Bacteria 4497
333 Ga0207658_10048303 3300025986 Bacteria 3120
334 Ga0207703_10000931 3300026035 Bacteria 28414
335 Ga0207703_10001837 3300026035 Bacteria 18926
336 Ga0207703_10026533 3300026035 Bacteria 4560
337 Ga0207678_10028049 3300026067 Bacteria 4917
338 Ga0207678_10046744 3300026067 Bacteria 3743
339 Ga0207678_10155218 3300026067 Bacteria 1954
340 Ga0207708_10003301 3300026075 Bacteria 11873
341 Ga0207708_10106735 3300026075 Bacteria 2172
342 Ga0207702_10003782 3300026078 Bacteria 13659
343 Ga0207641_10002241 3300026088 Bacteria 18054
344 Ga0207641_10416560 3300026088 Bacteria 1292
345 Ga0207641_10416561 3300026088 Bacteria 1292
346 Ga0207648_10001407 3300026089 Bacteria 26493
347 Ga0207648_10036960 3300026089 Bacteria 4302
348 Ga0207648_10307240 3300026089 Bacteria 1423
349 Ga0207676_10000001 3300026095 Bacteria 1439222
350 Ga0207676_10005269 3300026095 Bacteria 9154
351 Ga0207676_10008269 3300026095 Bacteria 7399
352 Ga0207674_10000536 3300026116 Bacteria 49766
353 Ga0207674_10083098 3300026116 Bacteria 3202
354 Ga0207674_10260873 3300026116 Bacteria 1680
355 Ga0207674_10281293 3300026116 Bacteria 1612
356 Ga0207675_100000345 3300026118 Bacteria 44273
357 Ga0207675_100001625 3300026118 Bacteria 22527
358 Ga0207675_100009265 3300026118 Bacteria 9232
359 Ga0207675_100010996 3300026118 Bacteria 8479
360 Ga0207675_100012530 3300026118 Bacteria 7920
361 Ga0207675_100105310 3300026118 Bacteria 2658
362 Ga0207675_100276354 3300026118 Bacteria 1631
363 Ga0207675_100287270 3300026118 Bacteria 1599
364 Ga0207683_10034525 3300026121 Bacteria 4395
365 Ga0207683_10047615 3300026121 Bacteria 3754
366 Ga0207683_10064063 3300026121 Bacteria 3239
367 Ga0207698_10012426 3300026142 Bacteria 5571
368 Ga0207698_10057160 3300026142 Bacteria 3016
369 Ga0209179_1000013 3300027512 Bacteria 62144
370 Ga0265354_1000774 3300028016 Bacteria 5204
371 Ga0265356_1002312 3300028017 Bacteria 2570
372 Ga0268266_10001083 3300028379 Bacteria 34130
373 Ga0268266_10004153 3300028379 Bacteria 13973
374 Ga0268266_10047347 3300028379 Bacteria 3683
375 Ga0268266_10409662 3300028379 Bacteria 1283
376 Ga0268265_10001823 3300028380 Bacteria 17029
377 Ga0268265_10025833 3300028380 Bacteria 4174
378 Ga0268265_10284555 3300028380 Bacteria 1481
379 Ga0268264_10000061 3300028381 Bacteria 303123
380 Ga0268264_10000179 3300028381 Bacteria 134401
381 Ga0268264_10027283 3300028381 Bacteria 4664
382 Ga0265319_1020051 3300028563 Bacteria 2486
383 Ga0265334_10000127 3300028573 Bacteria 48527
384 Ga0265318_10000024 3300028577 Bacteria 159801
385 Ga0307515_10299892 3300028794 Bacteria 1293
386 Ga0265338_10010433 3300028800 Bacteria 10893
387 Ga0265338_10028206 3300028800 Bacteria 5605
388 Ga0307511_10000040 3300030521 Bacteria 102640
389 Ga0265770_1000354 3300030878 Bacteria 6250
390 Ga0265330_10003907 3300031235 Bacteria 7664
391 Ga0265328_10010066 3300031239 Bacteria 3822
392 Ga0265320_10005045 3300031240 Bacteria 8549
393 Ga0265325_10005133 3300031241 Bacteria 8144
394 Ga0265340_10045334 3300031247 Bacteria 2148
395 Ga0265339_10023115 3300031249 Bacteria 3596
396 Ga0265331_10005948 3300031250 Bacteria 7282
397 Ga0265327_10000014 3300031251 Bacteria 506288
398 Ga0265316_10024185 3300031344 Bacteria 5096
399 Ga0307513_10040878 3300031456 Bacteria 5123
400 Ga0307513_10063236 3300031456 Bacteria 3906
401 Ga0307513_10175972 3300031456 Bacteria 2010
402 Ga0307509_10001628 3300031507 Bacteria 37634
403 Ga0307509_10170332 3300031507 Bacteria 2058
404 Ga0307509_10176859 3300031507 Bacteria 2005
405 Ga0307509_10199032 3300031507 Bacteria 1843
406 Ga0307408_100001210 3300031548 Bacteria 19453
407 Ga0265313_10004752 3300031595 Bacteria 10242
408 Ga0307508_10074771 3300031616 Bacteria 2965
409 Ga0307514_10091103 3300031649 Bacteria 2222
410 Ga0316575_10018347 3300031665 Bacteria 2666
411 Ga0265314_10001695 3300031711 Bacteria 23953
412 Ga0265342_10068460 3300031712 Bacteria 2074
413 Ga0316576_10022743 3300031727 Bacteria 4357
414 Ga0316578_10003631 3300031728 Bacteria 7109
415 Ga0316578_10024545 3300031728 Bacteria 3382
416 Ga0316577_10001334 3300031733 Bacteria 11567
417 Ga0316577_10009802 3300031733 Bacteria 5162
418 Ga0307413_10001755 3300031824 Bacteria 8486
419 Ga0307410_10003357 3300031852 Bacteria 8019
420 Ga0307410_10004428 3300031852 Bacteria 7260
421 Ga0307407_10004906 3300031903 Bacteria 5743
422 Ga0307407_10005254 3300031903 Bacteria 5596
423 Ga0307409_100002705 3300031995 Bacteria 9350
424 Ga0307409_100007342 3300031995 Bacteria 6585
425 Ga0307416_100070648 3300032002 Bacteria 2896
426 Ga0307411_10010509 3300032005 Bacteria 4939
427 Ga0307415_100090684 3300032126 Bacteria 2212
428 Ga0307415_100139537 3300032126 Bacteria 1849
429 Ga0316583_10028218 3300032133 Bacteria 2002
430 Ga0316585_10000956 3300032137 Bacteria 7410
431 Ga0316580_10022804 3300032139 Bacteria 1932
432 Ga0316593_10000472 3300032168 Bacteria 7413
433 Ga0316593_10003014 3300032168 Bacteria 4104
434 Ga0316593_10031252 3300032168 Bacteria 1734
435 Ga0307510_10000013 3300033180 Bacteria 274569
436 Ga0307510_10010455 3300033180 Bacteria 11024
437 Ga0316592_1000192 3300033524 Bacteria 7310
438 Ga0316596_1000369 3300033541 Bacteria 7411
439 Ga0316596_1002070 3300033541 Bacteria 4227
440 Ga0373936_0015718 3300035113 Bacteria 2902
441 Ga0316574_0007763 3300035398 Bacteria 5905
442 Ga0316574_0021798 3300035398 Bacteria 3807
443 Ga0316574_0023127 3300035398 Bacteria 3708
444 Ga0316582_0017047 3300036647 Bacteria 4191
445 Ga0316582_0033533 3300036647 Bacteria 3155
446 Ga0316584_0005374 3300036712 Bacteria 8593
447 Ga0316584_0029740 3300036712 Bacteria 4033
448 Ga0395899_0000128 3300037312 Bacteria 119014
449 Ga0395899_0000904 3300037312 Bacteria 27911
450 Ga0395899_0002101 3300037312 Bacteria 16364
451 Ga0395899_0036149 3300037312 Bacteria 3706
452 Ga0395900_0000874 3300037418 Bacteria 39520
453 Ga0395900_0036284 3300037418 Bacteria 5082
454 Ga0395900_0050571 3300037418 Bacteria 4280
455 Ga0395900_0062747 3300037418 Bacteria 3819
456 Ga0395900_0163739 3300037418 Bacteria 2267
457 Ga0395900_0322603 3300037418 Bacteria 1524
458 Ga0395898_0003704 3300037466 Bacteria 16960
459 Ga0395898_0039391 3300037466 Bacteria 4677
460 Ga0395898_0154334 3300037466 Bacteria 2196
461 Ga0395898_0157087 3300037466 Bacteria 2175
462 Ga0395898_0160048 3300037466 Bacteria 2153
463 Ga0395898_0207310 3300037466 Bacteria 1870
464 Ga0395905_0009571 3300037471 Bacteria 9461
465 Ga0395905_0010272 3300037471 Bacteria 9114
466 Ga0395905_0075118 3300037471 Bacteria 3167
467 Ga0395905_0242584 3300037471 Bacteria 1684
468 Ga0395905_0295595 3300037471 Bacteria 1506
469 Ga0395901_0000054 3300038443 Bacteria 160505
470 Ga0395901_0003565 3300038443 Bacteria 15697
471 Ga0395901_0127852 3300038443 Bacteria 2671
472 Ga0395901_0155312 3300038443 Bacteria 2403
473 Ga0395901_0426283 3300038443 Bacteria 1359
474 Ga0400484_03261 3300038725 Bacteria 37196
475 Ga0400484_07350 3300038725 Bacteria 7933
476 Ga0400490_20091 3300038726 Bacteria 9857
477 Ga0400490_21770 3300038726 Bacteria 5517
478 Ga0400490_45662 3300038726 Bacteria 38225
479 Ga0400490_51771 3300038726 Bacteria 2053
480 Ga0400491_10244 3300038727 Bacteria 3893
481 Ga0400491_16906 3300038727 Bacteria 2081
482 Ga0400488_04816 3300038741 Bacteria 1117
483 Ga0400488_18372 3300038741 Bacteria 11596
484 Ga0400488_23615 3300038741 Bacteria 4654
485 Ga0400488_31619 3300038741 Bacteria 1531
486 Ga0400488_40478 3300038741 Bacteria 1121
487 Ga0400486_10786 3300038742 Bacteria 2942
488 Ga0400483_044439 3300039062 Bacteria 12231
489 Ga0400483_048826 3300039062 Bacteria 15631
490 Ga0400483_163381 3300039062 Bacteria 10819
491 Ga0400487_26214 3300039110 Bacteria 1642
492 Ga0400487_41427 3300039110 Bacteria 4185
493 Ga0400487_47735 3300039110 Bacteria 59107
494 Ga0400487_51105 3300039110 Bacteria 2410
495 Ga0400487_51635 3300039110 Bacteria 1751
496 Ga0436361_0080172 3300039447 Bacteria 39325
497 Ga0436361_0119299 3300039447 Bacteria 18398
498 Ga0436361_0837724 3300039447 Bacteria 3222
499 Ga0436361_0944997 3300039447 Bacteria 6398
500 Ga0436363_0672559 3300039450 Bacteria 12181
501 Ga0436363_1199362 3300039450 Bacteria 5411
502 Ga0436362_0176928 3300039453 Bacteria 3764
503 Ga0451787_573112 3300041441 Bacteria 2089
504 Ga0451789_1220021 3300041443 Bacteria 1111
505 Ga0451793_0865321 3300041452 Bacteria 1749
506 Ga0451795_0279517 3300041456 Bacteria 1210
507 Ga0451807_1281246 3300041486 Bacteria 2974
508 Ga0451853_3198134 3300041512 Bacteria 1950
509 Ga0439448_0003707 3300042005 Bacteria 4256
510 Ga0439448_0045297 3300042005 Bacteria 1431
511 Ga0439450_024169 3300042008 Bacteria 1323
512 Ga0439450_039179 3300042008 Bacteria 1094
513 Ga0450904_001557 3300042139 Bacteria 3131
514 Ga0439458_0001531 3300042157 Bacteria 5778
515 Ga0451577_0097310 3300042876 Bacteria 2628
516 Ga0451577_0104243 3300042876 Bacteria 2535
517 Ga0466969_0015826 3300044656 Bacteria 3953
518 Ga0466972_0002881 3300044658 Bacteria 8512
519 Ga0453683_0068607 3300044673 Bacteria 2217
520 Ga0466965_0014133 3300044683 Bacteria 3776
521 Ga0466965_0016917 3300044683 Bacteria 3478
522 Ga0466965_0043666 3300044683 Bacteria 2213
523 Ga0466966_0005305 3300044684 Bacteria 8476
524 Ga0466966_0033545 3300044684 Bacteria 3324
525 Ga0466966_0221696 3300044684 Bacteria 1141
526 Ga0466966_0239292 3300044684 Bacteria 1094
527 Ga0466961_0124576 3300044693 Bacteria 1617
528 Ga0466964_0001227 3300044706 Bacteria 8693
529 Ga0466964_0001931 3300044706 Bacteria 7257
530 Ga0466971_0010136 3300044719 Bacteria 4115
531 Ga0466971_0132277 3300044719 Bacteria 1158
532 Ga0466968_0001801 3300044735 Bacteria 7739
533 Ga0466968_0099409 3300044735 Bacteria 1297
534 Ga0466957_0046829 3300044842 Bacteria 2626
535 Ga0466957_0159888 3300044842 Bacteria 1462
536 Ga0466960_0126220 3300044901 Bacteria 1345
537 Ga0466959_0045778 3300045049 Bacteria 3221
538 Ga0466959_0080319 3300045049 Bacteria 2351
539 Ga0466959_0145988 3300045049 Bacteria 1669
540 Ga0451576_0000250 3300045051 Bacteria 132101
541 Ga0466958_0075060 3300045836 Bacteria 2073
542 Ga0495617_000057 3300046452 Bacteria 100673
543 Ga0495617_000303 3300046452 Bacteria 27779
544 Ga0495617_046083 3300046452 Bacteria 1453
545 Ga0495627_001817 3300046453 Bacteria 11358
546 Ga0495627_006174 3300046453 Bacteria 4721
547 Ga0495592_0046495 3300046454 Bacteria 3235
548 Ga0495603_0086608 3300046455 Bacteria 1833
549 Ga0495590_0000018 3300046457 Bacteria 216375
550 Ga0495590_0002149 3300046457 Bacteria 8279
551 Ga0495590_0002928 3300046457 Bacteria 7024
552 Ga0495590_0058050 3300046457 Bacteria 1353
553 Ga0495591_012498 3300046458 Bacteria 3159
554 Ga0495591_019841 3300046458 Bacteria 2238
555 Ga0495629_0132375 3300046459 Bacteria 1737
556 Ga0495638_0010108 3300046460 Bacteria 6574
557 Ga0495638_0027791 3300046460 Bacteria 3659
558 Ga0495638_0048144 3300046460 Bacteria 2669
559 Ga0495638_0112870 3300046460 Bacteria 1613
560 Ga0495651_0028201 3300046462 Bacteria 4375
561 Ga0495651_0100413 3300046462 Bacteria 2155
562 Ga0495653_0028643 3300046463 Bacteria 4452
563 Ga0495653_0078585 3300046463 Bacteria 2446
564 Ga0495650_0000108 3300046471 Bacteria 200369
565 Ga0495650_0000140 3300046471 Bacteria 169317
566 Ga0495650_0032139 3300046471 Bacteria 2351
567 Ga0495605_0000416 3300046474 Bacteria 38811
568 Ga0495605_0000438 3300046474 Bacteria 37563
569 Ga0495605_0003370 3300046474 Bacteria 9538
570 Ga0495605_0011441 3300046474 Bacteria 4944
571 Ga0495605_0027851 3300046474 Bacteria 2923
572 Ga0495605_0029379 3300046474 Bacteria 2829
573 Ga0495605_0041158 3300046474 Bacteria 2302
574 Ga0495605_0045539 3300046474 Bacteria 2161
575 Ga0495605_0124866 3300046474 Bacteria 1164
576 Ga0495584_0000006 3300046491 Bacteria 301775
577 Ga0495584_0000281 3300046491 Bacteria 35857
578 Ga0495584_0009627 3300046491 Bacteria 4976
579 Ga0495584_0013652 3300046491 Bacteria 4143
580 Ga0495584_0033622 3300046491 Bacteria 2594
581 Ga0495584_0036504 3300046491 Bacteria 2483
582 Ga0495584_0043266 3300046491 Bacteria 2273
583 Ga0495584_0171850 3300046491 Bacteria 1101
584 Ga0495585_0000193 3300046492 Bacteria 63937
585 Ga0495585_0000515 3300046492 Bacteria 36553
586 Ga0495585_0002529 3300046492 Bacteria 12997
587 Ga0495585_0003683 3300046492 Bacteria 10243
588 Ga0495585_0005187 3300046492 Bacteria 8261
589 Ga0495585_0007454 3300046492 Bacteria 6694
590 Ga0495585_0014980 3300046492 Bacteria 4508
591 Ga0495585_0038339 3300046492 Bacteria 2697
592 Ga0495585_0064979 3300046492 Bacteria 1999
593 Ga0495585_0065111 3300046492 Bacteria 1997
594 Ga0495585_0065981 3300046492 Bacteria 1982
595 Ga0495585_0115949 3300046492 Bacteria 1420
596 Ga0495594_0039206 3300046499 Bacteria 2589
597 Ga0495594_0206510 3300046499 Bacteria 1119
598 Ga0495596_0001089 3300046500 Bacteria 16084
599 Ga0495596_0001435 3300046500 Bacteria 13653
600 Ga0495596_0001794 3300046500 Bacteria 11945
601 Ga0495596_0007906 3300046500 Bacteria 4763
602 Ga0495596_0011978 3300046500 Bacteria 3722
603 Ga0495596_0012711 3300046500 Bacteria 3594
604 Ga0495596_0020949 3300046500 Bacteria 2672
605 Ga0495596_0023469 3300046500 Bacteria 2502
606 Ga0495596_0023665 3300046500 Bacteria 2491
607 Ga0495596_0052210 3300046500 Bacteria 1600
608 Ga0495596_0053292 3300046500 Bacteria 1583
609 Ga0495596_0057895 3300046500 Bacteria 1511
610 Ga0495607_0003330 3300046501 Bacteria 12335
611 Ga0495607_0011000 3300046501 Bacteria 6048
612 Ga0495607_0019846 3300046501 Bacteria 4261
613 Ga0495607_0025658 3300046501 Bacteria 3663
614 Ga0495607_0031999 3300046501 Bacteria 3216
615 Ga0495607_0050509 3300046501 Bacteria 2420
616 Ga0495607_0069694 3300046501 Bacteria 1967
617 Ga0495583_0003816 3300046506 Bacteria 11182
618 Ga0495583_0012109 3300046506 Bacteria 4905
619 Ga0495583_0014101 3300046506 Bacteria 4422
620 Ga0495583_0020486 3300046506 Bacteria 3425
621 Ga0495583_0029563 3300046506 Bacteria 2679
622 Ga0495583_0032217 3300046506 Bacteria 2531
623 Ga0495583_0032488 3300046506 Bacteria 2519
624 Ga0495583_0037057 3300046506 Bacteria 2314
625 Ga0495583_0059784 3300046506 Bacteria 1706
626 Ga0495583_0164587 3300046506 Bacteria 913
627 Ga0495606_0006986 3300046507 Bacteria 10256
628 Ga0495606_0011967 3300046507 Bacteria 7010
629 Ga0495606_0027851 3300046507 Bacteria 3997
630 Ga0495606_0086107 3300046507 Bacteria 1942
631 Ga0495606_0113794 3300046507 Bacteria 1628
632 Ga0495608_0041553 3300046511 Bacteria 3076
633 Ga0495610_0002329 3300046512 Bacteria 16055
634 Ga0495616_0000662 3300046513 Bacteria 25597
635 Ga0495616_0002246 3300046513 Bacteria 12914
636 Ga0495616_0002684 3300046513 Bacteria 11663
637 Ga0495616_0003012 3300046513 Bacteria 10933
638 Ga0495616_0004448 3300046513 Bacteria 8829
639 Ga0495616_0013824 3300046513 Bacteria 4538
640 Ga0495616_0018343 3300046513 Bacteria 3842
641 Ga0495616_0026851 3300046513 Bacteria 3058
642 Ga0495616_0033272 3300046513 Bacteria 2687
643 Ga0495616_0034518 3300046513 Bacteria 2627
644 Ga0495616_0057056 3300046513 Bacteria 1926
645 Ga0495616_0068379 3300046513 Bacteria 1724
646 Ga0495616_0111702 3300046513 Bacteria 1269
647 Ga0495620_0004669 3300046515 Bacteria 7698
648 Ga0495628_0004565 3300046516 Bacteria 12256
649 Ga0495630_0084205 3300046517 Bacteria 2401
650 Ga0495631_0000632 3300046518 Bacteria 23007
651 Ga0495631_0001483 3300046518 Bacteria 14222
652 Ga0495631_0002977 3300046518 Bacteria 9377
653 Ga0495631_0007116 3300046518 Bacteria 5717
654 Ga0495631_0011740 3300046518 Bacteria 4297
655 Ga0495631_0016053 3300046518 Bacteria 3577
656 Ga0495631_0018121 3300046518 Bacteria 3318
657 Ga0495631_0041077 3300046518 Bacteria 2047
658 Ga0495631_0042382 3300046518 Bacteria 2011
659 Ga0495631_0052764 3300046518 Bacteria 1775
660 Ga0495632_0000214 3300046519 Bacteria 58439
661 Ga0495632_0000364 3300046519 Bacteria 43040
662 Ga0495632_0003852 3300046519 Bacteria 10434
663 Ga0495632_0009850 3300046519 Bacteria 5716
664 Ga0495632_0011405 3300046519 Bacteria 5187
665 Ga0495632_0014316 3300046519 Bacteria 4490
666 Ga0495632_0015456 3300046519 Bacteria 4278
667 Ga0495632_0026674 3300046519 Bacteria 3038
668 Ga0495632_0027244 3300046519 Bacteria 2995
669 Ga0495632_0052634 3300046519 Bacteria 2001
670 Ga0495632_0056759 3300046519 Bacteria 1913
671 Ga0495632_0056879 3300046519 Bacteria 1911
672 Ga0495632_0087379 3300046519 Bacteria 1482
673 Ga0495637_0000612 3300046520 Bacteria 25396
674 Ga0495643_0000141 3300046522 Bacteria 115660
675 Ga0495643_0004483 3300046522 Bacteria 9748
676 Ga0495643_0019252 3300046522 Bacteria 3952
677 Ga0495643_0021003 3300046522 Bacteria 3753
678 Ga0495643_0032721 3300046522 Bacteria 2883
679 Ga0495643_0043697 3300046522 Bacteria 2437
680 Ga0495643_0061065 3300046522 Bacteria 1999
681 Ga0495643_0120803 3300046522 Bacteria 1324
682 Ga0495644_0002371 3300046523 Bacteria 7511
683 Ga0495644_0005317 3300046523 Bacteria 5028
684 Ga0495644_0007533 3300046523 Bacteria 4196
685 Ga0495644_0025164 3300046523 Bacteria 2260
686 Ga0495644_0030060 3300046523 Bacteria 2051
687 Ga0495648_0000109 3300046524 Bacteria 101519
688 Ga0495648_0004137 3300046524 Bacteria 12482
689 Ga0495648_0019039 3300046524 Bacteria 4841
690 Ga0495666_0012627 3300046526 Bacteria 4210
691 Ga0495642_0000741 3300046528 Bacteria 16179
692 Ga0495642_0001464 3300046528 Bacteria 10572
693 Ga0495642_0007631 3300046528 Bacteria 4147
694 Ga0495642_0013970 3300046528 Bacteria 3110
695 Ga0495642_0037500 3300046528 Bacteria 1961
696 Ga0495642_0054460 3300046528 Bacteria 1649
697 Ga0495642_0065860 3300046528 Bacteria 1509
698 Ga0495652_0012068 3300046529 Bacteria 7808
699 Ga0495652_0040085 3300046529 Bacteria 4048
700 Ga0495654_0047746 3300046530 Bacteria 2103
701 Ga0495654_0048172 3300046530 Bacteria 2092
702 Ga0495654_0059366 3300046530 Bacteria 1842
703 Ga0495654_0094487 3300046530 Bacteria 1383
704 Ga0495665_0019053 3300046531 Bacteria 3688
705 Ga0495665_0026571 3300046531 Bacteria 3109
706 Ga0495665_0030666 3300046531 Bacteria 2878
707 Ga0495586_0142085 3300046535 Bacteria 1347
708 Ga0495598_0022846 3300046537 Bacteria 1677
709 Ga0495609_0000009 3300046538 Bacteria 354860
710 Ga0495609_0001562 3300046538 Bacteria 14985
711 Ga0495609_0006657 3300046538 Bacteria 5864
712 Ga0495609_0018010 3300046538 Bacteria 3276
713 Ga0495609_0020796 3300046538 Bacteria 3029
714 Ga0495609_0037586 3300046538 Bacteria 2183
715 Ga0495609_0049452 3300046538 Bacteria 1876
716 Ga0495609_0049544 3300046538 Bacteria 1874
717 Ga0495609_0114655 3300046538 Bacteria 1161
718 Ga0495597_0002044 3300046542 Bacteria 13485
719 Ga0495597_0003097 3300046542 Bacteria 10004
720 Ga0495597_0014117 3300046542 Bacteria 3808
721 Ga0495597_0042966 3300046542 Bacteria 2013
722 Ga0495645_0027376 3300046543 Bacteria 4142
723 Ga0495622_0038097 3300046557 Bacteria 2238
724 Ga0495622_0049436 3300046557 Bacteria 1952
725 Ga0495633_0006086 3300046558 Bacteria 7228
726 Ga0495633_0007030 3300046558 Bacteria 6559
727 Ga0495633_0007058 3300046558 Bacteria 6539
728 Ga0495633_0026986 3300046558 Bacteria 2811
729 Ga0495633_0088992 3300046558 Bacteria 1435
730 Ga0495656_0022919 3300046615 Bacteria 2451
731 Ga0495656_0053279 3300046615 Bacteria 1738
732 Ga0495668_0003200 3300046616 Bacteria 12527
733 Ga0495668_0003639 3300046616 Bacteria 11407
734 Ga0495668_0015431 3300046616 Bacteria 4461
735 Ga0495668_0016287 3300046616 Bacteria 4320
736 Ga0495668_0020369 3300046616 Bacteria 3815
737 Ga0495668_0051043 3300046616 Bacteria 2290
738 Ga0495668_0114115 3300046616 Bacteria 1477
739 Ga0495634_0201412 3300046642 Bacteria 1236
740 Ga0495611_0000499 3300046648 Bacteria 23354
741 Ga0495611_0002457 3300046648 Bacteria 8460
742 Ga0495611_0019231 3300046648 Bacteria 2933
743 Ga0495611_0019315 3300046648 Bacteria 2926
744 Ga0495611_0024956 3300046648 Bacteria 2602
745 Ga0495611_0026413 3300046648 Bacteria 2533
746 Ga0495611_0031348 3300046648 Bacteria 2339
747 Ga0495625_0032776 3300046660 Bacteria 3848
748 Ga0495625_0063609 3300046660 Bacteria 2605
749 Ga0495625_0066343 3300046660 Bacteria 2542
750 Ga0495625_0124604 3300046660 Bacteria 1750
751 Ga0495625_0178631 3300046660 Bacteria 1413
752 Ga0495635_0002454 3300046663 Bacteria 12659
753 Ga0495661_0001929 3300046665 Bacteria 16505
754 Ga0495661_0007429 3300046665 Bacteria 7642
755 Ga0495661_0012238 3300046665 Bacteria 5795
756 Ga0495661_0013191 3300046665 Bacteria 5556
757 Ga0495661_0027110 3300046665 Bacteria 3680
758 Ga0495661_0035807 3300046665 Bacteria 3112
759 Ga0495661_0064902 3300046665 Bacteria 2152
760 Ga0495661_0065409 3300046665 Bacteria 2142
761 Ga0495661_0071191 3300046665 Bacteria 2032
762 Ga0495661_0075659 3300046665 Bacteria 1956
763 Ga0495661_0153789 3300046665 Bacteria 1240
764 Ga0495661_0171609 3300046665 Bacteria 1156
765 Ga0495588_0000077 3300046674 Bacteria 215338
766 Ga0495588_0010399 3300046674 Bacteria 4328
767 Ga0495588_0012275 3300046674 Bacteria 4043
768 Ga0495588_0027405 3300046674 Bacteria 2847
769 Ga0495588_0031167 3300046674 Bacteria 2682
770 Ga0495588_0055912 3300046674 Bacteria 2037
771 Ga0495588_0067940 3300046674 Bacteria 1850
772 Ga0495657_0073728 3300046675 Bacteria 2222
773 Ga0495599_0004944 3300046678 Bacteria 7925
774 Ga0495623_0011364 3300046679 Bacteria 5760
775 Ga0495646_0012052 3300046680 Bacteria 5499
776 Ga0495669_0000116 3300046684 Bacteria 51756
777 Ga0495669_0007431 3300046684 Bacteria 4595
778 Ga0495669_0011905 3300046684 Bacteria 3699
779 Ga0495669_0030253 3300046684 Bacteria 2377
780 Ga0495624_0300210 3300046690 Bacteria 968
781 Ga0495670_0001273 3300046691 Bacteria 12311
782 Ga0495670_0005019 3300046691 Bacteria 6507
783 Ga0495670_0007909 3300046691 Bacteria 5227
784 Ga0495670_0016363 3300046691 Bacteria 3644
785 Ga0495670_0041425 3300046691 Bacteria 2298
786 Ga0495670_0049421 3300046691 Bacteria 2104
787 Ga0495670_0072508 3300046691 Bacteria 1744
788 Ga0495671_0002689 3300046692 Bacteria 11143
789 Ga0495671_0016637 3300046692 Bacteria 3924
790 Ga0495649_0003311 3300046694 Bacteria 10948
791 Ga0495649_0003561 3300046694 Bacteria 10460
792 Ga0495649_0011717 3300046694 Bacteria 5131
793 Ga0495649_0057116 3300046694 Bacteria 2105
794 Ga0495649_0082868 3300046694 Bacteria 1713
795 Ga0495589_0001060 3300046794 Bacteria 16526
796 Ga0495589_0007613 3300046794 Bacteria 5673
797 Ga0495589_0013208 3300046794 Bacteria 4261
798 Ga0495589_0017044 3300046794 Bacteria 3730
799 Ga0495589_0019655 3300046794 Bacteria 3458
800 Ga0495660_0000178 3300046810 Bacteria 68956
801 Ga0495660_0010952 3300046810 Bacteria 5271
802 Ga0495660_0020825 3300046810 Bacteria 3759
803 Ga0495660_0070404 3300046810 Bacteria 1856
804 Ga0495660_0070610 3300046810 Bacteria 1853
805 Ga0495660_0108124 3300046810 Bacteria 1422
806 Ga0495660_0117839 3300046810 Bacteria 1347
807 Ga0495604_0027131 3300047317 Bacteria 4556
808 Ga0495672_0000033 3300047320 Bacteria 291992
809 Ga0495672_0000437 3300047320 Bacteria 49739
810 Ga0495672_0001623 3300047320 Bacteria 21897
811 Ga0495672_0009440 3300047320 Bacteria 7068
812 Ga0495672_0010123 3300047320 Bacteria 6744
813 Ga0495672_0072525 3300047320 Bacteria 1944
814 Ga0495676_0000121 3300047321 Bacteria 59949
815 Ga0495676_0049524 3300047321 Bacteria 3377
816 Ga0495680_0007548 3300047322 Bacteria 9946
817 Ga0495683_0000182 3300047323 Bacteria 61818
818 Ga0495683_0001151 3300047323 Bacteria 18144
819 Ga0495683_0011839 3300047323 Bacteria 4586
820 Ga0495683_0018583 3300047323 Bacteria 3591
821 Ga0495683_0020136 3300047323 Bacteria 3443
822 Ga0495683_0020827 3300047323 Bacteria 3380
823 Ga0495687_000002 3300047443 Bacteria 1085770
824 Ga0495687_000017 3300047443 Bacteria 350429
825 Ga0495687_000024 3300047443 Bacteria 316676
826 Ga0495687_000458 3300047443 Bacteria 49855
827 Ga0495687_013931 3300047443 Bacteria 4166
828 Ga0495687_014022 3300047443 Bacteria 4147
829 Ga0495675_0016790 3300047444 Bacteria 4629
830 Ga0495677_0000117 3300047445 Bacteria 38586
831 Ga0495677_0003340 3300047445 Bacteria 6242
832 Ga0495677_0004846 3300047445 Bacteria 5132
833 Ga0495677_0005027 3300047445 Bacteria 5043
834 Ga0495677_0005223 3300047445 Bacteria 4938
835 Ga0495677_0008846 3300047445 Bacteria 3729
836 Ga0495677_0010361 3300047445 Bacteria 3425
837 Ga0495677_0017662 3300047445 Bacteria 2585
838 Ga0495677_0026283 3300047445 Bacteria 2111
839 Ga0495677_0027824 3300047445 Bacteria 2052
840 Ga0495677_0028764 3300047445 Bacteria 2020
841 Ga0495677_0029631 3300047445 Bacteria 1990
842 Ga0495679_003474 3300047446 Bacteria 7557
843 Ga0495679_004009 3300047446 Bacteria 6926
844 Ga0495679_013040 3300047446 Bacteria 3136
845 Ga0495685_004997 3300047447 Bacteria 4313
846 Ga0495681_0000994 3300047470 Bacteria 21702
847 Ga0495681_0012084 3300047470 Bacteria 5090
848 Ga0495681_0014560 3300047470 Bacteria 4497
849 Ga0495681_0023578 3300047470 Bacteria 3265
850 Ga0495681_0031695 3300047470 Bacteria 2671
851 Ga0495681_0058051 3300047470 Bacteria 1795
852 Ga0495686_0000591 3300047472 Bacteria 50934
853 Ga0495686_0001614 3300047472 Bacteria 23675
854 Ga0495686_0082989 3300047472 Bacteria 1955
855 Ga0495593_0088157 3300047673 Bacteria 1599
856 Ga0495593_0117865 3300047673 Bacteria 1352
857 Ga0495602_0077771 3300048088 Bacteria 2805
858 Ga0495614_0004132 3300048089 Bacteria 6536
859 Ga0495626_0000004 3300048091 Bacteria 356599
860 Ga0495626_0000016 3300048091 Bacteria 232214
861 Ga0495626_0000693 3300048091 Bacteria 32187
862 Ga0495626_0006971 3300048091 Bacteria 6359
863 Ga0495626_0012875 3300048091 Bacteria 4366
864 Ga0495626_0015332 3300048091 Bacteria 3927
865 Ga0495626_0030305 3300048091 Bacteria 2609
866 Ga0495626_0035415 3300048091 Bacteria 2382
867 Ga0495626_0042550 3300048091 Bacteria 2133
868 Ga0495626_0042772 3300048091 Bacteria 2127
869 Ga0495626_0079806 3300048091 Bacteria 1455
870 Ga0496101_0100541 3300048904 Bacteria 2163
871 Ga0496102_0000340 3300048905 Bacteria 57233
872 Ga0496102_0031296 3300048905 Bacteria 4772
873 Ga0496102_0039013 3300048905 Bacteria 4289
874 Ga0496102_0073083 3300048905 Bacteria 3152
875 Ga0496102_0189580 3300048905 Bacteria 1937
876 Ga0496102_0285842 3300048905 Bacteria 1554
877 Ga0496103_0013246 3300048906 Bacteria 4888
878 Ga0496103_0097970 3300048906 Unclassified 1854
879 Ga0496103_0201425 3300048906 Bacteria 1280
880 Ga0496106_0239107 3300048909 Bacteria 1451
881 Ga0496107_0007412 3300048910 Bacteria 7562
882 Ga0496108_0019844 3300048911 Bacteria 5522
883 Ga0496109_0005210 3300048912 Bacteria 10861
884 Ga0496109_0102982 3300048912 Bacteria 2649
885 Ga0496110_0004929 3300048913 Bacteria 10425
886 Ga0496111_0152130 3300048914 Bacteria 1716
887 Ga0496112_0020372 3300048915 Bacteria 6287
888 Ga0496112_0321442 3300048915 Bacteria 1492
889 Ga0496113_0023519 3300048916 Bacteria 4369
890 Ga0496113_0176820 3300048916 Bacteria 1691
891 Ga0496113_0347407 3300048916 Bacteria 1190
892 Ga0496115_0143915 3300048918 Bacteria 1967
893 Ga0496116_0046354 3300048919 Bacteria 2934
894 Ga0496117_0000057 3300048920 Bacteria 268246
895 Ga0496118_0000028 3300048921 Bacteria 366490
896 Ga0496119_0005745 3300048922 Bacteria 11760
897 Ga0496119_0009417 3300048922 Bacteria 8387
898 Ga0496120_0007468 3300048923 Bacteria 8123
899 Ga0496120_0014995 3300048923 Bacteria 5132
900 Ga0496120_0056979 3300048923 Bacteria 2202
901 Ga0496121_0001295 3300048924 Bacteria 43040
902 Ga0496121_0029970 3300048924 Bacteria 5010
903 Ga0496121_0046034 3300048924 Bacteria 3739
904 Ga0496121_0095309 3300048924 Bacteria 2313
905 Ga0496121_0204670 3300048924 Bacteria 1403
906 Ga0496122_0009237 3300048925 Bacteria 10432
907 Ga0496122_0009551 3300048925 Bacteria 10188
908 Ga0496122_0090290 3300048925 Bacteria 2091
909 Ga0496123_0026217 3300048926 Bacteria 4373
910 Ga0496123_0042315 3300048926 Bacteria 3145
911 Ga0496123_0093738 3300048926 Bacteria 1772
912 Ga0496124_0002724 3300048927 Bacteria 22533
913 Ga0496124_0003292 3300048927 Bacteria 19912
914 Ga0496124_0012916 3300048927 Bacteria 8193
915 Ga0496124_0035599 3300048927 Bacteria 4354
916 Ga0496124_0056406 3300048927 Bacteria 3313
917 Ga0496124_0091173 3300048927 Bacteria 2484
918 Ga0496125_0011721 3300048928 Bacteria 8738
919 Ga0496125_0013698 3300048928 Bacteria 7956
920 Ga0496125_0059832 3300048928 Bacteria 3066
921 Ga0496125_0103905 3300048928 Bacteria 2083
922 Ga0496125_0203493 3300048928 Bacteria 1293
923 Ga0496126_0038970 3300048929 Bacteria 4416
924 Ga0496126_0068887 3300048929 Bacteria 3157
925 Ga0496126_0097557 3300048929 Bacteria 2575
926 Ga0501308_000102 3300049128 Bacteria 3985
927 Ga0501304_000184 3300049160 Bacteria 2688
928 Ga0495678_000275 3300049459 Bacteria 56673
929 Ga0495678_000746 3300049459 Bacteria 29508
930 Ga0495678_001983 3300049459 Bacteria 14748
931 Ga0495678_002319 3300049459 Bacteria 13113
932 Ga0495678_004447 3300049459 Bacteria 8101
933 Ga0495678_014319 3300049459 Bacteria 3691
934 Ga0495682_0002099 3300049460 Bacteria 9711
935 Ga0495682_0017114 3300049460 Bacteria 2740
936 Ga0495682_0019757 3300049460 Bacteria 2531
937 Ga0495682_0027473 3300049460 Bacteria 2110
938 Ga0495682_0074150 3300049460 Bacteria 1224
939 Ga0501033_0361474 3300049570 Bacteria 1016
940 Ga0501037_0008788 3300049573 Bacteria 7408
941 Ga0501037_0013697 3300049573 Bacteria 5975
942 Ga0501039_0030179 3300049575 Bacteria 4179
943 Ga0501040_0049070 3300049576 Bacteria 2886
944 Ga0501046_0012173 3300049580 Bacteria 7334
945 Ga0501047_0098639 3300049581 Bacteria 2800
946 Ga0501048_0286988 3300049582 Bacteria 1170
947 Ga0501067_0003287 3300049583 Bacteria 8901
948 Ga0501068_0000097 3300049584 Bacteria 37675
949 Ga0501069_0020201 3300049585 Bacteria 3607
950 Ga0501070_0003050 3300049586 Bacteria 14588
951 Ga0501070_0008303 3300049586 Bacteria 8776
952 Ga0501070_0015322 3300049586 Bacteria 6450
953 Ga0501070_0134521 3300049586 Bacteria 2041
954 Ga0501071_0068445 3300049587 Bacteria 2583
955 Ga0501072_0028213 3300049588 Bacteria 4382
956 Ga0501073_0000086 3300049589 Bacteria 59101
957 Ga0501074_0028123 3300049590 Bacteria 4074
958 Ga0501074_0057987 3300049590 Bacteria 2789
959 Ga0501075_0319129 3300049591 Bacteria 1184
960 Ga0501076_0061458 3300049592 Bacteria 2989
961 Ga0501077_0001839 3300049593 Bacteria 12841
962 Ga0501079_0000201 3300049741 Bacteria 34664
963 Ga0501080_0001101 3300049742 Bacteria 22270
964 Ga0501080_0003269 3300049742 Bacteria 14304
965 Ga0501081_0244740 3300049743 Bacteria 1308
966 Ga0501083_0001294 3300049744 Bacteria 16922
967 Ga0501035_0004380 3300049822 Bacteria 13405
968 Ga0501044_0001746 3300049823 Bacteria 25368
969 nmdc:mga03683_150182_c1 3300050489 Bacteria 1051
970 nmdc:mga07m45_124896_c1 3300050496 Bacteria 1488
971 nmdc:mga0qj67_232795_c1 3300050509 Bacteria 1495
972 nmdc:mga0qj67_7557_c1 3300050509 Bacteria 8031
973 nmdc:mga06r32_166393_c1 3300050510 Bacteria 2188
974 nmdc:mga06r32_34635_c1 3300050510 Bacteria 4763
975 Ga0500646_0031268 3300053090 Bacteria 1465
976 Ga0500583_0001580 3300053092 Bacteria 6603
977 Ga0500583_0015022 3300053092 Bacteria 3052
978 Ga0500583_0020890 3300053092 Bacteria 2712
979 Ga0500640_090446 3300053095 Bacteria 1283
980 Ga0500650_0000034 3300053098 Bacteria 52582
981 Ga0500556_0000374 3300053104 Bacteria 32602
982 Ga0500642_0195462 3300053130 Bacteria 943
983 Ga0500658_0104505 3300053134 Bacteria 1240
984 Ga0500568_0004577 3300053139 Bacteria 7367
985 Ga0500616_0000016 3300053153 Bacteria 627087
986 Ga0500633_0115889 3300053160 Bacteria 995
987 Ga0500637_0003857 3300053178 Bacteria 6988
988 Ga0500637_0040698 3300053178 Bacteria 2626
989 Ga0501084_0001279 3300054114 Bacteria 19817
990 Ga0501084_0182396 3300054114 Bacteria 1772
991 Ga0587067_002624 3300059640 Bacteria 2157
992 Ga0466962_0108370 3300061719 Bacteria 1336
993 2511250642 2511231003 Bacteria 5606035
994 2511384950 2511231026 Bacteria 5225445
995 2547373081 2547132103 Bacteria 5115736
996 2643802366 2643221556 Bacteria 7251154
997 2644030670 2643221603 Bacteria 6147767
998 2644475879 2643221684 Bacteria 7145183
999 2765569009 2765235838 Bacteria 5445269
1000 2809145418 2808606418 Bacteria 6724496
1001 2819542543 2818991436 Bacteria 5376622
1002 2839096106 2839094727 Bacteria 5534556
1003 2843691967 2843690924 Bacteria 5169057
1004 2846040439 2846037992 Bacteria 4526407
1005 8001526377 8001522603 Bacteria 4726425
1006 8047673771 8047673197 Bacteria 7395230
1007 8054360169 8054357960 Bacteria 2867777
1008 Ga0157369_10019811
1009 JGI25156J39149_1004435
1010 JGI25162J39368_1000036
1011 JGI25154J39366_1002733
1012 JGI25150J39212_1005125
1013 JGI25165J46597_1000022
1014 rootL2_10014064
1015 rootL2_10091680
1016 Ga0007410J51695_1012750
1017 Ga0007409J51694_1006362
1018 Ga0007416J51690_1012585
1019 Ga0032354_1023937
1020 Ga0055538_1000011
1021 Ga0055539_1000016
1022 Ga0055533_1000019
1023 Ga0055525_1000001
1024 Ga0055525_1000042
1025 Ga0055542_1010239
1026 Ga0055541_1000017
1027 Ga0065707_10082492
1028 Ga0070676_10102203
1029 Ga0070683_100016811
1030 Ga0070670_100000001
1031 Ga0070670_100025491
1032 Ga0070670_100127161
1033 Ga0068869_100040075
1034 Ga0068869_100087511
1035 Ga0068869_100182469
1036 Ga0068869_100450708
1037 Ga0070666_10015694
1038 Ga0070666_10036180
1039 Ga0070666_10049131
1040 Ga0070680_100026542
1041 Ga0070680_100085042
1042 Ga0070682_100003924
1043 Ga0070660_100014318
1044 Ga0070660_100041122
1045 Ga0070689_100008006
1046 Ga0070689_100016914
1047 Ga0070687_100160380
1048 Ga0070661_100000813
1049 Ga0070661_100036959
1050 Ga0070661_100175855
1051 Ga0070668_100023143
1052 Ga0070669_100046626
1053 Ga0070669_100164633
1054 Ga0070675_100024523
1055 Ga0070675_100031692
1056 Ga0070675_100057275
1057 Ga0070675_100177229
1058 Ga0070671_100000018
1059 Ga0070671_100010483
1060 Ga0070674_100003565
1061 Ga0070674_100013910
1062 Ga0070673_100060284
1063 Ga0070688_100004521
1064 Ga0070688_100099691
1065 Ga0070659_100053692
1066 Ga0070659_100070043
1067 Ga0070667_100000026
1068 Ga0070667_100020275
1069 Ga0070667_100049400
1070 Ga0070667_100247902
1071 Ga0070713_100212468
1072 Ga0070713_100230531
1073 Ga0070701_10052915
1074 Ga0070701_10058065
1075 Ga0070705_100009205
1076 Ga0070663_100079890
1077 Ga0070663_100240090
1078 Ga0070678_100025418
1079 Ga0070662_100014371
1080 Ga0070662_100038172
1081 Ga0070681_10005499
1082 Ga0070681_10229940
1083 Ga0068867_100005237
1084 Ga0068867_100032317
1085 Ga0068867_100034852
1086 Ga0068867_100113656
1087 Ga0070685_10000007
1088 Ga0070685_10159859
1089 Ga0070706_100140325
1090 Ga0070679_100008554
1091 Ga0070679_100046729
1092 Ga0070679_100422533
1093 Ga0070684_100005117
1094 Ga0068853_100099084
1095 Ga0070672_100019627
1096 Ga0070672_100034611
1097 Ga0070672_100118028
1098 Ga0070672_100308130
1099 Ga0070686_100009512
1100 Ga0070686_100027798
1101 Ga0070696_100031637
1102 Ga0070696_100087225
1103 Ga0070665_100044195
1104 Ga0070665_100068997
1105 Ga0070665_100567097
1106 Ga0070704_100032448
1107 Ga0070704_100135283
1108 Ga0070704_100321259
1109 Ga0068855_100008719
1110 Ga0068855_100031837
1111 Ga0068855_100220292
1112 Ga0070664_100012001
1113 Ga0070664_100014812
1114 Ga0070664_100065531
1115 Ga0070664_100216824
1116 Ga0068857_100006850
1117 Ga0068857_100140938
1118 Ga0068857_100396467
1119 Ga0068857_100463351
1120 Ga0068854_100005152
1121 Ga0068856_100016323
1122 Ga0068856_100092120
1123 Ga0070702_100017140
1124 Ga0068852_100001206
1125 Ga0068852_100095514
1126 Ga0068859_100001745
1127 Ga0068859_100007685
1128 Ga0068859_100080974
1129 Ga0068859_100115963
1130 Ga0068859_100150062
1131 Ga0068859_100223012
1132 Ga0068864_100000012
1133 Ga0068864_100037858
1134 Ga0068866_10150941
1135 Ga0068861_100000962
1136 Ga0068861_100074083
1137 Ga0068861_100101784
1138 Ga0068861_100208178
1139 Ga0068861_100335508
1140 Ga0068863_100008065
1141 Ga0068863_100017541
1142 Ga0068858_100001018
1143 Ga0068858_100016226
1144 Ga0068858_100017352
1145 Ga0068858_100428549
1146 Ga0068860_100004168
1147 Ga0068860_100007832
1148 Ga0068862_100001146
1149 Ga0068862_100033113
1150 Ga0068862_100036344
1151 Ga0068862_100209238
1152 Ga0075363_100002122
1153 Ga0075367_10013597
1154 Ga0075369_10064583
1155 Ga0075366_10123535
1156 Ga0097621_100068678
1157 Ga0068871_100100355
1158 Ga0075430_100011821
1159 Ga0075431_100035076
1160 Ga0075431_100104471
1161 Ga0068865_100008565
1162 Ga0068865_100023560
1163 Ga0068865_100278869
1164 Ga0097620_100001745
1165 Ga0097620_100007685
1166 Ga0097620_100080966
1167 Ga0097620_100115964
1168 Ga0097620_100150062
1169 Ga0097620_100223007
1170 Ga0099795_10000014
1171 Ga0105240_10019812
1172 Ga0105240_10038598
1173 Ga0105240_10059153
1174 Ga0105240_10328511
1175 Ga0111539_10012880
1176 Ga0111539_10429433
1177 Ga0105247_10001941
1178 Ga0105247_10018455
1179 Ga0105247_10202911
1180 Ga0105243_10216785
1181 Ga0105241_10044133
1182 Ga0105241_10082865
1183 Ga0105242_10030398
1184 Ga0105242_10045340
1185 Ga0105242_10054998
1186 Ga0105248_10123619
1187 Ga0105248_10263891
1188 Ga0105237_10023342
1189 Ga0105237_10310823
1190 Ga0105238_10003217
1191 Ga0105238_10049013
1192 Ga0105238_10371117
1193 Ga0105249_10070890
1194 Ga0105249_10086586
1195 Ga0105249_10103644
1196 Ga0105249_10263908
1197 Ga0099796_10000054
1198 Ga0157373_10006638
1199 Ga0157371_10000078
1200 Ga0157370_10031830
1201 Ga0157369_10001598
1202 Ga0157369_10004689
1203 Ga0157374_10265654
1204 Ga0157378_10012175
1205 Ga0163162_10002139
1206 Ga0163162_10012636
1207 Ga0163162_10021561
1208 Ga0163162_10033867
1209 Ga0157372_10020911
1210 Ga0157372_10124114
1211 Ga0157372_10651454
1212 Ga0157375_10088560
1213 Ga0157375_10160315
1214 Ga0157375_10171726
1215 Ga0157375_10310817
1216 Ga0163163_10000051
1217 Ga0163163_10089960
1218 Ga0163163_10144606
1219 Ga0157380_10020523
1220 Ga0157380_10080085
1221 Ga0157380_10189332
1222 Ga0182008_10103316
1223 Ga0182008_10117790
1224 Ga0157379_10006122
1225 Ga0157379_10034926
1226 Ga0157379_10247486
1227 Ga0157379_10704311
1228 Ga0157376_10222159
1229 Ga0157376_10396632
1230 Ga0182006_1010763
1231 Ga0182007_10021648
1232 Ga0182005_1000307
1233 Ga0163161_10012670
1234 Ga0163161_10165647
1235 Ga0213872_10000263
1236 Ga0213872_10001047
1237 Ga0213872_10011598
1238 Ga0213872_10012586
1239 Ga0213874_10066299
1240 Ga0213876_10107712
1241 Ga0209435_100716
1242 Ga0209784_100019
1243 Ga0209566_100017
1244 Ga0209674_100031
1245 Ga0209672_106450
1246 Ga0209563_100007
1247 Ga0209563_100035
1248 Ga0207427_100255
1249 Ga0209437_100038
1250 Ga0207425_1001639
1251 Ga0209646_1000872
1252 Ga0209026_1003950
1253 Ga0209677_100020
1254 Ga0209148_1000992
1255 Ga0209759_1000359
1256 Ga0209233_1000049
1257 Ga0209025_1016263
1258 Ga0209758_1002044
1259 Ga0207682_10000363
1260 Ga0207682_10000537
1261 Ga0207682_10004847
1262 Ga0207642_10030040
1263 Ga0207642_10081710
1264 Ga0207710_10000230
1265 Ga0207710_10070795
1266 Ga0207680_10004217
1267 Ga0207680_10041684
1268 Ga0207645_10000178
1269 Ga0207645_10008955
1270 Ga0207645_10144605
1271 Ga0207643_10020654
1272 Ga0207643_10035424
1273 Ga0207643_10174565
1274 Ga0207705_10023618
1275 Ga0207654_10280643
1276 Ga0207707_10024558
1277 Ga0207707_10045689
1278 Ga0207695_10018572
1279 Ga0207695_10032578
1280 Ga0207695_10073110
1281 Ga0207695_10109895
1282 Ga0207695_10235923
1283 Ga0207671_10182076
1284 Ga0207660_10027094
1285 Ga0207660_10094123
1286 Ga0207662_10015635
1287 Ga0207662_10109919
1288 Ga0207657_10019066
1289 Ga0207657_10037258
1290 Ga0207649_10000924
1291 Ga0207649_10035200
1292 Ga0207652_10375354
1293 Ga0207694_10003088
1294 Ga0207694_10015470
1295 Ga0207694_10040729
1296 Ga0207694_10260318
1297 Ga0207650_10000002
1298 Ga0207650_10123907
1299 Ga0207659_10036008
1300 Ga0207659_10413336
1301 Ga0207700_10135931
1302 Ga0207700_10247189
1303 Ga0207664_10015733
1304 Ga0207644_10000026
1305 Ga0207644_10001003
1306 Ga0207644_10036298
1307 Ga0207644_10150659
1308 Ga0207706_10000721
1309 Ga0207706_10007741
1310 Ga0207706_10023309
1311 Ga0207706_10070140
1312 Ga0207686_10049440
1313 Ga0207686_10076906
1314 Ga0207709_10040362
1315 Ga0207669_10100246
1316 Ga0207704_10020566
1317 Ga0207691_10003757
1318 Ga0207691_10007249
1319 Ga0207691_10032022
1320 Ga0207691_10058407
1321 Ga0207691_10092587
1322 Ga0207691_10191110
1323 Ga0207711_10000279
1324 Ga0207689_10012093
1325 Ga0207689_10043003
1326 Ga0207689_10100862
1327 Ga0207689_10185344
1328 Ga0207679_10004443
1329 Ga0207679_10066044
1330 Ga0207679_10069762
1331 Ga0207679_10159090
1332 Ga0207679_10167752
1333 Ga0207667_10013878
1334 Ga0207667_10019236
1335 Ga0207651_10543326
1336 Ga0207668_10220837
1337 Ga0207640_10207290
1338 Ga0207658_10000001
1339 Ga0207658_10021308
1340 Ga0207658_10048303
1341 Ga0207703_10000931
1342 Ga0207703_10001837
1343 Ga0207703_10026533
1344 Ga0207678_10028049
1345 Ga0207678_10046744
1346 Ga0207678_10155218
1347 Ga0207708_10003301
1348 Ga0207708_10106735
1349 Ga0207702_10003782
1350 Ga0207641_10002241
1351 Ga0207641_10416560
1352 Ga0207641_10416561
1353 Ga0207648_10001407
1354 Ga0207648_10036960
1355 Ga0207648_10307240
1356 Ga0207676_10000001
1357 Ga0207676_10005269
1358 Ga0207676_10008269
1359 Ga0207674_10000536
1360 Ga0207674_10083098
1361 Ga0207674_10260873
1362 Ga0207674_10281293
1363 Ga0207675_100000345
1364 Ga0207675_100001625
1365 Ga0207675_100009265
1366 Ga0207675_100010996
1367 Ga0207675_100012530
1368 Ga0207675_100105310
1369 Ga0207675_100276354
1370 Ga0207675_100287270
1371 Ga0207683_10034525
1372 Ga0207683_10047615
1373 Ga0207683_10064063
1374 Ga0207698_10012426
1375 Ga0207698_10057160
1376 Ga0209179_1000013
1377 Ga0265354_1000774
1378 Ga0265356_1002312
1379 Ga0268266_10001083
1380 Ga0268266_10004153
1381 Ga0268266_10047347
1382 Ga0268266_10409662
1383 Ga0268265_10001823
1384 Ga0268265_10025833
1385 Ga0268265_10284555
1386 Ga0268264_10000061
1387 Ga0268264_10000179
1388 Ga0268264_10027283
1389 Ga0265319_1020051
1390 Ga0265334_10000127
1391 Ga0265318_10000024
1392 Ga0307515_10299892
1393 Ga0265338_10010433
1394 Ga0265338_10028206
1395 Ga0307511_10000040
1396 Ga0265770_1000354
1397 Ga0265330_10003907
1398 Ga0265328_10010066
1399 Ga0265320_10005045
1400 Ga0265325_10005133
1401 Ga0265340_10045334
1402 Ga0265339_10023115
1403 Ga0265331_10005948
1404 Ga0265327_10000014
1405 Ga0265316_10024185
1406 Ga0307513_10040878
1407 Ga0307513_10063236
1408 Ga0307513_10175972
1409 Ga0307509_10001628
1410 Ga0307509_10170332
1411 Ga0307509_10176859
1412 Ga0307509_10199032
1413 Ga0307408_100001210
1414 Ga0265313_10004752
1415 Ga0307508_10074771
1416 Ga0307514_10091103
1417 Ga0316575_10018347
1418 Ga0265314_10001695
1419 Ga0265342_10068460
1420 Ga0316576_10022743
1421 Ga0316578_10003631
1422 Ga0316578_10024545
1423 Ga0316577_10001334
1424 Ga0316577_10009802
1425 Ga0307413_10001755
1426 Ga0307410_10003357
1427 Ga0307410_10004428
1428 Ga0307407_10004906
1429 Ga0307407_10005254
1430 Ga0307409_100002705
1431 Ga0307409_100007342
1432 Ga0307416_100070648
1433 Ga0307411_10010509
1434 Ga0307415_100090684
1435 Ga0307415_100139537
1436 Ga0316583_10028218
1437 Ga0316585_10000956
1438 Ga0316580_10022804
1439 Ga0316593_10000472
1440 Ga0316593_10003014
1441 Ga0316593_10031252
1442 Ga0307510_10000013
1443 Ga0307510_10010455
1444 Ga0316592_1000192
1445 Ga0316596_1000369
1446 Ga0316596_1002070
1447 Ga0373936_0015718
1448 Ga0316574_0007763
1449 Ga0316574_0021798
1450 Ga0316574_0023127
1451 Ga0316582_0017047
1452 Ga0316582_0033533
1453 Ga0316584_0005374
1454 Ga0316584_0029740
1455 Ga0395899_0000128
1456 Ga0395899_0000904
1457 Ga0395899_0002101
1458 Ga0395899_0036149
1459 Ga0395900_0000874
1460 Ga0395900_0036284
1461 Ga0395900_0050571
1462 Ga0395900_0062747
1463 Ga0395900_0163739
1464 Ga0395900_0322603
1465 Ga0395898_0003704
1466 Ga0395898_0039391
1467 Ga0395898_0154334
1468 Ga0395898_0157087
1469 Ga0395898_0160048
1470 Ga0395898_0207310
1471 Ga0395905_0009571
1472 Ga0395905_0010272
1473 Ga0395905_0075118
1474 Ga0395905_0242584
1475 Ga0395905_0295595
1476 Ga0395901_0000054
1477 Ga0395901_0003565
1478 Ga0395901_0127852
1479 Ga0395901_0155312
1480 Ga0395901_0426283
1481 Ga0400484_03261
1482 Ga0400484_07350
1483 Ga0400490_20091
1484 Ga0400490_21770
1485 Ga0400490_45662
1486 Ga0400490_51771
1487 Ga0400491_10244
1488 Ga0400491_16906
1489 Ga0400488_04816
1490 Ga0400488_18372
1491 Ga0400488_23615
1492 Ga0400488_31619
1493 Ga0400488_40478
1494 Ga0400486_10786
1495 Ga0400483_044439
1496 Ga0400483_048826
1497 Ga0400483_163381
1498 Ga0400487_26214
1499 Ga0400487_41427
1500 Ga0400487_47735
1501 Ga0400487_51105
1502 Ga0400487_51635
1503 Ga0436361_0080172
1504 Ga0436361_0119299
1505 Ga0436361_0837724
1506 Ga0436361_0944997
1507 Ga0436363_0672559
1508 Ga0436363_1199362
1509 Ga0436362_0176928
1510 Ga0451787_573112
1511 Ga0451789_1220021
1512 Ga0451793_0865321
1513 Ga0451795_0279517
1514 Ga0451807_1281246
1515 Ga0451853_3198134
1516 Ga0439448_0003707
1517 Ga0439448_0045297
1518 Ga0439450_024169
1519 Ga0439450_039179
1520 Ga0450904_001557
1521 Ga0439458_0001531
1522 Ga0451577_0097310
1523 Ga0451577_0104243
1524 Ga0466969_0015826
1525 Ga0466972_0002881
1526 Ga0453683_0068607
1527 Ga0466965_0014133
1528 Ga0466965_0016917
1529 Ga0466965_0043666
1530 Ga0466966_0005305
1531 Ga0466966_0033545
1532 Ga0466966_0221696
1533 Ga0466966_0239292
1534 Ga0466961_0124576
1535 Ga0466964_0001227
1536 Ga0466964_0001931
1537 Ga0466971_0010136
1538 Ga0466971_0132277
1539 Ga0466968_0001801
1540 Ga0466968_0099409
1541 Ga0466957_0046829
1542 Ga0466957_0159888
1543 Ga0466960_0126220
1544 Ga0466959_0045778
1545 Ga0466959_0080319
1546 Ga0466959_0145988
1547 Ga0451576_0000250
1548 Ga0466958_0075060
1549 Ga0495617_000057
1550 Ga0495617_000303
1551 Ga0495617_046083
1552 Ga0495627_001817
1553 Ga0495627_006174
1554 Ga0495592_0046495
1555 Ga0495603_0086608
1556 Ga0495590_0000018
1557 Ga0495590_0002149
1558 Ga0495590_0002928
1559 Ga0495590_0058050
1560 Ga0495591_012498
1561 Ga0495591_019841
1562 Ga0495629_0132375
1563 Ga0495638_0010108
1564 Ga0495638_0027791
1565 Ga0495638_0048144
1566 Ga0495638_0112870
1567 Ga0495651_0028201
1568 Ga0495651_0100413
1569 Ga0495653_0028643
1570 Ga0495653_0078585
1571 Ga0495650_0000108
1572 Ga0495650_0000140
1573 Ga0495650_0032139
1574 Ga0495605_0000416
1575 Ga0495605_0000438
1576 Ga0495605_0003370
1577 Ga0495605_0011441
1578 Ga0495605_0027851
1579 Ga0495605_0029379
1580 Ga0495605_0041158
1581 Ga0495605_0045539
1582 Ga0495605_0124866
1583 Ga0495584_0000006
1584 Ga0495584_0000281
1585 Ga0495584_0009627
1586 Ga0495584_0013652
1587 Ga0495584_0033622
1588 Ga0495584_0036504
1589 Ga0495584_0043266
1590 Ga0495584_0171850
1591 Ga0495585_0000193
1592 Ga0495585_0000515
1593 Ga0495585_0002529
1594 Ga0495585_0003683
1595 Ga0495585_0005187
1596 Ga0495585_0007454
1597 Ga0495585_0014980
1598 Ga0495585_0038339
1599 Ga0495585_0064979
1600 Ga0495585_0065111
1601 Ga0495585_0065981
1602 Ga0495585_0115949
1603 Ga0495594_0039206
1604 Ga0495594_0206510
1605 Ga0495596_0001089
1606 Ga0495596_0001435
1607 Ga0495596_0001794
1608 Ga0495596_0007906
1609 Ga0495596_0011978
1610 Ga0495596_0012711
1611 Ga0495596_0020949
1612 Ga0495596_0023469
1613 Ga0495596_0023665
1614 Ga0495596_0052210
1615 Ga0495596_0053292
1616 Ga0495596_0057895
1617 Ga0495607_0003330
1618 Ga0495607_0011000
1619 Ga0495607_0019846
1620 Ga0495607_0025658
1621 Ga0495607_0031999
1622 Ga0495607_0050509
1623 Ga0495607_0069694
1624 Ga0495583_0003816
1625 Ga0495583_0012109
1626 Ga0495583_0014101
1627 Ga0495583_0020486
1628 Ga0495583_0029563
1629 Ga0495583_0032217
1630 Ga0495583_0032488
1631 Ga0495583_0037057
1632 Ga0495583_0059784
1633 Ga0495583_0164587
1634 Ga0495606_0006986
1635 Ga0495606_0011967
1636 Ga0495606_0027851
1637 Ga0495606_0086107
1638 Ga0495606_0113794
1639 Ga0495608_0041553
1640 Ga0495610_0002329
1641 Ga0495616_0000662
1642 Ga0495616_0002246
1643 Ga0495616_0002684
1644 Ga0495616_0003012
1645 Ga0495616_0004448
1646 Ga0495616_0013824
1647 Ga0495616_0018343
1648 Ga0495616_0026851
1649 Ga0495616_0033272
1650 Ga0495616_0034518
1651 Ga0495616_0057056
1652 Ga0495616_0068379
1653 Ga0495616_0111702
1654 Ga0495620_0004669
1655 Ga0495628_0004565
1656 Ga0495630_0084205
1657 Ga0495631_0000632
1658 Ga0495631_0001483
1659 Ga0495631_0002977
1660 Ga0495631_0007116
1661 Ga0495631_0011740
1662 Ga0495631_0016053
1663 Ga0495631_0018121
1664 Ga0495631_0041077
1665 Ga0495631_0042382
1666 Ga0495631_0052764
1667 Ga0495632_0000214
1668 Ga0495632_0000364
1669 Ga0495632_0003852
1670 Ga0495632_0009850
1671 Ga0495632_0011405
1672 Ga0495632_0014316
1673 Ga0495632_0015456
1674 Ga0495632_0026674
1675 Ga0495632_0027244
1676 Ga0495632_0052634
1677 Ga0495632_0056759
1678 Ga0495632_0056879
1679 Ga0495632_0087379
1680 Ga0495637_0000612
1681 Ga0495643_0000141
1682 Ga0495643_0004483
1683 Ga0495643_0019252
1684 Ga0495643_0021003
1685 Ga0495643_0032721
1686 Ga0495643_0043697
1687 Ga0495643_0061065
1688 Ga0495643_0120803
1689 Ga0495644_0002371
1690 Ga0495644_0005317
1691 Ga0495644_0007533
1692 Ga0495644_0025164
1693 Ga0495644_0030060
1694 Ga0495648_0000109
1695 Ga0495648_0004137
1696 Ga0495648_0019039
1697 Ga0495666_0012627
1698 Ga0495642_0000741
1699 Ga0495642_0001464
1700 Ga0495642_0007631
1701 Ga0495642_0013970
1702 Ga0495642_0037500
1703 Ga0495642_0054460
1704 Ga0495642_0065860
1705 Ga0495652_0012068
1706 Ga0495652_0040085
1707 Ga0495654_0047746
1708 Ga0495654_0048172
1709 Ga0495654_0059366
1710 Ga0495654_0094487
1711 Ga0495665_0019053
1712 Ga0495665_0026571
1713 Ga0495665_0030666
1714 Ga0495586_0142085
1715 Ga0495598_0022846
1716 Ga0495609_0000009
1717 Ga0495609_0001562
1718 Ga0495609_0006657
1719 Ga0495609_0018010
1720 Ga0495609_0020796
1721 Ga0495609_0037586
1722 Ga0495609_0049452
1723 Ga0495609_0049544
1724 Ga0495609_0114655
1725 Ga0495597_0002044
1726 Ga0495597_0003097
1727 Ga0495597_0014117
1728 Ga0495597_0042966
1729 Ga0495645_0027376
1730 Ga0495622_0038097
1731 Ga0495622_0049436
1732 Ga0495633_0006086
1733 Ga0495633_0007030
1734 Ga0495633_0007058
1735 Ga0495633_0026986
1736 Ga0495633_0088992
1737 Ga0495656_0022919
1738 Ga0495656_0053279
1739 Ga0495668_0003200
1740 Ga0495668_0003639
1741 Ga0495668_0015431
1742 Ga0495668_0016287
1743 Ga0495668_0020369
1744 Ga0495668_0051043
1745 Ga0495668_0114115
1746 Ga0495634_0201412
1747 Ga0495611_0000499
1748 Ga0495611_0002457
1749 Ga0495611_0019231
1750 Ga0495611_0019315
1751 Ga0495611_0024956
1752 Ga0495611_0026413
1753 Ga0495611_0031348
1754 Ga0495625_0032776
1755 Ga0495625_0063609
1756 Ga0495625_0066343
1757 Ga0495625_0124604
1758 Ga0495625_0178631
1759 Ga0495635_0002454
1760 Ga0495661_0001929
1761 Ga0495661_0007429
1762 Ga0495661_0012238
1763 Ga0495661_0013191
1764 Ga0495661_0027110
1765 Ga0495661_0035807
1766 Ga0495661_0064902
1767 Ga0495661_0065409
1768 Ga0495661_0071191
1769 Ga0495661_0075659
1770 Ga0495661_0153789
1771 Ga0495661_0171609
1772 Ga0495588_0000077
1773 Ga0495588_0010399
1774 Ga0495588_0012275
1775 Ga0495588_0027405
1776 Ga0495588_0031167
1777 Ga0495588_0055912
1778 Ga0495588_0067940
1779 Ga0495657_0073728
1780 Ga0495599_0004944
1781 Ga0495623_0011364
1782 Ga0495646_0012052
1783 Ga0495669_0000116
1784 Ga0495669_0007431
1785 Ga0495669_0011905
1786 Ga0495669_0030253
1787 Ga0495624_0300210
1788 Ga0495670_0001273
1789 Ga0495670_0005019
1790 Ga0495670_0007909
1791 Ga0495670_0016363
1792 Ga0495670_0041425
1793 Ga0495670_0049421
1794 Ga0495670_0072508
1795 Ga0495671_0002689
1796 Ga0495671_0016637
1797 Ga0495649_0003311
1798 Ga0495649_0003561
1799 Ga0495649_0011717
1800 Ga0495649_0057116
1801 Ga0495649_0082868
1802 Ga0495589_0001060
1803 Ga0495589_0007613
1804 Ga0495589_0013208
1805 Ga0495589_0017044
1806 Ga0495589_0019655
1807 Ga0495660_0000178
1808 Ga0495660_0010952
1809 Ga0495660_0020825
1810 Ga0495660_0070404
1811 Ga0495660_0070610
1812 Ga0495660_0108124
1813 Ga0495660_0117839
1814 Ga0495604_0027131
1815 Ga0495672_0000033
1816 Ga0495672_0000437
1817 Ga0495672_0001623
1818 Ga0495672_0009440
1819 Ga0495672_0010123
1820 Ga0495672_0072525
1821 Ga0495676_0000121
1822 Ga0495676_0049524
1823 Ga0495680_0007548
1824 Ga0495683_0000182
1825 Ga0495683_0001151
1826 Ga0495683_0011839
1827 Ga0495683_0018583
1828 Ga0495683_0020136
1829 Ga0495683_0020827
1830 Ga0495687_000002
1831 Ga0495687_000017
1832 Ga0495687_000024
1833 Ga0495687_000458
1834 Ga0495687_013931
1835 Ga0495687_014022
1836 Ga0495675_0016790
1837 Ga0495677_0000117
1838 Ga0495677_0003340
1839 Ga0495677_0004846
1840 Ga0495677_0005027
1841 Ga0495677_0005223
1842 Ga0495677_0008846
1843 Ga0495677_0010361
1844 Ga0495677_0017662
1845 Ga0495677_0026283
1846 Ga0495677_0027824
1847 Ga0495677_0028764
1848 Ga0495677_0029631
1849 Ga0495679_003474
1850 Ga0495679_004009
1851 Ga0495679_013040
1852 Ga0495685_004997
1853 Ga0495681_0000994
1854 Ga0495681_0012084
1855 Ga0495681_0014560
1856 Ga0495681_0023578
1857 Ga0495681_0031695
1858 Ga0495681_0058051
1859 Ga0495686_0000591
1860 Ga0495686_0001614
1861 Ga0495686_0082989
1862 Ga0495593_0088157
1863 Ga0495593_0117865
1864 Ga0495602_0077771
1865 Ga0495614_0004132
1866 Ga0495626_0000004
1867 Ga0495626_0000016
1868 Ga0495626_0000693
1869 Ga0495626_0006971
1870 Ga0495626_0012875
1871 Ga0495626_0015332
1872 Ga0495626_0030305
1873 Ga0495626_0035415
1874 Ga0495626_0042550
1875 Ga0495626_0042772
1876 Ga0495626_0079806
1877 Ga0496101_0100541
1878 Ga0496102_0000340
1879 Ga0496102_0031296
1880 Ga0496102_0039013
1881 Ga0496102_0073083
1882 Ga0496102_0189580
1883 Ga0496102_0285842
1884 Ga0496103_0013246
1885 Ga0496103_0097970
1886 Ga0496103_0201425
1887 Ga0496106_0239107
1888 Ga0496107_0007412
1889 Ga0496108_0019844
1890 Ga0496109_0005210
1891 Ga0496109_0102982
1892 Ga0496110_0004929
1893 Ga0496111_0152130
1894 Ga0496112_0020372
1895 Ga0496112_0321442
1896 Ga0496113_0023519
1897 Ga0496113_0176820
1898 Ga0496113_0347407
1899 Ga0496115_0143915
1900 Ga0496116_0046354
1901 Ga0496117_0000057
1902 Ga0496118_0000028
1903 Ga0496119_0005745
1904 Ga0496119_0009417
1905 Ga0496120_0007468
1906 Ga0496120_0014995
1907 Ga0496120_0056979
1908 Ga0496121_0001295
1909 Ga0496121_0029970
1910 Ga0496121_0046034
1911 Ga0496121_0095309
1912 Ga0496121_0204670
1913 Ga0496122_0009237
1914 Ga0496122_0009551
1915 Ga0496122_0090290
1916 Ga0496123_0026217
1917 Ga0496123_0042315
1918 Ga0496123_0093738
1919 Ga0496124_0002724
1920 Ga0496124_0003292
1921 Ga0496124_0012916
1922 Ga0496124_0035599
1923 Ga0496124_0056406
1924 Ga0496124_0091173
1925 Ga0496125_0011721
1926 Ga0496125_0013698
1927 Ga0496125_0059832
1928 Ga0496125_0103905
1929 Ga0496125_0203493
1930 Ga0496126_0038970
1931 Ga0496126_0068887
1932 Ga0496126_0097557
1933 Ga0501308_000102
1934 Ga0501304_000184
1935 Ga0495678_000275
1936 Ga0495678_000746
1937 Ga0495678_001983
1938 Ga0495678_002319
1939 Ga0495678_004447
1940 Ga0495678_014319
1941 Ga0495682_0002099
1942 Ga0495682_0017114
1943 Ga0495682_0019757
1944 Ga0495682_0027473
1945 Ga0495682_0074150
1946 Ga0501033_0361474
1947 Ga0501037_0008788
1948 Ga0501037_0013697
1949 Ga0501039_0030179
1950 Ga0501040_0049070
1951 Ga0501046_0012173
1952 Ga0501047_0098639
1953 Ga0501048_0286988
1954 Ga0501067_0003287
1955 Ga0501068_0000097
1956 Ga0501069_0020201
1957 Ga0501070_0003050
1958 Ga0501070_0008303
1959 Ga0501070_0015322
1960 Ga0501070_0134521
1961 Ga0501071_0068445
1962 Ga0501072_0028213
1963 Ga0501073_0000086
1964 Ga0501074_0028123
1965 Ga0501074_0057987
1966 Ga0501075_0319129
1967 Ga0501076_0061458
1968 Ga0501077_0001839
1969 Ga0501079_0000201
1970 Ga0501080_0001101
1971 Ga0501080_0003269
1972 Ga0501081_0244740
1973 Ga0501083_0001294
1974 Ga0501035_0004380
1975 Ga0501044_0001746
1976 nmdc:mga03683_150182_c1
1977 nmdc:mga07m45_124896_c1
1978 nmdc:mga0qj67_232795_c1
1979 nmdc:mga0qj67_7557_c1
1980 nmdc:mga06r32_166393_c1
1981 nmdc:mga06r32_34635_c1
1982 Ga0500646_0031268
1983 Ga0500583_0001580
1984 Ga0500583_0015022
1985 Ga0500583_0020890
1986 Ga0500640_090446
1987 Ga0500650_0000034
1988 Ga0500556_0000374
1989 Ga0500642_0195462
1990 Ga0500658_0104505
1991 Ga0500568_0004577
1992 Ga0500616_0000016
1993 Ga0500633_0115889
1994 Ga0500637_0003857
1995 Ga0500637_0040698
1996 Ga0501084_0001279
1997 Ga0501084_0182396
1998 Ga0587067_002624
1999 Ga0466962_0108370
2000 2511250642
2001 2511384950
2002 2547373081
2003 2643802366
2004 2644030670
2005 2644475879
2006 2765569009
2007 2809145418
2008 2819542543
2009 2839096106
2010 2843691967
2011 2846040439
2012 8001526377
2013 8047673771
2014 8054360169

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00698

Acyl_transf_1

Acyl transferase domain

25

327

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6smd-assembly2.cif.gz_C plmcat:antf (holo): type ii pks acyl-carrier protein in complex with its malonyl-transacylase 0.987 2 308
3h0p-assembly1.cif.gz_A 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. 0.9869 2 306
6u0j-assembly1.cif.gz_A crosslinked crystal structure of malonyl-coa acyl carrier protein transacylase, fabd, and acyl carrier protein, acpp 0.985 1 306
3tqe-assembly1.cif.gz_A structure of the malonyl coa-acyl carrier protein transacylase (fabd) from coxiella burnetii 0.9831 2 307
2g2y-assembly1.cif.gz_A structure of e.coli fabd complexed with malonate 0.9809 3 306
ID Description Score Start End Superfamily
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9851 6 285 3.20.10.10
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9782 6 285 3.20.10.10
2g1hA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.978 3 307 3.40.366.10
3tqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.9744 124 196 3.30.70.250
2cuyB01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.971 4 308 3.40.366.10
ID Description Score Start End GO Terms
AF-A0A2T8QRA5-F1-model_v4 deleted 0.9933 198 307
AF-V5U0C8-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9919 23 307 GO:0004314
GO:0005829
GO:0006633
AF-A0A378CU40-F1-model_v4 deleted 0.9914 183 307
AF-A0A7W9TU84-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9903 2 309 GO:0004314
GO:0005829
GO:0006633
AF-A0A1H7MJD1-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9903 2 310 GO:0004314
GO:0005829
GO:0006633

Map