F488037

General Info

Members Datasets Scaffolds Average Seq Length
1007 451 969 171

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10663633|Ga0157376_106636332
Length 190
Sequence VDGLPDRRSGVDGAGAGSALMEIVMIVAVAENGVIGAGGAIPWLLKSDMARFKALTSRKPVVMGRKTFVSIGRPLPGRTNIVVTRDAAFRADGVVVTNSFADAMAIATGDALRRFATEIAVIGGAEIYAQWMDRADRLEITEVHARPDGDTRFAAIDARDWEEVACVRNPAGADDSADFSYVTFRRRKPH

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2643221651 Afipia sp. Root123D2 Isolate Unclassified
8 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
9 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
10 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
11 2791355199
12 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
13 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
14 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
15 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
16 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
17 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
18 2904699407
19 2906610324
20 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
21 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
22 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
23 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
24 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
25 2922425934
26 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
27 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
28 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
29 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
30 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
120 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
214 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
215 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
235 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
247 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
248 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
249 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
250 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
251 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
258 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
259 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
260 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
261 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
274 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
275 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
276 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
277 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
278 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
281 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
298 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
299 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
300 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
301 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
304 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
307 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
308 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
309 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
312 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
313 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
314 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
315 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
319 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
320 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
321 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
331 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
334 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
340 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
351 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
352 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
355 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
356 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
359 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
360 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
380 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
381 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
385 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
386 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
387 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
392 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
397 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
398 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
399 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
400 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
401 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
402 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
403 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
404 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
405 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
406 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
407 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
408 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
409 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
410 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
411 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
412 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
413 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
414 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
415 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
416 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
417 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
418 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
419 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
420 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
421 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
422 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
423 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
424 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
425 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
426 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
427 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
428 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
429 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
430 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
431 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
432 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
433 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
434 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
435 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
436 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
437 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
438 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
439 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
440 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
441 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
442 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
443 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
444 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
445 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
446 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
447 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
448 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
449 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
450 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
451 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.22
Nodule 3.08
Rhizoplane 7.25
Rhizosphere 71.3
Stem 0
Stem Tuber 0
Unclassified 7.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000738 3300003215 Bacteria 20026
2 rootH2_10100776 3300003320 Bacteria 1134
3 rootL2_10156283 3300003322 Bacteria 1130
4 JGI25404J52841_10008621 3300003659 Bacteria 2175
5 JGI25404J52841_10019463 3300003659 Bacteria 1471
6 Ga0070658_10090223 3300005327 Bacteria 2525
7 Ga0070658_10946607 3300005327 Bacteria 749
8 Ga0070676_10202667 3300005328 Bacteria 1301
9 Ga0070676_10211892 3300005328 Bacteria 1275
10 Ga0070683_101016290 3300005329 Bacteria 796
11 Ga0070690_100013883 3300005330 Bacteria 4774
12 Ga0070690_100855336 3300005330 Bacteria 709
13 Ga0070670_100485037 3300005331 Bacteria 1098
14 Ga0068869_100111564 3300005334 Bacteria 2081
15 Ga0068869_100133194 3300005334 Bacteria 1912
16 Ga0068869_100140009 3300005334 Bacteria 1867
17 Ga0068869_101162221 3300005334 Bacteria 677
18 Ga0070666_10094036 3300005335 Bacteria 2061
19 Ga0070680_100000088 3300005336 Bacteria 51479
20 Ga0070680_100569234 3300005336 Bacteria 972
21 Ga0070682_100081625 3300005337 Bacteria 2094
22 Ga0070682_100471822 3300005337 Bacteria 966
23 Ga0068868_100105245 3300005338 Bacteria 2287
24 Ga0068868_100330768 3300005338 Bacteria 1300
25 Ga0068868_100459610 3300005338 Bacteria 1108
26 Ga0068868_100539507 3300005338 Bacteria 1027
27 Ga0070660_100095121 3300005339 Bacteria 2354
28 Ga0070660_100372677 3300005339 Bacteria 1178
29 Ga0070689_100556949 3300005340 Bacteria 988
30 Ga0070691_10293480 3300005341 Bacteria 886
31 Ga0070661_100000014 3300005344 Bacteria 158652
32 Ga0070661_100155180 3300005344 Bacteria 1732
33 Ga0070661_100547282 3300005344 Bacteria 931
34 Ga0070692_10185736 3300005345 Bacteria 1208
35 Ga0070668_100108937 3300005347 Bacteria 2203
36 Ga0070668_100357346 3300005347 Bacteria 1238
37 Ga0070668_100626033 3300005347 Bacteria 943
38 Ga0070668_100832552 3300005347 Bacteria 821
39 Ga0070668_100976201 3300005347 Bacteria 760
40 Ga0070669_101064525 3300005353 Bacteria 696
41 Ga0070675_101387632 3300005354 Bacteria 648
42 Ga0070671_100196427 3300005355 Bacteria 1710
43 Ga0070671_100216516 3300005355 Bacteria 1625
44 Ga0070671_100270463 3300005355 Bacteria 1444
45 Ga0070671_101014070 3300005355 Bacteria 727
46 Ga0070674_100035143 3300005356 Bacteria 3354
47 Ga0070674_100378784 3300005356 Bacteria 1151
48 Ga0070674_100693830 3300005356 Bacteria 869
49 Ga0070673_100112844 3300005364 Bacteria 2256
50 Ga0070673_100589410 3300005364 Bacteria 1013
51 Ga0070688_100317063 3300005365 Bacteria 1132
52 Ga0070688_100322111 3300005365 Bacteria 1123
53 Ga0070659_100214238 3300005366 Bacteria 1588
54 Ga0070659_100306833 3300005366 Bacteria 1325
55 Ga0070659_100334759 3300005366 Bacteria 1267
56 Ga0070659_100974340 3300005366 Bacteria 743
57 Ga0070667_100559616 3300005367 Bacteria 1051
58 Ga0070709_10096813 3300005434 Bacteria 1958
59 Ga0070714_100327084 3300005435 Bacteria 1435
60 Ga0070714_101163778 3300005435 Bacteria 752
61 Ga0070710_10011649 3300005437 Bacteria 4349
62 Ga0070701_10364149 3300005438 Bacteria 907
63 Ga0070711_100010862 3300005439 Bacteria 5645
64 Ga0070705_101026550 3300005440 Bacteria 671
65 Ga0070700_100351816 3300005441 Bacteria 1092
66 Ga0070663_100189605 3300005455 Bacteria 1599
67 Ga0070663_100294729 3300005455 Bacteria 1296
68 Ga0070663_100359125 3300005455 Bacteria 1181
69 Ga0070663_100629013 3300005455 Bacteria 905
70 Ga0070678_100007967 3300005456 Bacteria 6315
71 Ga0070678_100035283 3300005456 Bacteria 3490
72 Ga0070678_100039559 3300005456 Bacteria 3328
73 Ga0070678_100158466 3300005456 Bacteria 1831
74 Ga0070678_100196577 3300005456 Bacteria 1661
75 Ga0070678_100870676 3300005456 Bacteria 822
76 Ga0070678_101158368 3300005456 Bacteria 716
77 Ga0070662_100337333 3300005457 Bacteria 1232
78 Ga0070662_100507483 3300005457 Bacteria 1006
79 Ga0070681_10069164 3300005458 Bacteria 3497
80 Ga0070681_10085157 3300005458 Bacteria 3113
81 Ga0070681_10370790 3300005458 Bacteria 1342
82 Ga0070681_11290661 3300005458 Bacteria 653
83 Ga0068867_100358570 3300005459 Bacteria 1219
84 Ga0068867_100989926 3300005459 Bacteria 762
85 Ga0070685_10399497 3300005466 Bacteria 951
86 Ga0070685_10981054 3300005466 Bacteria 633
87 Ga0070699_100198513 3300005518 Bacteria 1783
88 Ga0070699_101543569 3300005518 Bacteria 609
89 Ga0070679_100000003 3300005530 Bacteria 307836
90 Ga0070679_100019162 3300005530 Bacteria 6648
91 Ga0070679_100759250 3300005530 Bacteria 913
92 Ga0070697_100658178 3300005536 Bacteria 923
93 Ga0068853_100406003 3300005539 Bacteria 1276
94 Ga0068853_100710798 3300005539 Bacteria 959
95 Ga0068853_100960605 3300005539 Bacteria 822
96 Ga0068853_101374817 3300005539 Bacteria 683
97 Ga0070672_100139942 3300005543 Bacteria 1995
98 Ga0070672_100173630 3300005543 Bacteria 1793
99 Ga0070672_100411830 3300005543 Bacteria 1160
100 Ga0070672_100545270 3300005543 Bacteria 1006
101 Ga0070686_100149257 3300005544 Bacteria 1635
102 Ga0070686_100277045 3300005544 Bacteria 1235
103 Ga0070665_100020950 3300005548 Bacteria 6570
104 Ga0070665_100080986 3300005548 Bacteria 3252
105 Ga0070665_100104062 3300005548 Bacteria 2841
106 Ga0070665_100160316 3300005548 Bacteria 2251
107 Ga0070665_100253571 3300005548 Bacteria 1760
108 Ga0070665_100503129 3300005548 Bacteria 1223
109 Ga0070665_100626694 3300005548 Bacteria 1088
110 Ga0070665_101429373 3300005548 Bacteria 700
111 Ga0070704_100117260 3300005549 Bacteria 2037
112 Ga0068855_100036490 3300005563 Bacteria 5850
113 Ga0068855_100172069 3300005563 Bacteria 2452
114 Ga0070664_100533733 3300005564 Bacteria 1084
115 Ga0070664_100630319 3300005564 Bacteria 996
116 Ga0070664_101348482 3300005564 Bacteria 674
117 Ga0068857_101048364 3300005577 Bacteria 786
118 Ga0068857_101165239 3300005577 Bacteria 746
119 Ga0068854_100070455 3300005578 Bacteria 2556
120 Ga0068854_100383616 3300005578 Bacteria 1159
121 Ga0068856_100173634 3300005614 Bacteria 2167
122 Ga0068856_100206953 3300005614 Bacteria 1976
123 Ga0070702_100194975 3300005615 Bacteria 1336
124 Ga0068852_100016778 3300005616 Bacteria 5723
125 Ga0068852_100045466 3300005616 Bacteria 3734
126 Ga0068852_100103442 3300005616 Bacteria 2576
127 Ga0068852_100558585 3300005616 Bacteria 1146
128 Ga0068852_101881571 3300005616 Bacteria 621
129 Ga0068859_100067475 3300005617 Bacteria 3611
130 Ga0068864_100111310 3300005618 Bacteria 2439
131 Ga0068864_101370879 3300005618 Bacteria 708
132 Ga0068866_10161326 3300005718 Bacteria 1308
133 Ga0068861_100184644 3300005719 Bacteria 1738
134 Ga0068861_101349839 3300005719 Bacteria 695
135 Ga0068870_10145078 3300005840 Bacteria 1392
136 Ga0068870_10251097 3300005840 Bacteria 1096
137 Ga0068863_100441310 3300005841 Bacteria 1276
138 Ga0068863_100780084 3300005841 Bacteria 952
139 Ga0068863_101015078 3300005841 Bacteria 833
140 Ga0068860_100128258 3300005843 Bacteria 2432
141 Ga0068860_100272452 3300005843 Bacteria 1652
142 Ga0068860_100297484 3300005843 Bacteria 1580
143 Ga0068860_100305761 3300005843 Bacteria 1558
144 Ga0068860_101427262 3300005843 Bacteria 713
145 Ga0068862_100197996 3300005844 Bacteria 1810
146 Ga0068862_100616472 3300005844 Bacteria 1043
147 Ga0068862_100669716 3300005844 Bacteria 1003
148 Ga0068862_100796587 3300005844 Bacteria 922
149 Ga0068862_100892254 3300005844 Bacteria 873
150 Ga0068862_100900719 3300005844 Bacteria 869
151 Ga0068862_101743178 3300005844 Bacteria 631
152 Ga0081455_10003699 3300005937 Bacteria 17509
153 Ga0081455_10008277 3300005937 Bacteria 10837
154 Ga0081455_10017249 3300005937 Bacteria 6931
155 Ga0081455_10070603 3300005937 Bacteria 2899
156 Ga0081455_10127588 3300005937 Bacteria 1994
157 Ga0081455_10159826 3300005937 Bacteria 1728
158 Ga0081455_10262950 3300005937 Bacteria 1256
159 Ga0081538_10020833 3300005981 Bacteria 4812
160 Ga0081540_1000996 3300005983 Bacteria 25476
161 Ga0081540_1003091 3300005983 Bacteria 13334
162 Ga0081540_1008013 3300005983 Bacteria 7435
163 Ga0081540_1010852 3300005983 Bacteria 6123
164 Ga0081540_1028988 3300005983 Bacteria 3094
165 Ga0081540_1051839 3300005983 Bacteria 2026
166 Ga0081540_1070603 3300005983 Bacteria 1617
167 Ga0081540_1072847 3300005983 Bacteria 1581
168 Ga0081540_1110341 3300005983 Bacteria 1164
169 Ga0081540_1152867 3300005983 Bacteria 908
170 Ga0081539_10041134 3300005985 Bacteria 2706
171 Ga0081539_10177574 3300005985 Bacteria 1001
172 Ga0070717_10608646 3300006028 Bacteria 991
173 Ga0075365_10026143 3300006038 Bacteria 3703
174 Ga0075365_10071612 3300006038 Unclassified 2334
175 Ga0075365_10446381 3300006038 Bacteria 913
176 Ga0075365_10672691 3300006038 Bacteria 731
177 Ga0075368_10002858 3300006042 Bacteria 5701
178 Ga0075368_10109378 3300006042 Bacteria 1139
179 Ga0075363_100003690 3300006048 Bacteria 6582
180 Ga0075363_100019054 3300006048 Bacteria 3426
181 Ga0075363_100092560 3300006048 Bacteria 1665
182 Ga0075363_100307411 3300006048 Bacteria 921
183 Ga0075363_100496104 3300006048 Bacteria 725
184 Ga0075364_10017241 3300006051 Bacteria 4508
185 Ga0075364_10022187 3300006051 Bacteria 4007
186 Ga0070712_100016528 3300006175 Bacteria 4768
187 Ga0070712_100030454 3300006175 Bacteria 3626
188 Ga0075362_10008950 3300006177 Bacteria 3850
189 Ga0075367_10011042 3300006178 Bacteria 4764
190 Ga0075367_10202959 3300006178 Bacteria 1239
191 Ga0075367_10245861 3300006178 Bacteria 1121
192 Ga0075367_10290976 3300006178 Bacteria 1028
193 Ga0075367_10306749 3300006178 Bacteria 999
194 Ga0075367_10414377 3300006178 Bacteria 852
195 Ga0075367_10611856 3300006178 Bacteria 692
196 Ga0075369_10011190 3300006186 Bacteria 3524
197 Ga0075369_10026249 3300006186 Bacteria 2427
198 Ga0075366_10074726 3300006195 Bacteria 2021
199 Ga0075366_10124765 3300006195 Bacteria 1552
200 Ga0075366_10264152 3300006195 Bacteria 1051
201 Ga0097621_100365951 3300006237 Bacteria 1285
202 Ga0075370_10042568 3300006353 Bacteria 2565
203 Ga0075370_10092808 3300006353 Bacteria 1742
204 Ga0075370_10148475 3300006353 Bacteria 1373
205 Ga0075370_10180483 3300006353 Bacteria 1242
206 Ga0075370_10336408 3300006353 Bacteria 900
207 Ga0075370_10364212 3300006353 Bacteria 865
208 Ga0075370_10514759 3300006353 Bacteria 723
209 Ga0068871_100107291 3300006358 Bacteria 2345
210 Ga0068871_100162487 3300006358 Bacteria 1910
211 Ga0068871_100220538 3300006358 Bacteria 1643
212 Ga0068871_100343989 3300006358 Bacteria 1318
213 Ga0075428_100025159 3300006844 Bacteria 6586
214 Ga0075428_100220390 3300006844 Bacteria 2049
215 Ga0075430_101210418 3300006846 Bacteria 622
216 Ga0075431_100001712 3300006847 Bacteria 20617
217 Ga0075434_100357445 3300006871 Bacteria 1481
218 Ga0068865_100291188 3300006881 Bacteria 1303
219 Ga0068865_100941720 3300006881 Bacteria 753
220 Ga0075436_100232485 3300006914 Bacteria 1310
221 Ga0097620_100067486 3300006931 Bacteria 3611
222 Ga0099824_1003225 3300006942 Bacteria 23847
223 Ga0099822_1005628 3300006943 Bacteria 16352
224 Ga0099794_10052540 3300007265 Bacteria 1964
225 Ga0099795_10040196 3300007788 Bacteria 1660
226 Ga0099795_10128197 3300007788 Bacteria 1021
227 Ga0099795_10323829 3300007788 Bacteria 683
228 Ga0105250_10157267 3300009092 Bacteria 948
229 Ga0105240_10177700 3300009093 Bacteria 2515
230 Ga0105240_10445878 3300009093 Bacteria 1449
231 Ga0111539_10089698 3300009094 Bacteria 3613
232 Ga0111539_10261925 3300009094 Bacteria 2013
233 Ga0111539_10335277 3300009094 Bacteria 1760
234 Ga0105245_10386161 3300009098 Bacteria 1395
235 Ga0105245_10444822 3300009098 Bacteria 1303
236 Ga0105245_10818767 3300009098 Bacteria 970
237 Ga0105245_11562928 3300009098 Bacteria 711
238 Ga0105245_11846327 3300009098 Bacteria 657
239 Ga0105247_10189004 3300009101 Bacteria 1378
240 Ga0105247_10196299 3300009101 Bacteria 1354
241 Ga0105247_10372541 3300009101 Bacteria 1010
242 Ga0105247_10389979 3300009101 Bacteria 989
243 Ga0114129_10037884 3300009147 Bacteria 6804
244 Ga0114129_10345513 3300009147 Bacteria 1972
245 Ga0114129_11387469 3300009147 Bacteria 867
246 Ga0105243_10282716 3300009148 Bacteria 1495
247 Ga0105243_10421131 3300009148 Bacteria 1246
248 Ga0105243_10691454 3300009148 Bacteria 993
249 Ga0105243_10984259 3300009148 Bacteria 845
250 Ga0105241_10155119 3300009174 Bacteria 1877
251 Ga0105242_10136248 3300009176 Bacteria 2125
252 Ga0105242_10185353 3300009176 Bacteria 1839
253 Ga0105242_10315136 3300009176 Bacteria 1433
254 Ga0105242_10650033 3300009176 Bacteria 1025
255 Ga0105242_11194681 3300009176 Bacteria 779
256 Ga0105248_10098374 3300009177 Bacteria 3296
257 Ga0105248_10108780 3300009177 Bacteria 3126
258 Ga0105248_10649225 3300009177 Bacteria 1191
259 Ga0105248_10692965 3300009177 Bacteria 1149
260 Ga0105237_10455384 3300009545 Bacteria 1285
261 Ga0105237_10501099 3300009545 Bacteria 1221
262 Ga0105237_10864289 3300009545 Bacteria 911
263 Ga0105237_11173532 3300009545 Bacteria 774
264 Ga0105237_11323625 3300009545 Bacteria 727
265 Ga0105237_11426633 3300009545 Bacteria 699
266 Ga0105238_10158752 3300009551 Bacteria 2237
267 Ga0105238_10273510 3300009551 Bacteria 1670
268 Ga0105238_10620758 3300009551 Bacteria 1090
269 Ga0105238_10915828 3300009551 Bacteria 895
270 Ga0105249_10215265 3300009553 Bacteria 1888
271 Ga0105249_10432775 3300009553 Bacteria 1352
272 Ga0105249_10806331 3300009553 Bacteria 1003
273 Ga0105249_11240327 3300009553 Bacteria 817
274 Ga0105249_12030534 3300009553 Bacteria 648
275 Ga0099796_10062156 3300010159 Bacteria 1327
276 Ga0105239_10024893 3300010375 Bacteria 6592
277 Ga0105239_10242659 3300010375 Bacteria 2022
278 Ga0105239_10396197 3300010375 Bacteria 1562
279 Ga0105239_11112850 3300010375 Bacteria 909
280 Ga0105239_12180236 3300010375 Bacteria 644
281 Ga0105246_10230215 3300011119 Bacteria 1459
282 Ga0105246_10295173 3300011119 Bacteria 1306
283 Ga0105246_10337501 3300011119 Bacteria 1230
284 Ga0105246_10348769 3300011119 Bacteria 1212
285 Ga0105246_11308707 3300011119 Bacteria 672
286 Ga0157373_10490549 3300013100 Bacteria 887
287 Ga0157370_10104481 3300013104 Bacteria 2652
288 Ga0157374_10328495 3300013296 Bacteria 1517
289 Ga0157374_10430092 3300013296 Bacteria 1320
290 Ga0157374_10460814 3300013296 Bacteria 1273
291 Ga0157374_10854423 3300013296 Bacteria 927
292 Ga0157378_10095979 3300013297 Bacteria 2701
293 Ga0157378_10404118 3300013297 Bacteria 1346
294 Ga0157378_10615398 3300013297 Bacteria 1099
295 Ga0157378_10817666 3300013297 Bacteria 958
296 Ga0163162_10413440 3300013306 Bacteria 1481
297 Ga0163162_10677145 3300013306 Bacteria 1154
298 Ga0157372_10822131 3300013307 Bacteria 1079
299 Ga0157375_10022963 3300013308 Bacteria 5749
300 Ga0157375_10284050 3300013308 Bacteria 1818
301 Ga0157375_10370365 3300013308 Bacteria 1599
302 Ga0157375_11141399 3300013308 Bacteria 913
303 Ga0157375_11652625 3300013308 Bacteria 758
304 Ga0163163_10195936 3300014325 Bacteria 2068
305 Ga0163163_10252362 3300014325 Bacteria 1815
306 Ga0163163_10559247 3300014325 Bacteria 1207
307 Ga0157380_10122053 3300014326 Bacteria 2209
308 Ga0157380_10158264 3300014326 Bacteria 1966
309 Ga0157380_10181760 3300014326 Bacteria 1848
310 Ga0157380_10280804 3300014326 Bacteria 1523
311 Ga0157380_10469416 3300014326 Bacteria 1214
312 Ga0157380_11337038 3300014326 Bacteria 765
313 Ga0157377_10084306 3300014745 Bacteria 1864
314 Ga0157379_10188769 3300014968 Bacteria 1863
315 Ga0157379_10206840 3300014968 Bacteria 1776
316 Ga0157379_10535312 3300014968 Bacteria 1088
317 Ga0157379_10703657 3300014968 Bacteria 948
318 Ga0157379_10718872 3300014968 Bacteria 938
319 Ga0157379_10810248 3300014968 Bacteria 884
320 Ga0157376_10350883 3300014969 Bacteria 1412
321 Ga0157376_10663633 3300014969 Bacteria 1044
322 Ga0163161_10026279 3300017792 Bacteria 4124
323 Ga0163161_10215639 3300017792 Bacteria 1484
324 Ga0163161_10455945 3300017792 Bacteria 1034
325 Ga0163161_10589924 3300017792 Bacteria 915
326 Ga0163161_10852310 3300017792 Bacteria 769
327 Ga0209455_1006055 3300025272 Bacteria 3635
328 Ga0209758_1065794 3300025297 Bacteria 1168
329 Ga0207697_10216455 3300025315 Bacteria 844
330 Ga0207653_10022300 3300025885 Bacteria 2011
331 Ga0207692_10013187 3300025898 Bacteria 3578
332 Ga0207642_10070349 3300025899 Bacteria 1663
333 Ga0207710_10079854 3300025900 Bacteria 1516
334 Ga0207710_10105922 3300025900 Bacteria 1331
335 Ga0207688_10056972 3300025901 Bacteria 2196
336 Ga0207688_10060556 3300025901 Bacteria 2133
337 Ga0207688_10078530 3300025901 Bacteria 1881
338 Ga0207685_10235982 3300025905 Bacteria 877
339 Ga0207699_10023406 3300025906 Bacteria 3362
340 Ga0207645_10061625 3300025907 Bacteria 2396
341 Ga0207645_10107392 3300025907 Bacteria 1805
342 Ga0207645_10372645 3300025907 Bacteria 957
343 Ga0207643_10075327 3300025908 Bacteria 1947
344 Ga0207643_10162292 3300025908 Bacteria 1345
345 Ga0207654_10040629 3300025911 Bacteria 2622
346 Ga0207707_10008592 3300025912 Bacteria 8854
347 Ga0207707_10303361 3300025912 Bacteria 1381
348 Ga0207695_10067565 3300025913 Bacteria 3666
349 Ga0207695_10076493 3300025913 Bacteria 3402
350 Ga0207671_10138314 3300025914 Bacteria 1874
351 Ga0207671_10141677 3300025914 Bacteria 1852
352 Ga0207671_10749271 3300025914 Bacteria 776
353 Ga0207693_10001851 3300025915 Bacteria 18534
354 Ga0207693_10050083 3300025915 Bacteria 3280
355 Ga0207663_10009598 3300025916 Bacteria 5122
356 Ga0207660_10000231 3300025917 Bacteria 35986
357 Ga0207660_10271149 3300025917 Bacteria 1344
358 Ga0207657_10104039 3300025919 Bacteria 2352
359 Ga0207657_10150210 3300025919 Bacteria 1898
360 Ga0207657_10415027 3300025919 Bacteria 1058
361 Ga0207657_10423804 3300025919 Bacteria 1046
362 Ga0207657_10716807 3300025919 Bacteria 776
363 Ga0207649_10000203 3300025920 Bacteria 49683
364 Ga0207649_10210830 3300025920 Bacteria 1378
365 Ga0207652_10000004 3300025921 Bacteria 436303
366 Ga0207652_10431321 3300025921 Bacteria 1188
367 Ga0207652_10924717 3300025921 Bacteria 769
368 Ga0207681_10498316 3300025923 Bacteria 997
369 Ga0207681_10709220 3300025923 Bacteria 837
370 Ga0207694_10154521 3300025924 Bacteria 1850
371 Ga0207694_10428851 3300025924 Bacteria 1102
372 Ga0207650_10344744 3300025925 Bacteria 1224
373 Ga0207659_10230032 3300025926 Bacteria 1495
374 Ga0207659_10606532 3300025926 Bacteria 933
375 Ga0207659_10752920 3300025926 Bacteria 836
376 Ga0207659_10765876 3300025926 Bacteria 828
377 Ga0207687_10052440 3300025927 Bacteria 2847
378 Ga0207664_10214985 3300025929 Bacteria 1665
379 Ga0207644_10231562 3300025931 Bacteria 1468
380 Ga0207644_11293574 3300025931 Bacteria 613
381 Ga0207690_10062103 3300025932 Bacteria 2542
382 Ga0207690_10234716 3300025932 Bacteria 1410
383 Ga0207690_10392706 3300025932 Bacteria 1105
384 Ga0207690_10464502 3300025932 Bacteria 1019
385 Ga0207706_10202309 3300025933 Bacteria 1742
386 Ga0207706_10543517 3300025933 Bacteria 1001
387 Ga0207706_10705820 3300025933 Bacteria 861
388 Ga0207706_10868446 3300025933 Bacteria 763
389 Ga0207686_10192088 3300025934 Bacteria 1456
390 Ga0207686_10210720 3300025934 Bacteria 1397
391 Ga0207709_10129363 3300025935 Bacteria 1718
392 Ga0207709_10359981 3300025935 Bacteria 1101
393 Ga0207709_10402879 3300025935 Bacteria 1046
394 Ga0207709_10510572 3300025935 Bacteria 939
395 Ga0207670_10439481 3300025936 Bacteria 1050
396 Ga0207669_10010625 3300025937 Bacteria 4438
397 Ga0207669_10018303 3300025937 Bacteria 3618
398 Ga0207669_10263510 3300025937 Bacteria 1290
399 Ga0207669_10901723 3300025937 Bacteria 738
400 Ga0207704_10029068 3300025938 Bacteria 3076
401 Ga0207704_10078158 3300025938 Bacteria 2127
402 Ga0207704_10363015 3300025938 Bacteria 1131
403 Ga0207704_11049785 3300025938 Bacteria 691
404 Ga0207665_10033322 3300025939 Bacteria 3413
405 Ga0207691_10065199 3300025940 Bacteria 3298
406 Ga0207711_10040565 3300025941 Bacteria 3961
407 Ga0207711_10109202 3300025941 Bacteria 2458
408 Ga0207711_10447228 3300025941 Bacteria 1203
409 Ga0207689_10121032 3300025942 Bacteria 2153
410 Ga0207689_10333347 3300025942 Bacteria 1260
411 Ga0207661_11381957 3300025944 Bacteria 646
412 Ga0207679_10193770 3300025945 Bacteria 1692
413 Ga0207679_10506363 3300025945 Bacteria 1078
414 Ga0207679_10526820 3300025945 Bacteria 1057
415 Ga0207679_11202631 3300025945 Bacteria 695
416 Ga0207667_10049551 3300025949 Bacteria 4435
417 Ga0207667_10131918 3300025949 Bacteria 2573
418 Ga0207667_11176950 3300025949 Bacteria 747
419 Ga0207651_10021773 3300025960 Bacteria 3904
420 Ga0207712_10151232 3300025961 Bacteria 1793
421 Ga0207712_10350499 3300025961 Bacteria 1227
422 Ga0207668_10047201 3300025972 Bacteria 2947
423 Ga0207668_10253892 3300025972 Bacteria 1429
424 Ga0207668_10270828 3300025972 Bacteria 1388
425 Ga0207668_10300481 3300025972 Bacteria 1324
426 Ga0207668_10397541 3300025972 Bacteria 1164
427 Ga0207668_10443281 3300025972 Bacteria 1106
428 Ga0207668_10587005 3300025972 Bacteria 969
429 Ga0207668_10714670 3300025972 Bacteria 881
430 Ga0207640_10970513 3300025981 Bacteria 746
431 Ga0207640_11147516 3300025981 Bacteria 689
432 Ga0207658_10224874 3300025986 Bacteria 1581
433 Ga0207658_10387261 3300025986 Bacteria 1226
434 Ga0207658_11337975 3300025986 Bacteria 655
435 Ga0207677_10154248 3300026023 Bacteria 1776
436 Ga0207677_10297427 3300026023 Bacteria 1332
437 Ga0207677_10395169 3300026023 Bacteria 1171
438 Ga0207677_10448545 3300026023 Bacteria 1105
439 Ga0207703_10252462 3300026035 Bacteria 1590
440 Ga0207703_10365183 3300026035 Bacteria 1332
441 Ga0207639_10143069 3300026041 Bacteria 1995
442 Ga0207639_10274317 3300026041 Bacteria 1480
443 Ga0207639_10477559 3300026041 Bacteria 1136
444 Ga0207639_10480486 3300026041 Bacteria 1132
445 Ga0207639_10529992 3300026041 Bacteria 1079
446 Ga0207678_10029610 3300026067 Bacteria 4780
447 Ga0207678_10035630 3300026067 Bacteria 4332
448 Ga0207678_10051481 3300026067 Bacteria 3555
449 Ga0207678_10071503 3300026067 Bacteria 2975
450 Ga0207678_10096872 3300026067 Bacteria 2521
451 Ga0207678_10187503 3300026067 Bacteria 1767
452 Ga0207678_10227861 3300026067 Bacteria 1595
453 Ga0207708_10197734 3300026075 Bacteria 1603
454 Ga0207708_10486896 3300026075 Bacteria 1032
455 Ga0207702_10621228 3300026078 Bacteria 1061
456 Ga0207702_11214197 3300026078 Bacteria 748
457 Ga0207641_10186159 3300026088 Bacteria 1905
458 Ga0207641_10659296 3300026088 Bacteria 1028
459 Ga0207648_10166283 3300026089 Bacteria 1949
460 Ga0207648_10327207 3300026089 Bacteria 1378
461 Ga0207648_10449648 3300026089 Bacteria 1173
462 Ga0207648_10704453 3300026089 Bacteria 936
463 Ga0207648_10977017 3300026089 Bacteria 793
464 Ga0207676_10586237 3300026095 Bacteria 1069
465 Ga0207674_10752688 3300026116 Bacteria 940
466 Ga0207674_10862879 3300026116 Bacteria 873
467 Ga0207675_100144538 3300026118 Bacteria 2261
468 Ga0207675_100208285 3300026118 Bacteria 1880
469 Ga0207675_100281521 3300026118 Bacteria 1616
470 Ga0207675_100304369 3300026118 Bacteria 1553
471 Ga0207675_100436423 3300026118 Bacteria 1296
472 Ga0207675_100776359 3300026118 Bacteria 970
473 Ga0207675_100989705 3300026118 Bacteria 859
474 Ga0207683_10038663 3300026121 Bacteria 4161
475 Ga0207683_10185005 3300026121 Bacteria 1890
476 Ga0207683_10195445 3300026121 Bacteria 1838
477 Ga0207683_10637824 3300026121 Bacteria 987
478 Ga0207698_10016150 3300026142 Bacteria 5023
479 Ga0207698_10035640 3300026142 Bacteria 3643
480 Ga0207698_10143685 3300026142 Bacteria 2060
481 Ga0207698_10417687 3300026142 Bacteria 1286
482 Ga0209589_1000006 3300027357 Bacteria 436292
483 Ga0209489_100007 3300027361 Bacteria 436292
484 Ga0209700_100008 3300027363 Bacteria 436292
485 Ga0209813_10002812 3300027866 Bacteria 4025
486 Ga0209813_10191817 3300027866 Bacteria 752
487 Ga0207428_10062077 3300027907 Bacteria 2956
488 Ga0268266_10013121 3300028379 Bacteria 7144
489 Ga0268266_10016287 3300028379 Bacteria 6355
490 Ga0268266_10064405 3300028379 Bacteria 3166
491 Ga0268266_10273960 3300028379 Bacteria 1567
492 Ga0268266_10395588 3300028379 Bacteria 1306
493 Ga0268265_10082483 3300028380 Bacteria 2542
494 Ga0268265_10168396 3300028380 Bacteria 1869
495 Ga0268265_10404034 3300028380 Bacteria 1263
496 Ga0268265_10521205 3300028380 Bacteria 1123
497 Ga0268265_10683197 3300028380 Bacteria 990
498 Ga0268265_10849276 3300028380 Bacteria 893
499 Ga0268264_10281335 3300028381 Bacteria 1558
500 Ga0268264_10332942 3300028381 Bacteria 1439
501 Ga0268264_10923590 3300028381 Bacteria 877
502 Ga0307517_10000085 3300028786 Bacteria 131200
503 Ga0307517_10209702 3300028786 Bacteria 1202
504 Ga0307515_10011214 3300028794 Bacteria 17023
505 Ga0307515_10295072 3300028794 Bacteria 1312
506 Ga0307515_10524383 3300028794 Bacteria 794
507 Ga0307512_10159191 3300030522 Bacteria 1328
508 Ga0265332_10025893 3300031238 Bacteria 2574
509 Ga0265325_10004960 3300031241 Bacteria 8297
510 Ga0265340_10014505 3300031247 Bacteria 4114
511 Ga0265340_10018719 3300031247 Bacteria 3570
512 Ga0265339_10013486 3300031249 Bacteria 4950
513 Ga0265339_10072556 3300031249 Bacteria 1832
514 Ga0265331_10236772 3300031250 Bacteria 820
515 Ga0265316_10332946 3300031344 Bacteria 1101
516 Ga0265316_10755228 3300031344 Bacteria 684
517 Ga0307513_10325561 3300031456 Bacteria 1293
518 Ga0307513_10530068 3300031456 Bacteria 892
519 Ga0307513_10590867 3300031456 Bacteria 820
520 Ga0307509_10165469 3300031507 Bacteria 2101
521 Ga0307509_10449591 3300031507 Bacteria 983
522 Ga0307408_100434618 3300031548 Bacteria 1135
523 Ga0307408_100621191 3300031548 Bacteria 963
524 Ga0307508_10083537 3300031616 Bacteria 2776
525 Ga0307508_10203809 3300031616 Bacteria 1579
526 Ga0307508_10250806 3300031616 Bacteria 1366
527 Ga0265314_10300686 3300031711 Bacteria 900
528 Ga0265342_10355544 3300031712 Bacteria 762
529 Ga0307516_10025519 3300031730 Bacteria 6017
530 Ga0307516_10025796 3300031730 Bacteria 5978
531 Ga0307516_10034272 3300031730 Bacteria 5104
532 Ga0307516_10116824 3300031730 Bacteria 2462
533 Ga0307516_10119591 3300031730 Bacteria 2427
534 Ga0307516_10238955 3300031730 Bacteria 1516
535 Ga0307516_10416953 3300031730 Bacteria 1001
536 Ga0307405_10323080 3300031731 Bacteria 1180
537 Ga0307405_10434658 3300031731 Bacteria 1036
538 Ga0307413_10034590 3300031824 Bacteria 2889
539 Ga0307413_10115918 3300031824 Bacteria 1804
540 Ga0307407_10258486 3300031903 Bacteria 1197
541 Ga0307407_10471285 3300031903 Bacteria 915
542 Ga0307407_10519864 3300031903 Bacteria 875
543 Ga0307412_10103281 3300031911 Bacteria 2020
544 Ga0307412_10272872 3300031911 Bacteria 1324
545 Ga0307412_10477436 3300031911 Bacteria 1033
546 Ga0307409_100328839 3300031995 Bacteria 1433
547 Ga0307416_100614473 3300032002 Bacteria 1168
548 Ga0307416_100620580 3300032002 Bacteria 1163
549 Ga0307416_100881057 3300032002 Bacteria 994
550 Ga0307414_10290685 3300032004 Bacteria 1378
551 Ga0307414_10693417 3300032004 Bacteria 921
552 Ga0307411_10002397 3300032005 Bacteria 8265
553 Ga0307411_10020733 3300032005 Bacteria 3831
554 Ga0307415_100524944 3300032126 Bacteria 1040
555 Ga0307510_10009700 3300033180 Bacteria 11458
556 Ga0307510_10019525 3300033180 Bacteria 7947
557 Ga0307510_10038953 3300033180 Bacteria 5246
558 Ga0315911_1000010 3300033442 Bacteria 322197
559 Ga0373928_0011813 3300035084 Bacteria 1735
560 Ga0373934_0049067 3300035086 Bacteria 1671
561 Ga0373940_0029665 3300035088 Bacteria 1450
562 Ga0373949_0067455 3300035090 Bacteria 931
563 Ga0373932_0005334 3300035112 Bacteria 3024
564 Ga0373936_0122716 3300035113 Bacteria 1111
565 Ga0373941_0002945 3300035115 Bacteria 3805
566 Ga0373953_0001358 3300035117 Bacteria 7042
567 Ga0373954_0001778 3300035118 Bacteria 8862
568 Ga0373956_0005729 3300035119 Bacteria 4967
569 Ga0373957_0002644 3300035120 Bacteria 5141
570 Ga0373955_0001783 3300035172 Bacteria 9235
571 Ga0373942_0122249 3300035207 Bacteria 815
572 Ga0373962_0034362 3300035242 Bacteria 1404
573 Ga0373924_0005305 3300035410 Bacteria 4557
574 Ga0373931_0001895 3300035691 Bacteria 9143
575 Ga0373935_0314397 3300035692 Bacteria 1110
576 Ga0373927_0005360 3300035695 Bacteria 8859
577 Ga0373927_0023382 3300035695 Bacteria 4047
578 Ga0373927_0035091 3300035695 Bacteria 3261
579 Ga0373927_0084258 3300035695 Bacteria 2062
580 Ga0373927_0310887 3300035695 Bacteria 1037
581 Ga0373933_0001908 3300035724 Bacteria 12027
582 Ga0373937_0015839 3300036401 Bacteria 6681
583 Ga0373925_0122843 3300037068 Bacteria 2017
584 Ga0373925_0405153 3300037068 Bacteria 1113
585 Ga0373925_0726130 3300037068 Bacteria 819
586 Ga0395899_0447270 3300037312 Bacteria 847
587 Ga0395898_0289712 3300037466 Bacteria 1562
588 Ga0395898_1067310 3300037466 Bacteria 742
589 Ga0395905_0100628 3300037471 Bacteria 2714
590 Ga0395905_0108120 3300037471 Bacteria 2611
591 Ga0395905_0710893 3300037471 Bacteria 907
592 Ga0395905_1157196 3300037471 Bacteria 677
593 Ga0395901_1019515 3300038443 Bacteria 802
594 Ga0395901_1139082 3300038443 Bacteria 749
595 Ga0439466_0150484 3300041411 Bacteria 713
596 Ga0439465_0079258 3300041413 Bacteria 1111
597 Ga0451789_0496885 3300041443 Bacteria 1094
598 Ga0451839_0837697 3300041496 Bacteria 1287
599 Ga0451851_0996752 3300041507 Bacteria 1225
600 Ga0439458_0029195 3300042157 Bacteria 1308
601 Ga0451577_0000753 3300042876 Bacteria 49360
602 Ga0439440_0222490 3300042993 Bacteria 567
603 Ga0453684_0001250 3300044712 Bacteria 76863
604 Ga0466957_0043947 3300044842 Bacteria 2707
605 Ga0466959_0130291 3300045049 Bacteria 1783
606 Ga0451576_1903073 3300045051 Bacteria 614
607 Ga0495617_006940 3300046452 Bacteria 3953
608 Ga0495617_030440 3300046452 Bacteria 1814
609 Ga0495592_0005568 3300046454 Bacteria 9316
610 Ga0495603_0029466 3300046455 Bacteria 3309
611 Ga0495603_0029732 3300046455 Bacteria 3294
612 Ga0495603_0049543 3300046455 Bacteria 2500
613 Ga0495603_0175304 3300046455 Bacteria 1241
614 Ga0495603_0223566 3300046455 Bacteria 1086
615 Ga0495629_0000922 3300046459 Bacteria 23637
616 Ga0495629_0527996 3300046459 Bacteria 794
617 Ga0495638_0045785 3300046460 Bacteria 2751
618 Ga0495638_0132101 3300046460 Bacteria 1465
619 Ga0495638_0428159 3300046460 Bacteria 680
620 Ga0495641_0201750 3300046461 Bacteria 891
621 Ga0495651_0019485 3300046462 Bacteria 5259
622 Ga0495651_0079787 3300046462 Bacteria 2473
623 Ga0495653_0004517 3300046463 Bacteria 11238
624 Ga0495650_0161393 3300046471 Bacteria 799
625 Ga0495580_0280085 3300046472 Bacteria 1138
626 Ga0495582_0072963 3300046473 Bacteria 1900
627 Ga0495605_0090050 3300046474 Bacteria 1423
628 Ga0495605_0149964 3300046474 Bacteria 1041
629 Ga0495639_0070181 3300046475 Bacteria 1617
630 Ga0495662_0198613 3300046476 Bacteria 989
631 Ga0495662_0265068 3300046476 Bacteria 846
632 Ga0495664_0250928 3300046477 Bacteria 1070
633 Ga0495584_0062955 3300046491 Bacteria 1864
634 Ga0495584_0204234 3300046491 Bacteria 1004
635 Ga0495584_0224730 3300046491 Bacteria 954
636 Ga0495585_0029264 3300046492 Bacteria 3136
637 Ga0495585_0162415 3300046492 Bacteria 1158
638 Ga0495594_0030720 3300046499 Bacteria 2909
639 Ga0495594_0053484 3300046499 Bacteria 2224
640 Ga0495607_0366589 3300046501 Bacteria 662
641 Ga0495607_0442827 3300046501 Bacteria 584
642 Ga0495583_0054834 3300046506 Bacteria 1803
643 Ga0495606_0000976 3300046507 Bacteria 41812
644 Ga0495606_0079533 3300046507 Bacteria 2041
645 Ga0495608_0035885 3300046511 Bacteria 3340
646 Ga0495610_0043698 3300046512 Bacteria 2230
647 Ga0495610_0198225 3300046512 Bacteria 824
648 Ga0495616_0125950 3300046513 Bacteria 1178
649 Ga0495616_0226512 3300046513 Bacteria 812
650 Ga0495620_0053999 3300046515 Bacteria 1699
651 Ga0495620_0065030 3300046515 Bacteria 1506
652 Ga0495620_0111811 3300046515 Bacteria 1082
653 Ga0495628_0030476 3300046516 Bacteria 4367
654 Ga0495631_0015766 3300046518 Bacteria 3614
655 Ga0495631_0107154 3300046518 Bacteria 1201
656 Ga0495631_0140815 3300046518 Bacteria 1036
657 Ga0495631_0155457 3300046518 Bacteria 981
658 Ga0495631_0257257 3300046518 Bacteria 744
659 Ga0495632_0090578 3300046519 Bacteria 1450
660 Ga0495632_0097751 3300046519 Bacteria 1385
661 Ga0495632_0196899 3300046519 Bacteria 919
662 Ga0495632_0303098 3300046519 Bacteria 708
663 Ga0495637_0089553 3300046520 Bacteria 1216
664 Ga0495637_0137071 3300046520 Bacteria 931
665 Ga0495644_0065872 3300046523 Bacteria 1361
666 Ga0495644_0076258 3300046523 Bacteria 1263
667 Ga0495644_0106370 3300046523 Bacteria 1063
668 Ga0495644_0108378 3300046523 Bacteria 1053
669 Ga0495663_0214113 3300046525 Bacteria 676
670 Ga0495663_0262920 3300046525 Bacteria 615
671 Ga0495652_0025506 3300046529 Bacteria 5228
672 Ga0495652_0205375 3300046529 Bacteria 1492
673 Ga0495652_0247135 3300046529 Bacteria 1324
674 Ga0495640_0035468 3300046533 Bacteria 3530
675 Ga0495587_0013911 3300046536 Bacteria 5052
676 Ga0495598_0009888 3300046537 Bacteria 2268
677 Ga0495598_0027478 3300046537 Bacteria 1570
678 Ga0495609_0022606 3300046538 Bacteria 2896
679 Ga0495609_0170564 3300046538 Bacteria 919
680 Ga0495609_0198945 3300046538 Bacteria 838
681 Ga0495621_0213857 3300046539 Bacteria 778
682 Ga0495597_0198730 3300046542 Bacteria 804
683 Ga0495645_0029715 3300046543 Bacteria 3976
684 Ga0495622_0078533 3300046557 Bacteria 1520
685 Ga0495633_0038360 3300046558 Bacteria 2288
686 Ga0495667_0007856 3300046559 Bacteria 7228
687 Ga0495667_0438941 3300046559 Bacteria 821
688 Ga0495656_0005268 3300046615 Bacteria 4455
689 Ga0495656_0056879 3300046615 Bacteria 1691
690 Ga0495656_0089573 3300046615 Bacteria 1404
691 Ga0495656_0110573 3300046615 Bacteria 1284
692 Ga0495668_0044002 3300046616 Bacteria 2481
693 Ga0495668_0070051 3300046616 Bacteria 1928
694 Ga0495668_0223332 3300046616 Bacteria 1031
695 Ga0495668_0240425 3300046616 Bacteria 991
696 Ga0495668_0270841 3300046616 Bacteria 930
697 Ga0495668_0352017 3300046616 Bacteria 808
698 Ga0495634_0010895 3300046642 Bacteria 6638
699 Ga0495611_0087431 3300046648 Bacteria 1438
700 Ga0495611_0159732 3300046648 Bacteria 1053
701 Ga0495625_0148756 3300046660 Bacteria 1575
702 Ga0495625_0206903 3300046660 Bacteria 1292
703 Ga0495625_0264340 3300046660 Bacteria 1112
704 Ga0495625_0348077 3300046660 Bacteria 937
705 Ga0495625_0390423 3300046660 Bacteria 871
706 Ga0495625_0528591 3300046660 Bacteria 717
707 Ga0495635_0002149 3300046663 Bacteria 13377
708 Ga0495635_0126515 3300046663 Bacteria 1743
709 Ga0495659_0006815 3300046664 Bacteria 3610
710 Ga0495661_0103488 3300046665 Bacteria 1598
711 Ga0495661_0155973 3300046665 Bacteria 1229
712 Ga0495661_0285868 3300046665 Bacteria 830
713 Ga0495588_0243798 3300046674 Bacteria 948
714 Ga0495588_0256813 3300046674 Bacteria 921
715 Ga0495588_0306992 3300046674 Bacteria 835
716 Ga0495657_0026686 3300046675 Bacteria 4087
717 Ga0495657_0539973 3300046675 Bacteria 678
718 Ga0495599_0001827 3300046678 Bacteria 12344
719 Ga0495623_0170793 3300046679 Bacteria 1270
720 Ga0495647_0014634 3300046681 Bacteria 2737
721 Ga0495647_0302618 3300046681 Bacteria 721
722 Ga0495669_0000675 3300046684 Bacteria 14839
723 Ga0495669_0104914 3300046684 Bacteria 1315
724 Ga0495669_0134897 3300046684 Bacteria 1163
725 Ga0495669_0254771 3300046684 Bacteria 843
726 Ga0495669_0476162 3300046684 Bacteria 607
727 Ga0495613_0092686 3300046689 Bacteria 2187
728 Ga0495613_0254730 3300046689 Bacteria 1224
729 Ga0495670_0012092 3300046691 Bacteria 4246
730 Ga0495670_0163891 3300046691 Bacteria 1169
731 Ga0495671_0230596 3300046692 Bacteria 895
732 Ga0495589_0087665 3300046794 Bacteria 1511
733 Ga0495600_0006396 3300046809 Bacteria 7170
734 Ga0495600_0159162 3300046809 Bacteria 1460
735 Ga0495600_0435927 3300046809 Bacteria 812
736 Ga0495581_0138320 3300047315 Bacteria 1420
737 Ga0495604_0005881 3300047317 Bacteria 9725
738 Ga0495636_0040926 3300047318 Bacteria 1922
739 Ga0495636_0139869 3300047318 Bacteria 1081
740 Ga0495636_0378807 3300047318 Bacteria 671
741 Ga0495674_0060932 3300047319 Bacteria 3290
742 Ga0495672_0029388 3300047320 Bacteria 3461
743 Ga0495672_0030049 3300047320 Bacteria 3414
744 Ga0495680_0009327 3300047322 Bacteria 8839
745 Ga0495683_0037356 3300047323 Bacteria 2462
746 Ga0495675_0008213 3300047444 Bacteria 6458
747 Ga0495677_0084468 3300047445 Bacteria 1192
748 Ga0495685_099265 3300047447 Bacteria 962
749 Ga0495673_0034976 3300047469 Bacteria 2319
750 Ga0495673_0102385 3300047469 Bacteria 1156
751 Ga0495673_0109406 3300047469 Bacteria 1107
752 Ga0495684_0026359 3300047471 Bacteria 4466
753 Ga0495686_0118536 3300047472 Bacteria 1580
754 Ga0495686_0180571 3300047472 Bacteria 1223
755 Ga0495686_0196855 3300047472 Bacteria 1158
756 Ga0495593_0008299 3300047673 Bacteria 6044
757 Ga0495593_0182007 3300047673 Bacteria 1058
758 Ga0495593_0207551 3300047673 Bacteria 984
759 Ga0495602_0011154 3300048088 Bacteria 9300
760 Ga0496100_0001613 3300048903 Bacteria 11146
761 Ga0496100_0394378 3300048903 Bacteria 1053
762 Ga0496100_0652085 3300048903 Bacteria 820
763 Ga0496100_1298602 3300048903 Bacteria 574
764 Ga0496100_1319465 3300048903 Bacteria 569
765 Ga0496101_0004421 3300048904 Bacteria 8844
766 Ga0496101_0092016 3300048904 Bacteria 2257
767 Ga0496101_0254104 3300048904 Bacteria 1370
768 Ga0496101_0366155 3300048904 Bacteria 1133
769 Ga0496101_1046176 3300048904 Bacteria 642
770 Ga0496102_0010509 3300048905 Bacteria 7970
771 Ga0496102_0012054 3300048905 Bacteria 7470
772 Ga0496102_0142359 3300048905 Bacteria 2249
773 Ga0496102_0195854 3300048905 Bacteria 1904
774 Ga0496102_0581821 3300048905 Bacteria 1042
775 Ga0496102_0848660 3300048905 Bacteria 835
776 Ga0496102_0876304 3300048905 Bacteria 820
777 Ga0496103_0028159 3300048906 Bacteria 3408
778 Ga0496103_0333963 3300048906 Bacteria 975
779 Ga0496104_0000264 3300048907 Bacteria 46250
780 Ga0496104_0081042 3300048907 Bacteria 3094
781 Ga0496104_0303660 3300048907 Bacteria 1508
782 Ga0496104_0430551 3300048907 Bacteria 1231
783 Ga0496104_0805641 3300048907 Bacteria 845
784 Ga0496105_0004722 3300048908 Bacteria 10282
785 Ga0496105_0024811 3300048908 Bacteria 4873
786 Ga0496105_0067512 3300048908 Bacteria 2953
787 Ga0496105_0258114 3300048908 Bacteria 1410
788 Ga0496106_0040286 3300048909 Bacteria 3498
789 Ga0496106_0128796 3300048909 Bacteria 1983
790 Ga0496106_0463958 3300048909 Bacteria 1017
791 Ga0496106_0500068 3300048909 Bacteria 976
792 Ga0496107_0004750 3300048910 Bacteria 9230
793 Ga0496107_0010483 3300048910 Bacteria 6442
794 Ga0496107_0106435 3300048910 Bacteria 2060
795 Ga0496107_0605431 3300048910 Bacteria 810
796 Ga0496108_0067242 3300048911 Bacteria 3022
797 Ga0496108_0081956 3300048911 Bacteria 2735
798 Ga0496109_0007688 3300048912 Bacteria 9135
799 Ga0496109_0010512 3300048912 Bacteria 7909
800 Ga0496109_0063721 3300048912 Bacteria 3372
801 Ga0496109_0181768 3300048912 Bacteria 1975
802 Ga0496109_0700640 3300048912 Bacteria 950
803 Ga0496110_0007695 3300048913 Bacteria 8620
804 Ga0496110_0009156 3300048913 Bacteria 7996
805 Ga0496110_0018621 3300048913 Bacteria 5824
806 Ga0496110_0300721 3300048913 Bacteria 1461
807 Ga0496110_0578618 3300048913 Bacteria 1020
808 Ga0496111_0003597 3300048914 Bacteria 9607
809 Ga0496111_0037700 3300048914 Bacteria 3460
810 Ga0496111_0127639 3300048914 Bacteria 1881
811 Ga0496111_0614863 3300048914 Bacteria 795
812 Ga0496112_0025430 3300048915 Bacteria 5685
813 Ga0496112_0070372 3300048915 Bacteria 3457
814 Ga0496112_0271642 3300048915 Bacteria 1643
815 Ga0496112_0542299 3300048915 Bacteria 1097
816 Ga0496112_0812483 3300048915 Bacteria 859
817 Ga0496113_0005354 3300048916 Bacteria 7996
818 Ga0496113_0006480 3300048916 Bacteria 7425
819 Ga0496113_0053298 3300048916 Bacteria 3024
820 Ga0496113_0384699 3300048916 Bacteria 1126
821 Ga0496113_0395933 3300048916 Bacteria 1109
822 Ga0496114_0004664 3300048917 Bacteria 10654
823 Ga0496114_0008103 3300048917 Bacteria 8322
824 Ga0496114_0110348 3300048917 Bacteria 2356
825 Ga0496114_0545311 3300048917 Bacteria 1025
826 Ga0496114_0558059 3300048917 Bacteria 1011
827 Ga0496114_0924234 3300048917 Bacteria 754
828 Ga0496115_0005898 3300048918 Bacteria 8932
829 Ga0496115_0274401 3300048918 Bacteria 1385
830 Ga0496115_0280060 3300048918 Bacteria 1369
831 Ga0496117_0163140 3300048920 Bacteria 1303
832 Ga0496118_0307866 3300048921 Bacteria 866
833 Ga0496119_0033029 3300048922 Bacteria 3440
834 Ga0496119_0168520 3300048922 Bacteria 1159
835 Ga0496120_0140607 3300048923 Bacteria 1226
836 Ga0496121_0000178 3300048924 Bacteria 141429
837 Ga0496121_0047711 3300048924 Bacteria 3651
838 Ga0496121_0115654 3300048924 Bacteria 2036
839 Ga0496121_0117262 3300048924 Bacteria 2017
840 Ga0496121_0144691 3300048924 Bacteria 1758
841 Ga0496121_0162927 3300048924 Bacteria 1628
842 Ga0496121_0231223 3300048924 Bacteria 1295
843 Ga0496121_0316954 3300048924 Bacteria 1051
844 Ga0496121_0685010 3300048924 Bacteria 619
845 Ga0496124_0160570 3300048927 Bacteria 1752
846 Ga0496124_0588364 3300048927 Bacteria 726
847 Ga0496125_0009067 3300048928 Bacteria 10297
848 Ga0496125_0076632 3300048928 Bacteria 2581
849 Ga0496125_0145306 3300048928 Bacteria 1640
850 Ga0496126_0007639 3300048929 Bacteria 11802
851 Ga0496126_0034270 3300048929 Bacteria 4769
852 Ga0496126_0051129 3300048929 Bacteria 3763
853 Ga0496126_0095324 3300048929 Bacteria 2610
854 Ga0496126_0143672 3300048929 Bacteria 2051
855 Ga0496126_0153196 3300048929 Bacteria 1974
856 Ga0496126_0195935 3300048929 Bacteria 1708
857 Ga0496126_0302736 3300048929 Bacteria 1318
858 Ga0496126_0341302 3300048929 Bacteria 1227
859 Ga0496126_0346739 3300048929 Bacteria 1215
860 Ga0496126_0457340 3300048929 Bacteria 1026
861 Ga0496126_0495118 3300048929 Bacteria 977
862 Ga0496126_0513915 3300048929 Bacteria 955
863 Ga0495678_035270 3300049459 Bacteria 2052
864 Ga0495682_0076929 3300049460 Bacteria 1200
865 Ga0501031_0661590 3300049568 Bacteria 671
866 Ga0501034_0213375 3300049571 Bacteria 1885
867 Ga0501039_1139986 3300049575 Bacteria 604
868 Ga0501047_0116166 3300049581 Bacteria 2558
869 Ga0501047_0137786 3300049581 Bacteria 2320
870 Ga0501067_0068698 3300049583 Bacteria 1962
871 Ga0501067_0073388 3300049583 Bacteria 1896
872 Ga0501076_1160462 3300049592 Bacteria 636
873 nmdc:mga03n38_140855_c1 3300050490 Bacteria 1204
874 nmdc:mga03n38_141278_c1 3300050490 Bacteria 1203
875 nmdc:mga03n38_257587_c1 3300050490 Bacteria 924
876 nmdc:mga03n38_40050_c1 3300050490 Bacteria 2035
877 nmdc:mga00v17_162573_c1 3300050491 Bacteria 1438
878 nmdc:mga00v17_20052_c1 3300050491 Bacteria 3826
879 nmdc:mga00v17_277365_c1 3300050491 Bacteria 1088
880 nmdc:mga00v17_39463_c1 3300050491 Bacteria 2828
881 nmdc:mga0yw44_166004_c1 3300050492 Bacteria 1447
882 nmdc:mga0yw44_17750_c1 3300050492 Bacteria 3881
883 nmdc:mga0yw44_41431_c1 3300050492 Unclassified 2741
884 nmdc:mga0yw44_780845_c1 3300050492 Bacteria 649
885 nmdc:mga0k408_247025_c1 3300050493 Bacteria 1066
886 nmdc:mga0k408_477258_c1 3300050493 Bacteria 740
887 nmdc:mga06z11_12508_c1 3300050494 Bacteria 3694
888 nmdc:mga06z11_226138_c1 3300050494 Bacteria 1095
889 nmdc:mga06z11_276415_c1 3300050494 Bacteria 994
890 nmdc:mga06z11_32790_c1 3300050494 Bacteria 2536
891 nmdc:mga06z11_448217_c1 3300050494 Bacteria 780
892 nmdc:mga06z11_84892_c1 3300050494 Bacteria 1707
893 nmdc:mga04h51_146802_c1 3300050495 Bacteria 899
894 nmdc:mga04h51_66211_c1 3300050495 Bacteria 1251
895 nmdc:mga07m45_198930_c1 3300050496 Bacteria 1165
896 nmdc:mga07m45_41448_c1 3300050496 Bacteria 2578
897 nmdc:mga07m45_420172_c1 3300050496 Bacteria 776
898 nmdc:mga07m45_47017_c1 3300050496 Bacteria 2425
899 nmdc:mga05p37_1432600_c1 3300050507 Bacteria 693
900 nmdc:mga05p37_280399_c1 3300050507 Bacteria 1988
901 nmdc:mga05p37_29696_c2 3300050507 Bacteria 5761
902 nmdc:mga09592_373507_c1 3300050508 Bacteria 1233
903 nmdc:mga06r32_12202_c1 3300050510 Bacteria 7749
904 nmdc:mga08y16_252069_c1 3300050511 Bacteria 1824
905 nmdc:mga08y16_52748_c1 3300050511 Bacteria 4254
906 nmdc:mga08y16_678874_c1 3300050511 Bacteria 1032
907 nmdc:mga0n895_231793_c1 3300050512 Bacteria 1874
908 nmdc:mga0n895_96815_c1 3300050512 Bacteria 2956
909 nmdc:mga0rr50_418514_c1 3300050513 Bacteria 1133
910 nmdc:mga08x19_688452_c1 3300050514 Bacteria 725
911 nmdc:mga0a205_205529_c1 3300050515 Bacteria 1858
912 nmdc:mga0sz30_108053_c1 3300050516 Bacteria 1218
913 nmdc:mga0sz30_192682_c1 3300050516 Bacteria 905
914 nmdc:mga0sz30_215855_c1 3300050516 Bacteria 853
915 nmdc:mga0sz30_2375_c1 3300050516 Bacteria 6399
916 Ga0495601_0099317 3300053077 Bacteria 1879
917 Ga0495612_0074765 3300053078 Bacteria 1417
918 Ga0500635_0002566 3300053080 Bacteria 4515
919 Ga0495655_0028464 3300053083 Bacteria 1335
920 Ga0495655_0227871 3300053083 Bacteria 619
921 Ga0495595_0003401 3300053084 Bacteria 6323
922 Ga0495595_0022694 3300053084 Bacteria 2757
923 Ga0495619_0011847 3300053085 Bacteria 5492
924 Ga0495619_0037524 3300053085 Bacteria 3158
925 Ga0495619_0344012 3300053085 Bacteria 1032
926 Ga0500578_0094848 3300053086 Bacteria 1893
927 Ga0500643_034871 3300053087 Bacteria 1513
928 Ga0500646_0025692 3300053090 Bacteria 1592
929 Ga0500583_0146990 3300053092 Bacteria 1172
930 Ga0500566_0024402 3300053094 Bacteria 3550
931 Ga0500641_0003076 3300053096 Bacteria 5913
932 Ga0500641_0034871 3300053096 Bacteria 2005
933 Ga0500641_0078769 3300053096 Bacteria 1396
934 Ga0500650_0133385 3300053098 Bacteria 1154
935 Ga0500654_097892 3300053099 Bacteria 1268
936 Ga0500554_002814 3300053102 Bacteria 3475
937 Ga0500562_057460 3300053108 Bacteria 1044
938 Ga0500569_000323 3300053109 Bacteria 7662
939 Ga0500595_002264 3300053119 Bacteria 9721
940 Ga0500595_002758 3300053119 Bacteria 8465
941 Ga0500595_003563 3300053119 Bacteria 7231
942 Ga0500595_134736 3300053119 Bacteria 694
943 Ga0500655_067473 3300053133 Bacteria 726
944 Ga0500561_0053717 3300053137 Bacteria 1108
945 Ga0500568_0132400 3300053139 Bacteria 926
946 Ga0500577_0021539 3300053142 Bacteria 2125
947 Ga0500577_0078843 3300053142 Bacteria 1309
948 Ga0500588_0055913 3300053146 Bacteria 1247
949 Ga0500588_0246146 3300053146 Bacteria 670
950 Ga0500589_013888 3300053147 Bacteria 3559
951 Ga0500589_149998 3300053147 Bacteria 950
952 Ga0500603_002517 3300053150 Bacteria 4001
953 Ga0500616_0074173 3300053153 Bacteria 1725
954 Ga0500616_0084438 3300053153 Bacteria 1588
955 Ga0500616_0178677 3300053153 Bacteria 957
956 Ga0500622_0055243 3300053156 Bacteria 2035
957 Ga0500633_0039755 3300053160 Bacteria 1574
958 Ga0500634_0042288 3300053161 Bacteria 2472
959 Ga0500638_089332 3300053162 Bacteria 1453
960 Ga0500636_0026335 3300053177 Bacteria 3437
961 Ga0500636_0219900 3300053177 Bacteria 990
962 Ga0500636_0446545 3300053177 Bacteria 586
963 Ga0500637_0000600 3300053178 Bacteria 14194
964 Ga0500637_0020687 3300053178 Bacteria 3567
965 Ga0500645_020268 3300053730 Bacteria 2062
966 Ga0500645_020334 3300053730 Bacteria 2058
967 Ga0500645_084809 3300053730 Bacteria 902
968 Ga0500609_000821 3300053731 Bacteria 4665
969 Ga0500661_004937 3300055283 Bacteria 2498

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_11562928 Ga0105245_115629282 138
2 3300025315 Ga0207697_10216455 Ga0207697_102164552 148
3 iso_pu_bacteria 2908739725 2908744989 150
4 3300046512 Ga0495610_0043698 Ga0495610_0043698_1621_2130 151
5 3300005334 Ga0068869_101162221 Ga0068869_1011622211 153
6 3300042876 Ga0451577_0000753 Ga0451577_0000753_37499_37996 154
7 3300044712 Ga0453684_0001250 Ga0453684_0001250_32283_32780 154
8 3300005344 Ga0070661_100000014 Ga0070661_10000001448 157
9 3300005618 Ga0068864_101370879 Ga0068864_1013708792 157
10 3300025920 Ga0207649_10000203 Ga0207649_1000020323 157
11 3300031730 Ga0307516_10034272 Ga0307516_100342724 158
12 3300005336 Ga0070680_100000088 Ga0070680_10000008854 159
13 3300005458 Ga0070681_10370790 Ga0070681_103707901 159
14 3300005530 Ga0070679_100000003 Ga0070679_100000003221 159
15 3300005548 Ga0070665_100104062 Ga0070665_1001040622 159
16 3300009551 Ga0105238_10158752 Ga0105238_101587522 159
17 3300009553 Ga0105249_10432775 Ga0105249_104327753 159
18 3300013100 Ga0157373_10490549 Ga0157373_104905491 159
19 3300013104 Ga0157370_10104481 Ga0157370_101044813 159
20 3300025912 Ga0207707_10303361 Ga0207707_103033612 159
21 3300025917 Ga0207660_10000231 Ga0207660_1000023121 159
22 3300025921 Ga0207652_10000004 Ga0207652_10000004222 159
23 3300025961 Ga0207712_10350499 Ga0207712_103504992 159
24 3300038443 Ga0395901_1139082 Ga0395901_1139082_18_497 159
25 3300031247 Ga0265340_10014505 Ga0265340_100145054 161
26 3300006038 Ga0075365_10071612 Ga0075365_100716123 162
27 3300006353 Ga0075370_10364212 Ga0075370_103642122 162
28 3300050492 nmdc:mga0yw44_41431_c1 nmdc:mga0yw44_41431_c1_1637_2149 162
29 iso_pu_bacteria 2513237096 2513654957 163
30 iso_pu_bacteria 2513237137 2513861247 163
31 iso_pu_bacteria 2513237145 2513916020 163
32 iso_pu_bacteria 2517572143 2517894676 163
33 iso_pu_bacteria 2524023228 2524534416 163
34 iso_pu_bacteria 2667528175 2671119098 163
35 iso_pu_bacteria 2728368998 2728747665 163
36 iso_pu_bacteria 2885374607 2885382406 163
37 iso_pu_bacteria 2903748898 2903757864 163
38 iso_pu_bacteria 2904699407 2904705710 163
39 iso_pu_bacteria 2906610324 2906611403 163
40 iso_pu_bacteria 2906635258 2906641559 163
41 iso_pu_bacteria 2906660503 2906661263 163
42 iso_pu_bacteria 2922361189 2922366932 163
43 iso_pu_bacteria 2922425934 2922427964 163
44 iso_pu_bacteria 2935630451 2935632117 163
45 iso_pu_bacteria 2941507105 2941508065 163
46 iso_pu_bacteria 2941515067 2941515430 163
47 iso_pu_bacteria 2941523033 2941523995 163
48 iso_pu_bacteria 3005474847 3005477672 163
49 iso_pu_bacteria 8006933436 8006933546 163
50 iso_pu_bacteria 8006973647 8006983219 163
51 iso_pu_bacteria 8019555841 8019559471 163
52 iso_pu_bacteria 8019565922 8019569574 163
53 3300048908 Ga0496105_0024811 Ga0496105_0024811_11_511 164
54 3300048928 Ga0496125_0009067 Ga0496125_0009067_5445_5993 164
55 3300048929 Ga0496126_0495118 Ga0496126_0495118_151_699 164
56 iso_pu_bacteria 2513237101 2513697361 164
57 iso_pu_bacteria 2721755755 2723843143 164
58 iso_pu_bacteria 2876808645 2876815420 164
59 iso_pu_bacteria 2879110137 2879117970 164
60 iso_pu_bacteria 2889033259 2889033556 164
61 iso_pu_bacteria 2922386360 2922390291 164
62 iso_pu_bacteria 8006964411 8006971340 164
63 iso_pu_bacteria 8006984368 8006989292 164
64 iso_pu_bacteria 8006994254 8006997768 164
65 iso_pu_bacteria 8056673599 8056674807 164
66 iso_pu_bacteria 2791355199 2793079454 165
67 3300003659 JGI25404J52841_10019463 JGI25404J52841_100194632 166
68 3300005455 Ga0070663_100629013 Ga0070663_1006290132 166
69 3300005937 Ga0081455_10017249 Ga0081455_100172493 166
70 3300005937 Ga0081455_10262950 Ga0081455_102629501 166
71 3300005983 Ga0081540_1152867 Ga0081540_11528672 166
72 3300049581 Ga0501047_0116166 Ga0501047_0116166_1945_2460 166
73 3300005327 Ga0070658_10090223 Ga0070658_100902232 167
74 3300005328 Ga0070676_10211892 Ga0070676_102118921 167
75 3300005330 Ga0070690_100855336 Ga0070690_1008553361 167
76 3300005334 Ga0068869_100111564 Ga0068869_1001115642 167
77 3300005334 Ga0068869_100133194 Ga0068869_1001331941 167
78 3300005338 Ga0068868_100330768 Ga0068868_1003307682 167
79 3300005339 Ga0070660_100095121 Ga0070660_1000951212 167
80 3300005345 Ga0070692_10185736 Ga0070692_101857361 167
81 3300005353 Ga0070669_101064525 Ga0070669_1010645251 167
82 3300005355 Ga0070671_100196427 Ga0070671_1001964273 167
83 3300005355 Ga0070671_100270463 Ga0070671_1002704632 167
84 3300005356 Ga0070674_100035143 Ga0070674_1000351434 167
85 3300005365 Ga0070688_100317063 Ga0070688_1003170631 167
86 3300005366 Ga0070659_100334759 Ga0070659_1003347591 167
87 3300005367 Ga0070667_100559616 Ga0070667_1005596162 167
88 3300005438 Ga0070701_10364149 Ga0070701_103641492 167
89 3300005455 Ga0070663_100189605 Ga0070663_1001896053 167
90 3300005456 Ga0070678_100039559 Ga0070678_1000395594 167
91 3300005456 Ga0070678_100158466 Ga0070678_1001584663 167
92 3300005456 Ga0070678_101158368 Ga0070678_1011583682 167
93 3300005457 Ga0070662_100507483 Ga0070662_1005074832 167
94 3300005458 Ga0070681_10069164 Ga0070681_100691645 167
95 3300005459 Ga0068867_100358570 Ga0068867_1003585702 167
96 3300005466 Ga0070685_10981054 Ga0070685_109810541 167
97 3300005518 Ga0070699_101543569 Ga0070699_1015435691 167
98 3300005539 Ga0068853_100406003 Ga0068853_1004060032 167
99 3300005539 Ga0068853_101374817 Ga0068853_1013748171 167
100 3300005543 Ga0070672_100411830 Ga0070672_1004118302 167
101 3300005543 Ga0070672_100545270 Ga0070672_1005452702 167
102 3300005544 Ga0070686_100149257 Ga0070686_1001492572 167
103 3300005548 Ga0070665_100253571 Ga0070665_1002535713 167
104 3300005548 Ga0070665_100503129 Ga0070665_1005031292 167
105 3300005548 Ga0070665_101429373 Ga0070665_1014293731 167
106 3300005563 Ga0068855_100172069 Ga0068855_1001720691 167
107 3300005564 Ga0070664_100533733 Ga0070664_1005337332 167
108 3300005614 Ga0068856_100206953 Ga0068856_1002069533 167
109 3300005615 Ga0070702_100194975 Ga0070702_1001949752 167
110 3300005616 Ga0068852_100103442 Ga0068852_1001034422 167
111 3300005616 Ga0068852_100558585 Ga0068852_1005585853 167
112 3300005617 Ga0068859_100067475 Ga0068859_1000674754 167
113 3300005618 Ga0068864_100111310 Ga0068864_1001113102 167
114 3300005840 Ga0068870_10251097 Ga0068870_102510972 167
115 3300005841 Ga0068863_100441310 Ga0068863_1004413102 167
116 3300005841 Ga0068863_101015078 Ga0068863_1010150782 167
117 3300005843 Ga0068860_100128258 Ga0068860_1001282582 167
118 3300005843 Ga0068860_100272452 Ga0068860_1002724523 167
119 3300005843 Ga0068860_101427262 Ga0068860_1014272621 167
120 3300005844 Ga0068862_100197996 Ga0068862_1001979962 167
121 3300005844 Ga0068862_100669716 Ga0068862_1006697162 167
122 3300005844 Ga0068862_100796587 Ga0068862_1007965871 167
123 3300005844 Ga0068862_101743178 Ga0068862_1017431781 167
124 3300005937 Ga0081455_10003699 Ga0081455_100036992 167
125 3300005937 Ga0081455_10127588 Ga0081455_101275882 167
126 3300005937 Ga0081455_10159826 Ga0081455_101598262 167
127 3300005981 Ga0081538_10020833 Ga0081538_100208336 167
128 3300005983 Ga0081540_1003091 Ga0081540_100309110 167
129 3300005983 Ga0081540_1072847 Ga0081540_10728472 167
130 3300006038 Ga0075365_10026143 Ga0075365_100261432 167
131 3300006038 Ga0075365_10446381 Ga0075365_104463812 167
132 3300006042 Ga0075368_10002858 Ga0075368_100028585 167
133 3300006048 Ga0075363_100003690 Ga0075363_1000036903 167
134 3300006048 Ga0075363_100092560 Ga0075363_1000925603 167
135 3300006048 Ga0075363_100496104 Ga0075363_1004961041 167
136 3300006051 Ga0075364_10017241 Ga0075364_100172411 167
137 3300006051 Ga0075364_10022187 Ga0075364_100221872 167
138 3300006177 Ga0075362_10008950 Ga0075362_100089504 167
139 3300006178 Ga0075367_10011042 Ga0075367_100110425 167
140 3300006178 Ga0075367_10202959 Ga0075367_102029592 167
141 3300006178 Ga0075367_10245861 Ga0075367_102458612 167
142 3300006178 Ga0075367_10306749 Ga0075367_103067492 167
143 3300006178 Ga0075367_10611856 Ga0075367_106118561 167
144 3300006186 Ga0075369_10011190 Ga0075369_100111902 167
145 3300006186 Ga0075369_10026249 Ga0075369_100262493 167
146 3300006195 Ga0075366_10074726 Ga0075366_100747263 167
147 3300006237 Ga0097621_100365951 Ga0097621_1003659512 167
148 3300006353 Ga0075370_10092808 Ga0075370_100928082 167
149 3300006353 Ga0075370_10180483 Ga0075370_101804831 167
150 3300006358 Ga0068871_100107291 Ga0068871_1001072911 167
151 3300006358 Ga0068871_100220538 Ga0068871_1002205381 167
152 3300006844 Ga0075428_100025159 Ga0075428_1000251596 167
153 3300006844 Ga0075428_100220390 Ga0075428_1002203903 167
154 3300006846 Ga0075430_101210418 Ga0075430_1012104181 167
155 3300006847 Ga0075431_100001712 Ga0075431_10000171216 167
156 3300006871 Ga0075434_100357445 Ga0075434_1003574453 167
157 3300006914 Ga0075436_100232485 Ga0075436_1002324852 167
158 3300006931 Ga0097620_100067486 Ga0097620_1000674864 167
159 3300006942 Ga0099824_1003225 Ga0099824_100322518 167
160 3300006943 Ga0099822_1005628 Ga0099822_100562814 167
161 3300009094 Ga0111539_10261925 Ga0111539_102619252 167
162 3300009098 Ga0105245_10444822 Ga0105245_104448222 167
163 3300009101 Ga0105247_10196299 Ga0105247_101962991 167
164 3300009147 Ga0114129_10037884 Ga0114129_100378848 167
165 3300009147 Ga0114129_10345513 Ga0114129_103455132 167
166 3300009147 Ga0114129_11387469 Ga0114129_113874692 167
167 3300009148 Ga0105243_10282716 Ga0105243_102827162 167
168 3300009148 Ga0105243_10691454 Ga0105243_106914542 167
169 3300009174 Ga0105241_10155119 Ga0105241_101551192 167
170 3300009176 Ga0105242_10315136 Ga0105242_103151362 167
171 3300009176 Ga0105242_10650033 Ga0105242_106500332 167
172 3300009176 Ga0105242_11194681 Ga0105242_111946811 167
173 3300009177 Ga0105248_10098374 Ga0105248_100983743 167
174 3300009177 Ga0105248_10108780 Ga0105248_101087802 167
175 3300009545 Ga0105237_10455384 Ga0105237_104553842 167
176 3300009545 Ga0105237_11323625 Ga0105237_113236251 167
177 3300009551 Ga0105238_10620758 Ga0105238_106207582 167
178 3300009553 Ga0105249_10806331 Ga0105249_108063311 167
179 3300009553 Ga0105249_11240327 Ga0105249_112403271 167
180 3300009553 Ga0105249_12030534 Ga0105249_120305342 167
181 3300010375 Ga0105239_10024893 Ga0105239_100248937 167
182 3300010375 Ga0105239_10242659 Ga0105239_102426594 167
183 3300011119 Ga0105246_10348769 Ga0105246_103487692 167
184 3300011119 Ga0105246_11308707 Ga0105246_113087071 167
185 3300013296 Ga0157374_10854423 Ga0157374_108544232 167
186 3300013297 Ga0157378_10615398 Ga0157378_106153982 167
187 3300013306 Ga0163162_10677145 Ga0163162_106771452 167
188 3300013308 Ga0157375_10370365 Ga0157375_103703653 167
189 3300013308 Ga0157375_11652625 Ga0157375_116526252 167
190 3300014325 Ga0163163_10252362 Ga0163163_102523622 167
191 3300014325 Ga0163163_10559247 Ga0163163_105592472 167
192 3300014326 Ga0157380_10122053 Ga0157380_101220532 167
193 3300014326 Ga0157380_10469416 Ga0157380_104694161 167
194 3300014745 Ga0157377_10084306 Ga0157377_100843062 167
195 3300014968 Ga0157379_10535312 Ga0157379_105353122 167
196 3300014969 Ga0157376_10350883 Ga0157376_103508832 167
197 3300017792 Ga0163161_10455945 Ga0163161_104559452 167
198 3300017792 Ga0163161_10852310 Ga0163161_108523102 167
199 3300025272 Ga0209455_1006055 Ga0209455_10060554 167
200 3300025885 Ga0207653_10022300 Ga0207653_100223002 167
201 3300025900 Ga0207710_10079854 Ga0207710_100798543 167
202 3300025900 Ga0207710_10105922 Ga0207710_101059222 167
203 3300025905 Ga0207685_10235982 Ga0207685_102359821 167
204 3300025907 Ga0207645_10107392 Ga0207645_101073922 167
205 3300025908 Ga0207643_10162292 Ga0207643_101622922 167
206 3300025911 Ga0207654_10040629 Ga0207654_100406295 167
207 3300025914 Ga0207671_10141677 Ga0207671_101416772 167
208 3300025919 Ga0207657_10104039 Ga0207657_101040393 167
209 3300025919 Ga0207657_10150210 Ga0207657_101502103 167
210 3300025921 Ga0207652_10431321 Ga0207652_104313212 167
211 3300025923 Ga0207681_10498316 Ga0207681_104983161 167
212 3300025923 Ga0207681_10709220 Ga0207681_107092201 167
213 3300025924 Ga0207694_10154521 Ga0207694_101545212 167
214 3300025924 Ga0207694_10428851 Ga0207694_104288512 167
215 3300025925 Ga0207650_10344744 Ga0207650_103447442 167
216 3300025926 Ga0207659_10230032 Ga0207659_102300323 167
217 3300025927 Ga0207687_10052440 Ga0207687_100524405 167
218 3300025931 Ga0207644_10231562 Ga0207644_102315622 167
219 3300025932 Ga0207690_10234716 Ga0207690_102347162 167
220 3300025933 Ga0207706_10543517 Ga0207706_105435172 167
221 3300025934 Ga0207686_10210720 Ga0207686_102107202 167
222 3300025935 Ga0207709_10510572 Ga0207709_105105721 167
223 3300025938 Ga0207704_10363015 Ga0207704_103630151 167
224 3300025938 Ga0207704_11049785 Ga0207704_110497852 167
225 3300025941 Ga0207711_10040565 Ga0207711_100405654 167
226 3300025941 Ga0207711_10109202 Ga0207711_101092023 167
227 3300025942 Ga0207689_10121032 Ga0207689_101210322 167
228 3300025945 Ga0207679_10506363 Ga0207679_105063632 167
229 3300025949 Ga0207667_10131918 Ga0207667_101319184 167
230 3300025972 Ga0207668_10270828 Ga0207668_102708282 167
231 3300025972 Ga0207668_10397541 Ga0207668_103975412 167
232 3300025972 Ga0207668_10443281 Ga0207668_104432812 167
233 3300025972 Ga0207668_10587005 Ga0207668_105870051 167
234 3300025981 Ga0207640_11147516 Ga0207640_111475161 167
235 3300025986 Ga0207658_10224874 Ga0207658_102248741 167
236 3300025986 Ga0207658_10387261 Ga0207658_103872612 167
237 3300025986 Ga0207658_11337975 Ga0207658_113379751 167
238 3300026023 Ga0207677_10154248 Ga0207677_101542482 167
239 3300026035 Ga0207703_10365183 Ga0207703_103651831 167
240 3300026041 Ga0207639_10274317 Ga0207639_102743172 167
241 3300026041 Ga0207639_10477559 Ga0207639_104775592 167
242 3300026041 Ga0207639_10480486 Ga0207639_104804862 167
243 3300026067 Ga0207678_10051481 Ga0207678_100514816 167
244 3300026067 Ga0207678_10096872 Ga0207678_100968723 167
245 3300026067 Ga0207678_10187503 Ga0207678_101875032 167
246 3300026075 Ga0207708_10197734 Ga0207708_101977342 167
247 3300026075 Ga0207708_10486896 Ga0207708_104868961 167
248 3300026078 Ga0207702_11214197 Ga0207702_112141972 167
249 3300026088 Ga0207641_10186159 Ga0207641_101861593 167
250 3300026089 Ga0207648_10449648 Ga0207648_104496482 167
251 3300026089 Ga0207648_10977017 Ga0207648_109770171 167
252 3300026118 Ga0207675_100436423 Ga0207675_1004364232 167
253 3300026121 Ga0207683_10195445 Ga0207683_101954453 167
254 3300026121 Ga0207683_10637824 Ga0207683_106378242 167
255 3300026142 Ga0207698_10143685 Ga0207698_101436852 167
256 3300026142 Ga0207698_10417687 Ga0207698_104176872 167
257 3300027357 Ga0209589_1000006 Ga0209589_1000006313 167
258 3300027361 Ga0209489_100007 Ga0209489_100007313 167
259 3300027363 Ga0209700_100008 Ga0209700_100008313 167
260 3300027866 Ga0209813_10002812 Ga0209813_100028125 167
261 3300028379 Ga0268266_10064405 Ga0268266_100644053 167
262 3300028379 Ga0268266_10273960 Ga0268266_102739603 167
263 3300028379 Ga0268266_10395588 Ga0268266_103955882 167
264 3300028380 Ga0268265_10082483 Ga0268265_100824833 167
265 3300028380 Ga0268265_10168396 Ga0268265_101683962 167
266 3300028380 Ga0268265_10404034 Ga0268265_104040341 167
267 3300028380 Ga0268265_10683197 Ga0268265_106831972 167
268 3300028381 Ga0268264_10281335 Ga0268264_102813353 167
269 3300031456 Ga0307513_10325561 Ga0307513_103255612 167
270 3300031507 Ga0307509_10165469 Ga0307509_101654692 167
271 3300031548 Ga0307408_100621191 Ga0307408_1006211912 167
272 3300031730 Ga0307516_10238955 Ga0307516_102389552 167
273 3300031731 Ga0307405_10434658 Ga0307405_104346582 167
274 3300032002 Ga0307416_100620580 Ga0307416_1006205802 167
275 3300032002 Ga0307416_100881057 Ga0307416_1008810571 167
276 3300033180 Ga0307510_10019525 Ga0307510_100195257 167
277 3300033442 Ga0315911_1000010 Ga0315911_1000010229 167
278 3300035084 Ga0373928_0011813 Ga0373928_0011813_1028_1537 167
279 3300035088 Ga0373940_0029665 Ga0373940_0029665_461_970 167
280 3300035090 Ga0373949_0067455 Ga0373949_0067455_16_525 167
281 3300035112 Ga0373932_0005334 Ga0373932_0005334_1251_1760 167
282 3300035115 Ga0373941_0002945 Ga0373941_0002945_143_649 167
283 3300035242 Ga0373962_0034362 Ga0373962_0034362_504_1013 167
284 3300035691 Ga0373931_0001895 Ga0373931_0001895_2105_2662 167
285 3300035695 Ga0373927_0023382 Ga0373927_0023382_2353_2862 167
286 3300046452 Ga0495617_030440 Ga0495617_030440_704_1216 167
287 3300046455 Ga0495603_0029732 Ga0495603_0029732_1219_1734 167
288 3300046455 Ga0495603_0049543 Ga0495603_0049543_1238_1750 167
289 3300046455 Ga0495603_0175304 Ga0495603_0175304_422_931 167
290 3300046461 Ga0495641_0201750 Ga0495641_0201750_121_633 167
291 3300046471 Ga0495650_0161393 Ga0495650_0161393_200_712 167
292 3300046472 Ga0495580_0280085 Ga0495580_0280085_213_725 167
293 3300046475 Ga0495639_0070181 Ga0495639_0070181_452_967 167
294 3300046476 Ga0495662_0265068 Ga0495662_0265068_225_740 167
295 3300046491 Ga0495584_0062955 Ga0495584_0062955_436_948 167
296 3300046491 Ga0495584_0204234 Ga0495584_0204234_264_776 167
297 3300046492 Ga0495585_0029264 Ga0495585_0029264_1214_1726 167
298 3300046499 Ga0495594_0030720 Ga0495594_0030720_936_1448 167
299 3300046499 Ga0495594_0053484 Ga0495594_0053484_1171_1686 167
300 3300046501 Ga0495607_0442827 Ga0495607_0442827_45_557 167
301 3300046507 Ga0495606_0079533 Ga0495606_0079533_1437_1949 167
302 3300046512 Ga0495610_0198225 Ga0495610_0198225_32_544 167
303 3300046515 Ga0495620_0053999 Ga0495620_0053999_974_1486 167
304 3300046518 Ga0495631_0015766 Ga0495631_0015766_303_815 167
305 3300046518 Ga0495631_0257257 Ga0495631_0257257_14_526 167
306 3300046519 Ga0495632_0090578 Ga0495632_0090578_193_705 167
307 3300046523 Ga0495644_0076258 Ga0495644_0076258_436_948 167
308 3300046537 Ga0495598_0027478 Ga0495598_0027478_854_1366 167
309 3300046538 Ga0495609_0170564 Ga0495609_0170564_359_871 167
310 3300046539 Ga0495621_0213857 Ga0495621_0213857_109_621 167
311 3300046542 Ga0495597_0198730 Ga0495597_0198730_111_623 167
312 3300046557 Ga0495622_0078533 Ga0495622_0078533_558_1070 167
313 3300046558 Ga0495633_0038360 Ga0495633_0038360_1255_1767 167
314 3300046615 Ga0495656_0056879 Ga0495656_0056879_993_1505 167
315 3300046616 Ga0495668_0070051 Ga0495668_0070051_647_1165 167
316 3300046616 Ga0495668_0240425 Ga0495668_0240425_233_745 167
317 3300046616 Ga0495668_0270841 Ga0495668_0270841_200_712 167
318 3300046660 Ga0495625_0264340 Ga0495625_0264340_171_683 167
319 3300046660 Ga0495625_0390423 Ga0495625_0390423_32_544 167
320 3300046660 Ga0495625_0528591 Ga0495625_0528591_34_546 167
321 3300046664 Ga0495659_0006815 Ga0495659_0006815_2777_3289 167
322 3300046665 Ga0495661_0155973 Ga0495661_0155973_246_758 167
323 3300046674 Ga0495588_0256813 Ga0495588_0256813_202_714 167
324 3300046681 Ga0495647_0014634 Ga0495647_0014634_1609_2121 167
325 3300046681 Ga0495647_0302618 Ga0495647_0302618_113_628 167
326 3300046684 Ga0495669_0104914 Ga0495669_0104914_28_540 167
327 3300046684 Ga0495669_0134897 Ga0495669_0134897_462_968 167
328 3300046684 Ga0495669_0254771 Ga0495669_0254771_252_764 167
329 3300046684 Ga0495669_0476162 Ga0495669_0476162_18_533 167
330 3300046691 Ga0495670_0012092 Ga0495670_0012092_2637_3173 167
331 3300046691 Ga0495670_0163891 Ga0495670_0163891_501_1016 167
332 3300046692 Ga0495671_0230596 Ga0495671_0230596_236_748 167
333 3300047318 Ga0495636_0040926 Ga0495636_0040926_772_1284 167
334 3300047323 Ga0495683_0037356 Ga0495683_0037356_1819_2331 167
335 3300048903 Ga0496100_0652085 Ga0496100_0652085_85_597 167
336 3300048903 Ga0496100_1298602 Ga0496100_1298602_41_556 167
337 3300048904 Ga0496101_0092016 Ga0496101_0092016_571_1128 167
338 3300048904 Ga0496101_0254104 Ga0496101_0254104_815_1327 167
339 3300048904 Ga0496101_1046176 Ga0496101_1046176_94_606 167
340 3300048905 Ga0496102_0010509 Ga0496102_0010509_1356_1913 167
341 3300048905 Ga0496102_0195854 Ga0496102_0195854_625_1137 167
342 3300048906 Ga0496103_0028159 Ga0496103_0028159_803_1312 167
343 3300048907 Ga0496104_0000264 Ga0496104_0000264_1211_1729 167
344 3300048907 Ga0496104_0430551 Ga0496104_0430551_34_546 167
345 3300048908 Ga0496105_0004722 Ga0496105_0004722_5014_5571 167
346 3300048908 Ga0496105_0067512 Ga0496105_0067512_992_1510 167
347 3300048909 Ga0496106_0128796 Ga0496106_0128796_1205_1762 167
348 3300048909 Ga0496106_0500068 Ga0496106_0500068_30_542 167
349 3300048910 Ga0496107_0010483 Ga0496107_0010483_1983_2540 167
350 3300048910 Ga0496107_0106435 Ga0496107_0106435_932_1444 167
351 3300048911 Ga0496108_0067242 Ga0496108_0067242_419_928 167
352 3300048911 Ga0496108_0081956 Ga0496108_0081956_356_874 167
353 3300048912 Ga0496109_0007688 Ga0496109_0007688_6373_6882 167
354 3300048912 Ga0496109_0063721 Ga0496109_0063721_1224_1736 167
355 3300048912 Ga0496109_0700640 Ga0496109_0700640_209_718 167
356 3300048913 Ga0496110_0007695 Ga0496110_0007695_2387_2944 167
357 3300048913 Ga0496110_0009156 Ga0496110_0009156_6395_6913 167
358 3300048913 Ga0496110_0578618 Ga0496110_0578618_328_840 167
359 3300048914 Ga0496111_0003597 Ga0496111_0003597_5576_6133 167
360 3300048914 Ga0496111_0037700 Ga0496111_0037700_1136_1654 167
361 3300048914 Ga0496111_0614863 Ga0496111_0614863_213_725 167
362 3300048915 Ga0496112_0025430 Ga0496112_0025430_1415_1924 167
363 3300048915 Ga0496112_0542299 Ga0496112_0542299_377_889 167
364 3300048916 Ga0496113_0005354 Ga0496113_0005354_2035_2592 167
365 3300048916 Ga0496113_0053298 Ga0496113_0053298_470_988 167
366 3300048916 Ga0496113_0384699 Ga0496113_0384699_574_1086 167
367 3300048917 Ga0496114_0004664 Ga0496114_0004664_4708_5265 167
368 3300048917 Ga0496114_0924234 Ga0496114_0924234_182_691 167
369 3300048918 Ga0496115_0274401 Ga0496115_0274401_623_1135 167
370 3300048920 Ga0496117_0163140 Ga0496117_0163140_121_633 167
371 3300048922 Ga0496119_0033029 Ga0496119_0033029_33_545 167
372 3300048924 Ga0496121_0144691 Ga0496121_0144691_880_1392 167
373 3300048924 Ga0496121_0162927 Ga0496121_0162927_886_1398 167
374 3300048924 Ga0496121_0685010 Ga0496121_0685010_84_596 167
375 3300048928 Ga0496125_0076632 Ga0496125_0076632_1919_2431 167
376 3300048928 Ga0496125_0145306 Ga0496125_0145306_472_984 167
377 3300048929 Ga0496126_0034270 Ga0496126_0034270_668_1180 167
378 3300048929 Ga0496126_0051129 Ga0496126_0051129_3041_3553 167
379 3300048929 Ga0496126_0143672 Ga0496126_0143672_574_1086 167
380 3300048929 Ga0496126_0302736 Ga0496126_0302736_136_648 167
381 3300048929 Ga0496126_0346739 Ga0496126_0346739_133_645 167
382 3300049459 Ga0495678_035270 Ga0495678_035270_1153_1659 167
383 3300050490 nmdc:mga03n38_140855_c1 nmdc:mga03n38_140855_c1_599_1111 167
384 3300050490 nmdc:mga03n38_141278_c1 nmdc:mga03n38_141278_c1_495_1013 167
385 3300050491 nmdc:mga00v17_162573_c1 nmdc:mga00v17_162573_c1_578_1090 167
386 3300050491 nmdc:mga00v17_20052_c1 nmdc:mga00v17_20052_c1_187_705 167
387 3300050491 nmdc:mga00v17_39463_c1 nmdc:mga00v17_39463_c1_1840_2352 167
388 3300050492 nmdc:mga0yw44_17750_c1 nmdc:mga0yw44_17750_c1_1751_2263 167
389 3300050492 nmdc:mga0yw44_780845_c1 nmdc:mga0yw44_780845_c1_115_627 167
390 3300050493 nmdc:mga0k408_247025_c1 nmdc:mga0k408_247025_c1_526_1038 167
391 3300050493 nmdc:mga0k408_477258_c1 nmdc:mga0k408_477258_c1_70_582 167
392 3300050494 nmdc:mga06z11_12508_c1 nmdc:mga06z11_12508_c1_627_1145 167
393 3300050494 nmdc:mga06z11_32790_c1 nmdc:mga06z11_32790_c1_130_648 167
394 3300050494 nmdc:mga06z11_448217_c1 nmdc:mga06z11_448217_c1_77_595 167
395 3300050494 nmdc:mga06z11_84892_c1 nmdc:mga06z11_84892_c1_683_1195 167
396 3300050495 nmdc:mga04h51_146802_c1 nmdc:mga04h51_146802_c1_147_659 167
397 3300050495 nmdc:mga04h51_66211_c1 nmdc:mga04h51_66211_c1_626_1144 167
398 3300050507 nmdc:mga05p37_1432600_c1 nmdc:mga05p37_1432600_c1_76_612 167
399 3300050507 nmdc:mga05p37_280399_c1 nmdc:mga05p37_280399_c1_598_1110 167
400 3300050507 nmdc:mga05p37_29696_c2 nmdc:mga05p37_29696_c2_5040_5558 167
401 3300050508 nmdc:mga09592_373507_c1 nmdc:mga09592_373507_c1_203_721 167
402 3300050510 nmdc:mga06r32_12202_c1 nmdc:mga06r32_12202_c1_6525_7043 167
403 3300050511 nmdc:mga08y16_678874_c1 nmdc:mga08y16_678874_c1_377_895 167
404 3300050512 nmdc:mga0n895_96815_c1 nmdc:mga0n895_96815_c1_1010_1522 167
405 3300050513 nmdc:mga0rr50_418514_c1 nmdc:mga0rr50_418514_c1_590_1102 167
406 3300050514 nmdc:mga08x19_688452_c1 nmdc:mga08x19_688452_c1_32_544 167
407 3300050515 nmdc:mga0a205_205529_c1 nmdc:mga0a205_205529_c1_306_818 167
408 3300050516 nmdc:mga0sz30_108053_c1 nmdc:mga0sz30_108053_c1_447_959 167
409 3300050516 nmdc:mga0sz30_192682_c1 nmdc:mga0sz30_192682_c1_274_786 167
410 3300050516 nmdc:mga0sz30_215855_c1 nmdc:mga0sz30_215855_c1_216_728 167
411 3300050516 nmdc:mga0sz30_2375_c1 nmdc:mga0sz30_2375_c1_963_1475 167
412 3300053083 Ga0495655_0028464 Ga0495655_0028464_397_909 167
413 3300053096 Ga0500641_0003076 Ga0500641_0003076_203_709 167
414 3300053096 Ga0500641_0078769 Ga0500641_0078769_870_1382 167
415 3300053119 Ga0500595_002264 Ga0500595_002264_764_1276 167
416 3300053137 Ga0500561_0053717 Ga0500561_0053717_387_899 167
417 3300053156 Ga0500622_0055243 Ga0500622_0055243_115_627 167
418 3300053162 Ga0500638_089332 Ga0500638_089332_452_964 167
419 3300003215 JGI25153J46596_10000738 JGI25153J46596_100007386 168
420 3300003320 rootH2_10100776 rootH2_101007762 168
421 3300003322 rootL2_10156283 rootL2_101562831 168
422 3300003659 JGI25404J52841_10008621 JGI25404J52841_100086213 168
423 3300005327 Ga0070658_10946607 Ga0070658_109466071 168
424 3300005328 Ga0070676_10202667 Ga0070676_102026672 168
425 3300005329 Ga0070683_101016290 Ga0070683_1010162901 168
426 3300005330 Ga0070690_100013883 Ga0070690_1000138831 168
427 3300005331 Ga0070670_100485037 Ga0070670_1004850372 168
428 3300005334 Ga0068869_100140009 Ga0068869_1001400092 168
429 3300005335 Ga0070666_10094036 Ga0070666_100940362 168
430 3300005336 Ga0070680_100569234 Ga0070680_1005692341 168
431 3300005337 Ga0070682_100081625 Ga0070682_1000816252 168
432 3300005337 Ga0070682_100471822 Ga0070682_1004718221 168
433 3300005338 Ga0068868_100105245 Ga0068868_1001052453 168
434 3300005338 Ga0068868_100459610 Ga0068868_1004596102 168
435 3300005338 Ga0068868_100539507 Ga0068868_1005395072 168
436 3300005339 Ga0070660_100372677 Ga0070660_1003726772 168
437 3300005340 Ga0070689_100556949 Ga0070689_1005569492 168
438 3300005341 Ga0070691_10293480 Ga0070691_102934802 168
439 3300005344 Ga0070661_100155180 Ga0070661_1001551803 168
440 3300005344 Ga0070661_100547282 Ga0070661_1005472822 168
441 3300005347 Ga0070668_100108937 Ga0070668_1001089371 168
442 3300005347 Ga0070668_100357346 Ga0070668_1003573462 168
443 3300005347 Ga0070668_100626033 Ga0070668_1006260331 168
444 3300005347 Ga0070668_100832552 Ga0070668_1008325522 168
445 3300005347 Ga0070668_100976201 Ga0070668_1009762012 168
446 3300005354 Ga0070675_101387632 Ga0070675_1013876321 168
447 3300005355 Ga0070671_100216516 Ga0070671_1002165162 168
448 3300005355 Ga0070671_101014070 Ga0070671_1010140702 168
449 3300005356 Ga0070674_100378784 Ga0070674_1003787842 168
450 3300005356 Ga0070674_100693830 Ga0070674_1006938302 168
451 3300005364 Ga0070673_100112844 Ga0070673_1001128442 168
452 3300005364 Ga0070673_100589410 Ga0070673_1005894101 168
453 3300005365 Ga0070688_100322111 Ga0070688_1003221112 168
454 3300005366 Ga0070659_100214238 Ga0070659_1002142381 168
455 3300005366 Ga0070659_100306833 Ga0070659_1003068332 168
456 3300005366 Ga0070659_100974340 Ga0070659_1009743402 168
457 3300005434 Ga0070709_10096813 Ga0070709_100968132 168
458 3300005435 Ga0070714_100327084 Ga0070714_1003270842 168
459 3300005435 Ga0070714_101163778 Ga0070714_1011637782 168
460 3300005437 Ga0070710_10011649 Ga0070710_100116492 168
461 3300005439 Ga0070711_100010862 Ga0070711_1000108626 168
462 3300005440 Ga0070705_101026550 Ga0070705_1010265501 168
463 3300005441 Ga0070700_100351816 Ga0070700_1003518162 168
464 3300005455 Ga0070663_100294729 Ga0070663_1002947292 168
465 3300005455 Ga0070663_100359125 Ga0070663_1003591252 168
466 3300005456 Ga0070678_100007967 Ga0070678_1000079675 168
467 3300005456 Ga0070678_100035283 Ga0070678_1000352834 168
468 3300005456 Ga0070678_100196577 Ga0070678_1001965772 168
469 3300005456 Ga0070678_100870676 Ga0070678_1008706761 168
470 3300005457 Ga0070662_100337333 Ga0070662_1003373332 168
471 3300005458 Ga0070681_10085157 Ga0070681_100851572 168
472 3300005458 Ga0070681_11290661 Ga0070681_112906611 168
473 3300005459 Ga0068867_100989926 Ga0068867_1009899262 168
474 3300005466 Ga0070685_10399497 Ga0070685_103994972 168
475 3300005518 Ga0070699_100198513 Ga0070699_1001985132 168
476 3300005530 Ga0070679_100019162 Ga0070679_1000191625 168
477 3300005530 Ga0070679_100759250 Ga0070679_1007592501 168
478 3300005536 Ga0070697_100658178 Ga0070697_1006581781 168
479 3300005539 Ga0068853_100710798 Ga0068853_1007107982 168
480 3300005539 Ga0068853_100960605 Ga0068853_1009606052 168
481 3300005543 Ga0070672_100139942 Ga0070672_1001399421 168
482 3300005543 Ga0070672_100173630 Ga0070672_1001736303 168
483 3300005544 Ga0070686_100277045 Ga0070686_1002770451 168
484 3300005548 Ga0070665_100020950 Ga0070665_1000209503 168
485 3300005548 Ga0070665_100080986 Ga0070665_1000809863 168
486 3300005548 Ga0070665_100160316 Ga0070665_1001603164 168
487 3300005548 Ga0070665_100626694 Ga0070665_1006266942 168
488 3300005549 Ga0070704_100117260 Ga0070704_1001172601 168
489 3300005563 Ga0068855_100036490 Ga0068855_1000364902 168
490 3300005564 Ga0070664_100630319 Ga0070664_1006303192 168
491 3300005564 Ga0070664_101348482 Ga0070664_1013484821 168
492 3300005577 Ga0068857_101048364 Ga0068857_1010483641 168
493 3300005577 Ga0068857_101165239 Ga0068857_1011652391 168
494 3300005578 Ga0068854_100070455 Ga0068854_1000704552 168
495 3300005578 Ga0068854_100383616 Ga0068854_1003836162 168
496 3300005614 Ga0068856_100173634 Ga0068856_1001736342 168
497 3300005616 Ga0068852_100016778 Ga0068852_1000167783 168
498 3300005616 Ga0068852_100045466 Ga0068852_1000454663 168
499 3300005616 Ga0068852_101881571 Ga0068852_1018815711 168
500 3300005718 Ga0068866_10161326 Ga0068866_101613262 168
501 3300005719 Ga0068861_100184644 Ga0068861_1001846443 168
502 3300005719 Ga0068861_101349839 Ga0068861_1013498391 168
503 3300005840 Ga0068870_10145078 Ga0068870_101450782 168
504 3300005841 Ga0068863_100780084 Ga0068863_1007800842 168
505 3300005843 Ga0068860_100297484 Ga0068860_1002974841 168
506 3300005843 Ga0068860_100305761 Ga0068860_1003057612 168
507 3300005844 Ga0068862_100616472 Ga0068862_1006164721 168
508 3300005844 Ga0068862_100892254 Ga0068862_1008922542 168
509 3300005844 Ga0068862_100900719 Ga0068862_1009007191 168
510 3300005937 Ga0081455_10008277 Ga0081455_1000827710 168
511 3300005937 Ga0081455_10070603 Ga0081455_100706032 168
512 3300005983 Ga0081540_1000996 Ga0081540_100099620 168
513 3300005983 Ga0081540_1008013 Ga0081540_10080135 168
514 3300005983 Ga0081540_1010852 Ga0081540_10108525 168
515 3300005983 Ga0081540_1028988 Ga0081540_10289882 168
516 3300005983 Ga0081540_1051839 Ga0081540_10518392 168
517 3300005983 Ga0081540_1070603 Ga0081540_10706031 168
518 3300005983 Ga0081540_1110341 Ga0081540_11103412 168
519 3300005985 Ga0081539_10041134 Ga0081539_100411343 168
520 3300005985 Ga0081539_10177574 Ga0081539_101775742 168
521 3300006028 Ga0070717_10608646 Ga0070717_106086461 168
522 3300006038 Ga0075365_10672691 Ga0075365_106726912 168
523 3300006042 Ga0075368_10109378 Ga0075368_101093782 168
524 3300006048 Ga0075363_100019054 Ga0075363_1000190543 168
525 3300006048 Ga0075363_100307411 Ga0075363_1003074111 168
526 3300006175 Ga0070712_100016528 Ga0070712_1000165282 168
527 3300006175 Ga0070712_100030454 Ga0070712_1000304543 168
528 3300006178 Ga0075367_10290976 Ga0075367_102909761 168
529 3300006178 Ga0075367_10414377 Ga0075367_104143771 168
530 3300006195 Ga0075366_10124765 Ga0075366_101247652 168
531 3300006195 Ga0075366_10264152 Ga0075366_102641522 168
532 3300006353 Ga0075370_10042568 Ga0075370_100425683 168
533 3300006353 Ga0075370_10148475 Ga0075370_101484752 168
534 3300006353 Ga0075370_10336408 Ga0075370_103364081 168
535 3300006353 Ga0075370_10514759 Ga0075370_105147591 168
536 3300006358 Ga0068871_100162487 Ga0068871_1001624873 168
537 3300006358 Ga0068871_100343989 Ga0068871_1003439892 168
538 3300006881 Ga0068865_100291188 Ga0068865_1002911882 168
539 3300006881 Ga0068865_100941720 Ga0068865_1009417202 168
540 3300007265 Ga0099794_10052540 Ga0099794_100525402 168
541 3300007788 Ga0099795_10040196 Ga0099795_100401962 168
542 3300007788 Ga0099795_10128197 Ga0099795_101281972 168
543 3300007788 Ga0099795_10323829 Ga0099795_103238292 168
544 3300009092 Ga0105250_10157267 Ga0105250_101572672 168
545 3300009093 Ga0105240_10177700 Ga0105240_101777003 168
546 3300009093 Ga0105240_10445878 Ga0105240_104458782 168
547 3300009094 Ga0111539_10089698 Ga0111539_100896984 168
548 3300009094 Ga0111539_10335277 Ga0111539_103352773 168
549 3300009098 Ga0105245_10386161 Ga0105245_103861612 168
550 3300009098 Ga0105245_10818767 Ga0105245_108187671 168
551 3300009098 Ga0105245_11846327 Ga0105245_118463272 168
552 3300009101 Ga0105247_10189004 Ga0105247_101890041 168
553 3300009101 Ga0105247_10372541 Ga0105247_103725412 168
554 3300009101 Ga0105247_10389979 Ga0105247_103899791 168
555 3300009148 Ga0105243_10421131 Ga0105243_104211313 168
556 3300009148 Ga0105243_10984259 Ga0105243_109842591 168
557 3300009176 Ga0105242_10136248 Ga0105242_101362483 168
558 3300009176 Ga0105242_10185353 Ga0105242_101853532 168
559 3300009177 Ga0105248_10649225 Ga0105248_106492252 168
560 3300009177 Ga0105248_10692965 Ga0105248_106929651 168
561 3300009545 Ga0105237_10501099 Ga0105237_105010991 168
562 3300009545 Ga0105237_10864289 Ga0105237_108642892 168
563 3300009545 Ga0105237_11173532 Ga0105237_111735322 168
564 3300009545 Ga0105237_11426633 Ga0105237_114266331 168
565 3300009551 Ga0105238_10273510 Ga0105238_102735103 168
566 3300009551 Ga0105238_10915828 Ga0105238_109158282 168
567 3300009553 Ga0105249_10215265 Ga0105249_102152653 168
568 3300010159 Ga0099796_10062156 Ga0099796_100621562 168
569 3300010375 Ga0105239_10396197 Ga0105239_103961972 168
570 3300010375 Ga0105239_11112850 Ga0105239_111128501 168
571 3300010375 Ga0105239_12180236 Ga0105239_121802361 168
572 3300011119 Ga0105246_10230215 Ga0105246_102302152 168
573 3300011119 Ga0105246_10295173 Ga0105246_102951732 168
574 3300011119 Ga0105246_10337501 Ga0105246_103375012 168
575 3300013296 Ga0157374_10328495 Ga0157374_103284951 168
576 3300013296 Ga0157374_10430092 Ga0157374_104300923 168
577 3300013296 Ga0157374_10460814 Ga0157374_104608142 168
578 3300013297 Ga0157378_10095979 Ga0157378_100959792 168
579 3300013297 Ga0157378_10404118 Ga0157378_104041182 168
580 3300013297 Ga0157378_10817666 Ga0157378_108176662 168
581 3300013306 Ga0163162_10413440 Ga0163162_104134402 168
582 3300013307 Ga0157372_10822131 Ga0157372_108221312 168
583 3300013308 Ga0157375_10022963 Ga0157375_100229635 168
584 3300013308 Ga0157375_10284050 Ga0157375_102840503 168
585 3300013308 Ga0157375_11141399 Ga0157375_111413992 168
586 3300014325 Ga0163163_10195936 Ga0163163_101959362 168
587 3300014326 Ga0157380_10158264 Ga0157380_101582642 168
588 3300014326 Ga0157380_10181760 Ga0157380_101817603 168
589 3300014326 Ga0157380_10280804 Ga0157380_102808043 168
590 3300014326 Ga0157380_11337038 Ga0157380_113370381 168
591 3300014968 Ga0157379_10188769 Ga0157379_101887692 168
592 3300014968 Ga0157379_10206840 Ga0157379_102068402 168
593 3300014968 Ga0157379_10703657 Ga0157379_107036571 168
594 3300014968 Ga0157379_10718872 Ga0157379_107188721 168
595 3300014968 Ga0157379_10810248 Ga0157379_108102482 168
596 3300014969 Ga0157376_10663633 Ga0157376_106636332 168
597 3300017792 Ga0163161_10026279 Ga0163161_100262792 168
598 3300017792 Ga0163161_10215639 Ga0163161_102156393 168
599 3300017792 Ga0163161_10589924 Ga0163161_105899242 168
600 3300025297 Ga0209758_1065794 Ga0209758_10657941 168
601 3300025898 Ga0207692_10013187 Ga0207692_100131872 168
602 3300025899 Ga0207642_10070349 Ga0207642_100703493 168
603 3300025901 Ga0207688_10056972 Ga0207688_100569722 168
604 3300025901 Ga0207688_10060556 Ga0207688_100605563 168
605 3300025901 Ga0207688_10078530 Ga0207688_100785302 168
606 3300025906 Ga0207699_10023406 Ga0207699_100234064 168
607 3300025907 Ga0207645_10061625 Ga0207645_100616252 168
608 3300025907 Ga0207645_10372645 Ga0207645_103726452 168
609 3300025908 Ga0207643_10075327 Ga0207643_100753272 168
610 3300025912 Ga0207707_10008592 Ga0207707_1000859211 168
611 3300025913 Ga0207695_10067565 Ga0207695_100675652 168
612 3300025913 Ga0207695_10076493 Ga0207695_100764932 168
613 3300025914 Ga0207671_10138314 Ga0207671_101383142 168
614 3300025914 Ga0207671_10749271 Ga0207671_107492712 168
615 3300025915 Ga0207693_10001851 Ga0207693_100018518 168
616 3300025915 Ga0207693_10050083 Ga0207693_100500833 168
617 3300025916 Ga0207663_10009598 Ga0207663_100095985 168
618 3300025917 Ga0207660_10271149 Ga0207660_102711492 168
619 3300025919 Ga0207657_10415027 Ga0207657_104150272 168
620 3300025919 Ga0207657_10423804 Ga0207657_104238042 168
621 3300025919 Ga0207657_10716807 Ga0207657_107168072 168
622 3300025920 Ga0207649_10210830 Ga0207649_102108302 168
623 3300025921 Ga0207652_10924717 Ga0207652_109247171 168
624 3300025926 Ga0207659_10606532 Ga0207659_106065322 168
625 3300025926 Ga0207659_10752920 Ga0207659_107529202 168
626 3300025926 Ga0207659_10765876 Ga0207659_107658761 168
627 3300025929 Ga0207664_10214985 Ga0207664_102149852 168
628 3300025931 Ga0207644_11293574 Ga0207644_112935741 168
629 3300025932 Ga0207690_10062103 Ga0207690_100621032 168
630 3300025932 Ga0207690_10392706 Ga0207690_103927062 168
631 3300025932 Ga0207690_10464502 Ga0207690_104645022 168
632 3300025933 Ga0207706_10202309 Ga0207706_102023093 168
633 3300025933 Ga0207706_10705820 Ga0207706_107058202 168
634 3300025933 Ga0207706_10868446 Ga0207706_108684461 168
635 3300025934 Ga0207686_10192088 Ga0207686_101920882 168
636 3300025935 Ga0207709_10129363 Ga0207709_101293633 168
637 3300025935 Ga0207709_10359981 Ga0207709_103599812 168
638 3300025935 Ga0207709_10402879 Ga0207709_104028791 168
639 3300025936 Ga0207670_10439481 Ga0207670_104394811 168
640 3300025937 Ga0207669_10010625 Ga0207669_100106255 168
641 3300025937 Ga0207669_10018303 Ga0207669_100183034 168
642 3300025937 Ga0207669_10263510 Ga0207669_102635102 168
643 3300025937 Ga0207669_10901723 Ga0207669_109017232 168
644 3300025938 Ga0207704_10029068 Ga0207704_100290682 168
645 3300025938 Ga0207704_10078158 Ga0207704_100781582 168
646 3300025939 Ga0207665_10033322 Ga0207665_100333225 168
647 3300025940 Ga0207691_10065199 Ga0207691_100651991 168
648 3300025941 Ga0207711_10447228 Ga0207711_104472282 168
649 3300025942 Ga0207689_10333347 Ga0207689_103333472 168
650 3300025944 Ga0207661_11381957 Ga0207661_113819571 168
651 3300025945 Ga0207679_10193770 Ga0207679_101937701 168
652 3300025945 Ga0207679_10526820 Ga0207679_105268202 168
653 3300025945 Ga0207679_11202631 Ga0207679_112026311 168
654 3300025949 Ga0207667_10049551 Ga0207667_100495512 168
655 3300025949 Ga0207667_11176950 Ga0207667_111769501 168
656 3300025960 Ga0207651_10021773 Ga0207651_100217732 168
657 3300025961 Ga0207712_10151232 Ga0207712_101512323 168
658 3300025972 Ga0207668_10047201 Ga0207668_100472014 168
659 3300025972 Ga0207668_10253892 Ga0207668_102538922 168
660 3300025972 Ga0207668_10300481 Ga0207668_103004811 168
661 3300025972 Ga0207668_10714670 Ga0207668_107146701 168
662 3300025981 Ga0207640_10970513 Ga0207640_109705132 168
663 3300026023 Ga0207677_10297427 Ga0207677_102974271 168
664 3300026023 Ga0207677_10395169 Ga0207677_103951691 168
665 3300026023 Ga0207677_10448545 Ga0207677_104485452 168
666 3300026035 Ga0207703_10252462 Ga0207703_102524622 168
667 3300026041 Ga0207639_10143069 Ga0207639_101430693 168
668 3300026041 Ga0207639_10529992 Ga0207639_105299922 168
669 3300026067 Ga0207678_10029610 Ga0207678_100296104 168
670 3300026067 Ga0207678_10035630 Ga0207678_100356305 168
671 3300026067 Ga0207678_10071503 Ga0207678_100715033 168
672 3300026067 Ga0207678_10227861 Ga0207678_102278612 168
673 3300026078 Ga0207702_10621228 Ga0207702_106212282 168
674 3300026088 Ga0207641_10659296 Ga0207641_106592962 168
675 3300026089 Ga0207648_10166283 Ga0207648_101662832 168
676 3300026089 Ga0207648_10327207 Ga0207648_103272073 168
677 3300026089 Ga0207648_10704453 Ga0207648_107044531 168
678 3300026095 Ga0207676_10586237 Ga0207676_105862372 168
679 3300026116 Ga0207674_10752688 Ga0207674_107526882 168
680 3300026116 Ga0207674_10862879 Ga0207674_108628792 168
681 3300026118 Ga0207675_100144538 Ga0207675_1001445382 168
682 3300026118 Ga0207675_100208285 Ga0207675_1002082853 168
683 3300026118 Ga0207675_100281521 Ga0207675_1002815213 168
684 3300026118 Ga0207675_100304369 Ga0207675_1003043692 168
685 3300026118 Ga0207675_100776359 Ga0207675_1007763592 168
686 3300026118 Ga0207675_100989705 Ga0207675_1009897052 168
687 3300026121 Ga0207683_10038663 Ga0207683_100386634 168
688 3300026121 Ga0207683_10185005 Ga0207683_101850053 168
689 3300026142 Ga0207698_10016150 Ga0207698_100161505 168
690 3300026142 Ga0207698_10035640 Ga0207698_100356404 168
691 3300027866 Ga0209813_10191817 Ga0209813_101918171 168
692 3300027907 Ga0207428_10062077 Ga0207428_100620773 168
693 3300028379 Ga0268266_10013121 Ga0268266_100131214 168
694 3300028379 Ga0268266_10016287 Ga0268266_100162875 168
695 3300028380 Ga0268265_10521205 Ga0268265_105212052 168
696 3300028380 Ga0268265_10849276 Ga0268265_108492762 168
697 3300028381 Ga0268264_10332942 Ga0268264_103329422 168
698 3300028381 Ga0268264_10923590 Ga0268264_109235902 168
699 3300028786 Ga0307517_10000085 Ga0307517_1000008537 168
700 3300028786 Ga0307517_10209702 Ga0307517_102097022 168
701 3300028794 Ga0307515_10011214 Ga0307515_100112146 168
702 3300028794 Ga0307515_10295072 Ga0307515_102950722 168
703 3300028794 Ga0307515_10524383 Ga0307515_105243831 168
704 3300030522 Ga0307512_10159191 Ga0307512_101591912 168
705 3300031238 Ga0265332_10025893 Ga0265332_100258933 168
706 3300031241 Ga0265325_10004960 Ga0265325_1000496011 168
707 3300031247 Ga0265340_10018719 Ga0265340_100187194 168
708 3300031249 Ga0265339_10013486 Ga0265339_100134862 168
709 3300031249 Ga0265339_10072556 Ga0265339_100725562 168
710 3300031250 Ga0265331_10236772 Ga0265331_102367722 168
711 3300031344 Ga0265316_10332946 Ga0265316_103329462 168
712 3300031344 Ga0265316_10755228 Ga0265316_107552282 168
713 3300031456 Ga0307513_10530068 Ga0307513_105300682 168
714 3300031456 Ga0307513_10590867 Ga0307513_105908672 168
715 3300031507 Ga0307509_10449591 Ga0307509_104495912 168
716 3300031548 Ga0307408_100434618 Ga0307408_1004346183 168
717 3300031616 Ga0307508_10083537 Ga0307508_100835373 168
718 3300031616 Ga0307508_10203809 Ga0307508_102038092 168
719 3300031616 Ga0307508_10250806 Ga0307508_102508062 168
720 3300031711 Ga0265314_10300686 Ga0265314_103006862 168
721 3300031712 Ga0265342_10355544 Ga0265342_103555442 168
722 3300031730 Ga0307516_10025519 Ga0307516_100255195 168
723 3300031730 Ga0307516_10025796 Ga0307516_100257964 168
724 3300031730 Ga0307516_10116824 Ga0307516_101168242 168
725 3300031730 Ga0307516_10119591 Ga0307516_101195912 168
726 3300031730 Ga0307516_10416953 Ga0307516_104169532 168
727 3300031731 Ga0307405_10323080 Ga0307405_103230801 168
728 3300031824 Ga0307413_10034590 Ga0307413_100345902 168
729 3300031824 Ga0307413_10115918 Ga0307413_101159183 168
730 3300031903 Ga0307407_10258486 Ga0307407_102584862 168
731 3300031903 Ga0307407_10471285 Ga0307407_104712852 168
732 3300031903 Ga0307407_10519864 Ga0307407_105198641 168
733 3300031911 Ga0307412_10103281 Ga0307412_101032811 168
734 3300031911 Ga0307412_10272872 Ga0307412_102728722 168
735 3300031911 Ga0307412_10477436 Ga0307412_104774361 168
736 3300031995 Ga0307409_100328839 Ga0307409_1003288391 168
737 3300032002 Ga0307416_100614473 Ga0307416_1006144732 168
738 3300032004 Ga0307414_10290685 Ga0307414_102906851 168
739 3300032004 Ga0307414_10693417 Ga0307414_106934172 168
740 3300032005 Ga0307411_10002397 Ga0307411_100023974 168
741 3300032005 Ga0307411_10020733 Ga0307411_100207335 168
742 3300032126 Ga0307415_100524944 Ga0307415_1005249442 168
743 3300033180 Ga0307510_10009700 Ga0307510_100097005 168
744 3300033180 Ga0307510_10038953 Ga0307510_100389536 168
745 3300035086 Ga0373934_0049067 Ga0373934_0049067_816_1352 168
746 3300035113 Ga0373936_0122716 Ga0373936_0122716_14_529 168
747 3300035117 Ga0373953_0001358 Ga0373953_0001358_1241_1777 168
748 3300035118 Ga0373954_0001778 Ga0373954_0001778_3375_3911 168
749 3300035119 Ga0373956_0005729 Ga0373956_0005729_2422_2958 168
750 3300035120 Ga0373957_0002644 Ga0373957_0002644_2791_3327 168
751 3300035172 Ga0373955_0001783 Ga0373955_0001783_4538_5074 168
752 3300035207 Ga0373942_0122249 Ga0373942_0122249_62_574 168
753 3300035410 Ga0373924_0005305 Ga0373924_0005305_1241_1777 168
754 3300035692 Ga0373935_0314397 Ga0373935_0314397_180_716 168
755 3300035695 Ga0373927_0005360 Ga0373927_0005360_3845_4357 168
756 3300035695 Ga0373927_0035091 Ga0373927_0035091_2092_2604 168
757 3300035695 Ga0373927_0084258 Ga0373927_0084258_943_1455 168
758 3300035695 Ga0373927_0310887 Ga0373927_0310887_15_530 168
759 3300035724 Ga0373933_0001908 Ga0373933_0001908_6883_7419 168
760 3300036401 Ga0373937_0015839 Ga0373937_0015839_4568_5104 168
761 3300037068 Ga0373925_0122843 Ga0373925_0122843_764_1276 168
762 3300037068 Ga0373925_0405153 Ga0373925_0405153_69_581 168
763 3300037068 Ga0373925_0726130 Ga0373925_0726130_232_768 168
764 3300037312 Ga0395899_0447270 Ga0395899_0447270_225_737 168
765 3300037466 Ga0395898_0289712 Ga0395898_0289712_956_1468 168
766 3300037466 Ga0395898_1067310 Ga0395898_1067310_73_597 168
767 3300037471 Ga0395905_0100628 Ga0395905_0100628_934_1446 168
768 3300037471 Ga0395905_0108120 Ga0395905_0108120_1051_1563 168
769 3300037471 Ga0395905_0710893 Ga0395905_0710893_255_767 168
770 3300037471 Ga0395905_1157196 Ga0395905_1157196_64_576 168
771 3300038443 Ga0395901_1019515 Ga0395901_1019515_181_693 168
772 3300041411 Ga0439466_0150484 Ga0439466_0150484_184_696 168
773 3300041413 Ga0439465_0079258 Ga0439465_0079258_363_875 168
774 3300041443 Ga0451789_0496885 Ga0451789_0496885_370_882 168
775 3300041496 Ga0451839_0837697 Ga0451839_0837697_485_1000 168
776 3300041507 Ga0451851_0996752 Ga0451851_0996752_547_1062 168
777 3300042157 Ga0439458_0029195 Ga0439458_0029195_81_587 168
778 3300042993 Ga0439440_0222490 Ga0439440_0222490_10_522 168
779 3300044842 Ga0466957_0043947 Ga0466957_0043947_426_944 168
780 3300045049 Ga0466959_0130291 Ga0466959_0130291_253_771 168
781 3300045051 Ga0451576_1903073 Ga0451576_1903073_55_567 168
782 3300046452 Ga0495617_006940 Ga0495617_006940_2733_3245 168
783 3300046454 Ga0495592_0005568 Ga0495592_0005568_7196_7732 168
784 3300046455 Ga0495603_0029466 Ga0495603_0029466_1150_1686 168
785 3300046455 Ga0495603_0223566 Ga0495603_0223566_153_665 168
786 3300046459 Ga0495629_0000922 Ga0495629_0000922_2151_2687 168
787 3300046459 Ga0495629_0527996 Ga0495629_0527996_145_663 168
788 3300046460 Ga0495638_0045785 Ga0495638_0045785_1095_1610 168
789 3300046460 Ga0495638_0132101 Ga0495638_0132101_718_1230 168
790 3300046460 Ga0495638_0428159 Ga0495638_0428159_42_557 168
791 3300046462 Ga0495651_0019485 Ga0495651_0019485_3146_3682 168
792 3300046462 Ga0495651_0079787 Ga0495651_0079787_118_630 168
793 3300046463 Ga0495653_0004517 Ga0495653_0004517_10515_11051 168
794 3300046473 Ga0495582_0072963 Ga0495582_0072963_647_1165 168
795 3300046474 Ga0495605_0090050 Ga0495605_0090050_616_1128 168
796 3300046474 Ga0495605_0149964 Ga0495605_0149964_161_709 168
797 3300046476 Ga0495662_0198613 Ga0495662_0198613_42_560 168
798 3300046477 Ga0495664_0250928 Ga0495664_0250928_375_893 168
799 3300046491 Ga0495584_0224730 Ga0495584_0224730_45_557 168
800 3300046492 Ga0495585_0162415 Ga0495585_0162415_74_586 168
801 3300046501 Ga0495607_0366589 Ga0495607_0366589_60_572 168
802 3300046506 Ga0495583_0054834 Ga0495583_0054834_309_821 168
803 3300046507 Ga0495606_0000976 Ga0495606_0000976_25456_26016 168
804 3300046511 Ga0495608_0035885 Ga0495608_0035885_1227_1763 168
805 3300046513 Ga0495616_0125950 Ga0495616_0125950_652_1164 168
806 3300046513 Ga0495616_0226512 Ga0495616_0226512_137_652 168
807 3300046515 Ga0495620_0065030 Ga0495620_0065030_523_1035 168
808 3300046515 Ga0495620_0111811 Ga0495620_0111811_483_1055 168
809 3300046516 Ga0495628_0030476 Ga0495628_0030476_2944_3480 168
810 3300046518 Ga0495631_0107154 Ga0495631_0107154_632_1144 168
811 3300046518 Ga0495631_0140815 Ga0495631_0140815_148_687 168
812 3300046518 Ga0495631_0155457 Ga0495631_0155457_74_586 168
813 3300046519 Ga0495632_0097751 Ga0495632_0097751_705_1217 168
814 3300046519 Ga0495632_0196899 Ga0495632_0196899_59_574 168
815 3300046519 Ga0495632_0303098 Ga0495632_0303098_174_686 168
816 3300046520 Ga0495637_0089553 Ga0495637_0089553_486_998 168
817 3300046520 Ga0495637_0137071 Ga0495637_0137071_372_884 168
818 3300046523 Ga0495644_0065872 Ga0495644_0065872_164_676 168
819 3300046523 Ga0495644_0106370 Ga0495644_0106370_188_700 168
820 3300046523 Ga0495644_0108378 Ga0495644_0108378_211_723 168
821 3300046525 Ga0495663_0214113 Ga0495663_0214113_87_602 168
822 3300046525 Ga0495663_0262920 Ga0495663_0262920_53_565 168
823 3300046529 Ga0495652_0025506 Ga0495652_0025506_921_1457 168
824 3300046529 Ga0495652_0205375 Ga0495652_0205375_465_977 168
825 3300046529 Ga0495652_0247135 Ga0495652_0247135_635_1147 168
826 3300046533 Ga0495640_0035468 Ga0495640_0035468_527_1063 168
827 3300046536 Ga0495587_0013911 Ga0495587_0013911_2069_2605 168
828 3300046537 Ga0495598_0009888 Ga0495598_0009888_1441_1953 168
829 3300046538 Ga0495609_0022606 Ga0495609_0022606_378_890 168
830 3300046538 Ga0495609_0198945 Ga0495609_0198945_89_637 168
831 3300046543 Ga0495645_0029715 Ga0495645_0029715_3252_3788 168
832 3300046559 Ga0495667_0007856 Ga0495667_0007856_4496_5032 168
833 3300046559 Ga0495667_0438941 Ga0495667_0438941_149_664 168
834 3300046615 Ga0495656_0005268 Ga0495656_0005268_2528_3040 168
835 3300046615 Ga0495656_0089573 Ga0495656_0089573_622_1134 168
836 3300046615 Ga0495656_0110573 Ga0495656_0110573_749_1261 168
837 3300046616 Ga0495668_0044002 Ga0495668_0044002_1330_1842 168
838 3300046616 Ga0495668_0223332 Ga0495668_0223332_94_642 168
839 3300046616 Ga0495668_0352017 Ga0495668_0352017_14_526 168
840 3300046642 Ga0495634_0010895 Ga0495634_0010895_3590_4126 168
841 3300046648 Ga0495611_0087431 Ga0495611_0087431_720_1232 168
842 3300046648 Ga0495611_0159732 Ga0495611_0159732_153_665 168
843 3300046660 Ga0495625_0148756 Ga0495625_0148756_720_1232 168
844 3300046660 Ga0495625_0206903 Ga0495625_0206903_674_1186 168
845 3300046660 Ga0495625_0348077 Ga0495625_0348077_340_852 168
846 3300046663 Ga0495635_0002149 Ga0495635_0002149_6948_7484 168
847 3300046663 Ga0495635_0126515 Ga0495635_0126515_221_736 168
848 3300046665 Ga0495661_0103488 Ga0495661_0103488_77_589 168
849 3300046665 Ga0495661_0285868 Ga0495661_0285868_172_684 168
850 3300046674 Ga0495588_0243798 Ga0495588_0243798_28_546 168
851 3300046674 Ga0495588_0306992 Ga0495588_0306992_71_583 168
852 3300046675 Ga0495657_0026686 Ga0495657_0026686_1355_1891 168
853 3300046675 Ga0495657_0539973 Ga0495657_0539973_65_577 168
854 3300046678 Ga0495599_0001827 Ga0495599_0001827_4480_5016 168
855 3300046679 Ga0495623_0170793 Ga0495623_0170793_371_883 168
856 3300046684 Ga0495669_0000675 Ga0495669_0000675_7182_7694 168
857 3300046689 Ga0495613_0092686 Ga0495613_0092686_349_861 168
858 3300046689 Ga0495613_0254730 Ga0495613_0254730_132_668 168
859 3300046794 Ga0495589_0087665 Ga0495589_0087665_123_635 168
860 3300046809 Ga0495600_0006396 Ga0495600_0006396_1578_2114 168
861 3300046809 Ga0495600_0159162 Ga0495600_0159162_44_556 168
862 3300046809 Ga0495600_0435927 Ga0495600_0435927_141_677 168
863 3300047315 Ga0495581_0138320 Ga0495581_0138320_476_994 168
864 3300047317 Ga0495604_0005881 Ga0495604_0005881_3296_3832 168
865 3300047318 Ga0495636_0139869 Ga0495636_0139869_258_770 168
866 3300047318 Ga0495636_0378807 Ga0495636_0378807_119_631 168
867 3300047319 Ga0495674_0060932 Ga0495674_0060932_2321_2857 168
868 3300047320 Ga0495672_0029388 Ga0495672_0029388_1166_1705 168
869 3300047320 Ga0495672_0030049 Ga0495672_0030049_1997_2533 168
870 3300047322 Ga0495680_0009327 Ga0495680_0009327_5854_6390 168
871 3300047444 Ga0495675_0008213 Ga0495675_0008213_3601_4137 168
872 3300047445 Ga0495677_0084468 Ga0495677_0084468_506_1018 168
873 3300047447 Ga0495685_099265 Ga0495685_099265_10_522 168
874 3300047469 Ga0495673_0034976 Ga0495673_0034976_1283_1795 168
875 3300047469 Ga0495673_0102385 Ga0495673_0102385_537_1049 168
876 3300047469 Ga0495673_0109406 Ga0495673_0109406_145_657 168
877 3300047471 Ga0495684_0026359 Ga0495684_0026359_2033_2569 168
878 3300047472 Ga0495686_0118536 Ga0495686_0118536_128_664 168
879 3300047472 Ga0495686_0180571 Ga0495686_0180571_523_1062 168
880 3300047472 Ga0495686_0196855 Ga0495686_0196855_236_748 168
881 3300047673 Ga0495593_0008299 Ga0495593_0008299_3429_3965 168
882 3300047673 Ga0495593_0182007 Ga0495593_0182007_194_709 168
883 3300047673 Ga0495593_0207551 Ga0495593_0207551_357_893 168
884 3300048088 Ga0495602_0011154 Ga0495602_0011154_4481_5017 168
885 3300048903 Ga0496100_0001613 Ga0496100_0001613_8809_9321 168
886 3300048903 Ga0496100_0394378 Ga0496100_0394378_455_964 168
887 3300048903 Ga0496100_1319465 Ga0496100_1319465_28_540 168
888 3300048904 Ga0496101_0004421 Ga0496101_0004421_3277_3789 168
889 3300048904 Ga0496101_0366155 Ga0496101_0366155_135_647 168
890 3300048905 Ga0496102_0012054 Ga0496102_0012054_1618_2130 168
891 3300048905 Ga0496102_0142359 Ga0496102_0142359_579_1091 168
892 3300048905 Ga0496102_0581821 Ga0496102_0581821_192_704 168
893 3300048905 Ga0496102_0848660 Ga0496102_0848660_63_575 168
894 3300048905 Ga0496102_0876304 Ga0496102_0876304_73_585 168
895 3300048906 Ga0496103_0333963 Ga0496103_0333963_102_614 168
896 3300048907 Ga0496104_0081042 Ga0496104_0081042_1939_2451 168
897 3300048907 Ga0496104_0303660 Ga0496104_0303660_692_1207 168
898 3300048907 Ga0496104_0805641 Ga0496104_0805641_193_705 168
899 3300048908 Ga0496105_0258114 Ga0496105_0258114_526_1038 168
900 3300048909 Ga0496106_0040286 Ga0496106_0040286_2259_2771 168
901 3300048909 Ga0496106_0463958 Ga0496106_0463958_488_1003 168
902 3300048910 Ga0496107_0004750 Ga0496107_0004750_2563_3075 168
903 3300048910 Ga0496107_0605431 Ga0496107_0605431_226_741 168
904 3300048912 Ga0496109_0010512 Ga0496109_0010512_5251_5763 168
905 3300048912 Ga0496109_0181768 Ga0496109_0181768_1355_1867 168
906 3300048913 Ga0496110_0018621 Ga0496110_0018621_995_1507 168
907 3300048913 Ga0496110_0300721 Ga0496110_0300721_697_1209 168
908 3300048914 Ga0496111_0127639 Ga0496111_0127639_15_530 168
909 3300048915 Ga0496112_0070372 Ga0496112_0070372_2773_3285 168
910 3300048915 Ga0496112_0271642 Ga0496112_0271642_122_658 168
911 3300048915 Ga0496112_0812483 Ga0496112_0812483_82_594 168
912 3300048916 Ga0496113_0006480 Ga0496113_0006480_3736_4248 168
913 3300048916 Ga0496113_0395933 Ga0496113_0395933_297_812 168
914 3300048917 Ga0496114_0008103 Ga0496114_0008103_1520_2032 168
915 3300048917 Ga0496114_0110348 Ga0496114_0110348_945_1457 168
916 3300048917 Ga0496114_0545311 Ga0496114_0545311_203_718 168
917 3300048917 Ga0496114_0558059 Ga0496114_0558059_88_606 168
918 3300048918 Ga0496115_0005898 Ga0496115_0005898_3826_4338 168
919 3300048918 Ga0496115_0280060 Ga0496115_0280060_648_1163 168
920 3300048921 Ga0496118_0307866 Ga0496118_0307866_201_719 168
921 3300048922 Ga0496119_0168520 Ga0496119_0168520_223_759 168
922 3300048923 Ga0496120_0140607 Ga0496120_0140607_259_777 168
923 3300048924 Ga0496121_0000178 Ga0496121_0000178_40923_41459 168
924 3300048924 Ga0496121_0047711 Ga0496121_0047711_2634_3152 168
925 3300048924 Ga0496121_0115654 Ga0496121_0115654_951_1463 168
926 3300048924 Ga0496121_0117262 Ga0496121_0117262_183_698 168
927 3300048924 Ga0496121_0231223 Ga0496121_0231223_471_1034 168
928 3300048924 Ga0496121_0316954 Ga0496121_0316954_420_938 168
929 3300048927 Ga0496124_0160570 Ga0496124_0160570_423_935 168
930 3300048927 Ga0496124_0588364 Ga0496124_0588364_186_701 168
931 3300048929 Ga0496126_0007639 Ga0496126_0007639_4218_4745 168
932 3300048929 Ga0496126_0095324 Ga0496126_0095324_1313_1825 168
933 3300048929 Ga0496126_0153196 Ga0496126_0153196_547_1107 168
934 3300048929 Ga0496126_0195935 Ga0496126_0195935_366_884 168
935 3300048929 Ga0496126_0341302 Ga0496126_0341302_435_971 168
936 3300048929 Ga0496126_0457340 Ga0496126_0457340_211_726 168
937 3300048929 Ga0496126_0513915 Ga0496126_0513915_356_892 168
938 3300049460 Ga0495682_0076929 Ga0495682_0076929_321_833 168
939 3300049568 Ga0501031_0661590 Ga0501031_0661590_125_631 168
940 3300049571 Ga0501034_0213375 Ga0501034_0213375_320_856 168
941 3300049575 Ga0501039_1139986 Ga0501039_1139986_29_565 168
942 3300049581 Ga0501047_0137786 Ga0501047_0137786_1750_2286 168
943 3300049583 Ga0501067_0068698 Ga0501067_0068698_1294_1800 168
944 3300049583 Ga0501067_0073388 Ga0501067_0073388_1364_1885 168
945 3300049592 Ga0501076_1160462 Ga0501076_1160462_70_603 168
946 3300050490 nmdc:mga03n38_257587_c1 nmdc:mga03n38_257587_c1_215_754 168
947 3300050490 nmdc:mga03n38_40050_c1 nmdc:mga03n38_40050_c1_884_1399 168
948 3300050491 nmdc:mga00v17_277365_c1 nmdc:mga00v17_277365_c1_443_955 168
949 3300050492 nmdc:mga0yw44_166004_c1 nmdc:mga0yw44_166004_c1_253_771 168
950 3300050494 nmdc:mga06z11_226138_c1 nmdc:mga06z11_226138_c1_81_593 168
951 3300050494 nmdc:mga06z11_276415_c1 nmdc:mga06z11_276415_c1_240_779 168
952 3300050496 nmdc:mga07m45_198930_c1 nmdc:mga07m45_198930_c1_473_979 168
953 3300050496 nmdc:mga07m45_41448_c1 nmdc:mga07m45_41448_c1_1289_1828 168
954 3300050496 nmdc:mga07m45_420172_c1 nmdc:mga07m45_420172_c1_76_591 168
955 3300050496 nmdc:mga07m45_47017_c1 nmdc:mga07m45_47017_c1_231_743 168
956 3300050511 nmdc:mga08y16_252069_c1 nmdc:mga08y16_252069_c1_1202_1714 168
957 3300050511 nmdc:mga08y16_52748_c1 nmdc:mga08y16_52748_c1_2222_2734 168
958 3300050512 nmdc:mga0n895_231793_c1 nmdc:mga0n895_231793_c1_426_938 168
959 3300053077 Ga0495601_0099317 Ga0495601_0099317_531_1082 168
960 3300053078 Ga0495612_0074765 Ga0495612_0074765_656_1207 168
961 3300053080 Ga0500635_0002566 Ga0500635_0002566_1680_2216 168
962 3300053083 Ga0495655_0227871 Ga0495655_0227871_46_582 168
963 3300053084 Ga0495595_0003401 Ga0495595_0003401_2196_2732 168
964 3300053084 Ga0495595_0022694 Ga0495595_0022694_1282_1797 168
965 3300053085 Ga0495619_0011847 Ga0495619_0011847_2450_2986 168
966 3300053085 Ga0495619_0037524 Ga0495619_0037524_1376_1891 168
967 3300053085 Ga0495619_0344012 Ga0495619_0344012_421_957 168
968 3300053086 Ga0500578_0094848 Ga0500578_0094848_1157_1669 168
969 3300053087 Ga0500643_034871 Ga0500643_034871_506_1018 168
970 3300053090 Ga0500646_0025692 Ga0500646_0025692_161_673 168
971 3300053092 Ga0500583_0146990 Ga0500583_0146990_221_733 168
972 3300053094 Ga0500566_0024402 Ga0500566_0024402_181_693 168
973 3300053096 Ga0500641_0034871 Ga0500641_0034871_38_550 168
974 3300053098 Ga0500650_0133385 Ga0500650_0133385_356_868 168
975 3300053099 Ga0500654_097892 Ga0500654_097892_631_1143 168
976 3300053102 Ga0500554_002814 Ga0500554_002814_1038_1574 168
977 3300053108 Ga0500562_057460 Ga0500562_057460_89_601 168
978 3300053109 Ga0500569_000323 Ga0500569_000323_152_664 168
979 3300053119 Ga0500595_002758 Ga0500595_002758_1708_2220 168
980 3300053119 Ga0500595_003563 Ga0500595_003563_113_649 168
981 3300053119 Ga0500595_134736 Ga0500595_134736_167_679 168
982 3300053133 Ga0500655_067473 Ga0500655_067473_135_647 168
983 3300053139 Ga0500568_0132400 Ga0500568_0132400_328_864 168
984 3300053142 Ga0500577_0021539 Ga0500577_0021539_288_800 168
985 3300053142 Ga0500577_0078843 Ga0500577_0078843_573_1085 168
986 3300053146 Ga0500588_0055913 Ga0500588_0055913_56_568 168
987 3300053146 Ga0500588_0246146 Ga0500588_0246146_148_660 168
988 3300053147 Ga0500589_013888 Ga0500589_013888_1694_2206 168
989 3300053147 Ga0500589_149998 Ga0500589_149998_236_748 168
990 3300053150 Ga0500603_002517 Ga0500603_002517_2670_3206 168
991 3300053153 Ga0500616_0074173 Ga0500616_0074173_639_1184 168
992 3300053153 Ga0500616_0084438 Ga0500616_0084438_291_848 168
993 3300053153 Ga0500616_0178677 Ga0500616_0178677_110_667 168
994 3300053160 Ga0500633_0039755 Ga0500633_0039755_109_621 168
995 3300053161 Ga0500634_0042288 Ga0500634_0042288_463_975 168
996 3300053177 Ga0500636_0026335 Ga0500636_0026335_482_994 168
997 3300053177 Ga0500636_0219900 Ga0500636_0219900_419_937 168
998 3300053177 Ga0500636_0446545 Ga0500636_0446545_64_576 168
999 3300053178 Ga0500637_0000600 Ga0500637_0000600_6373_6885 168
1000 3300053178 Ga0500637_0020687 Ga0500637_0020687_2113_2649 168
1001 3300053730 Ga0500645_020268 Ga0500645_020268_1284_1796 168
1002 3300053730 Ga0500645_020334 Ga0500645_020334_480_992 168
1003 3300053730 Ga0500645_084809 Ga0500645_084809_55_588 168
1004 3300053731 Ga0500609_000821 Ga0500609_000821_695_1207 168
1005 3300055283 Ga0500661_004937 Ga0500661_004937_681_1193 168
1006 iso_pu_bacteria 2643221651 2644287387 168
1007 iso_pu_bacteria 2874604998 2874612526 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

22

186

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xg4-assembly1.cif.gz_A x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim 0.9636 3 166
7mym-assembly1.cif.gz_A crystal structure of escherichia coli dihydrofolate reductase in complex with trimethoprim and nadph 0.9613 3 165
4p66-assembly1.cif.gz_A electrostatics of active site microenvironments of e. coli dhfr 0.9601 3 166
4p68-assembly1.cif.gz_A electrostatics of active site microenvironments for e. coli dhfr 0.9574 3 166
5w3q-assembly1.cif.gz_A l28f e.coli dhfr in complex with nadph 0.9568 3 166
ID Description Score Start End Superfamily
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9639 3 167 3.40.430.10
3fl9F00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9448 1 167 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.934 1 165 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9283 1 165 3.40.430.10
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9241 3 167 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7Y4LX80-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9942 1 166 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A059WM53-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9924 53 167 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A2P7BHF9-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9906 3 166 GO:0004146
GO:0005829
GO:0006730
GO:0016301
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A3S0DPS1-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9905 7 167 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A7S8C7J3-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9897 1 166 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Feature Viewer

pLDDT pTM Quality
96.87 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map