F488037
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1007 | 451 | 969 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10663633|Ga0157376_106636332 |
| Length | 190 |
| Sequence | VDGLPDRRSGVDGAGAGSALMEIVMIVAVAENGVIGAGGAIPWLLKSDMARFKALTSRKPVVMGRKTFVSIGRPLPGRTNIVVTRDAAFRADGVVVTNSFADAMAIATGDALRRFATEIAVIGGAEIYAQWMDRADRLEITEVHARPDGDTRFAAIDARDWEEVACVRNPAGADDSADFSYVTFRRRKPH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 7 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 8 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 9 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 10 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 11 | 2791355199 | |||
| 12 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 13 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 14 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 15 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 16 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 17 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 18 | 2904699407 | |||
| 19 | 2906610324 | |||
| 20 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 21 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 22 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 23 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 24 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 25 | 2922425934 | |||
| 26 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 27 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 28 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 29 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 30 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 33 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 34 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 120 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 226 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 227 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 234 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 242 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 245 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 246 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 247 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 248 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 259 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 274 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 275 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 277 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 278 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 281 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 282 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 283 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 380 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 381 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 382 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 383 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 384 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 385 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 394 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 395 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 397 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 409 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 412 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 416 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 417 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 418 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 419 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 421 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 422 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 424 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 425 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 426 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 427 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 428 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 429 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 431 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 432 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 433 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 434 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 435 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 436 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 437 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 439 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 441 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 442 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 443 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 444 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 445 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 446 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 447 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 448 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 449 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 450 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 451 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.61 |
| Metatranscriptomes | 0 |
| Isolates | 3.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.22 |
| Nodule | 3.08 |
| Rhizoplane | 7.25 |
| Rhizosphere | 71.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000738 | 3300003215 | Bacteria | 20026 |
| 2 | rootH2_10100776 | 3300003320 | Bacteria | 1134 |
| 3 | rootL2_10156283 | 3300003322 | Bacteria | 1130 |
| 4 | JGI25404J52841_10008621 | 3300003659 | Bacteria | 2175 |
| 5 | JGI25404J52841_10019463 | 3300003659 | Bacteria | 1471 |
| 6 | Ga0070658_10090223 | 3300005327 | Bacteria | 2525 |
| 7 | Ga0070658_10946607 | 3300005327 | Bacteria | 749 |
| 8 | Ga0070676_10202667 | 3300005328 | Bacteria | 1301 |
| 9 | Ga0070676_10211892 | 3300005328 | Bacteria | 1275 |
| 10 | Ga0070683_101016290 | 3300005329 | Bacteria | 796 |
| 11 | Ga0070690_100013883 | 3300005330 | Bacteria | 4774 |
| 12 | Ga0070690_100855336 | 3300005330 | Bacteria | 709 |
| 13 | Ga0070670_100485037 | 3300005331 | Bacteria | 1098 |
| 14 | Ga0068869_100111564 | 3300005334 | Bacteria | 2081 |
| 15 | Ga0068869_100133194 | 3300005334 | Bacteria | 1912 |
| 16 | Ga0068869_100140009 | 3300005334 | Bacteria | 1867 |
| 17 | Ga0068869_101162221 | 3300005334 | Bacteria | 677 |
| 18 | Ga0070666_10094036 | 3300005335 | Bacteria | 2061 |
| 19 | Ga0070680_100000088 | 3300005336 | Bacteria | 51479 |
| 20 | Ga0070680_100569234 | 3300005336 | Bacteria | 972 |
| 21 | Ga0070682_100081625 | 3300005337 | Bacteria | 2094 |
| 22 | Ga0070682_100471822 | 3300005337 | Bacteria | 966 |
| 23 | Ga0068868_100105245 | 3300005338 | Bacteria | 2287 |
| 24 | Ga0068868_100330768 | 3300005338 | Bacteria | 1300 |
| 25 | Ga0068868_100459610 | 3300005338 | Bacteria | 1108 |
| 26 | Ga0068868_100539507 | 3300005338 | Bacteria | 1027 |
| 27 | Ga0070660_100095121 | 3300005339 | Bacteria | 2354 |
| 28 | Ga0070660_100372677 | 3300005339 | Bacteria | 1178 |
| 29 | Ga0070689_100556949 | 3300005340 | Bacteria | 988 |
| 30 | Ga0070691_10293480 | 3300005341 | Bacteria | 886 |
| 31 | Ga0070661_100000014 | 3300005344 | Bacteria | 158652 |
| 32 | Ga0070661_100155180 | 3300005344 | Bacteria | 1732 |
| 33 | Ga0070661_100547282 | 3300005344 | Bacteria | 931 |
| 34 | Ga0070692_10185736 | 3300005345 | Bacteria | 1208 |
| 35 | Ga0070668_100108937 | 3300005347 | Bacteria | 2203 |
| 36 | Ga0070668_100357346 | 3300005347 | Bacteria | 1238 |
| 37 | Ga0070668_100626033 | 3300005347 | Bacteria | 943 |
| 38 | Ga0070668_100832552 | 3300005347 | Bacteria | 821 |
| 39 | Ga0070668_100976201 | 3300005347 | Bacteria | 760 |
| 40 | Ga0070669_101064525 | 3300005353 | Bacteria | 696 |
| 41 | Ga0070675_101387632 | 3300005354 | Bacteria | 648 |
| 42 | Ga0070671_100196427 | 3300005355 | Bacteria | 1710 |
| 43 | Ga0070671_100216516 | 3300005355 | Bacteria | 1625 |
| 44 | Ga0070671_100270463 | 3300005355 | Bacteria | 1444 |
| 45 | Ga0070671_101014070 | 3300005355 | Bacteria | 727 |
| 46 | Ga0070674_100035143 | 3300005356 | Bacteria | 3354 |
| 47 | Ga0070674_100378784 | 3300005356 | Bacteria | 1151 |
| 48 | Ga0070674_100693830 | 3300005356 | Bacteria | 869 |
| 49 | Ga0070673_100112844 | 3300005364 | Bacteria | 2256 |
| 50 | Ga0070673_100589410 | 3300005364 | Bacteria | 1013 |
| 51 | Ga0070688_100317063 | 3300005365 | Bacteria | 1132 |
| 52 | Ga0070688_100322111 | 3300005365 | Bacteria | 1123 |
| 53 | Ga0070659_100214238 | 3300005366 | Bacteria | 1588 |
| 54 | Ga0070659_100306833 | 3300005366 | Bacteria | 1325 |
| 55 | Ga0070659_100334759 | 3300005366 | Bacteria | 1267 |
| 56 | Ga0070659_100974340 | 3300005366 | Bacteria | 743 |
| 57 | Ga0070667_100559616 | 3300005367 | Bacteria | 1051 |
| 58 | Ga0070709_10096813 | 3300005434 | Bacteria | 1958 |
| 59 | Ga0070714_100327084 | 3300005435 | Bacteria | 1435 |
| 60 | Ga0070714_101163778 | 3300005435 | Bacteria | 752 |
| 61 | Ga0070710_10011649 | 3300005437 | Bacteria | 4349 |
| 62 | Ga0070701_10364149 | 3300005438 | Bacteria | 907 |
| 63 | Ga0070711_100010862 | 3300005439 | Bacteria | 5645 |
| 64 | Ga0070705_101026550 | 3300005440 | Bacteria | 671 |
| 65 | Ga0070700_100351816 | 3300005441 | Bacteria | 1092 |
| 66 | Ga0070663_100189605 | 3300005455 | Bacteria | 1599 |
| 67 | Ga0070663_100294729 | 3300005455 | Bacteria | 1296 |
| 68 | Ga0070663_100359125 | 3300005455 | Bacteria | 1181 |
| 69 | Ga0070663_100629013 | 3300005455 | Bacteria | 905 |
| 70 | Ga0070678_100007967 | 3300005456 | Bacteria | 6315 |
| 71 | Ga0070678_100035283 | 3300005456 | Bacteria | 3490 |
| 72 | Ga0070678_100039559 | 3300005456 | Bacteria | 3328 |
| 73 | Ga0070678_100158466 | 3300005456 | Bacteria | 1831 |
| 74 | Ga0070678_100196577 | 3300005456 | Bacteria | 1661 |
| 75 | Ga0070678_100870676 | 3300005456 | Bacteria | 822 |
| 76 | Ga0070678_101158368 | 3300005456 | Bacteria | 716 |
| 77 | Ga0070662_100337333 | 3300005457 | Bacteria | 1232 |
| 78 | Ga0070662_100507483 | 3300005457 | Bacteria | 1006 |
| 79 | Ga0070681_10069164 | 3300005458 | Bacteria | 3497 |
| 80 | Ga0070681_10085157 | 3300005458 | Bacteria | 3113 |
| 81 | Ga0070681_10370790 | 3300005458 | Bacteria | 1342 |
| 82 | Ga0070681_11290661 | 3300005458 | Bacteria | 653 |
| 83 | Ga0068867_100358570 | 3300005459 | Bacteria | 1219 |
| 84 | Ga0068867_100989926 | 3300005459 | Bacteria | 762 |
| 85 | Ga0070685_10399497 | 3300005466 | Bacteria | 951 |
| 86 | Ga0070685_10981054 | 3300005466 | Bacteria | 633 |
| 87 | Ga0070699_100198513 | 3300005518 | Bacteria | 1783 |
| 88 | Ga0070699_101543569 | 3300005518 | Bacteria | 609 |
| 89 | Ga0070679_100000003 | 3300005530 | Bacteria | 307836 |
| 90 | Ga0070679_100019162 | 3300005530 | Bacteria | 6648 |
| 91 | Ga0070679_100759250 | 3300005530 | Bacteria | 913 |
| 92 | Ga0070697_100658178 | 3300005536 | Bacteria | 923 |
| 93 | Ga0068853_100406003 | 3300005539 | Bacteria | 1276 |
| 94 | Ga0068853_100710798 | 3300005539 | Bacteria | 959 |
| 95 | Ga0068853_100960605 | 3300005539 | Bacteria | 822 |
| 96 | Ga0068853_101374817 | 3300005539 | Bacteria | 683 |
| 97 | Ga0070672_100139942 | 3300005543 | Bacteria | 1995 |
| 98 | Ga0070672_100173630 | 3300005543 | Bacteria | 1793 |
| 99 | Ga0070672_100411830 | 3300005543 | Bacteria | 1160 |
| 100 | Ga0070672_100545270 | 3300005543 | Bacteria | 1006 |
| 101 | Ga0070686_100149257 | 3300005544 | Bacteria | 1635 |
| 102 | Ga0070686_100277045 | 3300005544 | Bacteria | 1235 |
| 103 | Ga0070665_100020950 | 3300005548 | Bacteria | 6570 |
| 104 | Ga0070665_100080986 | 3300005548 | Bacteria | 3252 |
| 105 | Ga0070665_100104062 | 3300005548 | Bacteria | 2841 |
| 106 | Ga0070665_100160316 | 3300005548 | Bacteria | 2251 |
| 107 | Ga0070665_100253571 | 3300005548 | Bacteria | 1760 |
| 108 | Ga0070665_100503129 | 3300005548 | Bacteria | 1223 |
| 109 | Ga0070665_100626694 | 3300005548 | Bacteria | 1088 |
| 110 | Ga0070665_101429373 | 3300005548 | Bacteria | 700 |
| 111 | Ga0070704_100117260 | 3300005549 | Bacteria | 2037 |
| 112 | Ga0068855_100036490 | 3300005563 | Bacteria | 5850 |
| 113 | Ga0068855_100172069 | 3300005563 | Bacteria | 2452 |
| 114 | Ga0070664_100533733 | 3300005564 | Bacteria | 1084 |
| 115 | Ga0070664_100630319 | 3300005564 | Bacteria | 996 |
| 116 | Ga0070664_101348482 | 3300005564 | Bacteria | 674 |
| 117 | Ga0068857_101048364 | 3300005577 | Bacteria | 786 |
| 118 | Ga0068857_101165239 | 3300005577 | Bacteria | 746 |
| 119 | Ga0068854_100070455 | 3300005578 | Bacteria | 2556 |
| 120 | Ga0068854_100383616 | 3300005578 | Bacteria | 1159 |
| 121 | Ga0068856_100173634 | 3300005614 | Bacteria | 2167 |
| 122 | Ga0068856_100206953 | 3300005614 | Bacteria | 1976 |
| 123 | Ga0070702_100194975 | 3300005615 | Bacteria | 1336 |
| 124 | Ga0068852_100016778 | 3300005616 | Bacteria | 5723 |
| 125 | Ga0068852_100045466 | 3300005616 | Bacteria | 3734 |
| 126 | Ga0068852_100103442 | 3300005616 | Bacteria | 2576 |
| 127 | Ga0068852_100558585 | 3300005616 | Bacteria | 1146 |
| 128 | Ga0068852_101881571 | 3300005616 | Bacteria | 621 |
| 129 | Ga0068859_100067475 | 3300005617 | Bacteria | 3611 |
| 130 | Ga0068864_100111310 | 3300005618 | Bacteria | 2439 |
| 131 | Ga0068864_101370879 | 3300005618 | Bacteria | 708 |
| 132 | Ga0068866_10161326 | 3300005718 | Bacteria | 1308 |
| 133 | Ga0068861_100184644 | 3300005719 | Bacteria | 1738 |
| 134 | Ga0068861_101349839 | 3300005719 | Bacteria | 695 |
| 135 | Ga0068870_10145078 | 3300005840 | Bacteria | 1392 |
| 136 | Ga0068870_10251097 | 3300005840 | Bacteria | 1096 |
| 137 | Ga0068863_100441310 | 3300005841 | Bacteria | 1276 |
| 138 | Ga0068863_100780084 | 3300005841 | Bacteria | 952 |
| 139 | Ga0068863_101015078 | 3300005841 | Bacteria | 833 |
| 140 | Ga0068860_100128258 | 3300005843 | Bacteria | 2432 |
| 141 | Ga0068860_100272452 | 3300005843 | Bacteria | 1652 |
| 142 | Ga0068860_100297484 | 3300005843 | Bacteria | 1580 |
| 143 | Ga0068860_100305761 | 3300005843 | Bacteria | 1558 |
| 144 | Ga0068860_101427262 | 3300005843 | Bacteria | 713 |
| 145 | Ga0068862_100197996 | 3300005844 | Bacteria | 1810 |
| 146 | Ga0068862_100616472 | 3300005844 | Bacteria | 1043 |
| 147 | Ga0068862_100669716 | 3300005844 | Bacteria | 1003 |
| 148 | Ga0068862_100796587 | 3300005844 | Bacteria | 922 |
| 149 | Ga0068862_100892254 | 3300005844 | Bacteria | 873 |
| 150 | Ga0068862_100900719 | 3300005844 | Bacteria | 869 |
| 151 | Ga0068862_101743178 | 3300005844 | Bacteria | 631 |
| 152 | Ga0081455_10003699 | 3300005937 | Bacteria | 17509 |
| 153 | Ga0081455_10008277 | 3300005937 | Bacteria | 10837 |
| 154 | Ga0081455_10017249 | 3300005937 | Bacteria | 6931 |
| 155 | Ga0081455_10070603 | 3300005937 | Bacteria | 2899 |
| 156 | Ga0081455_10127588 | 3300005937 | Bacteria | 1994 |
| 157 | Ga0081455_10159826 | 3300005937 | Bacteria | 1728 |
| 158 | Ga0081455_10262950 | 3300005937 | Bacteria | 1256 |
| 159 | Ga0081538_10020833 | 3300005981 | Bacteria | 4812 |
| 160 | Ga0081540_1000996 | 3300005983 | Bacteria | 25476 |
| 161 | Ga0081540_1003091 | 3300005983 | Bacteria | 13334 |
| 162 | Ga0081540_1008013 | 3300005983 | Bacteria | 7435 |
| 163 | Ga0081540_1010852 | 3300005983 | Bacteria | 6123 |
| 164 | Ga0081540_1028988 | 3300005983 | Bacteria | 3094 |
| 165 | Ga0081540_1051839 | 3300005983 | Bacteria | 2026 |
| 166 | Ga0081540_1070603 | 3300005983 | Bacteria | 1617 |
| 167 | Ga0081540_1072847 | 3300005983 | Bacteria | 1581 |
| 168 | Ga0081540_1110341 | 3300005983 | Bacteria | 1164 |
| 169 | Ga0081540_1152867 | 3300005983 | Bacteria | 908 |
| 170 | Ga0081539_10041134 | 3300005985 | Bacteria | 2706 |
| 171 | Ga0081539_10177574 | 3300005985 | Bacteria | 1001 |
| 172 | Ga0070717_10608646 | 3300006028 | Bacteria | 991 |
| 173 | Ga0075365_10026143 | 3300006038 | Bacteria | 3703 |
| 174 | Ga0075365_10071612 | 3300006038 | Unclassified | 2334 |
| 175 | Ga0075365_10446381 | 3300006038 | Bacteria | 913 |
| 176 | Ga0075365_10672691 | 3300006038 | Bacteria | 731 |
| 177 | Ga0075368_10002858 | 3300006042 | Bacteria | 5701 |
| 178 | Ga0075368_10109378 | 3300006042 | Bacteria | 1139 |
| 179 | Ga0075363_100003690 | 3300006048 | Bacteria | 6582 |
| 180 | Ga0075363_100019054 | 3300006048 | Bacteria | 3426 |
| 181 | Ga0075363_100092560 | 3300006048 | Bacteria | 1665 |
| 182 | Ga0075363_100307411 | 3300006048 | Bacteria | 921 |
| 183 | Ga0075363_100496104 | 3300006048 | Bacteria | 725 |
| 184 | Ga0075364_10017241 | 3300006051 | Bacteria | 4508 |
| 185 | Ga0075364_10022187 | 3300006051 | Bacteria | 4007 |
| 186 | Ga0070712_100016528 | 3300006175 | Bacteria | 4768 |
| 187 | Ga0070712_100030454 | 3300006175 | Bacteria | 3626 |
| 188 | Ga0075362_10008950 | 3300006177 | Bacteria | 3850 |
| 189 | Ga0075367_10011042 | 3300006178 | Bacteria | 4764 |
| 190 | Ga0075367_10202959 | 3300006178 | Bacteria | 1239 |
| 191 | Ga0075367_10245861 | 3300006178 | Bacteria | 1121 |
| 192 | Ga0075367_10290976 | 3300006178 | Bacteria | 1028 |
| 193 | Ga0075367_10306749 | 3300006178 | Bacteria | 999 |
| 194 | Ga0075367_10414377 | 3300006178 | Bacteria | 852 |
| 195 | Ga0075367_10611856 | 3300006178 | Bacteria | 692 |
| 196 | Ga0075369_10011190 | 3300006186 | Bacteria | 3524 |
| 197 | Ga0075369_10026249 | 3300006186 | Bacteria | 2427 |
| 198 | Ga0075366_10074726 | 3300006195 | Bacteria | 2021 |
| 199 | Ga0075366_10124765 | 3300006195 | Bacteria | 1552 |
| 200 | Ga0075366_10264152 | 3300006195 | Bacteria | 1051 |
| 201 | Ga0097621_100365951 | 3300006237 | Bacteria | 1285 |
| 202 | Ga0075370_10042568 | 3300006353 | Bacteria | 2565 |
| 203 | Ga0075370_10092808 | 3300006353 | Bacteria | 1742 |
| 204 | Ga0075370_10148475 | 3300006353 | Bacteria | 1373 |
| 205 | Ga0075370_10180483 | 3300006353 | Bacteria | 1242 |
| 206 | Ga0075370_10336408 | 3300006353 | Bacteria | 900 |
| 207 | Ga0075370_10364212 | 3300006353 | Bacteria | 865 |
| 208 | Ga0075370_10514759 | 3300006353 | Bacteria | 723 |
| 209 | Ga0068871_100107291 | 3300006358 | Bacteria | 2345 |
| 210 | Ga0068871_100162487 | 3300006358 | Bacteria | 1910 |
| 211 | Ga0068871_100220538 | 3300006358 | Bacteria | 1643 |
| 212 | Ga0068871_100343989 | 3300006358 | Bacteria | 1318 |
| 213 | Ga0075428_100025159 | 3300006844 | Bacteria | 6586 |
| 214 | Ga0075428_100220390 | 3300006844 | Bacteria | 2049 |
| 215 | Ga0075430_101210418 | 3300006846 | Bacteria | 622 |
| 216 | Ga0075431_100001712 | 3300006847 | Bacteria | 20617 |
| 217 | Ga0075434_100357445 | 3300006871 | Bacteria | 1481 |
| 218 | Ga0068865_100291188 | 3300006881 | Bacteria | 1303 |
| 219 | Ga0068865_100941720 | 3300006881 | Bacteria | 753 |
| 220 | Ga0075436_100232485 | 3300006914 | Bacteria | 1310 |
| 221 | Ga0097620_100067486 | 3300006931 | Bacteria | 3611 |
| 222 | Ga0099824_1003225 | 3300006942 | Bacteria | 23847 |
| 223 | Ga0099822_1005628 | 3300006943 | Bacteria | 16352 |
| 224 | Ga0099794_10052540 | 3300007265 | Bacteria | 1964 |
| 225 | Ga0099795_10040196 | 3300007788 | Bacteria | 1660 |
| 226 | Ga0099795_10128197 | 3300007788 | Bacteria | 1021 |
| 227 | Ga0099795_10323829 | 3300007788 | Bacteria | 683 |
| 228 | Ga0105250_10157267 | 3300009092 | Bacteria | 948 |
| 229 | Ga0105240_10177700 | 3300009093 | Bacteria | 2515 |
| 230 | Ga0105240_10445878 | 3300009093 | Bacteria | 1449 |
| 231 | Ga0111539_10089698 | 3300009094 | Bacteria | 3613 |
| 232 | Ga0111539_10261925 | 3300009094 | Bacteria | 2013 |
| 233 | Ga0111539_10335277 | 3300009094 | Bacteria | 1760 |
| 234 | Ga0105245_10386161 | 3300009098 | Bacteria | 1395 |
| 235 | Ga0105245_10444822 | 3300009098 | Bacteria | 1303 |
| 236 | Ga0105245_10818767 | 3300009098 | Bacteria | 970 |
| 237 | Ga0105245_11562928 | 3300009098 | Bacteria | 711 |
| 238 | Ga0105245_11846327 | 3300009098 | Bacteria | 657 |
| 239 | Ga0105247_10189004 | 3300009101 | Bacteria | 1378 |
| 240 | Ga0105247_10196299 | 3300009101 | Bacteria | 1354 |
| 241 | Ga0105247_10372541 | 3300009101 | Bacteria | 1010 |
| 242 | Ga0105247_10389979 | 3300009101 | Bacteria | 989 |
| 243 | Ga0114129_10037884 | 3300009147 | Bacteria | 6804 |
| 244 | Ga0114129_10345513 | 3300009147 | Bacteria | 1972 |
| 245 | Ga0114129_11387469 | 3300009147 | Bacteria | 867 |
| 246 | Ga0105243_10282716 | 3300009148 | Bacteria | 1495 |
| 247 | Ga0105243_10421131 | 3300009148 | Bacteria | 1246 |
| 248 | Ga0105243_10691454 | 3300009148 | Bacteria | 993 |
| 249 | Ga0105243_10984259 | 3300009148 | Bacteria | 845 |
| 250 | Ga0105241_10155119 | 3300009174 | Bacteria | 1877 |
| 251 | Ga0105242_10136248 | 3300009176 | Bacteria | 2125 |
| 252 | Ga0105242_10185353 | 3300009176 | Bacteria | 1839 |
| 253 | Ga0105242_10315136 | 3300009176 | Bacteria | 1433 |
| 254 | Ga0105242_10650033 | 3300009176 | Bacteria | 1025 |
| 255 | Ga0105242_11194681 | 3300009176 | Bacteria | 779 |
| 256 | Ga0105248_10098374 | 3300009177 | Bacteria | 3296 |
| 257 | Ga0105248_10108780 | 3300009177 | Bacteria | 3126 |
| 258 | Ga0105248_10649225 | 3300009177 | Bacteria | 1191 |
| 259 | Ga0105248_10692965 | 3300009177 | Bacteria | 1149 |
| 260 | Ga0105237_10455384 | 3300009545 | Bacteria | 1285 |
| 261 | Ga0105237_10501099 | 3300009545 | Bacteria | 1221 |
| 262 | Ga0105237_10864289 | 3300009545 | Bacteria | 911 |
| 263 | Ga0105237_11173532 | 3300009545 | Bacteria | 774 |
| 264 | Ga0105237_11323625 | 3300009545 | Bacteria | 727 |
| 265 | Ga0105237_11426633 | 3300009545 | Bacteria | 699 |
| 266 | Ga0105238_10158752 | 3300009551 | Bacteria | 2237 |
| 267 | Ga0105238_10273510 | 3300009551 | Bacteria | 1670 |
| 268 | Ga0105238_10620758 | 3300009551 | Bacteria | 1090 |
| 269 | Ga0105238_10915828 | 3300009551 | Bacteria | 895 |
| 270 | Ga0105249_10215265 | 3300009553 | Bacteria | 1888 |
| 271 | Ga0105249_10432775 | 3300009553 | Bacteria | 1352 |
| 272 | Ga0105249_10806331 | 3300009553 | Bacteria | 1003 |
| 273 | Ga0105249_11240327 | 3300009553 | Bacteria | 817 |
| 274 | Ga0105249_12030534 | 3300009553 | Bacteria | 648 |
| 275 | Ga0099796_10062156 | 3300010159 | Bacteria | 1327 |
| 276 | Ga0105239_10024893 | 3300010375 | Bacteria | 6592 |
| 277 | Ga0105239_10242659 | 3300010375 | Bacteria | 2022 |
| 278 | Ga0105239_10396197 | 3300010375 | Bacteria | 1562 |
| 279 | Ga0105239_11112850 | 3300010375 | Bacteria | 909 |
| 280 | Ga0105239_12180236 | 3300010375 | Bacteria | 644 |
| 281 | Ga0105246_10230215 | 3300011119 | Bacteria | 1459 |
| 282 | Ga0105246_10295173 | 3300011119 | Bacteria | 1306 |
| 283 | Ga0105246_10337501 | 3300011119 | Bacteria | 1230 |
| 284 | Ga0105246_10348769 | 3300011119 | Bacteria | 1212 |
| 285 | Ga0105246_11308707 | 3300011119 | Bacteria | 672 |
| 286 | Ga0157373_10490549 | 3300013100 | Bacteria | 887 |
| 287 | Ga0157370_10104481 | 3300013104 | Bacteria | 2652 |
| 288 | Ga0157374_10328495 | 3300013296 | Bacteria | 1517 |
| 289 | Ga0157374_10430092 | 3300013296 | Bacteria | 1320 |
| 290 | Ga0157374_10460814 | 3300013296 | Bacteria | 1273 |
| 291 | Ga0157374_10854423 | 3300013296 | Bacteria | 927 |
| 292 | Ga0157378_10095979 | 3300013297 | Bacteria | 2701 |
| 293 | Ga0157378_10404118 | 3300013297 | Bacteria | 1346 |
| 294 | Ga0157378_10615398 | 3300013297 | Bacteria | 1099 |
| 295 | Ga0157378_10817666 | 3300013297 | Bacteria | 958 |
| 296 | Ga0163162_10413440 | 3300013306 | Bacteria | 1481 |
| 297 | Ga0163162_10677145 | 3300013306 | Bacteria | 1154 |
| 298 | Ga0157372_10822131 | 3300013307 | Bacteria | 1079 |
| 299 | Ga0157375_10022963 | 3300013308 | Bacteria | 5749 |
| 300 | Ga0157375_10284050 | 3300013308 | Bacteria | 1818 |
| 301 | Ga0157375_10370365 | 3300013308 | Bacteria | 1599 |
| 302 | Ga0157375_11141399 | 3300013308 | Bacteria | 913 |
| 303 | Ga0157375_11652625 | 3300013308 | Bacteria | 758 |
| 304 | Ga0163163_10195936 | 3300014325 | Bacteria | 2068 |
| 305 | Ga0163163_10252362 | 3300014325 | Bacteria | 1815 |
| 306 | Ga0163163_10559247 | 3300014325 | Bacteria | 1207 |
| 307 | Ga0157380_10122053 | 3300014326 | Bacteria | 2209 |
| 308 | Ga0157380_10158264 | 3300014326 | Bacteria | 1966 |
| 309 | Ga0157380_10181760 | 3300014326 | Bacteria | 1848 |
| 310 | Ga0157380_10280804 | 3300014326 | Bacteria | 1523 |
| 311 | Ga0157380_10469416 | 3300014326 | Bacteria | 1214 |
| 312 | Ga0157380_11337038 | 3300014326 | Bacteria | 765 |
| 313 | Ga0157377_10084306 | 3300014745 | Bacteria | 1864 |
| 314 | Ga0157379_10188769 | 3300014968 | Bacteria | 1863 |
| 315 | Ga0157379_10206840 | 3300014968 | Bacteria | 1776 |
| 316 | Ga0157379_10535312 | 3300014968 | Bacteria | 1088 |
| 317 | Ga0157379_10703657 | 3300014968 | Bacteria | 948 |
| 318 | Ga0157379_10718872 | 3300014968 | Bacteria | 938 |
| 319 | Ga0157379_10810248 | 3300014968 | Bacteria | 884 |
| 320 | Ga0157376_10350883 | 3300014969 | Bacteria | 1412 |
| 321 | Ga0157376_10663633 | 3300014969 | Bacteria | 1044 |
| 322 | Ga0163161_10026279 | 3300017792 | Bacteria | 4124 |
| 323 | Ga0163161_10215639 | 3300017792 | Bacteria | 1484 |
| 324 | Ga0163161_10455945 | 3300017792 | Bacteria | 1034 |
| 325 | Ga0163161_10589924 | 3300017792 | Bacteria | 915 |
| 326 | Ga0163161_10852310 | 3300017792 | Bacteria | 769 |
| 327 | Ga0209455_1006055 | 3300025272 | Bacteria | 3635 |
| 328 | Ga0209758_1065794 | 3300025297 | Bacteria | 1168 |
| 329 | Ga0207697_10216455 | 3300025315 | Bacteria | 844 |
| 330 | Ga0207653_10022300 | 3300025885 | Bacteria | 2011 |
| 331 | Ga0207692_10013187 | 3300025898 | Bacteria | 3578 |
| 332 | Ga0207642_10070349 | 3300025899 | Bacteria | 1663 |
| 333 | Ga0207710_10079854 | 3300025900 | Bacteria | 1516 |
| 334 | Ga0207710_10105922 | 3300025900 | Bacteria | 1331 |
| 335 | Ga0207688_10056972 | 3300025901 | Bacteria | 2196 |
| 336 | Ga0207688_10060556 | 3300025901 | Bacteria | 2133 |
| 337 | Ga0207688_10078530 | 3300025901 | Bacteria | 1881 |
| 338 | Ga0207685_10235982 | 3300025905 | Bacteria | 877 |
| 339 | Ga0207699_10023406 | 3300025906 | Bacteria | 3362 |
| 340 | Ga0207645_10061625 | 3300025907 | Bacteria | 2396 |
| 341 | Ga0207645_10107392 | 3300025907 | Bacteria | 1805 |
| 342 | Ga0207645_10372645 | 3300025907 | Bacteria | 957 |
| 343 | Ga0207643_10075327 | 3300025908 | Bacteria | 1947 |
| 344 | Ga0207643_10162292 | 3300025908 | Bacteria | 1345 |
| 345 | Ga0207654_10040629 | 3300025911 | Bacteria | 2622 |
| 346 | Ga0207707_10008592 | 3300025912 | Bacteria | 8854 |
| 347 | Ga0207707_10303361 | 3300025912 | Bacteria | 1381 |
| 348 | Ga0207695_10067565 | 3300025913 | Bacteria | 3666 |
| 349 | Ga0207695_10076493 | 3300025913 | Bacteria | 3402 |
| 350 | Ga0207671_10138314 | 3300025914 | Bacteria | 1874 |
| 351 | Ga0207671_10141677 | 3300025914 | Bacteria | 1852 |
| 352 | Ga0207671_10749271 | 3300025914 | Bacteria | 776 |
| 353 | Ga0207693_10001851 | 3300025915 | Bacteria | 18534 |
| 354 | Ga0207693_10050083 | 3300025915 | Bacteria | 3280 |
| 355 | Ga0207663_10009598 | 3300025916 | Bacteria | 5122 |
| 356 | Ga0207660_10000231 | 3300025917 | Bacteria | 35986 |
| 357 | Ga0207660_10271149 | 3300025917 | Bacteria | 1344 |
| 358 | Ga0207657_10104039 | 3300025919 | Bacteria | 2352 |
| 359 | Ga0207657_10150210 | 3300025919 | Bacteria | 1898 |
| 360 | Ga0207657_10415027 | 3300025919 | Bacteria | 1058 |
| 361 | Ga0207657_10423804 | 3300025919 | Bacteria | 1046 |
| 362 | Ga0207657_10716807 | 3300025919 | Bacteria | 776 |
| 363 | Ga0207649_10000203 | 3300025920 | Bacteria | 49683 |
| 364 | Ga0207649_10210830 | 3300025920 | Bacteria | 1378 |
| 365 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 366 | Ga0207652_10431321 | 3300025921 | Bacteria | 1188 |
| 367 | Ga0207652_10924717 | 3300025921 | Bacteria | 769 |
| 368 | Ga0207681_10498316 | 3300025923 | Bacteria | 997 |
| 369 | Ga0207681_10709220 | 3300025923 | Bacteria | 837 |
| 370 | Ga0207694_10154521 | 3300025924 | Bacteria | 1850 |
| 371 | Ga0207694_10428851 | 3300025924 | Bacteria | 1102 |
| 372 | Ga0207650_10344744 | 3300025925 | Bacteria | 1224 |
| 373 | Ga0207659_10230032 | 3300025926 | Bacteria | 1495 |
| 374 | Ga0207659_10606532 | 3300025926 | Bacteria | 933 |
| 375 | Ga0207659_10752920 | 3300025926 | Bacteria | 836 |
| 376 | Ga0207659_10765876 | 3300025926 | Bacteria | 828 |
| 377 | Ga0207687_10052440 | 3300025927 | Bacteria | 2847 |
| 378 | Ga0207664_10214985 | 3300025929 | Bacteria | 1665 |
| 379 | Ga0207644_10231562 | 3300025931 | Bacteria | 1468 |
| 380 | Ga0207644_11293574 | 3300025931 | Bacteria | 613 |
| 381 | Ga0207690_10062103 | 3300025932 | Bacteria | 2542 |
| 382 | Ga0207690_10234716 | 3300025932 | Bacteria | 1410 |
| 383 | Ga0207690_10392706 | 3300025932 | Bacteria | 1105 |
| 384 | Ga0207690_10464502 | 3300025932 | Bacteria | 1019 |
| 385 | Ga0207706_10202309 | 3300025933 | Bacteria | 1742 |
| 386 | Ga0207706_10543517 | 3300025933 | Bacteria | 1001 |
| 387 | Ga0207706_10705820 | 3300025933 | Bacteria | 861 |
| 388 | Ga0207706_10868446 | 3300025933 | Bacteria | 763 |
| 389 | Ga0207686_10192088 | 3300025934 | Bacteria | 1456 |
| 390 | Ga0207686_10210720 | 3300025934 | Bacteria | 1397 |
| 391 | Ga0207709_10129363 | 3300025935 | Bacteria | 1718 |
| 392 | Ga0207709_10359981 | 3300025935 | Bacteria | 1101 |
| 393 | Ga0207709_10402879 | 3300025935 | Bacteria | 1046 |
| 394 | Ga0207709_10510572 | 3300025935 | Bacteria | 939 |
| 395 | Ga0207670_10439481 | 3300025936 | Bacteria | 1050 |
| 396 | Ga0207669_10010625 | 3300025937 | Bacteria | 4438 |
| 397 | Ga0207669_10018303 | 3300025937 | Bacteria | 3618 |
| 398 | Ga0207669_10263510 | 3300025937 | Bacteria | 1290 |
| 399 | Ga0207669_10901723 | 3300025937 | Bacteria | 738 |
| 400 | Ga0207704_10029068 | 3300025938 | Bacteria | 3076 |
| 401 | Ga0207704_10078158 | 3300025938 | Bacteria | 2127 |
| 402 | Ga0207704_10363015 | 3300025938 | Bacteria | 1131 |
| 403 | Ga0207704_11049785 | 3300025938 | Bacteria | 691 |
| 404 | Ga0207665_10033322 | 3300025939 | Bacteria | 3413 |
| 405 | Ga0207691_10065199 | 3300025940 | Bacteria | 3298 |
| 406 | Ga0207711_10040565 | 3300025941 | Bacteria | 3961 |
| 407 | Ga0207711_10109202 | 3300025941 | Bacteria | 2458 |
| 408 | Ga0207711_10447228 | 3300025941 | Bacteria | 1203 |
| 409 | Ga0207689_10121032 | 3300025942 | Bacteria | 2153 |
| 410 | Ga0207689_10333347 | 3300025942 | Bacteria | 1260 |
| 411 | Ga0207661_11381957 | 3300025944 | Bacteria | 646 |
| 412 | Ga0207679_10193770 | 3300025945 | Bacteria | 1692 |
| 413 | Ga0207679_10506363 | 3300025945 | Bacteria | 1078 |
| 414 | Ga0207679_10526820 | 3300025945 | Bacteria | 1057 |
| 415 | Ga0207679_11202631 | 3300025945 | Bacteria | 695 |
| 416 | Ga0207667_10049551 | 3300025949 | Bacteria | 4435 |
| 417 | Ga0207667_10131918 | 3300025949 | Bacteria | 2573 |
| 418 | Ga0207667_11176950 | 3300025949 | Bacteria | 747 |
| 419 | Ga0207651_10021773 | 3300025960 | Bacteria | 3904 |
| 420 | Ga0207712_10151232 | 3300025961 | Bacteria | 1793 |
| 421 | Ga0207712_10350499 | 3300025961 | Bacteria | 1227 |
| 422 | Ga0207668_10047201 | 3300025972 | Bacteria | 2947 |
| 423 | Ga0207668_10253892 | 3300025972 | Bacteria | 1429 |
| 424 | Ga0207668_10270828 | 3300025972 | Bacteria | 1388 |
| 425 | Ga0207668_10300481 | 3300025972 | Bacteria | 1324 |
| 426 | Ga0207668_10397541 | 3300025972 | Bacteria | 1164 |
| 427 | Ga0207668_10443281 | 3300025972 | Bacteria | 1106 |
| 428 | Ga0207668_10587005 | 3300025972 | Bacteria | 969 |
| 429 | Ga0207668_10714670 | 3300025972 | Bacteria | 881 |
| 430 | Ga0207640_10970513 | 3300025981 | Bacteria | 746 |
| 431 | Ga0207640_11147516 | 3300025981 | Bacteria | 689 |
| 432 | Ga0207658_10224874 | 3300025986 | Bacteria | 1581 |
| 433 | Ga0207658_10387261 | 3300025986 | Bacteria | 1226 |
| 434 | Ga0207658_11337975 | 3300025986 | Bacteria | 655 |
| 435 | Ga0207677_10154248 | 3300026023 | Bacteria | 1776 |
| 436 | Ga0207677_10297427 | 3300026023 | Bacteria | 1332 |
| 437 | Ga0207677_10395169 | 3300026023 | Bacteria | 1171 |
| 438 | Ga0207677_10448545 | 3300026023 | Bacteria | 1105 |
| 439 | Ga0207703_10252462 | 3300026035 | Bacteria | 1590 |
| 440 | Ga0207703_10365183 | 3300026035 | Bacteria | 1332 |
| 441 | Ga0207639_10143069 | 3300026041 | Bacteria | 1995 |
| 442 | Ga0207639_10274317 | 3300026041 | Bacteria | 1480 |
| 443 | Ga0207639_10477559 | 3300026041 | Bacteria | 1136 |
| 444 | Ga0207639_10480486 | 3300026041 | Bacteria | 1132 |
| 445 | Ga0207639_10529992 | 3300026041 | Bacteria | 1079 |
| 446 | Ga0207678_10029610 | 3300026067 | Bacteria | 4780 |
| 447 | Ga0207678_10035630 | 3300026067 | Bacteria | 4332 |
| 448 | Ga0207678_10051481 | 3300026067 | Bacteria | 3555 |
| 449 | Ga0207678_10071503 | 3300026067 | Bacteria | 2975 |
| 450 | Ga0207678_10096872 | 3300026067 | Bacteria | 2521 |
| 451 | Ga0207678_10187503 | 3300026067 | Bacteria | 1767 |
| 452 | Ga0207678_10227861 | 3300026067 | Bacteria | 1595 |
| 453 | Ga0207708_10197734 | 3300026075 | Bacteria | 1603 |
| 454 | Ga0207708_10486896 | 3300026075 | Bacteria | 1032 |
| 455 | Ga0207702_10621228 | 3300026078 | Bacteria | 1061 |
| 456 | Ga0207702_11214197 | 3300026078 | Bacteria | 748 |
| 457 | Ga0207641_10186159 | 3300026088 | Bacteria | 1905 |
| 458 | Ga0207641_10659296 | 3300026088 | Bacteria | 1028 |
| 459 | Ga0207648_10166283 | 3300026089 | Bacteria | 1949 |
| 460 | Ga0207648_10327207 | 3300026089 | Bacteria | 1378 |
| 461 | Ga0207648_10449648 | 3300026089 | Bacteria | 1173 |
| 462 | Ga0207648_10704453 | 3300026089 | Bacteria | 936 |
| 463 | Ga0207648_10977017 | 3300026089 | Bacteria | 793 |
| 464 | Ga0207676_10586237 | 3300026095 | Bacteria | 1069 |
| 465 | Ga0207674_10752688 | 3300026116 | Bacteria | 940 |
| 466 | Ga0207674_10862879 | 3300026116 | Bacteria | 873 |
| 467 | Ga0207675_100144538 | 3300026118 | Bacteria | 2261 |
| 468 | Ga0207675_100208285 | 3300026118 | Bacteria | 1880 |
| 469 | Ga0207675_100281521 | 3300026118 | Bacteria | 1616 |
| 470 | Ga0207675_100304369 | 3300026118 | Bacteria | 1553 |
| 471 | Ga0207675_100436423 | 3300026118 | Bacteria | 1296 |
| 472 | Ga0207675_100776359 | 3300026118 | Bacteria | 970 |
| 473 | Ga0207675_100989705 | 3300026118 | Bacteria | 859 |
| 474 | Ga0207683_10038663 | 3300026121 | Bacteria | 4161 |
| 475 | Ga0207683_10185005 | 3300026121 | Bacteria | 1890 |
| 476 | Ga0207683_10195445 | 3300026121 | Bacteria | 1838 |
| 477 | Ga0207683_10637824 | 3300026121 | Bacteria | 987 |
| 478 | Ga0207698_10016150 | 3300026142 | Bacteria | 5023 |
| 479 | Ga0207698_10035640 | 3300026142 | Bacteria | 3643 |
| 480 | Ga0207698_10143685 | 3300026142 | Bacteria | 2060 |
| 481 | Ga0207698_10417687 | 3300026142 | Bacteria | 1286 |
| 482 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 483 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 484 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 485 | Ga0209813_10002812 | 3300027866 | Bacteria | 4025 |
| 486 | Ga0209813_10191817 | 3300027866 | Bacteria | 752 |
| 487 | Ga0207428_10062077 | 3300027907 | Bacteria | 2956 |
| 488 | Ga0268266_10013121 | 3300028379 | Bacteria | 7144 |
| 489 | Ga0268266_10016287 | 3300028379 | Bacteria | 6355 |
| 490 | Ga0268266_10064405 | 3300028379 | Bacteria | 3166 |
| 491 | Ga0268266_10273960 | 3300028379 | Bacteria | 1567 |
| 492 | Ga0268266_10395588 | 3300028379 | Bacteria | 1306 |
| 493 | Ga0268265_10082483 | 3300028380 | Bacteria | 2542 |
| 494 | Ga0268265_10168396 | 3300028380 | Bacteria | 1869 |
| 495 | Ga0268265_10404034 | 3300028380 | Bacteria | 1263 |
| 496 | Ga0268265_10521205 | 3300028380 | Bacteria | 1123 |
| 497 | Ga0268265_10683197 | 3300028380 | Bacteria | 990 |
| 498 | Ga0268265_10849276 | 3300028380 | Bacteria | 893 |
| 499 | Ga0268264_10281335 | 3300028381 | Bacteria | 1558 |
| 500 | Ga0268264_10332942 | 3300028381 | Bacteria | 1439 |
| 501 | Ga0268264_10923590 | 3300028381 | Bacteria | 877 |
| 502 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 503 | Ga0307517_10209702 | 3300028786 | Bacteria | 1202 |
| 504 | Ga0307515_10011214 | 3300028794 | Bacteria | 17023 |
| 505 | Ga0307515_10295072 | 3300028794 | Bacteria | 1312 |
| 506 | Ga0307515_10524383 | 3300028794 | Bacteria | 794 |
| 507 | Ga0307512_10159191 | 3300030522 | Bacteria | 1328 |
| 508 | Ga0265332_10025893 | 3300031238 | Bacteria | 2574 |
| 509 | Ga0265325_10004960 | 3300031241 | Bacteria | 8297 |
| 510 | Ga0265340_10014505 | 3300031247 | Bacteria | 4114 |
| 511 | Ga0265340_10018719 | 3300031247 | Bacteria | 3570 |
| 512 | Ga0265339_10013486 | 3300031249 | Bacteria | 4950 |
| 513 | Ga0265339_10072556 | 3300031249 | Bacteria | 1832 |
| 514 | Ga0265331_10236772 | 3300031250 | Bacteria | 820 |
| 515 | Ga0265316_10332946 | 3300031344 | Bacteria | 1101 |
| 516 | Ga0265316_10755228 | 3300031344 | Bacteria | 684 |
| 517 | Ga0307513_10325561 | 3300031456 | Bacteria | 1293 |
| 518 | Ga0307513_10530068 | 3300031456 | Bacteria | 892 |
| 519 | Ga0307513_10590867 | 3300031456 | Bacteria | 820 |
| 520 | Ga0307509_10165469 | 3300031507 | Bacteria | 2101 |
| 521 | Ga0307509_10449591 | 3300031507 | Bacteria | 983 |
| 522 | Ga0307408_100434618 | 3300031548 | Bacteria | 1135 |
| 523 | Ga0307408_100621191 | 3300031548 | Bacteria | 963 |
| 524 | Ga0307508_10083537 | 3300031616 | Bacteria | 2776 |
| 525 | Ga0307508_10203809 | 3300031616 | Bacteria | 1579 |
| 526 | Ga0307508_10250806 | 3300031616 | Bacteria | 1366 |
| 527 | Ga0265314_10300686 | 3300031711 | Bacteria | 900 |
| 528 | Ga0265342_10355544 | 3300031712 | Bacteria | 762 |
| 529 | Ga0307516_10025519 | 3300031730 | Bacteria | 6017 |
| 530 | Ga0307516_10025796 | 3300031730 | Bacteria | 5978 |
| 531 | Ga0307516_10034272 | 3300031730 | Bacteria | 5104 |
| 532 | Ga0307516_10116824 | 3300031730 | Bacteria | 2462 |
| 533 | Ga0307516_10119591 | 3300031730 | Bacteria | 2427 |
| 534 | Ga0307516_10238955 | 3300031730 | Bacteria | 1516 |
| 535 | Ga0307516_10416953 | 3300031730 | Bacteria | 1001 |
| 536 | Ga0307405_10323080 | 3300031731 | Bacteria | 1180 |
| 537 | Ga0307405_10434658 | 3300031731 | Bacteria | 1036 |
| 538 | Ga0307413_10034590 | 3300031824 | Bacteria | 2889 |
| 539 | Ga0307413_10115918 | 3300031824 | Bacteria | 1804 |
| 540 | Ga0307407_10258486 | 3300031903 | Bacteria | 1197 |
| 541 | Ga0307407_10471285 | 3300031903 | Bacteria | 915 |
| 542 | Ga0307407_10519864 | 3300031903 | Bacteria | 875 |
| 543 | Ga0307412_10103281 | 3300031911 | Bacteria | 2020 |
| 544 | Ga0307412_10272872 | 3300031911 | Bacteria | 1324 |
| 545 | Ga0307412_10477436 | 3300031911 | Bacteria | 1033 |
| 546 | Ga0307409_100328839 | 3300031995 | Bacteria | 1433 |
| 547 | Ga0307416_100614473 | 3300032002 | Bacteria | 1168 |
| 548 | Ga0307416_100620580 | 3300032002 | Bacteria | 1163 |
| 549 | Ga0307416_100881057 | 3300032002 | Bacteria | 994 |
| 550 | Ga0307414_10290685 | 3300032004 | Bacteria | 1378 |
| 551 | Ga0307414_10693417 | 3300032004 | Bacteria | 921 |
| 552 | Ga0307411_10002397 | 3300032005 | Bacteria | 8265 |
| 553 | Ga0307411_10020733 | 3300032005 | Bacteria | 3831 |
| 554 | Ga0307415_100524944 | 3300032126 | Bacteria | 1040 |
| 555 | Ga0307510_10009700 | 3300033180 | Bacteria | 11458 |
| 556 | Ga0307510_10019525 | 3300033180 | Bacteria | 7947 |
| 557 | Ga0307510_10038953 | 3300033180 | Bacteria | 5246 |
| 558 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 559 | Ga0373928_0011813 | 3300035084 | Bacteria | 1735 |
| 560 | Ga0373934_0049067 | 3300035086 | Bacteria | 1671 |
| 561 | Ga0373940_0029665 | 3300035088 | Bacteria | 1450 |
| 562 | Ga0373949_0067455 | 3300035090 | Bacteria | 931 |
| 563 | Ga0373932_0005334 | 3300035112 | Bacteria | 3024 |
| 564 | Ga0373936_0122716 | 3300035113 | Bacteria | 1111 |
| 565 | Ga0373941_0002945 | 3300035115 | Bacteria | 3805 |
| 566 | Ga0373953_0001358 | 3300035117 | Bacteria | 7042 |
| 567 | Ga0373954_0001778 | 3300035118 | Bacteria | 8862 |
| 568 | Ga0373956_0005729 | 3300035119 | Bacteria | 4967 |
| 569 | Ga0373957_0002644 | 3300035120 | Bacteria | 5141 |
| 570 | Ga0373955_0001783 | 3300035172 | Bacteria | 9235 |
| 571 | Ga0373942_0122249 | 3300035207 | Bacteria | 815 |
| 572 | Ga0373962_0034362 | 3300035242 | Bacteria | 1404 |
| 573 | Ga0373924_0005305 | 3300035410 | Bacteria | 4557 |
| 574 | Ga0373931_0001895 | 3300035691 | Bacteria | 9143 |
| 575 | Ga0373935_0314397 | 3300035692 | Bacteria | 1110 |
| 576 | Ga0373927_0005360 | 3300035695 | Bacteria | 8859 |
| 577 | Ga0373927_0023382 | 3300035695 | Bacteria | 4047 |
| 578 | Ga0373927_0035091 | 3300035695 | Bacteria | 3261 |
| 579 | Ga0373927_0084258 | 3300035695 | Bacteria | 2062 |
| 580 | Ga0373927_0310887 | 3300035695 | Bacteria | 1037 |
| 581 | Ga0373933_0001908 | 3300035724 | Bacteria | 12027 |
| 582 | Ga0373937_0015839 | 3300036401 | Bacteria | 6681 |
| 583 | Ga0373925_0122843 | 3300037068 | Bacteria | 2017 |
| 584 | Ga0373925_0405153 | 3300037068 | Bacteria | 1113 |
| 585 | Ga0373925_0726130 | 3300037068 | Bacteria | 819 |
| 586 | Ga0395899_0447270 | 3300037312 | Bacteria | 847 |
| 587 | Ga0395898_0289712 | 3300037466 | Bacteria | 1562 |
| 588 | Ga0395898_1067310 | 3300037466 | Bacteria | 742 |
| 589 | Ga0395905_0100628 | 3300037471 | Bacteria | 2714 |
| 590 | Ga0395905_0108120 | 3300037471 | Bacteria | 2611 |
| 591 | Ga0395905_0710893 | 3300037471 | Bacteria | 907 |
| 592 | Ga0395905_1157196 | 3300037471 | Bacteria | 677 |
| 593 | Ga0395901_1019515 | 3300038443 | Bacteria | 802 |
| 594 | Ga0395901_1139082 | 3300038443 | Bacteria | 749 |
| 595 | Ga0439466_0150484 | 3300041411 | Bacteria | 713 |
| 596 | Ga0439465_0079258 | 3300041413 | Bacteria | 1111 |
| 597 | Ga0451789_0496885 | 3300041443 | Bacteria | 1094 |
| 598 | Ga0451839_0837697 | 3300041496 | Bacteria | 1287 |
| 599 | Ga0451851_0996752 | 3300041507 | Bacteria | 1225 |
| 600 | Ga0439458_0029195 | 3300042157 | Bacteria | 1308 |
| 601 | Ga0451577_0000753 | 3300042876 | Bacteria | 49360 |
| 602 | Ga0439440_0222490 | 3300042993 | Bacteria | 567 |
| 603 | Ga0453684_0001250 | 3300044712 | Bacteria | 76863 |
| 604 | Ga0466957_0043947 | 3300044842 | Bacteria | 2707 |
| 605 | Ga0466959_0130291 | 3300045049 | Bacteria | 1783 |
| 606 | Ga0451576_1903073 | 3300045051 | Bacteria | 614 |
| 607 | Ga0495617_006940 | 3300046452 | Bacteria | 3953 |
| 608 | Ga0495617_030440 | 3300046452 | Bacteria | 1814 |
| 609 | Ga0495592_0005568 | 3300046454 | Bacteria | 9316 |
| 610 | Ga0495603_0029466 | 3300046455 | Bacteria | 3309 |
| 611 | Ga0495603_0029732 | 3300046455 | Bacteria | 3294 |
| 612 | Ga0495603_0049543 | 3300046455 | Bacteria | 2500 |
| 613 | Ga0495603_0175304 | 3300046455 | Bacteria | 1241 |
| 614 | Ga0495603_0223566 | 3300046455 | Bacteria | 1086 |
| 615 | Ga0495629_0000922 | 3300046459 | Bacteria | 23637 |
| 616 | Ga0495629_0527996 | 3300046459 | Bacteria | 794 |
| 617 | Ga0495638_0045785 | 3300046460 | Bacteria | 2751 |
| 618 | Ga0495638_0132101 | 3300046460 | Bacteria | 1465 |
| 619 | Ga0495638_0428159 | 3300046460 | Bacteria | 680 |
| 620 | Ga0495641_0201750 | 3300046461 | Bacteria | 891 |
| 621 | Ga0495651_0019485 | 3300046462 | Bacteria | 5259 |
| 622 | Ga0495651_0079787 | 3300046462 | Bacteria | 2473 |
| 623 | Ga0495653_0004517 | 3300046463 | Bacteria | 11238 |
| 624 | Ga0495650_0161393 | 3300046471 | Bacteria | 799 |
| 625 | Ga0495580_0280085 | 3300046472 | Bacteria | 1138 |
| 626 | Ga0495582_0072963 | 3300046473 | Bacteria | 1900 |
| 627 | Ga0495605_0090050 | 3300046474 | Bacteria | 1423 |
| 628 | Ga0495605_0149964 | 3300046474 | Bacteria | 1041 |
| 629 | Ga0495639_0070181 | 3300046475 | Bacteria | 1617 |
| 630 | Ga0495662_0198613 | 3300046476 | Bacteria | 989 |
| 631 | Ga0495662_0265068 | 3300046476 | Bacteria | 846 |
| 632 | Ga0495664_0250928 | 3300046477 | Bacteria | 1070 |
| 633 | Ga0495584_0062955 | 3300046491 | Bacteria | 1864 |
| 634 | Ga0495584_0204234 | 3300046491 | Bacteria | 1004 |
| 635 | Ga0495584_0224730 | 3300046491 | Bacteria | 954 |
| 636 | Ga0495585_0029264 | 3300046492 | Bacteria | 3136 |
| 637 | Ga0495585_0162415 | 3300046492 | Bacteria | 1158 |
| 638 | Ga0495594_0030720 | 3300046499 | Bacteria | 2909 |
| 639 | Ga0495594_0053484 | 3300046499 | Bacteria | 2224 |
| 640 | Ga0495607_0366589 | 3300046501 | Bacteria | 662 |
| 641 | Ga0495607_0442827 | 3300046501 | Bacteria | 584 |
| 642 | Ga0495583_0054834 | 3300046506 | Bacteria | 1803 |
| 643 | Ga0495606_0000976 | 3300046507 | Bacteria | 41812 |
| 644 | Ga0495606_0079533 | 3300046507 | Bacteria | 2041 |
| 645 | Ga0495608_0035885 | 3300046511 | Bacteria | 3340 |
| 646 | Ga0495610_0043698 | 3300046512 | Bacteria | 2230 |
| 647 | Ga0495610_0198225 | 3300046512 | Bacteria | 824 |
| 648 | Ga0495616_0125950 | 3300046513 | Bacteria | 1178 |
| 649 | Ga0495616_0226512 | 3300046513 | Bacteria | 812 |
| 650 | Ga0495620_0053999 | 3300046515 | Bacteria | 1699 |
| 651 | Ga0495620_0065030 | 3300046515 | Bacteria | 1506 |
| 652 | Ga0495620_0111811 | 3300046515 | Bacteria | 1082 |
| 653 | Ga0495628_0030476 | 3300046516 | Bacteria | 4367 |
| 654 | Ga0495631_0015766 | 3300046518 | Bacteria | 3614 |
| 655 | Ga0495631_0107154 | 3300046518 | Bacteria | 1201 |
| 656 | Ga0495631_0140815 | 3300046518 | Bacteria | 1036 |
| 657 | Ga0495631_0155457 | 3300046518 | Bacteria | 981 |
| 658 | Ga0495631_0257257 | 3300046518 | Bacteria | 744 |
| 659 | Ga0495632_0090578 | 3300046519 | Bacteria | 1450 |
| 660 | Ga0495632_0097751 | 3300046519 | Bacteria | 1385 |
| 661 | Ga0495632_0196899 | 3300046519 | Bacteria | 919 |
| 662 | Ga0495632_0303098 | 3300046519 | Bacteria | 708 |
| 663 | Ga0495637_0089553 | 3300046520 | Bacteria | 1216 |
| 664 | Ga0495637_0137071 | 3300046520 | Bacteria | 931 |
| 665 | Ga0495644_0065872 | 3300046523 | Bacteria | 1361 |
| 666 | Ga0495644_0076258 | 3300046523 | Bacteria | 1263 |
| 667 | Ga0495644_0106370 | 3300046523 | Bacteria | 1063 |
| 668 | Ga0495644_0108378 | 3300046523 | Bacteria | 1053 |
| 669 | Ga0495663_0214113 | 3300046525 | Bacteria | 676 |
| 670 | Ga0495663_0262920 | 3300046525 | Bacteria | 615 |
| 671 | Ga0495652_0025506 | 3300046529 | Bacteria | 5228 |
| 672 | Ga0495652_0205375 | 3300046529 | Bacteria | 1492 |
| 673 | Ga0495652_0247135 | 3300046529 | Bacteria | 1324 |
| 674 | Ga0495640_0035468 | 3300046533 | Bacteria | 3530 |
| 675 | Ga0495587_0013911 | 3300046536 | Bacteria | 5052 |
| 676 | Ga0495598_0009888 | 3300046537 | Bacteria | 2268 |
| 677 | Ga0495598_0027478 | 3300046537 | Bacteria | 1570 |
| 678 | Ga0495609_0022606 | 3300046538 | Bacteria | 2896 |
| 679 | Ga0495609_0170564 | 3300046538 | Bacteria | 919 |
| 680 | Ga0495609_0198945 | 3300046538 | Bacteria | 838 |
| 681 | Ga0495621_0213857 | 3300046539 | Bacteria | 778 |
| 682 | Ga0495597_0198730 | 3300046542 | Bacteria | 804 |
| 683 | Ga0495645_0029715 | 3300046543 | Bacteria | 3976 |
| 684 | Ga0495622_0078533 | 3300046557 | Bacteria | 1520 |
| 685 | Ga0495633_0038360 | 3300046558 | Bacteria | 2288 |
| 686 | Ga0495667_0007856 | 3300046559 | Bacteria | 7228 |
| 687 | Ga0495667_0438941 | 3300046559 | Bacteria | 821 |
| 688 | Ga0495656_0005268 | 3300046615 | Bacteria | 4455 |
| 689 | Ga0495656_0056879 | 3300046615 | Bacteria | 1691 |
| 690 | Ga0495656_0089573 | 3300046615 | Bacteria | 1404 |
| 691 | Ga0495656_0110573 | 3300046615 | Bacteria | 1284 |
| 692 | Ga0495668_0044002 | 3300046616 | Bacteria | 2481 |
| 693 | Ga0495668_0070051 | 3300046616 | Bacteria | 1928 |
| 694 | Ga0495668_0223332 | 3300046616 | Bacteria | 1031 |
| 695 | Ga0495668_0240425 | 3300046616 | Bacteria | 991 |
| 696 | Ga0495668_0270841 | 3300046616 | Bacteria | 930 |
| 697 | Ga0495668_0352017 | 3300046616 | Bacteria | 808 |
| 698 | Ga0495634_0010895 | 3300046642 | Bacteria | 6638 |
| 699 | Ga0495611_0087431 | 3300046648 | Bacteria | 1438 |
| 700 | Ga0495611_0159732 | 3300046648 | Bacteria | 1053 |
| 701 | Ga0495625_0148756 | 3300046660 | Bacteria | 1575 |
| 702 | Ga0495625_0206903 | 3300046660 | Bacteria | 1292 |
| 703 | Ga0495625_0264340 | 3300046660 | Bacteria | 1112 |
| 704 | Ga0495625_0348077 | 3300046660 | Bacteria | 937 |
| 705 | Ga0495625_0390423 | 3300046660 | Bacteria | 871 |
| 706 | Ga0495625_0528591 | 3300046660 | Bacteria | 717 |
| 707 | Ga0495635_0002149 | 3300046663 | Bacteria | 13377 |
| 708 | Ga0495635_0126515 | 3300046663 | Bacteria | 1743 |
| 709 | Ga0495659_0006815 | 3300046664 | Bacteria | 3610 |
| 710 | Ga0495661_0103488 | 3300046665 | Bacteria | 1598 |
| 711 | Ga0495661_0155973 | 3300046665 | Bacteria | 1229 |
| 712 | Ga0495661_0285868 | 3300046665 | Bacteria | 830 |
| 713 | Ga0495588_0243798 | 3300046674 | Bacteria | 948 |
| 714 | Ga0495588_0256813 | 3300046674 | Bacteria | 921 |
| 715 | Ga0495588_0306992 | 3300046674 | Bacteria | 835 |
| 716 | Ga0495657_0026686 | 3300046675 | Bacteria | 4087 |
| 717 | Ga0495657_0539973 | 3300046675 | Bacteria | 678 |
| 718 | Ga0495599_0001827 | 3300046678 | Bacteria | 12344 |
| 719 | Ga0495623_0170793 | 3300046679 | Bacteria | 1270 |
| 720 | Ga0495647_0014634 | 3300046681 | Bacteria | 2737 |
| 721 | Ga0495647_0302618 | 3300046681 | Bacteria | 721 |
| 722 | Ga0495669_0000675 | 3300046684 | Bacteria | 14839 |
| 723 | Ga0495669_0104914 | 3300046684 | Bacteria | 1315 |
| 724 | Ga0495669_0134897 | 3300046684 | Bacteria | 1163 |
| 725 | Ga0495669_0254771 | 3300046684 | Bacteria | 843 |
| 726 | Ga0495669_0476162 | 3300046684 | Bacteria | 607 |
| 727 | Ga0495613_0092686 | 3300046689 | Bacteria | 2187 |
| 728 | Ga0495613_0254730 | 3300046689 | Bacteria | 1224 |
| 729 | Ga0495670_0012092 | 3300046691 | Bacteria | 4246 |
| 730 | Ga0495670_0163891 | 3300046691 | Bacteria | 1169 |
| 731 | Ga0495671_0230596 | 3300046692 | Bacteria | 895 |
| 732 | Ga0495589_0087665 | 3300046794 | Bacteria | 1511 |
| 733 | Ga0495600_0006396 | 3300046809 | Bacteria | 7170 |
| 734 | Ga0495600_0159162 | 3300046809 | Bacteria | 1460 |
| 735 | Ga0495600_0435927 | 3300046809 | Bacteria | 812 |
| 736 | Ga0495581_0138320 | 3300047315 | Bacteria | 1420 |
| 737 | Ga0495604_0005881 | 3300047317 | Bacteria | 9725 |
| 738 | Ga0495636_0040926 | 3300047318 | Bacteria | 1922 |
| 739 | Ga0495636_0139869 | 3300047318 | Bacteria | 1081 |
| 740 | Ga0495636_0378807 | 3300047318 | Bacteria | 671 |
| 741 | Ga0495674_0060932 | 3300047319 | Bacteria | 3290 |
| 742 | Ga0495672_0029388 | 3300047320 | Bacteria | 3461 |
| 743 | Ga0495672_0030049 | 3300047320 | Bacteria | 3414 |
| 744 | Ga0495680_0009327 | 3300047322 | Bacteria | 8839 |
| 745 | Ga0495683_0037356 | 3300047323 | Bacteria | 2462 |
| 746 | Ga0495675_0008213 | 3300047444 | Bacteria | 6458 |
| 747 | Ga0495677_0084468 | 3300047445 | Bacteria | 1192 |
| 748 | Ga0495685_099265 | 3300047447 | Bacteria | 962 |
| 749 | Ga0495673_0034976 | 3300047469 | Bacteria | 2319 |
| 750 | Ga0495673_0102385 | 3300047469 | Bacteria | 1156 |
| 751 | Ga0495673_0109406 | 3300047469 | Bacteria | 1107 |
| 752 | Ga0495684_0026359 | 3300047471 | Bacteria | 4466 |
| 753 | Ga0495686_0118536 | 3300047472 | Bacteria | 1580 |
| 754 | Ga0495686_0180571 | 3300047472 | Bacteria | 1223 |
| 755 | Ga0495686_0196855 | 3300047472 | Bacteria | 1158 |
| 756 | Ga0495593_0008299 | 3300047673 | Bacteria | 6044 |
| 757 | Ga0495593_0182007 | 3300047673 | Bacteria | 1058 |
| 758 | Ga0495593_0207551 | 3300047673 | Bacteria | 984 |
| 759 | Ga0495602_0011154 | 3300048088 | Bacteria | 9300 |
| 760 | Ga0496100_0001613 | 3300048903 | Bacteria | 11146 |
| 761 | Ga0496100_0394378 | 3300048903 | Bacteria | 1053 |
| 762 | Ga0496100_0652085 | 3300048903 | Bacteria | 820 |
| 763 | Ga0496100_1298602 | 3300048903 | Bacteria | 574 |
| 764 | Ga0496100_1319465 | 3300048903 | Bacteria | 569 |
| 765 | Ga0496101_0004421 | 3300048904 | Bacteria | 8844 |
| 766 | Ga0496101_0092016 | 3300048904 | Bacteria | 2257 |
| 767 | Ga0496101_0254104 | 3300048904 | Bacteria | 1370 |
| 768 | Ga0496101_0366155 | 3300048904 | Bacteria | 1133 |
| 769 | Ga0496101_1046176 | 3300048904 | Bacteria | 642 |
| 770 | Ga0496102_0010509 | 3300048905 | Bacteria | 7970 |
| 771 | Ga0496102_0012054 | 3300048905 | Bacteria | 7470 |
| 772 | Ga0496102_0142359 | 3300048905 | Bacteria | 2249 |
| 773 | Ga0496102_0195854 | 3300048905 | Bacteria | 1904 |
| 774 | Ga0496102_0581821 | 3300048905 | Bacteria | 1042 |
| 775 | Ga0496102_0848660 | 3300048905 | Bacteria | 835 |
| 776 | Ga0496102_0876304 | 3300048905 | Bacteria | 820 |
| 777 | Ga0496103_0028159 | 3300048906 | Bacteria | 3408 |
| 778 | Ga0496103_0333963 | 3300048906 | Bacteria | 975 |
| 779 | Ga0496104_0000264 | 3300048907 | Bacteria | 46250 |
| 780 | Ga0496104_0081042 | 3300048907 | Bacteria | 3094 |
| 781 | Ga0496104_0303660 | 3300048907 | Bacteria | 1508 |
| 782 | Ga0496104_0430551 | 3300048907 | Bacteria | 1231 |
| 783 | Ga0496104_0805641 | 3300048907 | Bacteria | 845 |
| 784 | Ga0496105_0004722 | 3300048908 | Bacteria | 10282 |
| 785 | Ga0496105_0024811 | 3300048908 | Bacteria | 4873 |
| 786 | Ga0496105_0067512 | 3300048908 | Bacteria | 2953 |
| 787 | Ga0496105_0258114 | 3300048908 | Bacteria | 1410 |
| 788 | Ga0496106_0040286 | 3300048909 | Bacteria | 3498 |
| 789 | Ga0496106_0128796 | 3300048909 | Bacteria | 1983 |
| 790 | Ga0496106_0463958 | 3300048909 | Bacteria | 1017 |
| 791 | Ga0496106_0500068 | 3300048909 | Bacteria | 976 |
| 792 | Ga0496107_0004750 | 3300048910 | Bacteria | 9230 |
| 793 | Ga0496107_0010483 | 3300048910 | Bacteria | 6442 |
| 794 | Ga0496107_0106435 | 3300048910 | Bacteria | 2060 |
| 795 | Ga0496107_0605431 | 3300048910 | Bacteria | 810 |
| 796 | Ga0496108_0067242 | 3300048911 | Bacteria | 3022 |
| 797 | Ga0496108_0081956 | 3300048911 | Bacteria | 2735 |
| 798 | Ga0496109_0007688 | 3300048912 | Bacteria | 9135 |
| 799 | Ga0496109_0010512 | 3300048912 | Bacteria | 7909 |
| 800 | Ga0496109_0063721 | 3300048912 | Bacteria | 3372 |
| 801 | Ga0496109_0181768 | 3300048912 | Bacteria | 1975 |
| 802 | Ga0496109_0700640 | 3300048912 | Bacteria | 950 |
| 803 | Ga0496110_0007695 | 3300048913 | Bacteria | 8620 |
| 804 | Ga0496110_0009156 | 3300048913 | Bacteria | 7996 |
| 805 | Ga0496110_0018621 | 3300048913 | Bacteria | 5824 |
| 806 | Ga0496110_0300721 | 3300048913 | Bacteria | 1461 |
| 807 | Ga0496110_0578618 | 3300048913 | Bacteria | 1020 |
| 808 | Ga0496111_0003597 | 3300048914 | Bacteria | 9607 |
| 809 | Ga0496111_0037700 | 3300048914 | Bacteria | 3460 |
| 810 | Ga0496111_0127639 | 3300048914 | Bacteria | 1881 |
| 811 | Ga0496111_0614863 | 3300048914 | Bacteria | 795 |
| 812 | Ga0496112_0025430 | 3300048915 | Bacteria | 5685 |
| 813 | Ga0496112_0070372 | 3300048915 | Bacteria | 3457 |
| 814 | Ga0496112_0271642 | 3300048915 | Bacteria | 1643 |
| 815 | Ga0496112_0542299 | 3300048915 | Bacteria | 1097 |
| 816 | Ga0496112_0812483 | 3300048915 | Bacteria | 859 |
| 817 | Ga0496113_0005354 | 3300048916 | Bacteria | 7996 |
| 818 | Ga0496113_0006480 | 3300048916 | Bacteria | 7425 |
| 819 | Ga0496113_0053298 | 3300048916 | Bacteria | 3024 |
| 820 | Ga0496113_0384699 | 3300048916 | Bacteria | 1126 |
| 821 | Ga0496113_0395933 | 3300048916 | Bacteria | 1109 |
| 822 | Ga0496114_0004664 | 3300048917 | Bacteria | 10654 |
| 823 | Ga0496114_0008103 | 3300048917 | Bacteria | 8322 |
| 824 | Ga0496114_0110348 | 3300048917 | Bacteria | 2356 |
| 825 | Ga0496114_0545311 | 3300048917 | Bacteria | 1025 |
| 826 | Ga0496114_0558059 | 3300048917 | Bacteria | 1011 |
| 827 | Ga0496114_0924234 | 3300048917 | Bacteria | 754 |
| 828 | Ga0496115_0005898 | 3300048918 | Bacteria | 8932 |
| 829 | Ga0496115_0274401 | 3300048918 | Bacteria | 1385 |
| 830 | Ga0496115_0280060 | 3300048918 | Bacteria | 1369 |
| 831 | Ga0496117_0163140 | 3300048920 | Bacteria | 1303 |
| 832 | Ga0496118_0307866 | 3300048921 | Bacteria | 866 |
| 833 | Ga0496119_0033029 | 3300048922 | Bacteria | 3440 |
| 834 | Ga0496119_0168520 | 3300048922 | Bacteria | 1159 |
| 835 | Ga0496120_0140607 | 3300048923 | Bacteria | 1226 |
| 836 | Ga0496121_0000178 | 3300048924 | Bacteria | 141429 |
| 837 | Ga0496121_0047711 | 3300048924 | Bacteria | 3651 |
| 838 | Ga0496121_0115654 | 3300048924 | Bacteria | 2036 |
| 839 | Ga0496121_0117262 | 3300048924 | Bacteria | 2017 |
| 840 | Ga0496121_0144691 | 3300048924 | Bacteria | 1758 |
| 841 | Ga0496121_0162927 | 3300048924 | Bacteria | 1628 |
| 842 | Ga0496121_0231223 | 3300048924 | Bacteria | 1295 |
| 843 | Ga0496121_0316954 | 3300048924 | Bacteria | 1051 |
| 844 | Ga0496121_0685010 | 3300048924 | Bacteria | 619 |
| 845 | Ga0496124_0160570 | 3300048927 | Bacteria | 1752 |
| 846 | Ga0496124_0588364 | 3300048927 | Bacteria | 726 |
| 847 | Ga0496125_0009067 | 3300048928 | Bacteria | 10297 |
| 848 | Ga0496125_0076632 | 3300048928 | Bacteria | 2581 |
| 849 | Ga0496125_0145306 | 3300048928 | Bacteria | 1640 |
| 850 | Ga0496126_0007639 | 3300048929 | Bacteria | 11802 |
| 851 | Ga0496126_0034270 | 3300048929 | Bacteria | 4769 |
| 852 | Ga0496126_0051129 | 3300048929 | Bacteria | 3763 |
| 853 | Ga0496126_0095324 | 3300048929 | Bacteria | 2610 |
| 854 | Ga0496126_0143672 | 3300048929 | Bacteria | 2051 |
| 855 | Ga0496126_0153196 | 3300048929 | Bacteria | 1974 |
| 856 | Ga0496126_0195935 | 3300048929 | Bacteria | 1708 |
| 857 | Ga0496126_0302736 | 3300048929 | Bacteria | 1318 |
| 858 | Ga0496126_0341302 | 3300048929 | Bacteria | 1227 |
| 859 | Ga0496126_0346739 | 3300048929 | Bacteria | 1215 |
| 860 | Ga0496126_0457340 | 3300048929 | Bacteria | 1026 |
| 861 | Ga0496126_0495118 | 3300048929 | Bacteria | 977 |
| 862 | Ga0496126_0513915 | 3300048929 | Bacteria | 955 |
| 863 | Ga0495678_035270 | 3300049459 | Bacteria | 2052 |
| 864 | Ga0495682_0076929 | 3300049460 | Bacteria | 1200 |
| 865 | Ga0501031_0661590 | 3300049568 | Bacteria | 671 |
| 866 | Ga0501034_0213375 | 3300049571 | Bacteria | 1885 |
| 867 | Ga0501039_1139986 | 3300049575 | Bacteria | 604 |
| 868 | Ga0501047_0116166 | 3300049581 | Bacteria | 2558 |
| 869 | Ga0501047_0137786 | 3300049581 | Bacteria | 2320 |
| 870 | Ga0501067_0068698 | 3300049583 | Bacteria | 1962 |
| 871 | Ga0501067_0073388 | 3300049583 | Bacteria | 1896 |
| 872 | Ga0501076_1160462 | 3300049592 | Bacteria | 636 |
| 873 | nmdc:mga03n38_140855_c1 | 3300050490 | Bacteria | 1204 |
| 874 | nmdc:mga03n38_141278_c1 | 3300050490 | Bacteria | 1203 |
| 875 | nmdc:mga03n38_257587_c1 | 3300050490 | Bacteria | 924 |
| 876 | nmdc:mga03n38_40050_c1 | 3300050490 | Bacteria | 2035 |
| 877 | nmdc:mga00v17_162573_c1 | 3300050491 | Bacteria | 1438 |
| 878 | nmdc:mga00v17_20052_c1 | 3300050491 | Bacteria | 3826 |
| 879 | nmdc:mga00v17_277365_c1 | 3300050491 | Bacteria | 1088 |
| 880 | nmdc:mga00v17_39463_c1 | 3300050491 | Bacteria | 2828 |
| 881 | nmdc:mga0yw44_166004_c1 | 3300050492 | Bacteria | 1447 |
| 882 | nmdc:mga0yw44_17750_c1 | 3300050492 | Bacteria | 3881 |
| 883 | nmdc:mga0yw44_41431_c1 | 3300050492 | Unclassified | 2741 |
| 884 | nmdc:mga0yw44_780845_c1 | 3300050492 | Bacteria | 649 |
| 885 | nmdc:mga0k408_247025_c1 | 3300050493 | Bacteria | 1066 |
| 886 | nmdc:mga0k408_477258_c1 | 3300050493 | Bacteria | 740 |
| 887 | nmdc:mga06z11_12508_c1 | 3300050494 | Bacteria | 3694 |
| 888 | nmdc:mga06z11_226138_c1 | 3300050494 | Bacteria | 1095 |
| 889 | nmdc:mga06z11_276415_c1 | 3300050494 | Bacteria | 994 |
| 890 | nmdc:mga06z11_32790_c1 | 3300050494 | Bacteria | 2536 |
| 891 | nmdc:mga06z11_448217_c1 | 3300050494 | Bacteria | 780 |
| 892 | nmdc:mga06z11_84892_c1 | 3300050494 | Bacteria | 1707 |
| 893 | nmdc:mga04h51_146802_c1 | 3300050495 | Bacteria | 899 |
| 894 | nmdc:mga04h51_66211_c1 | 3300050495 | Bacteria | 1251 |
| 895 | nmdc:mga07m45_198930_c1 | 3300050496 | Bacteria | 1165 |
| 896 | nmdc:mga07m45_41448_c1 | 3300050496 | Bacteria | 2578 |
| 897 | nmdc:mga07m45_420172_c1 | 3300050496 | Bacteria | 776 |
| 898 | nmdc:mga07m45_47017_c1 | 3300050496 | Bacteria | 2425 |
| 899 | nmdc:mga05p37_1432600_c1 | 3300050507 | Bacteria | 693 |
| 900 | nmdc:mga05p37_280399_c1 | 3300050507 | Bacteria | 1988 |
| 901 | nmdc:mga05p37_29696_c2 | 3300050507 | Bacteria | 5761 |
| 902 | nmdc:mga09592_373507_c1 | 3300050508 | Bacteria | 1233 |
| 903 | nmdc:mga06r32_12202_c1 | 3300050510 | Bacteria | 7749 |
| 904 | nmdc:mga08y16_252069_c1 | 3300050511 | Bacteria | 1824 |
| 905 | nmdc:mga08y16_52748_c1 | 3300050511 | Bacteria | 4254 |
| 906 | nmdc:mga08y16_678874_c1 | 3300050511 | Bacteria | 1032 |
| 907 | nmdc:mga0n895_231793_c1 | 3300050512 | Bacteria | 1874 |
| 908 | nmdc:mga0n895_96815_c1 | 3300050512 | Bacteria | 2956 |
| 909 | nmdc:mga0rr50_418514_c1 | 3300050513 | Bacteria | 1133 |
| 910 | nmdc:mga08x19_688452_c1 | 3300050514 | Bacteria | 725 |
| 911 | nmdc:mga0a205_205529_c1 | 3300050515 | Bacteria | 1858 |
| 912 | nmdc:mga0sz30_108053_c1 | 3300050516 | Bacteria | 1218 |
| 913 | nmdc:mga0sz30_192682_c1 | 3300050516 | Bacteria | 905 |
| 914 | nmdc:mga0sz30_215855_c1 | 3300050516 | Bacteria | 853 |
| 915 | nmdc:mga0sz30_2375_c1 | 3300050516 | Bacteria | 6399 |
| 916 | Ga0495601_0099317 | 3300053077 | Bacteria | 1879 |
| 917 | Ga0495612_0074765 | 3300053078 | Bacteria | 1417 |
| 918 | Ga0500635_0002566 | 3300053080 | Bacteria | 4515 |
| 919 | Ga0495655_0028464 | 3300053083 | Bacteria | 1335 |
| 920 | Ga0495655_0227871 | 3300053083 | Bacteria | 619 |
| 921 | Ga0495595_0003401 | 3300053084 | Bacteria | 6323 |
| 922 | Ga0495595_0022694 | 3300053084 | Bacteria | 2757 |
| 923 | Ga0495619_0011847 | 3300053085 | Bacteria | 5492 |
| 924 | Ga0495619_0037524 | 3300053085 | Bacteria | 3158 |
| 925 | Ga0495619_0344012 | 3300053085 | Bacteria | 1032 |
| 926 | Ga0500578_0094848 | 3300053086 | Bacteria | 1893 |
| 927 | Ga0500643_034871 | 3300053087 | Bacteria | 1513 |
| 928 | Ga0500646_0025692 | 3300053090 | Bacteria | 1592 |
| 929 | Ga0500583_0146990 | 3300053092 | Bacteria | 1172 |
| 930 | Ga0500566_0024402 | 3300053094 | Bacteria | 3550 |
| 931 | Ga0500641_0003076 | 3300053096 | Bacteria | 5913 |
| 932 | Ga0500641_0034871 | 3300053096 | Bacteria | 2005 |
| 933 | Ga0500641_0078769 | 3300053096 | Bacteria | 1396 |
| 934 | Ga0500650_0133385 | 3300053098 | Bacteria | 1154 |
| 935 | Ga0500654_097892 | 3300053099 | Bacteria | 1268 |
| 936 | Ga0500554_002814 | 3300053102 | Bacteria | 3475 |
| 937 | Ga0500562_057460 | 3300053108 | Bacteria | 1044 |
| 938 | Ga0500569_000323 | 3300053109 | Bacteria | 7662 |
| 939 | Ga0500595_002264 | 3300053119 | Bacteria | 9721 |
| 940 | Ga0500595_002758 | 3300053119 | Bacteria | 8465 |
| 941 | Ga0500595_003563 | 3300053119 | Bacteria | 7231 |
| 942 | Ga0500595_134736 | 3300053119 | Bacteria | 694 |
| 943 | Ga0500655_067473 | 3300053133 | Bacteria | 726 |
| 944 | Ga0500561_0053717 | 3300053137 | Bacteria | 1108 |
| 945 | Ga0500568_0132400 | 3300053139 | Bacteria | 926 |
| 946 | Ga0500577_0021539 | 3300053142 | Bacteria | 2125 |
| 947 | Ga0500577_0078843 | 3300053142 | Bacteria | 1309 |
| 948 | Ga0500588_0055913 | 3300053146 | Bacteria | 1247 |
| 949 | Ga0500588_0246146 | 3300053146 | Bacteria | 670 |
| 950 | Ga0500589_013888 | 3300053147 | Bacteria | 3559 |
| 951 | Ga0500589_149998 | 3300053147 | Bacteria | 950 |
| 952 | Ga0500603_002517 | 3300053150 | Bacteria | 4001 |
| 953 | Ga0500616_0074173 | 3300053153 | Bacteria | 1725 |
| 954 | Ga0500616_0084438 | 3300053153 | Bacteria | 1588 |
| 955 | Ga0500616_0178677 | 3300053153 | Bacteria | 957 |
| 956 | Ga0500622_0055243 | 3300053156 | Bacteria | 2035 |
| 957 | Ga0500633_0039755 | 3300053160 | Bacteria | 1574 |
| 958 | Ga0500634_0042288 | 3300053161 | Bacteria | 2472 |
| 959 | Ga0500638_089332 | 3300053162 | Bacteria | 1453 |
| 960 | Ga0500636_0026335 | 3300053177 | Bacteria | 3437 |
| 961 | Ga0500636_0219900 | 3300053177 | Bacteria | 990 |
| 962 | Ga0500636_0446545 | 3300053177 | Bacteria | 586 |
| 963 | Ga0500637_0000600 | 3300053178 | Bacteria | 14194 |
| 964 | Ga0500637_0020687 | 3300053178 | Bacteria | 3567 |
| 965 | Ga0500645_020268 | 3300053730 | Bacteria | 2062 |
| 966 | Ga0500645_020334 | 3300053730 | Bacteria | 2058 |
| 967 | Ga0500645_084809 | 3300053730 | Bacteria | 902 |
| 968 | Ga0500609_000821 | 3300053731 | Bacteria | 4665 |
| 969 | Ga0500661_004937 | 3300055283 | Bacteria | 2498 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_11562928 | Ga0105245_115629282 | 138 |
| 2 | 3300025315 | Ga0207697_10216455 | Ga0207697_102164552 | 148 |
| 3 | iso_pu_bacteria | 2908739725 | 2908744989 | 150 |
| 4 | 3300046512 | Ga0495610_0043698 | Ga0495610_0043698_1621_2130 | 151 |
| 5 | 3300005334 | Ga0068869_101162221 | Ga0068869_1011622211 | 153 |
| 6 | 3300042876 | Ga0451577_0000753 | Ga0451577_0000753_37499_37996 | 154 |
| 7 | 3300044712 | Ga0453684_0001250 | Ga0453684_0001250_32283_32780 | 154 |
| 8 | 3300005344 | Ga0070661_100000014 | Ga0070661_10000001448 | 157 |
| 9 | 3300005618 | Ga0068864_101370879 | Ga0068864_1013708792 | 157 |
| 10 | 3300025920 | Ga0207649_10000203 | Ga0207649_1000020323 | 157 |
| 11 | 3300031730 | Ga0307516_10034272 | Ga0307516_100342724 | 158 |
| 12 | 3300005336 | Ga0070680_100000088 | Ga0070680_10000008854 | 159 |
| 13 | 3300005458 | Ga0070681_10370790 | Ga0070681_103707901 | 159 |
| 14 | 3300005530 | Ga0070679_100000003 | Ga0070679_100000003221 | 159 |
| 15 | 3300005548 | Ga0070665_100104062 | Ga0070665_1001040622 | 159 |
| 16 | 3300009551 | Ga0105238_10158752 | Ga0105238_101587522 | 159 |
| 17 | 3300009553 | Ga0105249_10432775 | Ga0105249_104327753 | 159 |
| 18 | 3300013100 | Ga0157373_10490549 | Ga0157373_104905491 | 159 |
| 19 | 3300013104 | Ga0157370_10104481 | Ga0157370_101044813 | 159 |
| 20 | 3300025912 | Ga0207707_10303361 | Ga0207707_103033612 | 159 |
| 21 | 3300025917 | Ga0207660_10000231 | Ga0207660_1000023121 | 159 |
| 22 | 3300025921 | Ga0207652_10000004 | Ga0207652_10000004222 | 159 |
| 23 | 3300025961 | Ga0207712_10350499 | Ga0207712_103504992 | 159 |
| 24 | 3300038443 | Ga0395901_1139082 | Ga0395901_1139082_18_497 | 159 |
| 25 | 3300031247 | Ga0265340_10014505 | Ga0265340_100145054 | 161 |
| 26 | 3300006038 | Ga0075365_10071612 | Ga0075365_100716123 | 162 |
| 27 | 3300006353 | Ga0075370_10364212 | Ga0075370_103642122 | 162 |
| 28 | 3300050492 | nmdc:mga0yw44_41431_c1 | nmdc:mga0yw44_41431_c1_1637_2149 | 162 |
| 29 | iso_pu_bacteria | 2513237096 | 2513654957 | 163 |
| 30 | iso_pu_bacteria | 2513237137 | 2513861247 | 163 |
| 31 | iso_pu_bacteria | 2513237145 | 2513916020 | 163 |
| 32 | iso_pu_bacteria | 2517572143 | 2517894676 | 163 |
| 33 | iso_pu_bacteria | 2524023228 | 2524534416 | 163 |
| 34 | iso_pu_bacteria | 2667528175 | 2671119098 | 163 |
| 35 | iso_pu_bacteria | 2728368998 | 2728747665 | 163 |
| 36 | iso_pu_bacteria | 2885374607 | 2885382406 | 163 |
| 37 | iso_pu_bacteria | 2903748898 | 2903757864 | 163 |
| 38 | iso_pu_bacteria | 2904699407 | 2904705710 | 163 |
| 39 | iso_pu_bacteria | 2906610324 | 2906611403 | 163 |
| 40 | iso_pu_bacteria | 2906635258 | 2906641559 | 163 |
| 41 | iso_pu_bacteria | 2906660503 | 2906661263 | 163 |
| 42 | iso_pu_bacteria | 2922361189 | 2922366932 | 163 |
| 43 | iso_pu_bacteria | 2922425934 | 2922427964 | 163 |
| 44 | iso_pu_bacteria | 2935630451 | 2935632117 | 163 |
| 45 | iso_pu_bacteria | 2941507105 | 2941508065 | 163 |
| 46 | iso_pu_bacteria | 2941515067 | 2941515430 | 163 |
| 47 | iso_pu_bacteria | 2941523033 | 2941523995 | 163 |
| 48 | iso_pu_bacteria | 3005474847 | 3005477672 | 163 |
| 49 | iso_pu_bacteria | 8006933436 | 8006933546 | 163 |
| 50 | iso_pu_bacteria | 8006973647 | 8006983219 | 163 |
| 51 | iso_pu_bacteria | 8019555841 | 8019559471 | 163 |
| 52 | iso_pu_bacteria | 8019565922 | 8019569574 | 163 |
| 53 | 3300048908 | Ga0496105_0024811 | Ga0496105_0024811_11_511 | 164 |
| 54 | 3300048928 | Ga0496125_0009067 | Ga0496125_0009067_5445_5993 | 164 |
| 55 | 3300048929 | Ga0496126_0495118 | Ga0496126_0495118_151_699 | 164 |
| 56 | iso_pu_bacteria | 2513237101 | 2513697361 | 164 |
| 57 | iso_pu_bacteria | 2721755755 | 2723843143 | 164 |
| 58 | iso_pu_bacteria | 2876808645 | 2876815420 | 164 |
| 59 | iso_pu_bacteria | 2879110137 | 2879117970 | 164 |
| 60 | iso_pu_bacteria | 2889033259 | 2889033556 | 164 |
| 61 | iso_pu_bacteria | 2922386360 | 2922390291 | 164 |
| 62 | iso_pu_bacteria | 8006964411 | 8006971340 | 164 |
| 63 | iso_pu_bacteria | 8006984368 | 8006989292 | 164 |
| 64 | iso_pu_bacteria | 8006994254 | 8006997768 | 164 |
| 65 | iso_pu_bacteria | 8056673599 | 8056674807 | 164 |
| 66 | iso_pu_bacteria | 2791355199 | 2793079454 | 165 |
| 67 | 3300003659 | JGI25404J52841_10019463 | JGI25404J52841_100194632 | 166 |
| 68 | 3300005455 | Ga0070663_100629013 | Ga0070663_1006290132 | 166 |
| 69 | 3300005937 | Ga0081455_10017249 | Ga0081455_100172493 | 166 |
| 70 | 3300005937 | Ga0081455_10262950 | Ga0081455_102629501 | 166 |
| 71 | 3300005983 | Ga0081540_1152867 | Ga0081540_11528672 | 166 |
| 72 | 3300049581 | Ga0501047_0116166 | Ga0501047_0116166_1945_2460 | 166 |
| 73 | 3300005327 | Ga0070658_10090223 | Ga0070658_100902232 | 167 |
| 74 | 3300005328 | Ga0070676_10211892 | Ga0070676_102118921 | 167 |
| 75 | 3300005330 | Ga0070690_100855336 | Ga0070690_1008553361 | 167 |
| 76 | 3300005334 | Ga0068869_100111564 | Ga0068869_1001115642 | 167 |
| 77 | 3300005334 | Ga0068869_100133194 | Ga0068869_1001331941 | 167 |
| 78 | 3300005338 | Ga0068868_100330768 | Ga0068868_1003307682 | 167 |
| 79 | 3300005339 | Ga0070660_100095121 | Ga0070660_1000951212 | 167 |
| 80 | 3300005345 | Ga0070692_10185736 | Ga0070692_101857361 | 167 |
| 81 | 3300005353 | Ga0070669_101064525 | Ga0070669_1010645251 | 167 |
| 82 | 3300005355 | Ga0070671_100196427 | Ga0070671_1001964273 | 167 |
| 83 | 3300005355 | Ga0070671_100270463 | Ga0070671_1002704632 | 167 |
| 84 | 3300005356 | Ga0070674_100035143 | Ga0070674_1000351434 | 167 |
| 85 | 3300005365 | Ga0070688_100317063 | Ga0070688_1003170631 | 167 |
| 86 | 3300005366 | Ga0070659_100334759 | Ga0070659_1003347591 | 167 |
| 87 | 3300005367 | Ga0070667_100559616 | Ga0070667_1005596162 | 167 |
| 88 | 3300005438 | Ga0070701_10364149 | Ga0070701_103641492 | 167 |
| 89 | 3300005455 | Ga0070663_100189605 | Ga0070663_1001896053 | 167 |
| 90 | 3300005456 | Ga0070678_100039559 | Ga0070678_1000395594 | 167 |
| 91 | 3300005456 | Ga0070678_100158466 | Ga0070678_1001584663 | 167 |
| 92 | 3300005456 | Ga0070678_101158368 | Ga0070678_1011583682 | 167 |
| 93 | 3300005457 | Ga0070662_100507483 | Ga0070662_1005074832 | 167 |
| 94 | 3300005458 | Ga0070681_10069164 | Ga0070681_100691645 | 167 |
| 95 | 3300005459 | Ga0068867_100358570 | Ga0068867_1003585702 | 167 |
| 96 | 3300005466 | Ga0070685_10981054 | Ga0070685_109810541 | 167 |
| 97 | 3300005518 | Ga0070699_101543569 | Ga0070699_1015435691 | 167 |
| 98 | 3300005539 | Ga0068853_100406003 | Ga0068853_1004060032 | 167 |
| 99 | 3300005539 | Ga0068853_101374817 | Ga0068853_1013748171 | 167 |
| 100 | 3300005543 | Ga0070672_100411830 | Ga0070672_1004118302 | 167 |
| 101 | 3300005543 | Ga0070672_100545270 | Ga0070672_1005452702 | 167 |
| 102 | 3300005544 | Ga0070686_100149257 | Ga0070686_1001492572 | 167 |
| 103 | 3300005548 | Ga0070665_100253571 | Ga0070665_1002535713 | 167 |
| 104 | 3300005548 | Ga0070665_100503129 | Ga0070665_1005031292 | 167 |
| 105 | 3300005548 | Ga0070665_101429373 | Ga0070665_1014293731 | 167 |
| 106 | 3300005563 | Ga0068855_100172069 | Ga0068855_1001720691 | 167 |
| 107 | 3300005564 | Ga0070664_100533733 | Ga0070664_1005337332 | 167 |
| 108 | 3300005614 | Ga0068856_100206953 | Ga0068856_1002069533 | 167 |
| 109 | 3300005615 | Ga0070702_100194975 | Ga0070702_1001949752 | 167 |
| 110 | 3300005616 | Ga0068852_100103442 | Ga0068852_1001034422 | 167 |
| 111 | 3300005616 | Ga0068852_100558585 | Ga0068852_1005585853 | 167 |
| 112 | 3300005617 | Ga0068859_100067475 | Ga0068859_1000674754 | 167 |
| 113 | 3300005618 | Ga0068864_100111310 | Ga0068864_1001113102 | 167 |
| 114 | 3300005840 | Ga0068870_10251097 | Ga0068870_102510972 | 167 |
| 115 | 3300005841 | Ga0068863_100441310 | Ga0068863_1004413102 | 167 |
| 116 | 3300005841 | Ga0068863_101015078 | Ga0068863_1010150782 | 167 |
| 117 | 3300005843 | Ga0068860_100128258 | Ga0068860_1001282582 | 167 |
| 118 | 3300005843 | Ga0068860_100272452 | Ga0068860_1002724523 | 167 |
| 119 | 3300005843 | Ga0068860_101427262 | Ga0068860_1014272621 | 167 |
| 120 | 3300005844 | Ga0068862_100197996 | Ga0068862_1001979962 | 167 |
| 121 | 3300005844 | Ga0068862_100669716 | Ga0068862_1006697162 | 167 |
| 122 | 3300005844 | Ga0068862_100796587 | Ga0068862_1007965871 | 167 |
| 123 | 3300005844 | Ga0068862_101743178 | Ga0068862_1017431781 | 167 |
| 124 | 3300005937 | Ga0081455_10003699 | Ga0081455_100036992 | 167 |
| 125 | 3300005937 | Ga0081455_10127588 | Ga0081455_101275882 | 167 |
| 126 | 3300005937 | Ga0081455_10159826 | Ga0081455_101598262 | 167 |
| 127 | 3300005981 | Ga0081538_10020833 | Ga0081538_100208336 | 167 |
| 128 | 3300005983 | Ga0081540_1003091 | Ga0081540_100309110 | 167 |
| 129 | 3300005983 | Ga0081540_1072847 | Ga0081540_10728472 | 167 |
| 130 | 3300006038 | Ga0075365_10026143 | Ga0075365_100261432 | 167 |
| 131 | 3300006038 | Ga0075365_10446381 | Ga0075365_104463812 | 167 |
| 132 | 3300006042 | Ga0075368_10002858 | Ga0075368_100028585 | 167 |
| 133 | 3300006048 | Ga0075363_100003690 | Ga0075363_1000036903 | 167 |
| 134 | 3300006048 | Ga0075363_100092560 | Ga0075363_1000925603 | 167 |
| 135 | 3300006048 | Ga0075363_100496104 | Ga0075363_1004961041 | 167 |
| 136 | 3300006051 | Ga0075364_10017241 | Ga0075364_100172411 | 167 |
| 137 | 3300006051 | Ga0075364_10022187 | Ga0075364_100221872 | 167 |
| 138 | 3300006177 | Ga0075362_10008950 | Ga0075362_100089504 | 167 |
| 139 | 3300006178 | Ga0075367_10011042 | Ga0075367_100110425 | 167 |
| 140 | 3300006178 | Ga0075367_10202959 | Ga0075367_102029592 | 167 |
| 141 | 3300006178 | Ga0075367_10245861 | Ga0075367_102458612 | 167 |
| 142 | 3300006178 | Ga0075367_10306749 | Ga0075367_103067492 | 167 |
| 143 | 3300006178 | Ga0075367_10611856 | Ga0075367_106118561 | 167 |
| 144 | 3300006186 | Ga0075369_10011190 | Ga0075369_100111902 | 167 |
| 145 | 3300006186 | Ga0075369_10026249 | Ga0075369_100262493 | 167 |
| 146 | 3300006195 | Ga0075366_10074726 | Ga0075366_100747263 | 167 |
| 147 | 3300006237 | Ga0097621_100365951 | Ga0097621_1003659512 | 167 |
| 148 | 3300006353 | Ga0075370_10092808 | Ga0075370_100928082 | 167 |
| 149 | 3300006353 | Ga0075370_10180483 | Ga0075370_101804831 | 167 |
| 150 | 3300006358 | Ga0068871_100107291 | Ga0068871_1001072911 | 167 |
| 151 | 3300006358 | Ga0068871_100220538 | Ga0068871_1002205381 | 167 |
| 152 | 3300006844 | Ga0075428_100025159 | Ga0075428_1000251596 | 167 |
| 153 | 3300006844 | Ga0075428_100220390 | Ga0075428_1002203903 | 167 |
| 154 | 3300006846 | Ga0075430_101210418 | Ga0075430_1012104181 | 167 |
| 155 | 3300006847 | Ga0075431_100001712 | Ga0075431_10000171216 | 167 |
| 156 | 3300006871 | Ga0075434_100357445 | Ga0075434_1003574453 | 167 |
| 157 | 3300006914 | Ga0075436_100232485 | Ga0075436_1002324852 | 167 |
| 158 | 3300006931 | Ga0097620_100067486 | Ga0097620_1000674864 | 167 |
| 159 | 3300006942 | Ga0099824_1003225 | Ga0099824_100322518 | 167 |
| 160 | 3300006943 | Ga0099822_1005628 | Ga0099822_100562814 | 167 |
| 161 | 3300009094 | Ga0111539_10261925 | Ga0111539_102619252 | 167 |
| 162 | 3300009098 | Ga0105245_10444822 | Ga0105245_104448222 | 167 |
| 163 | 3300009101 | Ga0105247_10196299 | Ga0105247_101962991 | 167 |
| 164 | 3300009147 | Ga0114129_10037884 | Ga0114129_100378848 | 167 |
| 165 | 3300009147 | Ga0114129_10345513 | Ga0114129_103455132 | 167 |
| 166 | 3300009147 | Ga0114129_11387469 | Ga0114129_113874692 | 167 |
| 167 | 3300009148 | Ga0105243_10282716 | Ga0105243_102827162 | 167 |
| 168 | 3300009148 | Ga0105243_10691454 | Ga0105243_106914542 | 167 |
| 169 | 3300009174 | Ga0105241_10155119 | Ga0105241_101551192 | 167 |
| 170 | 3300009176 | Ga0105242_10315136 | Ga0105242_103151362 | 167 |
| 171 | 3300009176 | Ga0105242_10650033 | Ga0105242_106500332 | 167 |
| 172 | 3300009176 | Ga0105242_11194681 | Ga0105242_111946811 | 167 |
| 173 | 3300009177 | Ga0105248_10098374 | Ga0105248_100983743 | 167 |
| 174 | 3300009177 | Ga0105248_10108780 | Ga0105248_101087802 | 167 |
| 175 | 3300009545 | Ga0105237_10455384 | Ga0105237_104553842 | 167 |
| 176 | 3300009545 | Ga0105237_11323625 | Ga0105237_113236251 | 167 |
| 177 | 3300009551 | Ga0105238_10620758 | Ga0105238_106207582 | 167 |
| 178 | 3300009553 | Ga0105249_10806331 | Ga0105249_108063311 | 167 |
| 179 | 3300009553 | Ga0105249_11240327 | Ga0105249_112403271 | 167 |
| 180 | 3300009553 | Ga0105249_12030534 | Ga0105249_120305342 | 167 |
| 181 | 3300010375 | Ga0105239_10024893 | Ga0105239_100248937 | 167 |
| 182 | 3300010375 | Ga0105239_10242659 | Ga0105239_102426594 | 167 |
| 183 | 3300011119 | Ga0105246_10348769 | Ga0105246_103487692 | 167 |
| 184 | 3300011119 | Ga0105246_11308707 | Ga0105246_113087071 | 167 |
| 185 | 3300013296 | Ga0157374_10854423 | Ga0157374_108544232 | 167 |
| 186 | 3300013297 | Ga0157378_10615398 | Ga0157378_106153982 | 167 |
| 187 | 3300013306 | Ga0163162_10677145 | Ga0163162_106771452 | 167 |
| 188 | 3300013308 | Ga0157375_10370365 | Ga0157375_103703653 | 167 |
| 189 | 3300013308 | Ga0157375_11652625 | Ga0157375_116526252 | 167 |
| 190 | 3300014325 | Ga0163163_10252362 | Ga0163163_102523622 | 167 |
| 191 | 3300014325 | Ga0163163_10559247 | Ga0163163_105592472 | 167 |
| 192 | 3300014326 | Ga0157380_10122053 | Ga0157380_101220532 | 167 |
| 193 | 3300014326 | Ga0157380_10469416 | Ga0157380_104694161 | 167 |
| 194 | 3300014745 | Ga0157377_10084306 | Ga0157377_100843062 | 167 |
| 195 | 3300014968 | Ga0157379_10535312 | Ga0157379_105353122 | 167 |
| 196 | 3300014969 | Ga0157376_10350883 | Ga0157376_103508832 | 167 |
| 197 | 3300017792 | Ga0163161_10455945 | Ga0163161_104559452 | 167 |
| 198 | 3300017792 | Ga0163161_10852310 | Ga0163161_108523102 | 167 |
| 199 | 3300025272 | Ga0209455_1006055 | Ga0209455_10060554 | 167 |
| 200 | 3300025885 | Ga0207653_10022300 | Ga0207653_100223002 | 167 |
| 201 | 3300025900 | Ga0207710_10079854 | Ga0207710_100798543 | 167 |
| 202 | 3300025900 | Ga0207710_10105922 | Ga0207710_101059222 | 167 |
| 203 | 3300025905 | Ga0207685_10235982 | Ga0207685_102359821 | 167 |
| 204 | 3300025907 | Ga0207645_10107392 | Ga0207645_101073922 | 167 |
| 205 | 3300025908 | Ga0207643_10162292 | Ga0207643_101622922 | 167 |
| 206 | 3300025911 | Ga0207654_10040629 | Ga0207654_100406295 | 167 |
| 207 | 3300025914 | Ga0207671_10141677 | Ga0207671_101416772 | 167 |
| 208 | 3300025919 | Ga0207657_10104039 | Ga0207657_101040393 | 167 |
| 209 | 3300025919 | Ga0207657_10150210 | Ga0207657_101502103 | 167 |
| 210 | 3300025921 | Ga0207652_10431321 | Ga0207652_104313212 | 167 |
| 211 | 3300025923 | Ga0207681_10498316 | Ga0207681_104983161 | 167 |
| 212 | 3300025923 | Ga0207681_10709220 | Ga0207681_107092201 | 167 |
| 213 | 3300025924 | Ga0207694_10154521 | Ga0207694_101545212 | 167 |
| 214 | 3300025924 | Ga0207694_10428851 | Ga0207694_104288512 | 167 |
| 215 | 3300025925 | Ga0207650_10344744 | Ga0207650_103447442 | 167 |
| 216 | 3300025926 | Ga0207659_10230032 | Ga0207659_102300323 | 167 |
| 217 | 3300025927 | Ga0207687_10052440 | Ga0207687_100524405 | 167 |
| 218 | 3300025931 | Ga0207644_10231562 | Ga0207644_102315622 | 167 |
| 219 | 3300025932 | Ga0207690_10234716 | Ga0207690_102347162 | 167 |
| 220 | 3300025933 | Ga0207706_10543517 | Ga0207706_105435172 | 167 |
| 221 | 3300025934 | Ga0207686_10210720 | Ga0207686_102107202 | 167 |
| 222 | 3300025935 | Ga0207709_10510572 | Ga0207709_105105721 | 167 |
| 223 | 3300025938 | Ga0207704_10363015 | Ga0207704_103630151 | 167 |
| 224 | 3300025938 | Ga0207704_11049785 | Ga0207704_110497852 | 167 |
| 225 | 3300025941 | Ga0207711_10040565 | Ga0207711_100405654 | 167 |
| 226 | 3300025941 | Ga0207711_10109202 | Ga0207711_101092023 | 167 |
| 227 | 3300025942 | Ga0207689_10121032 | Ga0207689_101210322 | 167 |
| 228 | 3300025945 | Ga0207679_10506363 | Ga0207679_105063632 | 167 |
| 229 | 3300025949 | Ga0207667_10131918 | Ga0207667_101319184 | 167 |
| 230 | 3300025972 | Ga0207668_10270828 | Ga0207668_102708282 | 167 |
| 231 | 3300025972 | Ga0207668_10397541 | Ga0207668_103975412 | 167 |
| 232 | 3300025972 | Ga0207668_10443281 | Ga0207668_104432812 | 167 |
| 233 | 3300025972 | Ga0207668_10587005 | Ga0207668_105870051 | 167 |
| 234 | 3300025981 | Ga0207640_11147516 | Ga0207640_111475161 | 167 |
| 235 | 3300025986 | Ga0207658_10224874 | Ga0207658_102248741 | 167 |
| 236 | 3300025986 | Ga0207658_10387261 | Ga0207658_103872612 | 167 |
| 237 | 3300025986 | Ga0207658_11337975 | Ga0207658_113379751 | 167 |
| 238 | 3300026023 | Ga0207677_10154248 | Ga0207677_101542482 | 167 |
| 239 | 3300026035 | Ga0207703_10365183 | Ga0207703_103651831 | 167 |
| 240 | 3300026041 | Ga0207639_10274317 | Ga0207639_102743172 | 167 |
| 241 | 3300026041 | Ga0207639_10477559 | Ga0207639_104775592 | 167 |
| 242 | 3300026041 | Ga0207639_10480486 | Ga0207639_104804862 | 167 |
| 243 | 3300026067 | Ga0207678_10051481 | Ga0207678_100514816 | 167 |
| 244 | 3300026067 | Ga0207678_10096872 | Ga0207678_100968723 | 167 |
| 245 | 3300026067 | Ga0207678_10187503 | Ga0207678_101875032 | 167 |
| 246 | 3300026075 | Ga0207708_10197734 | Ga0207708_101977342 | 167 |
| 247 | 3300026075 | Ga0207708_10486896 | Ga0207708_104868961 | 167 |
| 248 | 3300026078 | Ga0207702_11214197 | Ga0207702_112141972 | 167 |
| 249 | 3300026088 | Ga0207641_10186159 | Ga0207641_101861593 | 167 |
| 250 | 3300026089 | Ga0207648_10449648 | Ga0207648_104496482 | 167 |
| 251 | 3300026089 | Ga0207648_10977017 | Ga0207648_109770171 | 167 |
| 252 | 3300026118 | Ga0207675_100436423 | Ga0207675_1004364232 | 167 |
| 253 | 3300026121 | Ga0207683_10195445 | Ga0207683_101954453 | 167 |
| 254 | 3300026121 | Ga0207683_10637824 | Ga0207683_106378242 | 167 |
| 255 | 3300026142 | Ga0207698_10143685 | Ga0207698_101436852 | 167 |
| 256 | 3300026142 | Ga0207698_10417687 | Ga0207698_104176872 | 167 |
| 257 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006313 | 167 |
| 258 | 3300027361 | Ga0209489_100007 | Ga0209489_100007313 | 167 |
| 259 | 3300027363 | Ga0209700_100008 | Ga0209700_100008313 | 167 |
| 260 | 3300027866 | Ga0209813_10002812 | Ga0209813_100028125 | 167 |
| 261 | 3300028379 | Ga0268266_10064405 | Ga0268266_100644053 | 167 |
| 262 | 3300028379 | Ga0268266_10273960 | Ga0268266_102739603 | 167 |
| 263 | 3300028379 | Ga0268266_10395588 | Ga0268266_103955882 | 167 |
| 264 | 3300028380 | Ga0268265_10082483 | Ga0268265_100824833 | 167 |
| 265 | 3300028380 | Ga0268265_10168396 | Ga0268265_101683962 | 167 |
| 266 | 3300028380 | Ga0268265_10404034 | Ga0268265_104040341 | 167 |
| 267 | 3300028380 | Ga0268265_10683197 | Ga0268265_106831972 | 167 |
| 268 | 3300028381 | Ga0268264_10281335 | Ga0268264_102813353 | 167 |
| 269 | 3300031456 | Ga0307513_10325561 | Ga0307513_103255612 | 167 |
| 270 | 3300031507 | Ga0307509_10165469 | Ga0307509_101654692 | 167 |
| 271 | 3300031548 | Ga0307408_100621191 | Ga0307408_1006211912 | 167 |
| 272 | 3300031730 | Ga0307516_10238955 | Ga0307516_102389552 | 167 |
| 273 | 3300031731 | Ga0307405_10434658 | Ga0307405_104346582 | 167 |
| 274 | 3300032002 | Ga0307416_100620580 | Ga0307416_1006205802 | 167 |
| 275 | 3300032002 | Ga0307416_100881057 | Ga0307416_1008810571 | 167 |
| 276 | 3300033180 | Ga0307510_10019525 | Ga0307510_100195257 | 167 |
| 277 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010229 | 167 |
| 278 | 3300035084 | Ga0373928_0011813 | Ga0373928_0011813_1028_1537 | 167 |
| 279 | 3300035088 | Ga0373940_0029665 | Ga0373940_0029665_461_970 | 167 |
| 280 | 3300035090 | Ga0373949_0067455 | Ga0373949_0067455_16_525 | 167 |
| 281 | 3300035112 | Ga0373932_0005334 | Ga0373932_0005334_1251_1760 | 167 |
| 282 | 3300035115 | Ga0373941_0002945 | Ga0373941_0002945_143_649 | 167 |
| 283 | 3300035242 | Ga0373962_0034362 | Ga0373962_0034362_504_1013 | 167 |
| 284 | 3300035691 | Ga0373931_0001895 | Ga0373931_0001895_2105_2662 | 167 |
| 285 | 3300035695 | Ga0373927_0023382 | Ga0373927_0023382_2353_2862 | 167 |
| 286 | 3300046452 | Ga0495617_030440 | Ga0495617_030440_704_1216 | 167 |
| 287 | 3300046455 | Ga0495603_0029732 | Ga0495603_0029732_1219_1734 | 167 |
| 288 | 3300046455 | Ga0495603_0049543 | Ga0495603_0049543_1238_1750 | 167 |
| 289 | 3300046455 | Ga0495603_0175304 | Ga0495603_0175304_422_931 | 167 |
| 290 | 3300046461 | Ga0495641_0201750 | Ga0495641_0201750_121_633 | 167 |
| 291 | 3300046471 | Ga0495650_0161393 | Ga0495650_0161393_200_712 | 167 |
| 292 | 3300046472 | Ga0495580_0280085 | Ga0495580_0280085_213_725 | 167 |
| 293 | 3300046475 | Ga0495639_0070181 | Ga0495639_0070181_452_967 | 167 |
| 294 | 3300046476 | Ga0495662_0265068 | Ga0495662_0265068_225_740 | 167 |
| 295 | 3300046491 | Ga0495584_0062955 | Ga0495584_0062955_436_948 | 167 |
| 296 | 3300046491 | Ga0495584_0204234 | Ga0495584_0204234_264_776 | 167 |
| 297 | 3300046492 | Ga0495585_0029264 | Ga0495585_0029264_1214_1726 | 167 |
| 298 | 3300046499 | Ga0495594_0030720 | Ga0495594_0030720_936_1448 | 167 |
| 299 | 3300046499 | Ga0495594_0053484 | Ga0495594_0053484_1171_1686 | 167 |
| 300 | 3300046501 | Ga0495607_0442827 | Ga0495607_0442827_45_557 | 167 |
| 301 | 3300046507 | Ga0495606_0079533 | Ga0495606_0079533_1437_1949 | 167 |
| 302 | 3300046512 | Ga0495610_0198225 | Ga0495610_0198225_32_544 | 167 |
| 303 | 3300046515 | Ga0495620_0053999 | Ga0495620_0053999_974_1486 | 167 |
| 304 | 3300046518 | Ga0495631_0015766 | Ga0495631_0015766_303_815 | 167 |
| 305 | 3300046518 | Ga0495631_0257257 | Ga0495631_0257257_14_526 | 167 |
| 306 | 3300046519 | Ga0495632_0090578 | Ga0495632_0090578_193_705 | 167 |
| 307 | 3300046523 | Ga0495644_0076258 | Ga0495644_0076258_436_948 | 167 |
| 308 | 3300046537 | Ga0495598_0027478 | Ga0495598_0027478_854_1366 | 167 |
| 309 | 3300046538 | Ga0495609_0170564 | Ga0495609_0170564_359_871 | 167 |
| 310 | 3300046539 | Ga0495621_0213857 | Ga0495621_0213857_109_621 | 167 |
| 311 | 3300046542 | Ga0495597_0198730 | Ga0495597_0198730_111_623 | 167 |
| 312 | 3300046557 | Ga0495622_0078533 | Ga0495622_0078533_558_1070 | 167 |
| 313 | 3300046558 | Ga0495633_0038360 | Ga0495633_0038360_1255_1767 | 167 |
| 314 | 3300046615 | Ga0495656_0056879 | Ga0495656_0056879_993_1505 | 167 |
| 315 | 3300046616 | Ga0495668_0070051 | Ga0495668_0070051_647_1165 | 167 |
| 316 | 3300046616 | Ga0495668_0240425 | Ga0495668_0240425_233_745 | 167 |
| 317 | 3300046616 | Ga0495668_0270841 | Ga0495668_0270841_200_712 | 167 |
| 318 | 3300046660 | Ga0495625_0264340 | Ga0495625_0264340_171_683 | 167 |
| 319 | 3300046660 | Ga0495625_0390423 | Ga0495625_0390423_32_544 | 167 |
| 320 | 3300046660 | Ga0495625_0528591 | Ga0495625_0528591_34_546 | 167 |
| 321 | 3300046664 | Ga0495659_0006815 | Ga0495659_0006815_2777_3289 | 167 |
| 322 | 3300046665 | Ga0495661_0155973 | Ga0495661_0155973_246_758 | 167 |
| 323 | 3300046674 | Ga0495588_0256813 | Ga0495588_0256813_202_714 | 167 |
| 324 | 3300046681 | Ga0495647_0014634 | Ga0495647_0014634_1609_2121 | 167 |
| 325 | 3300046681 | Ga0495647_0302618 | Ga0495647_0302618_113_628 | 167 |
| 326 | 3300046684 | Ga0495669_0104914 | Ga0495669_0104914_28_540 | 167 |
| 327 | 3300046684 | Ga0495669_0134897 | Ga0495669_0134897_462_968 | 167 |
| 328 | 3300046684 | Ga0495669_0254771 | Ga0495669_0254771_252_764 | 167 |
| 329 | 3300046684 | Ga0495669_0476162 | Ga0495669_0476162_18_533 | 167 |
| 330 | 3300046691 | Ga0495670_0012092 | Ga0495670_0012092_2637_3173 | 167 |
| 331 | 3300046691 | Ga0495670_0163891 | Ga0495670_0163891_501_1016 | 167 |
| 332 | 3300046692 | Ga0495671_0230596 | Ga0495671_0230596_236_748 | 167 |
| 333 | 3300047318 | Ga0495636_0040926 | Ga0495636_0040926_772_1284 | 167 |
| 334 | 3300047323 | Ga0495683_0037356 | Ga0495683_0037356_1819_2331 | 167 |
| 335 | 3300048903 | Ga0496100_0652085 | Ga0496100_0652085_85_597 | 167 |
| 336 | 3300048903 | Ga0496100_1298602 | Ga0496100_1298602_41_556 | 167 |
| 337 | 3300048904 | Ga0496101_0092016 | Ga0496101_0092016_571_1128 | 167 |
| 338 | 3300048904 | Ga0496101_0254104 | Ga0496101_0254104_815_1327 | 167 |
| 339 | 3300048904 | Ga0496101_1046176 | Ga0496101_1046176_94_606 | 167 |
| 340 | 3300048905 | Ga0496102_0010509 | Ga0496102_0010509_1356_1913 | 167 |
| 341 | 3300048905 | Ga0496102_0195854 | Ga0496102_0195854_625_1137 | 167 |
| 342 | 3300048906 | Ga0496103_0028159 | Ga0496103_0028159_803_1312 | 167 |
| 343 | 3300048907 | Ga0496104_0000264 | Ga0496104_0000264_1211_1729 | 167 |
| 344 | 3300048907 | Ga0496104_0430551 | Ga0496104_0430551_34_546 | 167 |
| 345 | 3300048908 | Ga0496105_0004722 | Ga0496105_0004722_5014_5571 | 167 |
| 346 | 3300048908 | Ga0496105_0067512 | Ga0496105_0067512_992_1510 | 167 |
| 347 | 3300048909 | Ga0496106_0128796 | Ga0496106_0128796_1205_1762 | 167 |
| 348 | 3300048909 | Ga0496106_0500068 | Ga0496106_0500068_30_542 | 167 |
| 349 | 3300048910 | Ga0496107_0010483 | Ga0496107_0010483_1983_2540 | 167 |
| 350 | 3300048910 | Ga0496107_0106435 | Ga0496107_0106435_932_1444 | 167 |
| 351 | 3300048911 | Ga0496108_0067242 | Ga0496108_0067242_419_928 | 167 |
| 352 | 3300048911 | Ga0496108_0081956 | Ga0496108_0081956_356_874 | 167 |
| 353 | 3300048912 | Ga0496109_0007688 | Ga0496109_0007688_6373_6882 | 167 |
| 354 | 3300048912 | Ga0496109_0063721 | Ga0496109_0063721_1224_1736 | 167 |
| 355 | 3300048912 | Ga0496109_0700640 | Ga0496109_0700640_209_718 | 167 |
| 356 | 3300048913 | Ga0496110_0007695 | Ga0496110_0007695_2387_2944 | 167 |
| 357 | 3300048913 | Ga0496110_0009156 | Ga0496110_0009156_6395_6913 | 167 |
| 358 | 3300048913 | Ga0496110_0578618 | Ga0496110_0578618_328_840 | 167 |
| 359 | 3300048914 | Ga0496111_0003597 | Ga0496111_0003597_5576_6133 | 167 |
| 360 | 3300048914 | Ga0496111_0037700 | Ga0496111_0037700_1136_1654 | 167 |
| 361 | 3300048914 | Ga0496111_0614863 | Ga0496111_0614863_213_725 | 167 |
| 362 | 3300048915 | Ga0496112_0025430 | Ga0496112_0025430_1415_1924 | 167 |
| 363 | 3300048915 | Ga0496112_0542299 | Ga0496112_0542299_377_889 | 167 |
| 364 | 3300048916 | Ga0496113_0005354 | Ga0496113_0005354_2035_2592 | 167 |
| 365 | 3300048916 | Ga0496113_0053298 | Ga0496113_0053298_470_988 | 167 |
| 366 | 3300048916 | Ga0496113_0384699 | Ga0496113_0384699_574_1086 | 167 |
| 367 | 3300048917 | Ga0496114_0004664 | Ga0496114_0004664_4708_5265 | 167 |
| 368 | 3300048917 | Ga0496114_0924234 | Ga0496114_0924234_182_691 | 167 |
| 369 | 3300048918 | Ga0496115_0274401 | Ga0496115_0274401_623_1135 | 167 |
| 370 | 3300048920 | Ga0496117_0163140 | Ga0496117_0163140_121_633 | 167 |
| 371 | 3300048922 | Ga0496119_0033029 | Ga0496119_0033029_33_545 | 167 |
| 372 | 3300048924 | Ga0496121_0144691 | Ga0496121_0144691_880_1392 | 167 |
| 373 | 3300048924 | Ga0496121_0162927 | Ga0496121_0162927_886_1398 | 167 |
| 374 | 3300048924 | Ga0496121_0685010 | Ga0496121_0685010_84_596 | 167 |
| 375 | 3300048928 | Ga0496125_0076632 | Ga0496125_0076632_1919_2431 | 167 |
| 376 | 3300048928 | Ga0496125_0145306 | Ga0496125_0145306_472_984 | 167 |
| 377 | 3300048929 | Ga0496126_0034270 | Ga0496126_0034270_668_1180 | 167 |
| 378 | 3300048929 | Ga0496126_0051129 | Ga0496126_0051129_3041_3553 | 167 |
| 379 | 3300048929 | Ga0496126_0143672 | Ga0496126_0143672_574_1086 | 167 |
| 380 | 3300048929 | Ga0496126_0302736 | Ga0496126_0302736_136_648 | 167 |
| 381 | 3300048929 | Ga0496126_0346739 | Ga0496126_0346739_133_645 | 167 |
| 382 | 3300049459 | Ga0495678_035270 | Ga0495678_035270_1153_1659 | 167 |
| 383 | 3300050490 | nmdc:mga03n38_140855_c1 | nmdc:mga03n38_140855_c1_599_1111 | 167 |
| 384 | 3300050490 | nmdc:mga03n38_141278_c1 | nmdc:mga03n38_141278_c1_495_1013 | 167 |
| 385 | 3300050491 | nmdc:mga00v17_162573_c1 | nmdc:mga00v17_162573_c1_578_1090 | 167 |
| 386 | 3300050491 | nmdc:mga00v17_20052_c1 | nmdc:mga00v17_20052_c1_187_705 | 167 |
| 387 | 3300050491 | nmdc:mga00v17_39463_c1 | nmdc:mga00v17_39463_c1_1840_2352 | 167 |
| 388 | 3300050492 | nmdc:mga0yw44_17750_c1 | nmdc:mga0yw44_17750_c1_1751_2263 | 167 |
| 389 | 3300050492 | nmdc:mga0yw44_780845_c1 | nmdc:mga0yw44_780845_c1_115_627 | 167 |
| 390 | 3300050493 | nmdc:mga0k408_247025_c1 | nmdc:mga0k408_247025_c1_526_1038 | 167 |
| 391 | 3300050493 | nmdc:mga0k408_477258_c1 | nmdc:mga0k408_477258_c1_70_582 | 167 |
| 392 | 3300050494 | nmdc:mga06z11_12508_c1 | nmdc:mga06z11_12508_c1_627_1145 | 167 |
| 393 | 3300050494 | nmdc:mga06z11_32790_c1 | nmdc:mga06z11_32790_c1_130_648 | 167 |
| 394 | 3300050494 | nmdc:mga06z11_448217_c1 | nmdc:mga06z11_448217_c1_77_595 | 167 |
| 395 | 3300050494 | nmdc:mga06z11_84892_c1 | nmdc:mga06z11_84892_c1_683_1195 | 167 |
| 396 | 3300050495 | nmdc:mga04h51_146802_c1 | nmdc:mga04h51_146802_c1_147_659 | 167 |
| 397 | 3300050495 | nmdc:mga04h51_66211_c1 | nmdc:mga04h51_66211_c1_626_1144 | 167 |
| 398 | 3300050507 | nmdc:mga05p37_1432600_c1 | nmdc:mga05p37_1432600_c1_76_612 | 167 |
| 399 | 3300050507 | nmdc:mga05p37_280399_c1 | nmdc:mga05p37_280399_c1_598_1110 | 167 |
| 400 | 3300050507 | nmdc:mga05p37_29696_c2 | nmdc:mga05p37_29696_c2_5040_5558 | 167 |
| 401 | 3300050508 | nmdc:mga09592_373507_c1 | nmdc:mga09592_373507_c1_203_721 | 167 |
| 402 | 3300050510 | nmdc:mga06r32_12202_c1 | nmdc:mga06r32_12202_c1_6525_7043 | 167 |
| 403 | 3300050511 | nmdc:mga08y16_678874_c1 | nmdc:mga08y16_678874_c1_377_895 | 167 |
| 404 | 3300050512 | nmdc:mga0n895_96815_c1 | nmdc:mga0n895_96815_c1_1010_1522 | 167 |
| 405 | 3300050513 | nmdc:mga0rr50_418514_c1 | nmdc:mga0rr50_418514_c1_590_1102 | 167 |
| 406 | 3300050514 | nmdc:mga08x19_688452_c1 | nmdc:mga08x19_688452_c1_32_544 | 167 |
| 407 | 3300050515 | nmdc:mga0a205_205529_c1 | nmdc:mga0a205_205529_c1_306_818 | 167 |
| 408 | 3300050516 | nmdc:mga0sz30_108053_c1 | nmdc:mga0sz30_108053_c1_447_959 | 167 |
| 409 | 3300050516 | nmdc:mga0sz30_192682_c1 | nmdc:mga0sz30_192682_c1_274_786 | 167 |
| 410 | 3300050516 | nmdc:mga0sz30_215855_c1 | nmdc:mga0sz30_215855_c1_216_728 | 167 |
| 411 | 3300050516 | nmdc:mga0sz30_2375_c1 | nmdc:mga0sz30_2375_c1_963_1475 | 167 |
| 412 | 3300053083 | Ga0495655_0028464 | Ga0495655_0028464_397_909 | 167 |
| 413 | 3300053096 | Ga0500641_0003076 | Ga0500641_0003076_203_709 | 167 |
| 414 | 3300053096 | Ga0500641_0078769 | Ga0500641_0078769_870_1382 | 167 |
| 415 | 3300053119 | Ga0500595_002264 | Ga0500595_002264_764_1276 | 167 |
| 416 | 3300053137 | Ga0500561_0053717 | Ga0500561_0053717_387_899 | 167 |
| 417 | 3300053156 | Ga0500622_0055243 | Ga0500622_0055243_115_627 | 167 |
| 418 | 3300053162 | Ga0500638_089332 | Ga0500638_089332_452_964 | 167 |
| 419 | 3300003215 | JGI25153J46596_10000738 | JGI25153J46596_100007386 | 168 |
| 420 | 3300003320 | rootH2_10100776 | rootH2_101007762 | 168 |
| 421 | 3300003322 | rootL2_10156283 | rootL2_101562831 | 168 |
| 422 | 3300003659 | JGI25404J52841_10008621 | JGI25404J52841_100086213 | 168 |
| 423 | 3300005327 | Ga0070658_10946607 | Ga0070658_109466071 | 168 |
| 424 | 3300005328 | Ga0070676_10202667 | Ga0070676_102026672 | 168 |
| 425 | 3300005329 | Ga0070683_101016290 | Ga0070683_1010162901 | 168 |
| 426 | 3300005330 | Ga0070690_100013883 | Ga0070690_1000138831 | 168 |
| 427 | 3300005331 | Ga0070670_100485037 | Ga0070670_1004850372 | 168 |
| 428 | 3300005334 | Ga0068869_100140009 | Ga0068869_1001400092 | 168 |
| 429 | 3300005335 | Ga0070666_10094036 | Ga0070666_100940362 | 168 |
| 430 | 3300005336 | Ga0070680_100569234 | Ga0070680_1005692341 | 168 |
| 431 | 3300005337 | Ga0070682_100081625 | Ga0070682_1000816252 | 168 |
| 432 | 3300005337 | Ga0070682_100471822 | Ga0070682_1004718221 | 168 |
| 433 | 3300005338 | Ga0068868_100105245 | Ga0068868_1001052453 | 168 |
| 434 | 3300005338 | Ga0068868_100459610 | Ga0068868_1004596102 | 168 |
| 435 | 3300005338 | Ga0068868_100539507 | Ga0068868_1005395072 | 168 |
| 436 | 3300005339 | Ga0070660_100372677 | Ga0070660_1003726772 | 168 |
| 437 | 3300005340 | Ga0070689_100556949 | Ga0070689_1005569492 | 168 |
| 438 | 3300005341 | Ga0070691_10293480 | Ga0070691_102934802 | 168 |
| 439 | 3300005344 | Ga0070661_100155180 | Ga0070661_1001551803 | 168 |
| 440 | 3300005344 | Ga0070661_100547282 | Ga0070661_1005472822 | 168 |
| 441 | 3300005347 | Ga0070668_100108937 | Ga0070668_1001089371 | 168 |
| 442 | 3300005347 | Ga0070668_100357346 | Ga0070668_1003573462 | 168 |
| 443 | 3300005347 | Ga0070668_100626033 | Ga0070668_1006260331 | 168 |
| 444 | 3300005347 | Ga0070668_100832552 | Ga0070668_1008325522 | 168 |
| 445 | 3300005347 | Ga0070668_100976201 | Ga0070668_1009762012 | 168 |
| 446 | 3300005354 | Ga0070675_101387632 | Ga0070675_1013876321 | 168 |
| 447 | 3300005355 | Ga0070671_100216516 | Ga0070671_1002165162 | 168 |
| 448 | 3300005355 | Ga0070671_101014070 | Ga0070671_1010140702 | 168 |
| 449 | 3300005356 | Ga0070674_100378784 | Ga0070674_1003787842 | 168 |
| 450 | 3300005356 | Ga0070674_100693830 | Ga0070674_1006938302 | 168 |
| 451 | 3300005364 | Ga0070673_100112844 | Ga0070673_1001128442 | 168 |
| 452 | 3300005364 | Ga0070673_100589410 | Ga0070673_1005894101 | 168 |
| 453 | 3300005365 | Ga0070688_100322111 | Ga0070688_1003221112 | 168 |
| 454 | 3300005366 | Ga0070659_100214238 | Ga0070659_1002142381 | 168 |
| 455 | 3300005366 | Ga0070659_100306833 | Ga0070659_1003068332 | 168 |
| 456 | 3300005366 | Ga0070659_100974340 | Ga0070659_1009743402 | 168 |
| 457 | 3300005434 | Ga0070709_10096813 | Ga0070709_100968132 | 168 |
| 458 | 3300005435 | Ga0070714_100327084 | Ga0070714_1003270842 | 168 |
| 459 | 3300005435 | Ga0070714_101163778 | Ga0070714_1011637782 | 168 |
| 460 | 3300005437 | Ga0070710_10011649 | Ga0070710_100116492 | 168 |
| 461 | 3300005439 | Ga0070711_100010862 | Ga0070711_1000108626 | 168 |
| 462 | 3300005440 | Ga0070705_101026550 | Ga0070705_1010265501 | 168 |
| 463 | 3300005441 | Ga0070700_100351816 | Ga0070700_1003518162 | 168 |
| 464 | 3300005455 | Ga0070663_100294729 | Ga0070663_1002947292 | 168 |
| 465 | 3300005455 | Ga0070663_100359125 | Ga0070663_1003591252 | 168 |
| 466 | 3300005456 | Ga0070678_100007967 | Ga0070678_1000079675 | 168 |
| 467 | 3300005456 | Ga0070678_100035283 | Ga0070678_1000352834 | 168 |
| 468 | 3300005456 | Ga0070678_100196577 | Ga0070678_1001965772 | 168 |
| 469 | 3300005456 | Ga0070678_100870676 | Ga0070678_1008706761 | 168 |
| 470 | 3300005457 | Ga0070662_100337333 | Ga0070662_1003373332 | 168 |
| 471 | 3300005458 | Ga0070681_10085157 | Ga0070681_100851572 | 168 |
| 472 | 3300005458 | Ga0070681_11290661 | Ga0070681_112906611 | 168 |
| 473 | 3300005459 | Ga0068867_100989926 | Ga0068867_1009899262 | 168 |
| 474 | 3300005466 | Ga0070685_10399497 | Ga0070685_103994972 | 168 |
| 475 | 3300005518 | Ga0070699_100198513 | Ga0070699_1001985132 | 168 |
| 476 | 3300005530 | Ga0070679_100019162 | Ga0070679_1000191625 | 168 |
| 477 | 3300005530 | Ga0070679_100759250 | Ga0070679_1007592501 | 168 |
| 478 | 3300005536 | Ga0070697_100658178 | Ga0070697_1006581781 | 168 |
| 479 | 3300005539 | Ga0068853_100710798 | Ga0068853_1007107982 | 168 |
| 480 | 3300005539 | Ga0068853_100960605 | Ga0068853_1009606052 | 168 |
| 481 | 3300005543 | Ga0070672_100139942 | Ga0070672_1001399421 | 168 |
| 482 | 3300005543 | Ga0070672_100173630 | Ga0070672_1001736303 | 168 |
| 483 | 3300005544 | Ga0070686_100277045 | Ga0070686_1002770451 | 168 |
| 484 | 3300005548 | Ga0070665_100020950 | Ga0070665_1000209503 | 168 |
| 485 | 3300005548 | Ga0070665_100080986 | Ga0070665_1000809863 | 168 |
| 486 | 3300005548 | Ga0070665_100160316 | Ga0070665_1001603164 | 168 |
| 487 | 3300005548 | Ga0070665_100626694 | Ga0070665_1006266942 | 168 |
| 488 | 3300005549 | Ga0070704_100117260 | Ga0070704_1001172601 | 168 |
| 489 | 3300005563 | Ga0068855_100036490 | Ga0068855_1000364902 | 168 |
| 490 | 3300005564 | Ga0070664_100630319 | Ga0070664_1006303192 | 168 |
| 491 | 3300005564 | Ga0070664_101348482 | Ga0070664_1013484821 | 168 |
| 492 | 3300005577 | Ga0068857_101048364 | Ga0068857_1010483641 | 168 |
| 493 | 3300005577 | Ga0068857_101165239 | Ga0068857_1011652391 | 168 |
| 494 | 3300005578 | Ga0068854_100070455 | Ga0068854_1000704552 | 168 |
| 495 | 3300005578 | Ga0068854_100383616 | Ga0068854_1003836162 | 168 |
| 496 | 3300005614 | Ga0068856_100173634 | Ga0068856_1001736342 | 168 |
| 497 | 3300005616 | Ga0068852_100016778 | Ga0068852_1000167783 | 168 |
| 498 | 3300005616 | Ga0068852_100045466 | Ga0068852_1000454663 | 168 |
| 499 | 3300005616 | Ga0068852_101881571 | Ga0068852_1018815711 | 168 |
| 500 | 3300005718 | Ga0068866_10161326 | Ga0068866_101613262 | 168 |
| 501 | 3300005719 | Ga0068861_100184644 | Ga0068861_1001846443 | 168 |
| 502 | 3300005719 | Ga0068861_101349839 | Ga0068861_1013498391 | 168 |
| 503 | 3300005840 | Ga0068870_10145078 | Ga0068870_101450782 | 168 |
| 504 | 3300005841 | Ga0068863_100780084 | Ga0068863_1007800842 | 168 |
| 505 | 3300005843 | Ga0068860_100297484 | Ga0068860_1002974841 | 168 |
| 506 | 3300005843 | Ga0068860_100305761 | Ga0068860_1003057612 | 168 |
| 507 | 3300005844 | Ga0068862_100616472 | Ga0068862_1006164721 | 168 |
| 508 | 3300005844 | Ga0068862_100892254 | Ga0068862_1008922542 | 168 |
| 509 | 3300005844 | Ga0068862_100900719 | Ga0068862_1009007191 | 168 |
| 510 | 3300005937 | Ga0081455_10008277 | Ga0081455_1000827710 | 168 |
| 511 | 3300005937 | Ga0081455_10070603 | Ga0081455_100706032 | 168 |
| 512 | 3300005983 | Ga0081540_1000996 | Ga0081540_100099620 | 168 |
| 513 | 3300005983 | Ga0081540_1008013 | Ga0081540_10080135 | 168 |
| 514 | 3300005983 | Ga0081540_1010852 | Ga0081540_10108525 | 168 |
| 515 | 3300005983 | Ga0081540_1028988 | Ga0081540_10289882 | 168 |
| 516 | 3300005983 | Ga0081540_1051839 | Ga0081540_10518392 | 168 |
| 517 | 3300005983 | Ga0081540_1070603 | Ga0081540_10706031 | 168 |
| 518 | 3300005983 | Ga0081540_1110341 | Ga0081540_11103412 | 168 |
| 519 | 3300005985 | Ga0081539_10041134 | Ga0081539_100411343 | 168 |
| 520 | 3300005985 | Ga0081539_10177574 | Ga0081539_101775742 | 168 |
| 521 | 3300006028 | Ga0070717_10608646 | Ga0070717_106086461 | 168 |
| 522 | 3300006038 | Ga0075365_10672691 | Ga0075365_106726912 | 168 |
| 523 | 3300006042 | Ga0075368_10109378 | Ga0075368_101093782 | 168 |
| 524 | 3300006048 | Ga0075363_100019054 | Ga0075363_1000190543 | 168 |
| 525 | 3300006048 | Ga0075363_100307411 | Ga0075363_1003074111 | 168 |
| 526 | 3300006175 | Ga0070712_100016528 | Ga0070712_1000165282 | 168 |
| 527 | 3300006175 | Ga0070712_100030454 | Ga0070712_1000304543 | 168 |
| 528 | 3300006178 | Ga0075367_10290976 | Ga0075367_102909761 | 168 |
| 529 | 3300006178 | Ga0075367_10414377 | Ga0075367_104143771 | 168 |
| 530 | 3300006195 | Ga0075366_10124765 | Ga0075366_101247652 | 168 |
| 531 | 3300006195 | Ga0075366_10264152 | Ga0075366_102641522 | 168 |
| 532 | 3300006353 | Ga0075370_10042568 | Ga0075370_100425683 | 168 |
| 533 | 3300006353 | Ga0075370_10148475 | Ga0075370_101484752 | 168 |
| 534 | 3300006353 | Ga0075370_10336408 | Ga0075370_103364081 | 168 |
| 535 | 3300006353 | Ga0075370_10514759 | Ga0075370_105147591 | 168 |
| 536 | 3300006358 | Ga0068871_100162487 | Ga0068871_1001624873 | 168 |
| 537 | 3300006358 | Ga0068871_100343989 | Ga0068871_1003439892 | 168 |
| 538 | 3300006881 | Ga0068865_100291188 | Ga0068865_1002911882 | 168 |
| 539 | 3300006881 | Ga0068865_100941720 | Ga0068865_1009417202 | 168 |
| 540 | 3300007265 | Ga0099794_10052540 | Ga0099794_100525402 | 168 |
| 541 | 3300007788 | Ga0099795_10040196 | Ga0099795_100401962 | 168 |
| 542 | 3300007788 | Ga0099795_10128197 | Ga0099795_101281972 | 168 |
| 543 | 3300007788 | Ga0099795_10323829 | Ga0099795_103238292 | 168 |
| 544 | 3300009092 | Ga0105250_10157267 | Ga0105250_101572672 | 168 |
| 545 | 3300009093 | Ga0105240_10177700 | Ga0105240_101777003 | 168 |
| 546 | 3300009093 | Ga0105240_10445878 | Ga0105240_104458782 | 168 |
| 547 | 3300009094 | Ga0111539_10089698 | Ga0111539_100896984 | 168 |
| 548 | 3300009094 | Ga0111539_10335277 | Ga0111539_103352773 | 168 |
| 549 | 3300009098 | Ga0105245_10386161 | Ga0105245_103861612 | 168 |
| 550 | 3300009098 | Ga0105245_10818767 | Ga0105245_108187671 | 168 |
| 551 | 3300009098 | Ga0105245_11846327 | Ga0105245_118463272 | 168 |
| 552 | 3300009101 | Ga0105247_10189004 | Ga0105247_101890041 | 168 |
| 553 | 3300009101 | Ga0105247_10372541 | Ga0105247_103725412 | 168 |
| 554 | 3300009101 | Ga0105247_10389979 | Ga0105247_103899791 | 168 |
| 555 | 3300009148 | Ga0105243_10421131 | Ga0105243_104211313 | 168 |
| 556 | 3300009148 | Ga0105243_10984259 | Ga0105243_109842591 | 168 |
| 557 | 3300009176 | Ga0105242_10136248 | Ga0105242_101362483 | 168 |
| 558 | 3300009176 | Ga0105242_10185353 | Ga0105242_101853532 | 168 |
| 559 | 3300009177 | Ga0105248_10649225 | Ga0105248_106492252 | 168 |
| 560 | 3300009177 | Ga0105248_10692965 | Ga0105248_106929651 | 168 |
| 561 | 3300009545 | Ga0105237_10501099 | Ga0105237_105010991 | 168 |
| 562 | 3300009545 | Ga0105237_10864289 | Ga0105237_108642892 | 168 |
| 563 | 3300009545 | Ga0105237_11173532 | Ga0105237_111735322 | 168 |
| 564 | 3300009545 | Ga0105237_11426633 | Ga0105237_114266331 | 168 |
| 565 | 3300009551 | Ga0105238_10273510 | Ga0105238_102735103 | 168 |
| 566 | 3300009551 | Ga0105238_10915828 | Ga0105238_109158282 | 168 |
| 567 | 3300009553 | Ga0105249_10215265 | Ga0105249_102152653 | 168 |
| 568 | 3300010159 | Ga0099796_10062156 | Ga0099796_100621562 | 168 |
| 569 | 3300010375 | Ga0105239_10396197 | Ga0105239_103961972 | 168 |
| 570 | 3300010375 | Ga0105239_11112850 | Ga0105239_111128501 | 168 |
| 571 | 3300010375 | Ga0105239_12180236 | Ga0105239_121802361 | 168 |
| 572 | 3300011119 | Ga0105246_10230215 | Ga0105246_102302152 | 168 |
| 573 | 3300011119 | Ga0105246_10295173 | Ga0105246_102951732 | 168 |
| 574 | 3300011119 | Ga0105246_10337501 | Ga0105246_103375012 | 168 |
| 575 | 3300013296 | Ga0157374_10328495 | Ga0157374_103284951 | 168 |
| 576 | 3300013296 | Ga0157374_10430092 | Ga0157374_104300923 | 168 |
| 577 | 3300013296 | Ga0157374_10460814 | Ga0157374_104608142 | 168 |
| 578 | 3300013297 | Ga0157378_10095979 | Ga0157378_100959792 | 168 |
| 579 | 3300013297 | Ga0157378_10404118 | Ga0157378_104041182 | 168 |
| 580 | 3300013297 | Ga0157378_10817666 | Ga0157378_108176662 | 168 |
| 581 | 3300013306 | Ga0163162_10413440 | Ga0163162_104134402 | 168 |
| 582 | 3300013307 | Ga0157372_10822131 | Ga0157372_108221312 | 168 |
| 583 | 3300013308 | Ga0157375_10022963 | Ga0157375_100229635 | 168 |
| 584 | 3300013308 | Ga0157375_10284050 | Ga0157375_102840503 | 168 |
| 585 | 3300013308 | Ga0157375_11141399 | Ga0157375_111413992 | 168 |
| 586 | 3300014325 | Ga0163163_10195936 | Ga0163163_101959362 | 168 |
| 587 | 3300014326 | Ga0157380_10158264 | Ga0157380_101582642 | 168 |
| 588 | 3300014326 | Ga0157380_10181760 | Ga0157380_101817603 | 168 |
| 589 | 3300014326 | Ga0157380_10280804 | Ga0157380_102808043 | 168 |
| 590 | 3300014326 | Ga0157380_11337038 | Ga0157380_113370381 | 168 |
| 591 | 3300014968 | Ga0157379_10188769 | Ga0157379_101887692 | 168 |
| 592 | 3300014968 | Ga0157379_10206840 | Ga0157379_102068402 | 168 |
| 593 | 3300014968 | Ga0157379_10703657 | Ga0157379_107036571 | 168 |
| 594 | 3300014968 | Ga0157379_10718872 | Ga0157379_107188721 | 168 |
| 595 | 3300014968 | Ga0157379_10810248 | Ga0157379_108102482 | 168 |
| 596 | 3300014969 | Ga0157376_10663633 | Ga0157376_106636332 | 168 |
| 597 | 3300017792 | Ga0163161_10026279 | Ga0163161_100262792 | 168 |
| 598 | 3300017792 | Ga0163161_10215639 | Ga0163161_102156393 | 168 |
| 599 | 3300017792 | Ga0163161_10589924 | Ga0163161_105899242 | 168 |
| 600 | 3300025297 | Ga0209758_1065794 | Ga0209758_10657941 | 168 |
| 601 | 3300025898 | Ga0207692_10013187 | Ga0207692_100131872 | 168 |
| 602 | 3300025899 | Ga0207642_10070349 | Ga0207642_100703493 | 168 |
| 603 | 3300025901 | Ga0207688_10056972 | Ga0207688_100569722 | 168 |
| 604 | 3300025901 | Ga0207688_10060556 | Ga0207688_100605563 | 168 |
| 605 | 3300025901 | Ga0207688_10078530 | Ga0207688_100785302 | 168 |
| 606 | 3300025906 | Ga0207699_10023406 | Ga0207699_100234064 | 168 |
| 607 | 3300025907 | Ga0207645_10061625 | Ga0207645_100616252 | 168 |
| 608 | 3300025907 | Ga0207645_10372645 | Ga0207645_103726452 | 168 |
| 609 | 3300025908 | Ga0207643_10075327 | Ga0207643_100753272 | 168 |
| 610 | 3300025912 | Ga0207707_10008592 | Ga0207707_1000859211 | 168 |
| 611 | 3300025913 | Ga0207695_10067565 | Ga0207695_100675652 | 168 |
| 612 | 3300025913 | Ga0207695_10076493 | Ga0207695_100764932 | 168 |
| 613 | 3300025914 | Ga0207671_10138314 | Ga0207671_101383142 | 168 |
| 614 | 3300025914 | Ga0207671_10749271 | Ga0207671_107492712 | 168 |
| 615 | 3300025915 | Ga0207693_10001851 | Ga0207693_100018518 | 168 |
| 616 | 3300025915 | Ga0207693_10050083 | Ga0207693_100500833 | 168 |
| 617 | 3300025916 | Ga0207663_10009598 | Ga0207663_100095985 | 168 |
| 618 | 3300025917 | Ga0207660_10271149 | Ga0207660_102711492 | 168 |
| 619 | 3300025919 | Ga0207657_10415027 | Ga0207657_104150272 | 168 |
| 620 | 3300025919 | Ga0207657_10423804 | Ga0207657_104238042 | 168 |
| 621 | 3300025919 | Ga0207657_10716807 | Ga0207657_107168072 | 168 |
| 622 | 3300025920 | Ga0207649_10210830 | Ga0207649_102108302 | 168 |
| 623 | 3300025921 | Ga0207652_10924717 | Ga0207652_109247171 | 168 |
| 624 | 3300025926 | Ga0207659_10606532 | Ga0207659_106065322 | 168 |
| 625 | 3300025926 | Ga0207659_10752920 | Ga0207659_107529202 | 168 |
| 626 | 3300025926 | Ga0207659_10765876 | Ga0207659_107658761 | 168 |
| 627 | 3300025929 | Ga0207664_10214985 | Ga0207664_102149852 | 168 |
| 628 | 3300025931 | Ga0207644_11293574 | Ga0207644_112935741 | 168 |
| 629 | 3300025932 | Ga0207690_10062103 | Ga0207690_100621032 | 168 |
| 630 | 3300025932 | Ga0207690_10392706 | Ga0207690_103927062 | 168 |
| 631 | 3300025932 | Ga0207690_10464502 | Ga0207690_104645022 | 168 |
| 632 | 3300025933 | Ga0207706_10202309 | Ga0207706_102023093 | 168 |
| 633 | 3300025933 | Ga0207706_10705820 | Ga0207706_107058202 | 168 |
| 634 | 3300025933 | Ga0207706_10868446 | Ga0207706_108684461 | 168 |
| 635 | 3300025934 | Ga0207686_10192088 | Ga0207686_101920882 | 168 |
| 636 | 3300025935 | Ga0207709_10129363 | Ga0207709_101293633 | 168 |
| 637 | 3300025935 | Ga0207709_10359981 | Ga0207709_103599812 | 168 |
| 638 | 3300025935 | Ga0207709_10402879 | Ga0207709_104028791 | 168 |
| 639 | 3300025936 | Ga0207670_10439481 | Ga0207670_104394811 | 168 |
| 640 | 3300025937 | Ga0207669_10010625 | Ga0207669_100106255 | 168 |
| 641 | 3300025937 | Ga0207669_10018303 | Ga0207669_100183034 | 168 |
| 642 | 3300025937 | Ga0207669_10263510 | Ga0207669_102635102 | 168 |
| 643 | 3300025937 | Ga0207669_10901723 | Ga0207669_109017232 | 168 |
| 644 | 3300025938 | Ga0207704_10029068 | Ga0207704_100290682 | 168 |
| 645 | 3300025938 | Ga0207704_10078158 | Ga0207704_100781582 | 168 |
| 646 | 3300025939 | Ga0207665_10033322 | Ga0207665_100333225 | 168 |
| 647 | 3300025940 | Ga0207691_10065199 | Ga0207691_100651991 | 168 |
| 648 | 3300025941 | Ga0207711_10447228 | Ga0207711_104472282 | 168 |
| 649 | 3300025942 | Ga0207689_10333347 | Ga0207689_103333472 | 168 |
| 650 | 3300025944 | Ga0207661_11381957 | Ga0207661_113819571 | 168 |
| 651 | 3300025945 | Ga0207679_10193770 | Ga0207679_101937701 | 168 |
| 652 | 3300025945 | Ga0207679_10526820 | Ga0207679_105268202 | 168 |
| 653 | 3300025945 | Ga0207679_11202631 | Ga0207679_112026311 | 168 |
| 654 | 3300025949 | Ga0207667_10049551 | Ga0207667_100495512 | 168 |
| 655 | 3300025949 | Ga0207667_11176950 | Ga0207667_111769501 | 168 |
| 656 | 3300025960 | Ga0207651_10021773 | Ga0207651_100217732 | 168 |
| 657 | 3300025961 | Ga0207712_10151232 | Ga0207712_101512323 | 168 |
| 658 | 3300025972 | Ga0207668_10047201 | Ga0207668_100472014 | 168 |
| 659 | 3300025972 | Ga0207668_10253892 | Ga0207668_102538922 | 168 |
| 660 | 3300025972 | Ga0207668_10300481 | Ga0207668_103004811 | 168 |
| 661 | 3300025972 | Ga0207668_10714670 | Ga0207668_107146701 | 168 |
| 662 | 3300025981 | Ga0207640_10970513 | Ga0207640_109705132 | 168 |
| 663 | 3300026023 | Ga0207677_10297427 | Ga0207677_102974271 | 168 |
| 664 | 3300026023 | Ga0207677_10395169 | Ga0207677_103951691 | 168 |
| 665 | 3300026023 | Ga0207677_10448545 | Ga0207677_104485452 | 168 |
| 666 | 3300026035 | Ga0207703_10252462 | Ga0207703_102524622 | 168 |
| 667 | 3300026041 | Ga0207639_10143069 | Ga0207639_101430693 | 168 |
| 668 | 3300026041 | Ga0207639_10529992 | Ga0207639_105299922 | 168 |
| 669 | 3300026067 | Ga0207678_10029610 | Ga0207678_100296104 | 168 |
| 670 | 3300026067 | Ga0207678_10035630 | Ga0207678_100356305 | 168 |
| 671 | 3300026067 | Ga0207678_10071503 | Ga0207678_100715033 | 168 |
| 672 | 3300026067 | Ga0207678_10227861 | Ga0207678_102278612 | 168 |
| 673 | 3300026078 | Ga0207702_10621228 | Ga0207702_106212282 | 168 |
| 674 | 3300026088 | Ga0207641_10659296 | Ga0207641_106592962 | 168 |
| 675 | 3300026089 | Ga0207648_10166283 | Ga0207648_101662832 | 168 |
| 676 | 3300026089 | Ga0207648_10327207 | Ga0207648_103272073 | 168 |
| 677 | 3300026089 | Ga0207648_10704453 | Ga0207648_107044531 | 168 |
| 678 | 3300026095 | Ga0207676_10586237 | Ga0207676_105862372 | 168 |
| 679 | 3300026116 | Ga0207674_10752688 | Ga0207674_107526882 | 168 |
| 680 | 3300026116 | Ga0207674_10862879 | Ga0207674_108628792 | 168 |
| 681 | 3300026118 | Ga0207675_100144538 | Ga0207675_1001445382 | 168 |
| 682 | 3300026118 | Ga0207675_100208285 | Ga0207675_1002082853 | 168 |
| 683 | 3300026118 | Ga0207675_100281521 | Ga0207675_1002815213 | 168 |
| 684 | 3300026118 | Ga0207675_100304369 | Ga0207675_1003043692 | 168 |
| 685 | 3300026118 | Ga0207675_100776359 | Ga0207675_1007763592 | 168 |
| 686 | 3300026118 | Ga0207675_100989705 | Ga0207675_1009897052 | 168 |
| 687 | 3300026121 | Ga0207683_10038663 | Ga0207683_100386634 | 168 |
| 688 | 3300026121 | Ga0207683_10185005 | Ga0207683_101850053 | 168 |
| 689 | 3300026142 | Ga0207698_10016150 | Ga0207698_100161505 | 168 |
| 690 | 3300026142 | Ga0207698_10035640 | Ga0207698_100356404 | 168 |
| 691 | 3300027866 | Ga0209813_10191817 | Ga0209813_101918171 | 168 |
| 692 | 3300027907 | Ga0207428_10062077 | Ga0207428_100620773 | 168 |
| 693 | 3300028379 | Ga0268266_10013121 | Ga0268266_100131214 | 168 |
| 694 | 3300028379 | Ga0268266_10016287 | Ga0268266_100162875 | 168 |
| 695 | 3300028380 | Ga0268265_10521205 | Ga0268265_105212052 | 168 |
| 696 | 3300028380 | Ga0268265_10849276 | Ga0268265_108492762 | 168 |
| 697 | 3300028381 | Ga0268264_10332942 | Ga0268264_103329422 | 168 |
| 698 | 3300028381 | Ga0268264_10923590 | Ga0268264_109235902 | 168 |
| 699 | 3300028786 | Ga0307517_10000085 | Ga0307517_1000008537 | 168 |
| 700 | 3300028786 | Ga0307517_10209702 | Ga0307517_102097022 | 168 |
| 701 | 3300028794 | Ga0307515_10011214 | Ga0307515_100112146 | 168 |
| 702 | 3300028794 | Ga0307515_10295072 | Ga0307515_102950722 | 168 |
| 703 | 3300028794 | Ga0307515_10524383 | Ga0307515_105243831 | 168 |
| 704 | 3300030522 | Ga0307512_10159191 | Ga0307512_101591912 | 168 |
| 705 | 3300031238 | Ga0265332_10025893 | Ga0265332_100258933 | 168 |
| 706 | 3300031241 | Ga0265325_10004960 | Ga0265325_1000496011 | 168 |
| 707 | 3300031247 | Ga0265340_10018719 | Ga0265340_100187194 | 168 |
| 708 | 3300031249 | Ga0265339_10013486 | Ga0265339_100134862 | 168 |
| 709 | 3300031249 | Ga0265339_10072556 | Ga0265339_100725562 | 168 |
| 710 | 3300031250 | Ga0265331_10236772 | Ga0265331_102367722 | 168 |
| 711 | 3300031344 | Ga0265316_10332946 | Ga0265316_103329462 | 168 |
| 712 | 3300031344 | Ga0265316_10755228 | Ga0265316_107552282 | 168 |
| 713 | 3300031456 | Ga0307513_10530068 | Ga0307513_105300682 | 168 |
| 714 | 3300031456 | Ga0307513_10590867 | Ga0307513_105908672 | 168 |
| 715 | 3300031507 | Ga0307509_10449591 | Ga0307509_104495912 | 168 |
| 716 | 3300031548 | Ga0307408_100434618 | Ga0307408_1004346183 | 168 |
| 717 | 3300031616 | Ga0307508_10083537 | Ga0307508_100835373 | 168 |
| 718 | 3300031616 | Ga0307508_10203809 | Ga0307508_102038092 | 168 |
| 719 | 3300031616 | Ga0307508_10250806 | Ga0307508_102508062 | 168 |
| 720 | 3300031711 | Ga0265314_10300686 | Ga0265314_103006862 | 168 |
| 721 | 3300031712 | Ga0265342_10355544 | Ga0265342_103555442 | 168 |
| 722 | 3300031730 | Ga0307516_10025519 | Ga0307516_100255195 | 168 |
| 723 | 3300031730 | Ga0307516_10025796 | Ga0307516_100257964 | 168 |
| 724 | 3300031730 | Ga0307516_10116824 | Ga0307516_101168242 | 168 |
| 725 | 3300031730 | Ga0307516_10119591 | Ga0307516_101195912 | 168 |
| 726 | 3300031730 | Ga0307516_10416953 | Ga0307516_104169532 | 168 |
| 727 | 3300031731 | Ga0307405_10323080 | Ga0307405_103230801 | 168 |
| 728 | 3300031824 | Ga0307413_10034590 | Ga0307413_100345902 | 168 |
| 729 | 3300031824 | Ga0307413_10115918 | Ga0307413_101159183 | 168 |
| 730 | 3300031903 | Ga0307407_10258486 | Ga0307407_102584862 | 168 |
| 731 | 3300031903 | Ga0307407_10471285 | Ga0307407_104712852 | 168 |
| 732 | 3300031903 | Ga0307407_10519864 | Ga0307407_105198641 | 168 |
| 733 | 3300031911 | Ga0307412_10103281 | Ga0307412_101032811 | 168 |
| 734 | 3300031911 | Ga0307412_10272872 | Ga0307412_102728722 | 168 |
| 735 | 3300031911 | Ga0307412_10477436 | Ga0307412_104774361 | 168 |
| 736 | 3300031995 | Ga0307409_100328839 | Ga0307409_1003288391 | 168 |
| 737 | 3300032002 | Ga0307416_100614473 | Ga0307416_1006144732 | 168 |
| 738 | 3300032004 | Ga0307414_10290685 | Ga0307414_102906851 | 168 |
| 739 | 3300032004 | Ga0307414_10693417 | Ga0307414_106934172 | 168 |
| 740 | 3300032005 | Ga0307411_10002397 | Ga0307411_100023974 | 168 |
| 741 | 3300032005 | Ga0307411_10020733 | Ga0307411_100207335 | 168 |
| 742 | 3300032126 | Ga0307415_100524944 | Ga0307415_1005249442 | 168 |
| 743 | 3300033180 | Ga0307510_10009700 | Ga0307510_100097005 | 168 |
| 744 | 3300033180 | Ga0307510_10038953 | Ga0307510_100389536 | 168 |
| 745 | 3300035086 | Ga0373934_0049067 | Ga0373934_0049067_816_1352 | 168 |
| 746 | 3300035113 | Ga0373936_0122716 | Ga0373936_0122716_14_529 | 168 |
| 747 | 3300035117 | Ga0373953_0001358 | Ga0373953_0001358_1241_1777 | 168 |
| 748 | 3300035118 | Ga0373954_0001778 | Ga0373954_0001778_3375_3911 | 168 |
| 749 | 3300035119 | Ga0373956_0005729 | Ga0373956_0005729_2422_2958 | 168 |
| 750 | 3300035120 | Ga0373957_0002644 | Ga0373957_0002644_2791_3327 | 168 |
| 751 | 3300035172 | Ga0373955_0001783 | Ga0373955_0001783_4538_5074 | 168 |
| 752 | 3300035207 | Ga0373942_0122249 | Ga0373942_0122249_62_574 | 168 |
| 753 | 3300035410 | Ga0373924_0005305 | Ga0373924_0005305_1241_1777 | 168 |
| 754 | 3300035692 | Ga0373935_0314397 | Ga0373935_0314397_180_716 | 168 |
| 755 | 3300035695 | Ga0373927_0005360 | Ga0373927_0005360_3845_4357 | 168 |
| 756 | 3300035695 | Ga0373927_0035091 | Ga0373927_0035091_2092_2604 | 168 |
| 757 | 3300035695 | Ga0373927_0084258 | Ga0373927_0084258_943_1455 | 168 |
| 758 | 3300035695 | Ga0373927_0310887 | Ga0373927_0310887_15_530 | 168 |
| 759 | 3300035724 | Ga0373933_0001908 | Ga0373933_0001908_6883_7419 | 168 |
| 760 | 3300036401 | Ga0373937_0015839 | Ga0373937_0015839_4568_5104 | 168 |
| 761 | 3300037068 | Ga0373925_0122843 | Ga0373925_0122843_764_1276 | 168 |
| 762 | 3300037068 | Ga0373925_0405153 | Ga0373925_0405153_69_581 | 168 |
| 763 | 3300037068 | Ga0373925_0726130 | Ga0373925_0726130_232_768 | 168 |
| 764 | 3300037312 | Ga0395899_0447270 | Ga0395899_0447270_225_737 | 168 |
| 765 | 3300037466 | Ga0395898_0289712 | Ga0395898_0289712_956_1468 | 168 |
| 766 | 3300037466 | Ga0395898_1067310 | Ga0395898_1067310_73_597 | 168 |
| 767 | 3300037471 | Ga0395905_0100628 | Ga0395905_0100628_934_1446 | 168 |
| 768 | 3300037471 | Ga0395905_0108120 | Ga0395905_0108120_1051_1563 | 168 |
| 769 | 3300037471 | Ga0395905_0710893 | Ga0395905_0710893_255_767 | 168 |
| 770 | 3300037471 | Ga0395905_1157196 | Ga0395905_1157196_64_576 | 168 |
| 771 | 3300038443 | Ga0395901_1019515 | Ga0395901_1019515_181_693 | 168 |
| 772 | 3300041411 | Ga0439466_0150484 | Ga0439466_0150484_184_696 | 168 |
| 773 | 3300041413 | Ga0439465_0079258 | Ga0439465_0079258_363_875 | 168 |
| 774 | 3300041443 | Ga0451789_0496885 | Ga0451789_0496885_370_882 | 168 |
| 775 | 3300041496 | Ga0451839_0837697 | Ga0451839_0837697_485_1000 | 168 |
| 776 | 3300041507 | Ga0451851_0996752 | Ga0451851_0996752_547_1062 | 168 |
| 777 | 3300042157 | Ga0439458_0029195 | Ga0439458_0029195_81_587 | 168 |
| 778 | 3300042993 | Ga0439440_0222490 | Ga0439440_0222490_10_522 | 168 |
| 779 | 3300044842 | Ga0466957_0043947 | Ga0466957_0043947_426_944 | 168 |
| 780 | 3300045049 | Ga0466959_0130291 | Ga0466959_0130291_253_771 | 168 |
| 781 | 3300045051 | Ga0451576_1903073 | Ga0451576_1903073_55_567 | 168 |
| 782 | 3300046452 | Ga0495617_006940 | Ga0495617_006940_2733_3245 | 168 |
| 783 | 3300046454 | Ga0495592_0005568 | Ga0495592_0005568_7196_7732 | 168 |
| 784 | 3300046455 | Ga0495603_0029466 | Ga0495603_0029466_1150_1686 | 168 |
| 785 | 3300046455 | Ga0495603_0223566 | Ga0495603_0223566_153_665 | 168 |
| 786 | 3300046459 | Ga0495629_0000922 | Ga0495629_0000922_2151_2687 | 168 |
| 787 | 3300046459 | Ga0495629_0527996 | Ga0495629_0527996_145_663 | 168 |
| 788 | 3300046460 | Ga0495638_0045785 | Ga0495638_0045785_1095_1610 | 168 |
| 789 | 3300046460 | Ga0495638_0132101 | Ga0495638_0132101_718_1230 | 168 |
| 790 | 3300046460 | Ga0495638_0428159 | Ga0495638_0428159_42_557 | 168 |
| 791 | 3300046462 | Ga0495651_0019485 | Ga0495651_0019485_3146_3682 | 168 |
| 792 | 3300046462 | Ga0495651_0079787 | Ga0495651_0079787_118_630 | 168 |
| 793 | 3300046463 | Ga0495653_0004517 | Ga0495653_0004517_10515_11051 | 168 |
| 794 | 3300046473 | Ga0495582_0072963 | Ga0495582_0072963_647_1165 | 168 |
| 795 | 3300046474 | Ga0495605_0090050 | Ga0495605_0090050_616_1128 | 168 |
| 796 | 3300046474 | Ga0495605_0149964 | Ga0495605_0149964_161_709 | 168 |
| 797 | 3300046476 | Ga0495662_0198613 | Ga0495662_0198613_42_560 | 168 |
| 798 | 3300046477 | Ga0495664_0250928 | Ga0495664_0250928_375_893 | 168 |
| 799 | 3300046491 | Ga0495584_0224730 | Ga0495584_0224730_45_557 | 168 |
| 800 | 3300046492 | Ga0495585_0162415 | Ga0495585_0162415_74_586 | 168 |
| 801 | 3300046501 | Ga0495607_0366589 | Ga0495607_0366589_60_572 | 168 |
| 802 | 3300046506 | Ga0495583_0054834 | Ga0495583_0054834_309_821 | 168 |
| 803 | 3300046507 | Ga0495606_0000976 | Ga0495606_0000976_25456_26016 | 168 |
| 804 | 3300046511 | Ga0495608_0035885 | Ga0495608_0035885_1227_1763 | 168 |
| 805 | 3300046513 | Ga0495616_0125950 | Ga0495616_0125950_652_1164 | 168 |
| 806 | 3300046513 | Ga0495616_0226512 | Ga0495616_0226512_137_652 | 168 |
| 807 | 3300046515 | Ga0495620_0065030 | Ga0495620_0065030_523_1035 | 168 |
| 808 | 3300046515 | Ga0495620_0111811 | Ga0495620_0111811_483_1055 | 168 |
| 809 | 3300046516 | Ga0495628_0030476 | Ga0495628_0030476_2944_3480 | 168 |
| 810 | 3300046518 | Ga0495631_0107154 | Ga0495631_0107154_632_1144 | 168 |
| 811 | 3300046518 | Ga0495631_0140815 | Ga0495631_0140815_148_687 | 168 |
| 812 | 3300046518 | Ga0495631_0155457 | Ga0495631_0155457_74_586 | 168 |
| 813 | 3300046519 | Ga0495632_0097751 | Ga0495632_0097751_705_1217 | 168 |
| 814 | 3300046519 | Ga0495632_0196899 | Ga0495632_0196899_59_574 | 168 |
| 815 | 3300046519 | Ga0495632_0303098 | Ga0495632_0303098_174_686 | 168 |
| 816 | 3300046520 | Ga0495637_0089553 | Ga0495637_0089553_486_998 | 168 |
| 817 | 3300046520 | Ga0495637_0137071 | Ga0495637_0137071_372_884 | 168 |
| 818 | 3300046523 | Ga0495644_0065872 | Ga0495644_0065872_164_676 | 168 |
| 819 | 3300046523 | Ga0495644_0106370 | Ga0495644_0106370_188_700 | 168 |
| 820 | 3300046523 | Ga0495644_0108378 | Ga0495644_0108378_211_723 | 168 |
| 821 | 3300046525 | Ga0495663_0214113 | Ga0495663_0214113_87_602 | 168 |
| 822 | 3300046525 | Ga0495663_0262920 | Ga0495663_0262920_53_565 | 168 |
| 823 | 3300046529 | Ga0495652_0025506 | Ga0495652_0025506_921_1457 | 168 |
| 824 | 3300046529 | Ga0495652_0205375 | Ga0495652_0205375_465_977 | 168 |
| 825 | 3300046529 | Ga0495652_0247135 | Ga0495652_0247135_635_1147 | 168 |
| 826 | 3300046533 | Ga0495640_0035468 | Ga0495640_0035468_527_1063 | 168 |
| 827 | 3300046536 | Ga0495587_0013911 | Ga0495587_0013911_2069_2605 | 168 |
| 828 | 3300046537 | Ga0495598_0009888 | Ga0495598_0009888_1441_1953 | 168 |
| 829 | 3300046538 | Ga0495609_0022606 | Ga0495609_0022606_378_890 | 168 |
| 830 | 3300046538 | Ga0495609_0198945 | Ga0495609_0198945_89_637 | 168 |
| 831 | 3300046543 | Ga0495645_0029715 | Ga0495645_0029715_3252_3788 | 168 |
| 832 | 3300046559 | Ga0495667_0007856 | Ga0495667_0007856_4496_5032 | 168 |
| 833 | 3300046559 | Ga0495667_0438941 | Ga0495667_0438941_149_664 | 168 |
| 834 | 3300046615 | Ga0495656_0005268 | Ga0495656_0005268_2528_3040 | 168 |
| 835 | 3300046615 | Ga0495656_0089573 | Ga0495656_0089573_622_1134 | 168 |
| 836 | 3300046615 | Ga0495656_0110573 | Ga0495656_0110573_749_1261 | 168 |
| 837 | 3300046616 | Ga0495668_0044002 | Ga0495668_0044002_1330_1842 | 168 |
| 838 | 3300046616 | Ga0495668_0223332 | Ga0495668_0223332_94_642 | 168 |
| 839 | 3300046616 | Ga0495668_0352017 | Ga0495668_0352017_14_526 | 168 |
| 840 | 3300046642 | Ga0495634_0010895 | Ga0495634_0010895_3590_4126 | 168 |
| 841 | 3300046648 | Ga0495611_0087431 | Ga0495611_0087431_720_1232 | 168 |
| 842 | 3300046648 | Ga0495611_0159732 | Ga0495611_0159732_153_665 | 168 |
| 843 | 3300046660 | Ga0495625_0148756 | Ga0495625_0148756_720_1232 | 168 |
| 844 | 3300046660 | Ga0495625_0206903 | Ga0495625_0206903_674_1186 | 168 |
| 845 | 3300046660 | Ga0495625_0348077 | Ga0495625_0348077_340_852 | 168 |
| 846 | 3300046663 | Ga0495635_0002149 | Ga0495635_0002149_6948_7484 | 168 |
| 847 | 3300046663 | Ga0495635_0126515 | Ga0495635_0126515_221_736 | 168 |
| 848 | 3300046665 | Ga0495661_0103488 | Ga0495661_0103488_77_589 | 168 |
| 849 | 3300046665 | Ga0495661_0285868 | Ga0495661_0285868_172_684 | 168 |
| 850 | 3300046674 | Ga0495588_0243798 | Ga0495588_0243798_28_546 | 168 |
| 851 | 3300046674 | Ga0495588_0306992 | Ga0495588_0306992_71_583 | 168 |
| 852 | 3300046675 | Ga0495657_0026686 | Ga0495657_0026686_1355_1891 | 168 |
| 853 | 3300046675 | Ga0495657_0539973 | Ga0495657_0539973_65_577 | 168 |
| 854 | 3300046678 | Ga0495599_0001827 | Ga0495599_0001827_4480_5016 | 168 |
| 855 | 3300046679 | Ga0495623_0170793 | Ga0495623_0170793_371_883 | 168 |
| 856 | 3300046684 | Ga0495669_0000675 | Ga0495669_0000675_7182_7694 | 168 |
| 857 | 3300046689 | Ga0495613_0092686 | Ga0495613_0092686_349_861 | 168 |
| 858 | 3300046689 | Ga0495613_0254730 | Ga0495613_0254730_132_668 | 168 |
| 859 | 3300046794 | Ga0495589_0087665 | Ga0495589_0087665_123_635 | 168 |
| 860 | 3300046809 | Ga0495600_0006396 | Ga0495600_0006396_1578_2114 | 168 |
| 861 | 3300046809 | Ga0495600_0159162 | Ga0495600_0159162_44_556 | 168 |
| 862 | 3300046809 | Ga0495600_0435927 | Ga0495600_0435927_141_677 | 168 |
| 863 | 3300047315 | Ga0495581_0138320 | Ga0495581_0138320_476_994 | 168 |
| 864 | 3300047317 | Ga0495604_0005881 | Ga0495604_0005881_3296_3832 | 168 |
| 865 | 3300047318 | Ga0495636_0139869 | Ga0495636_0139869_258_770 | 168 |
| 866 | 3300047318 | Ga0495636_0378807 | Ga0495636_0378807_119_631 | 168 |
| 867 | 3300047319 | Ga0495674_0060932 | Ga0495674_0060932_2321_2857 | 168 |
| 868 | 3300047320 | Ga0495672_0029388 | Ga0495672_0029388_1166_1705 | 168 |
| 869 | 3300047320 | Ga0495672_0030049 | Ga0495672_0030049_1997_2533 | 168 |
| 870 | 3300047322 | Ga0495680_0009327 | Ga0495680_0009327_5854_6390 | 168 |
| 871 | 3300047444 | Ga0495675_0008213 | Ga0495675_0008213_3601_4137 | 168 |
| 872 | 3300047445 | Ga0495677_0084468 | Ga0495677_0084468_506_1018 | 168 |
| 873 | 3300047447 | Ga0495685_099265 | Ga0495685_099265_10_522 | 168 |
| 874 | 3300047469 | Ga0495673_0034976 | Ga0495673_0034976_1283_1795 | 168 |
| 875 | 3300047469 | Ga0495673_0102385 | Ga0495673_0102385_537_1049 | 168 |
| 876 | 3300047469 | Ga0495673_0109406 | Ga0495673_0109406_145_657 | 168 |
| 877 | 3300047471 | Ga0495684_0026359 | Ga0495684_0026359_2033_2569 | 168 |
| 878 | 3300047472 | Ga0495686_0118536 | Ga0495686_0118536_128_664 | 168 |
| 879 | 3300047472 | Ga0495686_0180571 | Ga0495686_0180571_523_1062 | 168 |
| 880 | 3300047472 | Ga0495686_0196855 | Ga0495686_0196855_236_748 | 168 |
| 881 | 3300047673 | Ga0495593_0008299 | Ga0495593_0008299_3429_3965 | 168 |
| 882 | 3300047673 | Ga0495593_0182007 | Ga0495593_0182007_194_709 | 168 |
| 883 | 3300047673 | Ga0495593_0207551 | Ga0495593_0207551_357_893 | 168 |
| 884 | 3300048088 | Ga0495602_0011154 | Ga0495602_0011154_4481_5017 | 168 |
| 885 | 3300048903 | Ga0496100_0001613 | Ga0496100_0001613_8809_9321 | 168 |
| 886 | 3300048903 | Ga0496100_0394378 | Ga0496100_0394378_455_964 | 168 |
| 887 | 3300048903 | Ga0496100_1319465 | Ga0496100_1319465_28_540 | 168 |
| 888 | 3300048904 | Ga0496101_0004421 | Ga0496101_0004421_3277_3789 | 168 |
| 889 | 3300048904 | Ga0496101_0366155 | Ga0496101_0366155_135_647 | 168 |
| 890 | 3300048905 | Ga0496102_0012054 | Ga0496102_0012054_1618_2130 | 168 |
| 891 | 3300048905 | Ga0496102_0142359 | Ga0496102_0142359_579_1091 | 168 |
| 892 | 3300048905 | Ga0496102_0581821 | Ga0496102_0581821_192_704 | 168 |
| 893 | 3300048905 | Ga0496102_0848660 | Ga0496102_0848660_63_575 | 168 |
| 894 | 3300048905 | Ga0496102_0876304 | Ga0496102_0876304_73_585 | 168 |
| 895 | 3300048906 | Ga0496103_0333963 | Ga0496103_0333963_102_614 | 168 |
| 896 | 3300048907 | Ga0496104_0081042 | Ga0496104_0081042_1939_2451 | 168 |
| 897 | 3300048907 | Ga0496104_0303660 | Ga0496104_0303660_692_1207 | 168 |
| 898 | 3300048907 | Ga0496104_0805641 | Ga0496104_0805641_193_705 | 168 |
| 899 | 3300048908 | Ga0496105_0258114 | Ga0496105_0258114_526_1038 | 168 |
| 900 | 3300048909 | Ga0496106_0040286 | Ga0496106_0040286_2259_2771 | 168 |
| 901 | 3300048909 | Ga0496106_0463958 | Ga0496106_0463958_488_1003 | 168 |
| 902 | 3300048910 | Ga0496107_0004750 | Ga0496107_0004750_2563_3075 | 168 |
| 903 | 3300048910 | Ga0496107_0605431 | Ga0496107_0605431_226_741 | 168 |
| 904 | 3300048912 | Ga0496109_0010512 | Ga0496109_0010512_5251_5763 | 168 |
| 905 | 3300048912 | Ga0496109_0181768 | Ga0496109_0181768_1355_1867 | 168 |
| 906 | 3300048913 | Ga0496110_0018621 | Ga0496110_0018621_995_1507 | 168 |
| 907 | 3300048913 | Ga0496110_0300721 | Ga0496110_0300721_697_1209 | 168 |
| 908 | 3300048914 | Ga0496111_0127639 | Ga0496111_0127639_15_530 | 168 |
| 909 | 3300048915 | Ga0496112_0070372 | Ga0496112_0070372_2773_3285 | 168 |
| 910 | 3300048915 | Ga0496112_0271642 | Ga0496112_0271642_122_658 | 168 |
| 911 | 3300048915 | Ga0496112_0812483 | Ga0496112_0812483_82_594 | 168 |
| 912 | 3300048916 | Ga0496113_0006480 | Ga0496113_0006480_3736_4248 | 168 |
| 913 | 3300048916 | Ga0496113_0395933 | Ga0496113_0395933_297_812 | 168 |
| 914 | 3300048917 | Ga0496114_0008103 | Ga0496114_0008103_1520_2032 | 168 |
| 915 | 3300048917 | Ga0496114_0110348 | Ga0496114_0110348_945_1457 | 168 |
| 916 | 3300048917 | Ga0496114_0545311 | Ga0496114_0545311_203_718 | 168 |
| 917 | 3300048917 | Ga0496114_0558059 | Ga0496114_0558059_88_606 | 168 |
| 918 | 3300048918 | Ga0496115_0005898 | Ga0496115_0005898_3826_4338 | 168 |
| 919 | 3300048918 | Ga0496115_0280060 | Ga0496115_0280060_648_1163 | 168 |
| 920 | 3300048921 | Ga0496118_0307866 | Ga0496118_0307866_201_719 | 168 |
| 921 | 3300048922 | Ga0496119_0168520 | Ga0496119_0168520_223_759 | 168 |
| 922 | 3300048923 | Ga0496120_0140607 | Ga0496120_0140607_259_777 | 168 |
| 923 | 3300048924 | Ga0496121_0000178 | Ga0496121_0000178_40923_41459 | 168 |
| 924 | 3300048924 | Ga0496121_0047711 | Ga0496121_0047711_2634_3152 | 168 |
| 925 | 3300048924 | Ga0496121_0115654 | Ga0496121_0115654_951_1463 | 168 |
| 926 | 3300048924 | Ga0496121_0117262 | Ga0496121_0117262_183_698 | 168 |
| 927 | 3300048924 | Ga0496121_0231223 | Ga0496121_0231223_471_1034 | 168 |
| 928 | 3300048924 | Ga0496121_0316954 | Ga0496121_0316954_420_938 | 168 |
| 929 | 3300048927 | Ga0496124_0160570 | Ga0496124_0160570_423_935 | 168 |
| 930 | 3300048927 | Ga0496124_0588364 | Ga0496124_0588364_186_701 | 168 |
| 931 | 3300048929 | Ga0496126_0007639 | Ga0496126_0007639_4218_4745 | 168 |
| 932 | 3300048929 | Ga0496126_0095324 | Ga0496126_0095324_1313_1825 | 168 |
| 933 | 3300048929 | Ga0496126_0153196 | Ga0496126_0153196_547_1107 | 168 |
| 934 | 3300048929 | Ga0496126_0195935 | Ga0496126_0195935_366_884 | 168 |
| 935 | 3300048929 | Ga0496126_0341302 | Ga0496126_0341302_435_971 | 168 |
| 936 | 3300048929 | Ga0496126_0457340 | Ga0496126_0457340_211_726 | 168 |
| 937 | 3300048929 | Ga0496126_0513915 | Ga0496126_0513915_356_892 | 168 |
| 938 | 3300049460 | Ga0495682_0076929 | Ga0495682_0076929_321_833 | 168 |
| 939 | 3300049568 | Ga0501031_0661590 | Ga0501031_0661590_125_631 | 168 |
| 940 | 3300049571 | Ga0501034_0213375 | Ga0501034_0213375_320_856 | 168 |
| 941 | 3300049575 | Ga0501039_1139986 | Ga0501039_1139986_29_565 | 168 |
| 942 | 3300049581 | Ga0501047_0137786 | Ga0501047_0137786_1750_2286 | 168 |
| 943 | 3300049583 | Ga0501067_0068698 | Ga0501067_0068698_1294_1800 | 168 |
| 944 | 3300049583 | Ga0501067_0073388 | Ga0501067_0073388_1364_1885 | 168 |
| 945 | 3300049592 | Ga0501076_1160462 | Ga0501076_1160462_70_603 | 168 |
| 946 | 3300050490 | nmdc:mga03n38_257587_c1 | nmdc:mga03n38_257587_c1_215_754 | 168 |
| 947 | 3300050490 | nmdc:mga03n38_40050_c1 | nmdc:mga03n38_40050_c1_884_1399 | 168 |
| 948 | 3300050491 | nmdc:mga00v17_277365_c1 | nmdc:mga00v17_277365_c1_443_955 | 168 |
| 949 | 3300050492 | nmdc:mga0yw44_166004_c1 | nmdc:mga0yw44_166004_c1_253_771 | 168 |
| 950 | 3300050494 | nmdc:mga06z11_226138_c1 | nmdc:mga06z11_226138_c1_81_593 | 168 |
| 951 | 3300050494 | nmdc:mga06z11_276415_c1 | nmdc:mga06z11_276415_c1_240_779 | 168 |
| 952 | 3300050496 | nmdc:mga07m45_198930_c1 | nmdc:mga07m45_198930_c1_473_979 | 168 |
| 953 | 3300050496 | nmdc:mga07m45_41448_c1 | nmdc:mga07m45_41448_c1_1289_1828 | 168 |
| 954 | 3300050496 | nmdc:mga07m45_420172_c1 | nmdc:mga07m45_420172_c1_76_591 | 168 |
| 955 | 3300050496 | nmdc:mga07m45_47017_c1 | nmdc:mga07m45_47017_c1_231_743 | 168 |
| 956 | 3300050511 | nmdc:mga08y16_252069_c1 | nmdc:mga08y16_252069_c1_1202_1714 | 168 |
| 957 | 3300050511 | nmdc:mga08y16_52748_c1 | nmdc:mga08y16_52748_c1_2222_2734 | 168 |
| 958 | 3300050512 | nmdc:mga0n895_231793_c1 | nmdc:mga0n895_231793_c1_426_938 | 168 |
| 959 | 3300053077 | Ga0495601_0099317 | Ga0495601_0099317_531_1082 | 168 |
| 960 | 3300053078 | Ga0495612_0074765 | Ga0495612_0074765_656_1207 | 168 |
| 961 | 3300053080 | Ga0500635_0002566 | Ga0500635_0002566_1680_2216 | 168 |
| 962 | 3300053083 | Ga0495655_0227871 | Ga0495655_0227871_46_582 | 168 |
| 963 | 3300053084 | Ga0495595_0003401 | Ga0495595_0003401_2196_2732 | 168 |
| 964 | 3300053084 | Ga0495595_0022694 | Ga0495595_0022694_1282_1797 | 168 |
| 965 | 3300053085 | Ga0495619_0011847 | Ga0495619_0011847_2450_2986 | 168 |
| 966 | 3300053085 | Ga0495619_0037524 | Ga0495619_0037524_1376_1891 | 168 |
| 967 | 3300053085 | Ga0495619_0344012 | Ga0495619_0344012_421_957 | 168 |
| 968 | 3300053086 | Ga0500578_0094848 | Ga0500578_0094848_1157_1669 | 168 |
| 969 | 3300053087 | Ga0500643_034871 | Ga0500643_034871_506_1018 | 168 |
| 970 | 3300053090 | Ga0500646_0025692 | Ga0500646_0025692_161_673 | 168 |
| 971 | 3300053092 | Ga0500583_0146990 | Ga0500583_0146990_221_733 | 168 |
| 972 | 3300053094 | Ga0500566_0024402 | Ga0500566_0024402_181_693 | 168 |
| 973 | 3300053096 | Ga0500641_0034871 | Ga0500641_0034871_38_550 | 168 |
| 974 | 3300053098 | Ga0500650_0133385 | Ga0500650_0133385_356_868 | 168 |
| 975 | 3300053099 | Ga0500654_097892 | Ga0500654_097892_631_1143 | 168 |
| 976 | 3300053102 | Ga0500554_002814 | Ga0500554_002814_1038_1574 | 168 |
| 977 | 3300053108 | Ga0500562_057460 | Ga0500562_057460_89_601 | 168 |
| 978 | 3300053109 | Ga0500569_000323 | Ga0500569_000323_152_664 | 168 |
| 979 | 3300053119 | Ga0500595_002758 | Ga0500595_002758_1708_2220 | 168 |
| 980 | 3300053119 | Ga0500595_003563 | Ga0500595_003563_113_649 | 168 |
| 981 | 3300053119 | Ga0500595_134736 | Ga0500595_134736_167_679 | 168 |
| 982 | 3300053133 | Ga0500655_067473 | Ga0500655_067473_135_647 | 168 |
| 983 | 3300053139 | Ga0500568_0132400 | Ga0500568_0132400_328_864 | 168 |
| 984 | 3300053142 | Ga0500577_0021539 | Ga0500577_0021539_288_800 | 168 |
| 985 | 3300053142 | Ga0500577_0078843 | Ga0500577_0078843_573_1085 | 168 |
| 986 | 3300053146 | Ga0500588_0055913 | Ga0500588_0055913_56_568 | 168 |
| 987 | 3300053146 | Ga0500588_0246146 | Ga0500588_0246146_148_660 | 168 |
| 988 | 3300053147 | Ga0500589_013888 | Ga0500589_013888_1694_2206 | 168 |
| 989 | 3300053147 | Ga0500589_149998 | Ga0500589_149998_236_748 | 168 |
| 990 | 3300053150 | Ga0500603_002517 | Ga0500603_002517_2670_3206 | 168 |
| 991 | 3300053153 | Ga0500616_0074173 | Ga0500616_0074173_639_1184 | 168 |
| 992 | 3300053153 | Ga0500616_0084438 | Ga0500616_0084438_291_848 | 168 |
| 993 | 3300053153 | Ga0500616_0178677 | Ga0500616_0178677_110_667 | 168 |
| 994 | 3300053160 | Ga0500633_0039755 | Ga0500633_0039755_109_621 | 168 |
| 995 | 3300053161 | Ga0500634_0042288 | Ga0500634_0042288_463_975 | 168 |
| 996 | 3300053177 | Ga0500636_0026335 | Ga0500636_0026335_482_994 | 168 |
| 997 | 3300053177 | Ga0500636_0219900 | Ga0500636_0219900_419_937 | 168 |
| 998 | 3300053177 | Ga0500636_0446545 | Ga0500636_0446545_64_576 | 168 |
| 999 | 3300053178 | Ga0500637_0000600 | Ga0500637_0000600_6373_6885 | 168 |
| 1000 | 3300053178 | Ga0500637_0020687 | Ga0500637_0020687_2113_2649 | 168 |
| 1001 | 3300053730 | Ga0500645_020268 | Ga0500645_020268_1284_1796 | 168 |
| 1002 | 3300053730 | Ga0500645_020334 | Ga0500645_020334_480_992 | 168 |
| 1003 | 3300053730 | Ga0500645_084809 | Ga0500645_084809_55_588 | 168 |
| 1004 | 3300053731 | Ga0500609_000821 | Ga0500609_000821_695_1207 | 168 |
| 1005 | 3300055283 | Ga0500661_004937 | Ga0500661_004937_681_1193 | 168 |
| 1006 | iso_pu_bacteria | 2643221651 | 2644287387 | 168 |
| 1007 | iso_pu_bacteria | 2874604998 | 2874612526 | 168 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xg4-assembly1.cif.gz_A | x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim | 0.9636 | 3 | 166 |
| 7mym-assembly1.cif.gz_A | crystal structure of escherichia coli dihydrofolate reductase in complex with trimethoprim and nadph | 0.9613 | 3 | 165 |
| 4p66-assembly1.cif.gz_A | electrostatics of active site microenvironments of e. coli dhfr | 0.9601 | 3 | 166 |
| 4p68-assembly1.cif.gz_A | electrostatics of active site microenvironments for e. coli dhfr | 0.9574 | 3 | 166 |
| 5w3q-assembly1.cif.gz_A | l28f e.coli dhfr in complex with nadph | 0.9568 | 3 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4or7A00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9639 | 3 | 167 | 3.40.430.10 |
| 3fl9F00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9448 | 1 | 167 | 3.40.430.10 |
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.934 | 1 | 165 | 3.40.430.10 |
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9283 | 1 | 165 | 3.40.430.10 |
| 4or7A00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9241 | 3 | 167 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4LX80-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.9942 | 1 | 166 |
GO:0004146
GO:0005829 GO:0006730 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A059WM53-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.9924 | 53 | 167 |
GO:0004146
GO:0005829 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A2P7BHF9-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.9906 | 3 | 166 |
GO:0004146
GO:0005829 GO:0006730 GO:0016301 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A3S0DPS1-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.9905 | 7 | 167 |
GO:0004146
GO:0005829 GO:0006730 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A7S8C7J3-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.9897 | 1 | 166 |
GO:0004146
GO:0005829 GO:0006730 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar