F488052

General Info

Members Datasets Scaffolds Average Seq Length
1007 808 2014 268

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0015511|Ga0496111_0015511_3804_4757
Length 317
Sequence MATITMMVPTAPVTVMTMDMITATITMAATMLLRRSRERGAAMLDDFFIRALVAGIGVALTAGPLGCFVVWRRMAYFGDTMAHSALLGVALSLFFEVNLLLSVFGVAVLVSGLLLLLQRRQSLSADALLGILSHSALAIGLVLVAFMTWVRIDLIAFLFGDILAVTPSDIALIWGGGALVVLAMVFLWRPLIASTVSEDVAEAEGMRPAQAKLFFMLLMALVIAIAMKIVGIMLITSLLIIPAATARRFSASPEWMAVFASLIGALAVIGGLFGSLTYDTPSGPSIVVAALLLFIMSLVPAFGRNSAERAANKGVRG

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
53 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
54 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
55 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
56 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
57 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
58 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
59 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
91 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
93 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
97 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
104 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
105 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
106 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
107 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
108 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
112 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
115 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
116 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
117 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
118 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
188 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
199 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
202 2509276019 Ensifer aridi TW10 Isolate Nodule
203 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
204 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
205 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
206 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
207 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
208 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
209 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
210 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
211 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
212 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
213 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
214 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
215 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
216 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
217 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
218 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
219 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
220 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
221 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
222 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
223 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
224 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
225 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
226 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
227 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
228 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
229 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
230 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
231 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
232 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
233 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
234 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
235 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
236 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
237 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
238 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
239 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
240 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
241 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
242 2516143018 Ensifer sp. BR816 Isolate Nodule
243 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
244 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
245 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
246 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
247 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
248 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
249 2519899620 Rhizobium sp. Pop5 Isolate Nodule
250 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
251 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
252 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
253 2534681786 Brucella suis 92/29 Isolate Unclassified
254 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
255 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
256 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
257 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
258 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
259 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
260 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
261 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
262 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
263 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
264 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
265 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
266 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
267 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
268 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
269 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
270 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
271 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
272 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
273 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
274 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
275 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
276 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
277 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
278 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
279 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
280 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
281 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
282 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
283 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
284 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
285 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
286 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
287 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
288 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
289 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
290 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
291 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
292 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
293 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
294 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
295 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
296 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
297 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
298 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
299 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
300 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
301 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
302 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
303 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
304 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
305 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
306 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
307 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
308 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
309 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
310 2643221557 Ensifer sp. Root558 Isolate Unclassified
311 2643221558 Rhizobium sp. Root149 Isolate Unclassified
312 2643221568 Rhizobium sp. Root564 Isolate Unclassified
313 2643221580 Devosia sp. Root635 Isolate Unclassified
314 2643221582 Rhizobium sp. Root651 Isolate Unclassified
315 2643221591 Devosia sp. Root685 Isolate Unclassified
316 2643221599 Rhizobium sp. Root708 Isolate Unclassified
317 2643221607 Rhizobium sp. Root73 Isolate Unclassified
318 2643221610 Ensifer sp. Root74 Isolate Unclassified
319 2643221618 Ensifer sp. Root231 Isolate Unclassified
320 2643221626 Ensifer sp. Root31 Isolate Unclassified
321 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
322 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
323 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
324 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
325 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
326 2643221655 Ensifer sp. Root1252 Isolate Unclassified
327 2643221659 Ensifer sp. Root127 Isolate Unclassified
328 2643221668 Ensifer sp. Root423 Isolate Unclassified
329 2643221674 Devosia sp. Root436 Isolate Unclassified
330 2643221675 Ensifer sp. Root1298 Isolate Unclassified
331 2643221680 Ensifer sp. Root1312 Isolate Unclassified
332 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
333 2643221688 Rhizobium sp. Root482 Isolate Unclassified
334 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
335 2643221693 Rhizobium sp. Root491 Isolate Unclassified
336 2643221698 Ensifer sp. Root142 Isolate Unclassified
337 2643221712 Ensifer sp. Root258 Isolate Unclassified
338 2643221718 Rhizobium sp. Root268 Isolate Unclassified
339 2643221719 Rhizobium sp. Root274 Isolate Unclassified
340 2643221723 Ensifer sp. Root278 Isolate Unclassified
341 2643221726 Ensifer sp. Root954 Isolate Unclassified
342 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
343 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
344 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
345 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
346 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
347 2718217882 Rhizobium sp. N741 Isolate Nodule
348 2718217927 Rhizobium sp. N324 Isolate Nodule
349 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
350 2718218009 Rhizobium sp. N561 Isolate Nodule
351 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
352 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
353 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
354 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
355 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
356 2718218363 Rhizobium sp. N113 Isolate Nodule
357 2718218365 Rhizobium sp. N731 Isolate Nodule
358 2718218366 Rhizobium sp. N621 Isolate Nodule
359 2718218423 Rhizobium sp. N941 Isolate Nodule
360 2721755514 Rhizobium sp. N6212 Isolate Nodule
361 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
362 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
363 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
364 2721755809 Rhizobium sp. N541 Isolate Nodule
365 2721755810 Rhizobium sp. N871 Isolate Nodule
366 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
367 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
368 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
369 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
370 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
371 2728369365 Rhizobium sp. N1341 Isolate Nodule
372 2728369397 Rhizobium sp. N1314 Isolate Nodule
373 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
374 2738541293 Rhizobium sp. GV031 Isolate Unclassified
375 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
376 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
377 2751185800 Brucella pituitosa AA2 Isolate Unclassified
378 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
379 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
380 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
381 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
382 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
383 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
384 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
385 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
386 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
387 2791355256 Rhizobium sp. M10 Isolate Nodule
388 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
389 2791355260 Rhizobium sp. L9 Isolate Nodule
390 2791355261 Rhizobium sp. J15 Isolate Nodule
391 2791355262 Rhizobium sp. M1 Isolate Nodule
392 2791355263 Rhizobium chutanense C5 Isolate Nodule
393 2791355264 Rhizobium sp. S9 Isolate Nodule
394 2791355265 Rhizobium sp. H4 Isolate Nodule
395 2791355266 Rhizobium sp. L43 Isolate Nodule
396 2791355267 Rhizobium sp. L18 Isolate Nodule
397 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
398 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
399 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
400 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
401 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
402 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
403 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
404 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
405 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
406 2802429633 Rhizobium anhuiense J3 Isolate Nodule
407 2802429634 Rhizobium anhuiense S10 Isolate Nodule
408 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
409 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
410 2802429637 Rhizobium anhuiense C15 Isolate Nodule
411 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
412 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
413 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
414 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
415 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
416 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
417 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
418 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
419 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
420 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
421 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
422 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
423 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
424 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
425 2838048938 Rhizobium pisi 27/80 Isolate Nodule
426 2838061910 Rhizobium phaseoli L15 Isolate Nodule
427 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
428 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
429 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
430 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
431 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
432 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
433 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
434 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
435 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
436 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
437 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
438 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
439 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
440 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
441 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
442 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
443 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
444 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
445 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
446 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
447 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
448 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
449 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
450 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
451 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
452 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
453 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
454 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
455 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
456 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
457 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
458 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
459 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
460 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
461 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
462 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
463 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
464 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
465 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
466 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
467 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
468 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
469 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
470 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
471 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
472 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
473 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
474 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
475 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
476 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
477 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
478 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
479 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
480 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
481 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
482 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
483 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
484 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
485 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
486 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
487 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
488 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
489 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
490 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
491 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
492 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
493 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
494 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
495 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
496 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
497 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
498 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
499 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
500 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
501 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
502 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
503 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
504 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
505 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
506 2844163670 Ensifer sp. 1H6 Isolate Unclassified
507 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
508 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
509 2847085930 Erwinia persicina B64 Isolate Bulb
510 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
511 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
512 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
513 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
514 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
515 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
516 2854911287 Brucella lupini LUP21 Isolate Unclassified
517 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
518 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
519 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
520 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
521 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
522 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
523 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
524 2865014394 Pantoea sp. R-71966 Isolate Unclassified
525 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
526 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
527 2876601092 Pantoea endophytica 596 Isolate Unclassified
528 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
529 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
530 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
531 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
532 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
533 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
534 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
535 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
536 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
537 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
538 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
539 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
540 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
541 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
542 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
543 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
544 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
545 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
546 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
547 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
548 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
549 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
550 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
551 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
552 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
553 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
554 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
555 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
556 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
557 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
558 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
559 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
560 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
561 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
562 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
563 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
564 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
565 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
566 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
567 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
568 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
569 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
570 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
571 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
572 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
573 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
574 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
575 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
576 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
577 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
578 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
579 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
580 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
581 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
582 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
583 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
584 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
585 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
586 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
587 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
588 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
589 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
590 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
591 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
592 2932401849 Devosia sp. 2618 Isolate Rhizosphere
593 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
594 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
595 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
596 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
597 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
598 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
599 2933599457 Rhizobium phaseoli M3 Isolate Nodule
600 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
601 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
602 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
603 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
604 2936381700 Rhizobium chutanense C16 Isolate Unclassified
605 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
606 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
607 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
608 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
609 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
610 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
611 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
612 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
613 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
614 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
615 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
616 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
617 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
618 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
619 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
620 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
621 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
622 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
623 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
624 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
625 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
626 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
627 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
628 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
629 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
630 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
631 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
632 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
633 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
634 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
635 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
636 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
637 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
638 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
639 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
640 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
641 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
642 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
643 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
644 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
645 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
646 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
647 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
648 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
649 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
650 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
651 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
652 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
653 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
654 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
655 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
656 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
657 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
658 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
659 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
660 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
661 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
662 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
663 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
664 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
665 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
666 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
667 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
668 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
669 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
670 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
671 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
672 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
673 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
674 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
675 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
676 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
677 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
678 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
679 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
680 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
681 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
682 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
683 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
684 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
685 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
686 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
687 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
688 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
689 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
690 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
691 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
692 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
693 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
694 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
695 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
696 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
697 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
698 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
699 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
700 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
701 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
702 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
703 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
704 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
705 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
706 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
707 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
708 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
709 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
710 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
711 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
712 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
713 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
714 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
715 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
716 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
717 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
718 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
719 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
720 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
721 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
722 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
723 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
724 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
725 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
726 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
727 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
728 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
729 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
730 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
731 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
732 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
733 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
734 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
735 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
736 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
737 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
738 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
739 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
740 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
741 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
742 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
743 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
744 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
745 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
746 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
747 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
748 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
749 2996887358 Rhizobium sp. R711 Isolate Nodule
750 2996893221 Rhizobium sp. R635 Isolate Nodule
751 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
752 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
753 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
754 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
755 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
756 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
757 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
758 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
759 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
760 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
761 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
762 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
763 8005258706 Rhizobium sp. R693 Isolate Nodule
764 8005275841 Rhizobium sp. N4311 Isolate Nodule
765 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
766 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
767 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
768 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
769 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
770 8005321885 Rhizobium sp. R72 Isolate Nodule
771 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
772 8005382845 Rhizobium sp. R634 Isolate Nodule
773 8005395548 Rhizobium sp. R339 Isolate Nodule
774 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
775 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
776 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
777 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
778 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
779 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
780 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
781 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
782 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
783 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
784 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
785 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
786 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
787 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
788 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
789 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
790 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
791 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
792 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
793 8018176218 Rhizobium sp. N122 Isolate Nodule
794 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
795 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
796 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
797 8024501048 Rhizobium sp. H4 Isolate Nodule
798 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
799 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
800 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
801 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
802 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
803 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
804 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
805 8056382006 Rhizobium croatiense 13T Isolate Nodule
806 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
807 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
808 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.42
Metatranscriptomes 0.1
Isolates 60.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.7
Bulb 0.1
Endosphere 14.6
Nodule 42.9
Rhizoplane 1.99
Rhizosphere 19.66
Stem 0
Stem Tuber 0.4
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0015511 3300048914 Bacteria 5233
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25162J39368_1000209 3300002737 Bacteria 61889
5 JGI25162J39368_1000245 3300002737 Bacteria 54142
6 JGI25154J39366_1000011 3300002738 Bacteria 296007
7 JGI25158J39367_1000764 3300002739 Bacteria 6158
8 JGI25157J39369_1000030 3300002741 Bacteria 146112
9 JGI25152J39213_1000570 3300002773 Bacteria 20104
10 JGI25152J39213_1004071 3300002773 Bacteria 4746
11 JGI25152J39213_1011917 3300002773 Bacteria 1897
12 JGI25150J39212_1000326 3300002774 Bacteria 23479
13 JGI25150J39212_1005593 3300002774 Bacteria 2668
14 JGI25159J45721_1000078 3300002987 Bacteria 46708
15 JGI25159J45721_1000199 3300002987 Bacteria 27917
16 JGI25159J45721_1000530 3300002987 Bacteria 17359
17 JGI25151J46595_10000083 3300003187 Bacteria 130658
18 JGI25165J46597_1000302 3300003214 Bacteria 61889
19 JGI25165J46597_1000682 3300003214 Bacteria 27253
20 JGI25153J46596_10000377 3300003215 Bacteria 30499
21 JGI25153J46596_10005215 3300003215 Bacteria 6840
22 JGI25153J46596_10008879 3300003215 Bacteria 4746
23 rootH2_10150379 3300003320 Bacteria 1788
24 JGI25160J50197_1000087 3300003354 Bacteria 93379
25 JGI25160J50197_1000216 3300003354 Bacteria 46708
26 JGI25161J50226_1000066 3300003374 Bacteria 94505
27 JGI25161J50226_1000207 3300003374 Bacteria 38350
28 JGI25161J50226_1000412 3300003374 Bacteria 20844
29 Ga0055526_1000594 3300003771 Bacteria 28489
30 Ga0055526_1003679 3300003771 Bacteria 9591
31 Ga0055526_1028194 3300003771 Bacteria 1706
32 Ga0055524_1001754 3300003775 Bacteria 11976
33 Ga0055524_1001805 3300003775 Bacteria 11731
34 Ga0055524_1025058 3300003775 Bacteria 1875
35 Ga0055528_1000358 3300003790 Bacteria 37118
36 Ga0055528_1019378 3300003790 Bacteria 2257
37 Ga0055540_1012253 3300003792 Bacteria 2705
38 Ga0058692_1000085 3300003856 Bacteria 65543
39 Ga0058692_1000167 3300003856 Bacteria 40623
40 Ga0058692_1000350 3300003856 Bacteria 22460
41 Ga0058692_1006447 3300003856 Bacteria 3219
42 Ga0055543_1000053 3300004625 Bacteria 104589
43 Ga0055543_1000068 3300004625 Bacteria 94795
44 Ga0055543_1000301 3300004625 Bacteria 35189
45 Ga0055543_1001883 3300004625 Bacteria 7624
46 Ga0065165_1000717 3300005262 Bacteria 46746
47 Ga0065165_1000839 3300005262 Bacteria 40355
48 Ga0065165_1005533 3300005262 Bacteria 7050
49 Ga0070668_100205064 3300005347 Bacteria 1620
50 Ga0070669_100215989 3300005353 Bacteria 1515
51 Ga0070671_100084132 3300005355 Bacteria 2661
52 Ga0070667_100245343 3300005367 Bacteria 1600
53 Ga0070665_100543480 3300005548 Bacteria 1174
54 Ga0068854_100046155 3300005578 Bacteria 3101
55 Ga0068856_100035514 3300005614 Bacteria 4886
56 Ga0068851_10061721 3300005834 Bacteria 1922
57 Ga0075365_10000404 3300006038 Bacteria 15855
58 Ga0075365_10040694 3300006038 Bacteria 3032
59 Ga0075364_10224605 3300006051 Bacteria 1275
60 Ga0075362_10094396 3300006177 Bacteria 1392
61 Ga0075367_10006190 3300006178 Bacteria 6026
62 Ga0075367_10014267 3300006178 Bacteria 4297
63 Ga0075367_10130254 3300006178 Bacteria 1554
64 Ga0075367_10277944 3300006178 Bacteria 1052
65 Ga0075369_10000812 3300006186 Bacteria 10265
66 Ga0075369_10014994 3300006186 Bacteria 3103
67 Ga0079104_1000610 3300006946 Bacteria 35237
68 Ga0079104_1013531 3300006946 Bacteria 2509
69 Ga0099826_10000091 3300006948 Bacteria 44824
70 Ga0099826_10012274 3300006948 Bacteria 6455
71 Ga0105250_10003428 3300009092 Bacteria 7517
72 Ga0105240_10000005 3300009093 Bacteria 702630
73 Ga0105243_10023405 3300009148 Bacteria 4704
74 Ga0105237_10000766 3300009545 Bacteria 44044
75 Ga0123342_1012633 3300009766 Bacteria 8735
76 Ga0105239_10001069 3300010375 Bacteria 38061
77 Ga0105246_10009831 3300011119 Bacteria 5898
78 Ga0105246_10017249 3300011119 Bacteria 4587
79 Ga0157373_10000137 3300013100 Bacteria 57817
80 Ga0157373_10007245 3300013100 Bacteria 8273
81 Ga0157371_10000015 3300013102 Bacteria 339838
82 Ga0157371_10000810 3300013102 Bacteria 35896
83 Ga0157371_10016604 3300013102 Bacteria 5489
84 Ga0157370_10000046 3300013104 Bacteria 125612
85 Ga0157370_10000402 3300013104 Bacteria 54601
86 Ga0171463_1003 3300013249 Bacteria 695693
87 Ga0163162_10259195 3300013306 Bacteria 1871
88 Ga0157372_10029974 3300013307 Bacteria 5946
89 Ga0183363_1047 3300015690 Bacteria 39413
90 Ga0214544_1001682 3300021320 Bacteria 46508
91 Ga0214542_1001614 3300021321 Bacteria 46380
92 Ga0214543_1000078 3300021327 Bacteria 119775
93 Ga0214543_1001395 3300021327 Bacteria 46435
94 Ga0228711_1000016 3300022739 Bacteria 126351
95 Ga0228710_1000013 3300022740 Bacteria 145976
96 Ga0209435_100012 3300025206 Bacteria 401621
97 Ga0209760_101106 3300025207 Bacteria 3086
98 Ga0209436_100085 3300025208 Bacteria 46798
99 Ga0209436_103034 3300025208 Bacteria 4648
100 Ga0209436_105400 3300025208 Bacteria 2950
101 Ga0209437_100047 3300025233 Bacteria 405163
102 Ga0209437_100165 3300025233 Bacteria 145009
103 Ga0207425_1000024 3300025245 Bacteria 328978
104 Ga0207425_1001564 3300025245 Bacteria 9306
105 Ga0209646_1000026 3300025246 Bacteria 401621
106 Ga0209026_1000014 3300025250 Bacteria 401621
107 Ga0209677_100656 3300025253 Bacteria 18202
108 Ga0209759_1000012 3300025256 Bacteria 401621
109 Ga0209129_1000069 3300025258 Bacteria 212790
110 Ga0209129_1000184 3300025258 Bacteria 87102
111 Ga0209129_1002960 3300025258 Bacteria 7755
112 Ga0209129_1005886 3300025258 Bacteria 4162
113 Ga0209233_1000048 3300025261 Bacteria 453669
114 Ga0209233_1000069 3300025261 Bacteria 367639
115 Ga0209233_1000195 3300025261 Bacteria 125863
116 Ga0209565_1020981 3300025263 Bacteria 1371
117 Ga0209455_1014550 3300025272 Bacteria 1775
118 Ga0209673_1000010 3300025273 Bacteria 596656
119 Ga0209673_1003537 3300025273 Bacteria 9130
120 Ga0209673_1008196 3300025273 Bacteria 4689
121 Ga0209130_1000021 3300025284 Bacteria 374278
122 Ga0209130_1000029 3300025284 Bacteria 323399
123 Ga0209130_1000081 3300025284 Bacteria 166440
124 Ga0209130_1024642 3300025284 Bacteria 1310
125 Ga0209676_1005409 3300025292 Bacteria 6685
126 Ga0209676_1007095 3300025292 Bacteria 5362
127 Ga0209025_1000050 3300025294 Bacteria 331531
128 Ga0209025_1000094 3300025294 Bacteria 241080
129 Ga0209025_1000119 3300025294 Bacteria 210606
130 Ga0209025_1000959 3300025294 Bacteria 43491
131 Ga0209025_1001225 3300025294 Bacteria 35824
132 Ga0209025_1004412 3300025294 Bacteria 12242
133 Ga0209025_1021372 3300025294 Bacteria 3489
134 Ga0209025_1025145 3300025294 Bacteria 3042
135 Ga0209025_1030438 3300025294 Bacteria 2584
136 Ga0209025_1046039 3300025294 Bacteria 1800
137 Ga0209564_1000260 3300025295 Bacteria 112444
138 Ga0209564_1000278 3300025295 Bacteria 105405
139 Ga0209758_1000083 3300025297 Bacteria 257283
140 Ga0209758_1000418 3300025297 Bacteria 72150
141 Ga0209758_1001270 3300025297 Bacteria 31259
142 Ga0209758_1001756 3300025297 Bacteria 24054
143 Ga0209758_1028658 3300025297 Bacteria 2348
144 Ga0209050_1009223 3300025298 Bacteria 5091
145 Ga0209050_1030063 3300025298 Bacteria 1721
146 Ga0209256_1000042 3300025299 Bacteria 341821
147 Ga0209256_1001127 3300025299 Bacteria 30457
148 Ga0209256_1003234 3300025299 Bacteria 11741
149 Ga0209256_1003768 3300025299 Bacteria 10221
150 Ga0209256_1016068 3300025299 Bacteria 2575
151 Ga0207426_1000008 3300025302 Bacteria 848730
152 Ga0207426_1000010 3300025302 Bacteria 796003
153 Ga0207426_1000074 3300025302 Bacteria 323399
154 Ga0207426_1000952 3300025302 Bacteria 28571
155 Ga0209051_1001051 3300025303 Bacteria 25929
156 Ga0209051_1038275 3300025303 Bacteria 1747
157 Ga0209051_1059233 3300025303 Bacteria 1215
158 Ga0209257_1006328 3300025304 Bacteria 7699
159 Ga0209257_1007766 3300025304 Bacteria 6371
160 Ga0209257_1024647 3300025304 Bacteria 2077
161 Ga0209257_1036739 3300025304 Bacteria 1501
162 Ga0207696_1000062 3300025711 Bacteria 239603
163 Ga0207655_1000007 3300025728 Bacteria 773492
164 Ga0207655_1022807 3300025728 Bacteria 3122
165 Ga0207695_10000011 3300025913 Bacteria 910221
166 Ga0207671_10000241 3300025914 Bacteria 81847
167 Ga0207681_10140175 3300025923 Bacteria 1800
168 Ga0207668_10128587 3300025972 Bacteria 1931
169 Ga0207640_10027070 3300025981 Bacteria 3491
170 Ga0207702_10074236 3300026078 Bacteria 2935
171 Ga0209281_1000036 3300027111 Bacteria 369415
172 Ga0209281_1000047 3300027111 Bacteria 326514
173 Ga0209281_1000221 3300027111 Bacteria 122380
174 Ga0209371_1000005 3300027312 Bacteria 1061740
175 Ga0209371_1000021 3300027312 Bacteria 555864
176 Ga0209371_1000039 3300027312 Bacteria 350081
177 Ga0209371_1000199 3300027312 Bacteria 87337
178 Ga0209371_1000229 3300027312 Bacteria 71827
179 Ga0209371_1002365 3300027312 Bacteria 10675
180 Ga0209371_1004936 3300027312 Bacteria 5543
181 Ga0209282_1000041 3300027666 Bacteria 122268
182 Ga0209282_1000251 3300027666 Bacteria 26915
183 Ga0209282_1054726 3300027666 Bacteria 2262
184 Ga0209813_10033758 3300027866 Bacteria 1523
185 Ga0268266_10197077 3300028379 Bacteria 1842
186 Ga0268266_10397157 3300028379 Bacteria 1303
187 Ga0307515_10000023 3300028794 Bacteria 400846
188 Ga0307515_10013391 3300028794 Bacteria 15338
189 Ga0307515_10084680 3300028794 Bacteria 4068
190 Ga0268256_1000006 3300030500 Bacteria 1063991
191 Ga0268256_1000020 3300030500 Bacteria 557873
192 Ga0268256_1000033 3300030500 Bacteria 420973
193 Ga0268256_1000618 3300030500 Bacteria 27786
194 Ga0268256_1001050 3300030500 Bacteria 18470
195 Ga0268256_1003171 3300030500 Bacteria 7645
196 Ga0268256_1004176 3300030500 Bacteria 6112
197 Ga0316181_1097185 3300030744 Bacteria 1108
198 Ga0307408_100121756 3300031548 Bacteria 2022
199 Ga0307412_10029449 3300031911 Bacteria 3446
200 Ga0307412_10064336 3300031911 Bacteria 2478
201 Ga0307412_10179015 3300031911 Bacteria 1593
202 Ga0315914_1005042 3300031967 Bacteria 19465
203 Ga0307409_100219905 3300031995 Bacteria 1714
204 Ga0307416_100250920 3300032002 Bacteria 1722
205 Ga0315913_1003257 3300033430 Bacteria 19465
206 Ga0315915_1000017 3300033464 Bacteria 148111
207 Ga0400483_079876 3300039062 Bacteria 8635
208 Ga0400483_172620 3300039062 Bacteria 11957
209 Ga0439438_004464 3300041405 Bacteria 5359
210 Ga0439439_0052844 3300041406 Bacteria 1068
211 Ga0439447_002812 3300041407 Bacteria 6266
212 Ga0439465_0003881 3300041413 Bacteria 4879
213 Ga0439465_0011462 3300041413 Bacteria 2782
214 Ga0451791_1542990 3300041451 Bacteria 1143
215 Ga0451833_0387060 3300041491 Bacteria 1178
216 Ga0451835_0183697 3300041492 Bacteria 1002
217 Ga0451835_0197663 3300041492 Bacteria 1555
218 Ga0451837_0688979 3300041494 Bacteria 1760
219 Ga0451839_0261576 3300041496 Bacteria 5053
220 Ga0451841_0575577 3300041498 Bacteria 2710
221 Ga0451846_11831 3300041502 Bacteria 1770
222 Ga0451847_0545570 3300041503 Bacteria 2374
223 Ga0451851_0185573 3300041507 Bacteria 3658
224 Ga0451843_0557105 3300041509 Bacteria 1996
225 Ga0439449_0010911 3300042007 Bacteria 3428
226 Ga0439449_0015007 3300042007 Bacteria 2911
227 Ga0450908_008115 3300042184 Bacteria 1970
228 Ga0466968_0099450 3300044735 Bacteria 1297
229 Ga0466970_0000517 3300044765 Bacteria 19001
230 Ga0466970_0197868 3300044765 Bacteria 1118
231 Ga0466958_0025411 3300045836 Bacteria 3493
232 Ga0495617_007878 3300046452 Bacteria 3685
233 Ga0495591_000007 3300046458 Bacteria 366385
234 Ga0495591_000318 3300046458 Bacteria 43617
235 Ga0495650_0000026 3300046471 Bacteria 476029
236 Ga0495605_0015250 3300046474 Bacteria 4185
237 Ga0495605_0042953 3300046474 Bacteria 2243
238 Ga0495605_0162028 3300046474 Bacteria 992
239 Ga0495585_0019158 3300046492 Bacteria 3949
240 Ga0495585_0019219 3300046492 Bacteria 3942
241 Ga0495607_0014568 3300046501 Bacteria 5113
242 Ga0495607_0066247 3300046501 Bacteria 2033
243 Ga0495606_0001613 3300046507 Bacteria 29410
244 Ga0495606_0012820 3300046507 Bacteria 6679
245 Ga0495606_0108765 3300046507 Bacteria 1675
246 Ga0495610_0027460 3300046512 Bacteria 3023
247 Ga0495616_0051898 3300046513 Bacteria 2043
248 Ga0495631_0005659 3300046518 Bacteria 6519
249 Ga0495631_0039188 3300046518 Bacteria 2104
250 Ga0495632_0016479 3300046519 Bacteria 4109
251 Ga0495643_0039324 3300046522 Bacteria 2587
252 Ga0495644_0001680 3300046523 Bacteria 8985
253 Ga0495648_0009418 3300046524 Bacteria 7577
254 Ga0495654_0000007 3300046530 Bacteria 403529
255 Ga0495654_0000069 3300046530 Bacteria 120853
256 Ga0495633_0015993 3300046558 Bacteria 3881
257 Ga0495633_0082790 3300046558 Bacteria 1493
258 Ga0495633_0147035 3300046558 Bacteria 1089
259 Ga0495625_0047417 3300046660 Bacteria 3098
260 Ga0495625_0202915 3300046660 Bacteria 1307
261 Ga0495671_0022125 3300046692 Bacteria 3333
262 Ga0495649_0019733 3300046694 Bacteria 3785
263 Ga0495589_0003279 3300046794 Bacteria 8788
264 Ga0495660_0000016 3300046810 Bacteria 321859
265 Ga0495660_0029052 3300046810 Bacteria 3121
266 Ga0495672_0000001 3300047320 Bacteria 1458820
267 Ga0495673_0000352 3300047469 Bacteria 57266
268 Ga0495681_0005741 3300047470 Bacteria 8255
269 Ga0495686_0000796 3300047472 Bacteria 41000
270 Ga0495686_0023787 3300047472 Bacteria 4033
271 Ga0496100_0017847 3300048903 Bacteria 4197
272 Ga0496100_0080448 3300048903 Bacteria 2199
273 Ga0496101_0000093 3300048904 Bacteria 95734
274 Ga0496102_0010757 3300048905 Bacteria 7880
275 Ga0496104_0200879 3300048907 Bacteria 1905
276 Ga0496110_0370165 3300048913 Bacteria 1306
277 Ga0496113_0076669 3300048916 Bacteria 2554
278 Ga0496116_0000086 3300048919 Bacteria 217597
279 Ga0496116_0005431 3300048919 Bacteria 11825
280 Ga0496116_0006630 3300048919 Bacteria 10457
281 Ga0496116_0057331 3300048919 Bacteria 2547
282 Ga0496117_0000002 3300048920 Bacteria 2483758
283 Ga0496117_0000353 3300048920 Bacteria 81061
284 Ga0496117_0006313 3300048920 Bacteria 12058
285 Ga0496117_0071508 3300048920 Bacteria 2324
286 Ga0496118_0000204 3300048921 Bacteria 104260
287 Ga0496118_0000355 3300048921 Bacteria 77500
288 Ga0496118_0022010 3300048921 Bacteria 5590
289 Ga0496119_0003501 3300048922 Bacteria 16239
290 Ga0496119_0004804 3300048922 Bacteria 13257
291 Ga0496119_0014717 3300048922 Bacteria 6095
292 Ga0496119_0035312 3300048922 Bacteria 3277
293 Ga0496119_0087118 3300048922 Bacteria 1783
294 Ga0496119_0133318 3300048922 Bacteria 1351
295 Ga0496120_0000002 3300048923 Bacteria 547999
296 Ga0496120_0000116 3300048923 Bacteria 135302
297 Ga0496120_0000917 3300048923 Bacteria 41032
298 Ga0496120_0000941 3300048923 Bacteria 40051
299 Ga0496120_0002795 3300048923 Bacteria 16912
300 Ga0496120_0009779 3300048923 Bacteria 6762
301 Ga0496121_0000378 3300048924 Bacteria 91381
302 Ga0496121_0009399 3300048924 Bacteria 11245
303 Ga0496121_0043020 3300048924 Bacteria 3918
304 Ga0496121_0071342 3300048924 Bacteria 2794
305 Ga0496122_0000001 3300048925 Bacteria 1827766
306 Ga0496122_0000369 3300048925 Bacteria 96672
307 Ga0496122_0000525 3300048925 Bacteria 79294
308 Ga0496122_0003261 3300048925 Bacteria 21531
309 Ga0496122_0004665 3300048925 Bacteria 16828
310 Ga0496122_0008819 3300048925 Bacteria 10769
311 Ga0496122_0012544 3300048925 Bacteria 8418
312 Ga0496122_0024409 3300048925 Bacteria 5291
313 Ga0496122_0032026 3300048925 Bacteria 4358
314 Ga0496122_0072484 3300048925 Bacteria 2448
315 Ga0496122_0243607 3300048925 Bacteria 1011
316 Ga0496123_0000001 3300048926 Bacteria 1831497
317 Ga0496123_0000054 3300048926 Bacteria 234046
318 Ga0496123_0001014 3300048926 Bacteria 42878
319 Ga0496123_0002174 3300048926 Bacteria 25015
320 Ga0496123_0002482 3300048926 Bacteria 22770
321 Ga0496123_0003243 3300048926 Bacteria 18515
322 Ga0496124_0000357 3300048927 Bacteria 83170
323 Ga0496124_0001936 3300048927 Bacteria 28381
324 Ga0496124_0006121 3300048927 Bacteria 13215
325 Ga0496124_0010848 3300048927 Bacteria 9175
326 Ga0496124_0014592 3300048927 Bacteria 7589
327 Ga0496124_0049824 3300048927 Bacteria 3571
328 Ga0496124_0065627 3300048927 Bacteria 3025
329 Ga0496124_0075919 3300048927 Bacteria 2776
330 Ga0496124_0324998 3300048927 Bacteria 1099
331 Ga0496125_0000282 3300048928 Bacteria 101380
332 Ga0496125_0002081 3300048928 Bacteria 26974
333 Ga0496125_0011299 3300048928 Bacteria 8948
334 Ga0496125_0024477 3300048928 Bacteria 5551
335 Ga0496125_0028386 3300048928 Bacteria 5055
336 Ga0496125_0041019 3300048928 Bacteria 3962
337 Ga0496126_0000703 3300048929 Bacteria 61100
338 Ga0496126_0001019 3300048929 Bacteria 47578
339 Ga0496126_0041836 3300048929 Bacteria 4237
340 Ga0496126_0061193 3300048929 Bacteria 3383
341 Ga0496126_0070749 3300048929 Bacteria 3107
342 Ga0496126_0189716 3300048929 Bacteria 1742
343 Ga0496126_0255942 3300048929 Bacteria 1457
344 Ga0495678_001115 3300049459 Bacteria 22363
345 Ga0495682_0000001 3300049460 Bacteria 1559116
346 Ga0501032_0175424 3300049569 Bacteria 1404
347 Ga0501033_0000167 3300049570 Bacteria 63051
348 Ga0501033_0058254 3300049570 Bacteria 2854
349 Ga0501034_0002538 3300049571 Bacteria 21830
350 Ga0501034_0427279 3300049571 Bacteria 1245
351 Ga0501037_0088749 3300049573 Bacteria 2238
352 Ga0501037_0128592 3300049573 Bacteria 1817
353 Ga0501043_0027267 3300049579 Bacteria 4485
354 Ga0501070_0211017 3300049586 Bacteria 1594
355 Ga0501083_0092066 3300049744 Bacteria 2001
356 Ga0501280_000582 3300049776 Bacteria 8435
357 Ga0501035_0006797 3300049822 Bacteria 10686
358 Ga0501035_0195416 3300049822 Bacteria 1738
359 Ga0501044_0091936 3300049823 Bacteria 3060
360 Ga0501044_0263690 3300049823 Bacteria 1661
361 Ga0501044_0280231 3300049823 Bacteria 1601
362 Ga0501044_0355027 3300049823 Bacteria 1385
363 nmdc:mga03683_2318_c1 3300050489 Bacteria 5888
364 nmdc:mga03683_34891_c1 3300050489 Bacteria 2037
365 nmdc:mga03n38_1786_c1 3300050490 Bacteria 6376
366 nmdc:mga00v17_219758_c1 3300050491 Bacteria 1230
367 nmdc:mga00v17_264213_c1 3300050491 Bacteria 1116
368 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
369 nmdc:mga0yw44_33191_c1 3300050492 Bacteria 3014
370 nmdc:mga0yw44_72132_c1 3300050492 Bacteria 2146
371 nmdc:mga06z11_55161_c1 3300050494 Bacteria 2051
372 nmdc:mga06z11_817_c1 3300050494 Bacteria 11396
373 nmdc:mga04h51_23321_c1 3300050495 Bacteria 1883
374 nmdc:mga07m45_161522_c1 3300050496 Bacteria 1301
375 nmdc:mga07m45_176094_c1 3300050496 Bacteria 1244
376 nmdc:mga07m45_928_c1 3300050496 Bacteria 12810
377 nmdc:mga0sz30_12802_c1 3300050516 Bacteria 3269
378 nmdc:mga0sz30_215_c2 3300050516 Bacteria 16156
379 nmdc:mga0sz30_708_c1 3300050516 Bacteria 12251
380 Ga0500560_006454 3300053107 Bacteria 2685
381 Ga0500569_018613 3300053109 Bacteria 1796
382 Ga0500594_0016193 3300053118 Bacteria 1809
383 Ga0500618_000313 3300053125 Bacteria 35843
384 Ga0500618_000604 3300053125 Bacteria 22060
385 Ga0500618_012244 3300053125 Bacteria 2249
386 Ga0500621_000002 3300053126 Bacteria 849473
387 Ga0500658_0000945 3300053134 Bacteria 11858
388 Ga0500561_0000246 3300053137 Bacteria 9524
389 Ga0500568_0001517 3300053139 Bacteria 14797
390 Ga0500573_0000259 3300053140 Bacteria 22228
391 Ga0500616_0000301 3300053153 Bacteria 71758
392 Ga0500616_0004349 3300053153 Bacteria 10137
393 Ga0500616_0019956 3300053153 Bacteria 3770
394 Ga0500622_0001146 3300053156 Bacteria 22058
395 Ga0500627_0063175 3300053158 Bacteria 1632
396 Ga0500634_0079358 3300053161 Bacteria 1696
397 Ga0500636_0000153 3300053177 Bacteria 35853
398 Ga0500636_0001102 3300053177 Bacteria 14459
399 2509111387 2508501122 Bacteria 6292184
400 2509375674 2509276019 Bacteria 6802256
401 2509392200 2509276021 Bacteria 7634384
402 2509446848 2509276033 Bacteria 7180565
403 2510133800 2510065019 Bacteria 6903379
404 2510303300 2510065057 Bacteria 6649661
405 2510841077 2510461069 Bacteria 5505000
406 2510895229 2510461076 Bacteria 8618824
407 2511135221 2510917022 Bacteria 6504556
408 2511171678 2510917026 Bacteria 7046020
409 2511181650 2510917028 Bacteria 6185411
410 2511194381 2510917030 Bacteria 7460662
411 2511382934 2511231025 Bacteria 5324661
412 2511435065 2511231035 Bacteria 5341610
413 2511501959 2511231052 Bacteria 6974333
414 2512038281 2511231221 Bacteria 6846400
415 2512533330 2512047086 Bacteria 6850303
416 2512971115 2512875026 Bacteria 6861065
417 2513574159 2513237084 Bacteria 7231967
418 2513576805 2513237085 Bacteria 7695351
419 2513584743 2513237086 Bacteria 7265287
420 2513594686 2513237088 Bacteria 6927906
421 2513604528 2513237089 Bacteria 6553624
422 2513615451 2513237091 Bacteria 6900273
423 2513629549 2513237093 Bacteria 7545552
424 2513708190 2513237103 Bacteria 7647401
425 2513864754 2513237138 Bacteria 7368160
426 2513881239 2513237140 Bacteria 7076289
427 2513902371 2513237143 Bacteria 6664116
428 2513914100 2513237144 Bacteria 7530820
429 2513926077 2513237146 Bacteria 7166346
430 2513984613 2513237156 Bacteria 6402557
431 2513997076 2513237159 Bacteria 6810126
432 2514007581 2513237160 Bacteria 6650282
433 2514020151 2513237162 Bacteria 7468464
434 2515112846 2515075009 Bacteria 7288508
435 2515608749 2515154107 Bacteria 6795637
436 2515636467 2515154113 Bacteria 7807172
437 2515640817 2515154114 Bacteria 7848616
438 2515655499 2515154116 Bacteria 7552979
439 2515739343 2515154134 Bacteria 7220242
440 2516209680 2516143018 Bacteria 6951533
441 2516893254 2516653046 Bacteria 6989037
442 2517036553 2516653077 Bacteria 7555578
443 2517076923 2516653085 Bacteria 7346596
444 2517095685 2517093000 Bacteria 7412387
445 2517407249 2517287029 Bacteria 6905599
446 2517570001 2517487022 Bacteria 7227575
447 2520381517 2519899620 Bacteria 6499161
448 2524448844 2524023207 Bacteria 6813453
449 2524460169 2524023209 Bacteria 6679728
450 2530646157 2529292951 Bacteria 6916614
451 2535485924 2534681786 Bacteria 3308809
452 2535516599 2534681796 Bacteria 7146037
453 2537877728 2537561587 Bacteria 5425293
454 2551674933 2551306084 Bacteria 8942552
455 2551680187 2551306084 Bacteria 8942552
456 2551684836 2551306085 Bacteria 7347181
457 2551695934 2551306086 Bacteria 6843938
458 2551704472 2551306087 Bacteria 7351905
459 2551711463 2551306089 Bacteria 7162724
460 2551720832 2551306090 Bacteria 7953713
461 2551728684 2551306091 Bacteria 7086830
462 2551735015 2551306092 Bacteria 6992595
463 2551739435 2551306093 Bacteria 7064773
464 2554247610 2554235003 Bacteria 5877155
465 2558867990 2558860100 Bacteria 8458965
466 2559294743 2558860242 Bacteria 5568029
467 2561466428 2558860983 Bacteria 4133860
468 2566038038 2565956521 Bacteria 4468993
469 2585166120 2582581283 Bacteria 6030556
470 2585200279 2582581294 Bacteria 6626667
471 2585222622 2582581298 Bacteria 7315509
472 2585229901 2582581299 Bacteria 6518058
473 2585254865 2582581304 Bacteria 5831370
474 2585267675 2582581306 Bacteria 6450535
475 2585270958 2582581307 Bacteria 6597605
476 2585277307 2582581308 Bacteria 7413247
477 2585323521 2582581315 Bacteria 7318924
478 2585331656 2582581316 Bacteria 7774528
479 2585386734 2582581865 Bacteria 6644329
480 2585393038 2582581866 Bacteria 6859583
481 2585402116 2582581867 Bacteria 7184437
482 2585527301 2585427526 Bacteria 7258840
483 2585533958 2585427527 Bacteria 7273426
484 2585538038 2585427528 Bacteria 6842387
485 2585545205 2585427529 Bacteria 7395659
486 2585552191 2585427530 Bacteria 7383882
487 2585558682 2585427531 Bacteria 6992870
488 2585821901 2585427590 Bacteria 6824633
489 2585835986 2585427593 Bacteria 7141551
490 2585846824 2585427594 Bacteria 6180594
491 2585898047 2585427608 Bacteria 6544331
492 2585904348 2585427609 Bacteria 6667127
493 2585996018 2585427633 Bacteria 6413184
494 2586000622 2585427634 Bacteria 6455027
495 2587980535 2585428125 Bacteria 6662905
496 2599331571 2599185156 Bacteria 5403036
497 2599417550 2599185170 Bacteria 7295545
498 2599604007 2599185210 Bacteria 5624189
499 2599720972 2599185236 Bacteria 6875203
500 2600193102 2599185352 Bacteria 7228948
501 2600375710 2600254933 Bacteria 4750527
502 2601608265 2600255279 Bacteria 5605316
503 2601745039 2600255308 Bacteria 5611129
504 2608669758 2608642108 Bacteria 4104624
505 2616293520 2615840624 Bacteria 6557588
506 2616308686 2615840626 Bacteria 7921970
507 2616557010 2615840698 Bacteria 7319877
508 2617385782 2617270742 Bacteria 6808054
509 2643803601 2643221557 Bacteria 7184309
510 2643811649 2643221558 Bacteria 5460675
511 2643857660 2643221568 Bacteria 5187270
512 2643909757 2643221580 Bacteria 3816678
513 2643919230 2643221582 Bacteria 5804683
514 2643964498 2643221591 Bacteria 4397626
515 2644003868 2643221599 Bacteria 6292121
516 2644050748 2643221607 Bacteria 6314006
517 2644067569 2643221610 Bacteria 7480339
518 2644107716 2643221618 Bacteria 7717186
519 2644148613 2643221626 Bacteria 8069654
520 2644192607 2643221634 Bacteria 6705461
521 2644205222 2643221636 Bacteria 6583769
522 2644210235 2643221637 Bacteria 5345260
523 2644239675 2643221643 Bacteria 5749658
524 2644300354 2643221653 Bacteria 4569637
525 2644309110 2643221655 Bacteria 7722067
526 2644332937 2643221659 Bacteria 7890716
527 2644375248 2643221668 Bacteria 7306521
528 2644413558 2643221674 Bacteria 3919126
529 2644418622 2643221675 Bacteria 7473456
530 2644451989 2643221680 Bacteria 7473610
531 2644483666 2643221686 Bacteria 6310811
532 2644491791 2643221688 Bacteria 5260751
533 2644501337 2643221689 Bacteria 6042950
534 2644522136 2643221693 Bacteria 5513853
535 2644545891 2643221698 Bacteria 7756764
536 2644615052 2643221712 Bacteria 7729434
537 2644653787 2643221718 Bacteria 5345506
538 2644658578 2643221719 Bacteria 4568197
539 2644676588 2643221723 Bacteria 7095460
540 2644690751 2643221726 Bacteria 7455827
541 2650896422 2648501693 Bacteria 5069560
542 2657681176 2657244999 Bacteria 5946535
543 2671111617 2667528174 Bacteria 6435400
544 2686353702 2684622997 Bacteria 4624240
545 2692315858 2690316117 Bacteria 6800650
546 2719181656 2718217882 Bacteria 6556348
547 2719386189 2718217927 Bacteria 6972593
548 2719665997 2718217997 Bacteria 6740740
549 2719732320 2718218009 Bacteria 6478651
550 2720492417 2718218199 Bacteria 6740745
551 2720613772 2718218232 Bacteria 6720332
552 2720620560 2718218233 Bacteria 6662049
553 2720631985 2718218235 Bacteria 6630699
554 2720775713 2718218269 Bacteria 6906114
555 2721147748 2718218363 Bacteria 6524337
556 2721159196 2718218365 Bacteria 6274507
557 2721164583 2718218366 Bacteria 6425255
558 2721399971 2718218423 Bacteria 6438183
559 2722840753 2721755514 Bacteria 6424414
560 2723027320 2721755556 Bacteria 6745503
561 2723560939 2721755684 Bacteria 6859907
562 2723567532 2721755685 Bacteria 6704835
563 2724038784 2721755809 Bacteria 6438790
564 2724045076 2721755810 Bacteria 6479005
565 2724090320 2721755819 Bacteria 6906405
566 2724104797 2721755822 Bacteria 6726041
567 2724110598 2721755823 Bacteria 6752556
568 2725952708 2724679232 Bacteria 7646494
569 2730108256 2728369352 Bacteria 6745171
570 2730164891 2728369365 Bacteria 6555560
571 2730298828 2728369397 Bacteria 6274511
572 2738714046 2738541276 Bacteria 4690596
573 2738804214 2738541293 Bacteria 7065685
574 2738945435 2738541317 Bacteria 5340176
575 2739032695 2738541333 Bacteria 7106503
576 2753357176 2751185800 Bacteria 5467370
577 2753461852 2751185821 Bacteria 6189929
578 2757571228 2757320392 Bacteria 3737298
579 2758639582 2758568016 Bacteria 5645291
580 2766065722 2765235942 Bacteria 7445910
581 2778174118 2775507266 Bacteria 7392367
582 2792581774 2791355082 Bacteria 5973319
583 2792620157 2791355091 Bacteria 6135441
584 2792626423 2791355092 Bacteria 6248105
585 2792639371 2791355094 Bacteria 7011481
586 2793298714 2791355256 Bacteria 6798008
587 2793314684 2791355259 Bacteria 7254731
588 2793320520 2791355260 Bacteria 6598818
589 2793330440 2791355261 Bacteria 6661293
590 2793338337 2791355262 Bacteria 6774204
591 2793344286 2791355263 Bacteria 6872478
592 2793348728 2791355264 Bacteria 6429314
593 2793351981 2791355265 Bacteria 6539969
594 2793363844 2791355266 Bacteria 7116587
595 2793370334 2791355267 Bacteria 7222458
596 2802719496 2802428858 Bacteria 6636079
597 2802726911 2802428859 Bacteria 6667919
598 2802732230 2802428860 Bacteria 6525526
599 2802739833 2802428861 Bacteria 6534206
600 2802745339 2802428862 Bacteria 6633353
601 2802752731 2802428863 Bacteria 6410669
602 2804752375 2802429268 Bacteria 6094027
603 2805931004 2802429605 Bacteria 6875453
604 2805937981 2802429606 Bacteria 6346811
605 2806043675 2802429633 Bacteria 7341974
606 2806050394 2802429634 Bacteria 7083200
607 2806057211 2802429635 Bacteria 7650140
608 2806064592 2802429636 Bacteria 7597525
609 2806071859 2802429637 Bacteria 7067217
610 2808985488 2808606387 Bacteria 5697198
611 2819242027 2818991272 Bacteria 4622173
612 2819559971 2818991439 Bacteria 6907412
613 2819608967 2818991448 Bacteria 6772224
614 2819637805 2818991453 Bacteria 7181617
615 2819684743 2818991461 Bacteria 7026071
616 2821129486 2821123053 Bacteria 7836056
617 2837652182 2837651117 Bacteria 3772164
618 2837679770 2837678835 Bacteria 5252418
619 2838017815 2838016132 Bacteria 6577831
620 2838028590 2838022645 Bacteria 6494267
621 2838029988 2838029111 Bacteria 6603031
622 2838038238 2838035591 Bacteria 7166484
623 2838043824 2838042994 Bacteria 6046894
624 2838051893 2838048938 Bacteria 6044578
625 2838068487 2838061910 Bacteria 6794874
626 2838070305 2838068647 Bacteria 6208656
627 2838079602 2838074704 Bacteria 6785777
628 2838661885 2838661181 Bacteria 7385261
629 2838674157 2838668709 Bacteria 6671819
630 2838676336 2838675328 Bacteria 4909118
631 2838681756 2838680041 Bacteria 6545511
632 2838687197 2838686498 Bacteria 7807632
633 2838696328 2838694306 Bacteria 6853137
634 2838706597 2838701080 Bacteria 6669771
635 2838710433 2838707686 Bacteria 6619912
636 2838715219 2838714209 Bacteria 5525906
637 2838720981 2838719591 Bacteria 5523910
638 2838725977 2838724970 Bacteria 4908691
639 2838729831 2838729681 Bacteria 7400765
640 2838738482 2838736955 Bacteria 5760694
641 2838743154 2838742623 Bacteria 7396178
642 2841841149 2841840854 Bacteria 5761912
643 2841847939 2841846520 Bacteria 5345850
644 2841852640 2841851746 Bacteria 7532261
645 2841859509 2841859092 Bacteria 5436171
646 2841869941 2841864319 Bacteria 6742987
647 2842078607 2842077413 Bacteria 6508645
648 2842114833 2842110456 Bacteria 7656360
649 2842118884 2842118031 Bacteria 7033875
650 2842126031 2842124991 Bacteria 5346824
651 2842131230 2842130223 Bacteria 4909145
652 2842140927 2842140634 Bacteria 5759631
653 2842151332 2842146304 Bacteria 5957337
654 2842153600 2842152218 Bacteria 4908957
655 2842157900 2842156927 Bacteria 6894975
656 2842167551 2842163707 Bacteria 6916235
657 2842171462 2842170452 Bacteria 5525737
658 2842177220 2842175837 Bacteria 4908771
659 2842181519 2842180545 Bacteria 6888678
660 2842188327 2842187318 Bacteria 5524014
661 2842198420 2842192696 Bacteria 6147454
662 2842204618 2842198810 Bacteria 6608673
663 2842205635 2842205361 Bacteria 6340321
664 2842212638 2842211629 Bacteria 5523832
665 2842217783 2842217011 Bacteria 7497767
666 2842225743 2842224351 Bacteria 5524473
667 2842230430 2842229732 Bacteria 7475766
668 2842239845 2842237096 Bacteria 6620661
669 2842244332 2842243621 Bacteria 7421798
670 2842256351 2842250916 Bacteria 6579627
671 2842257582 2842257432 Bacteria 7401195
672 2842265647 2842264693 Bacteria 6472963
673 2842271265 2842271015 Bacteria 7807131
674 2842279092 2842278818 Bacteria 6340002
675 2842285755 2842285085 Bacteria 6011953
676 2842292269 2842291075 Bacteria 7076806
677 2842301929 2842298080 Bacteria 6123127
678 2842304893 2842304105 Bacteria 7023636
679 2842315071 2842311132 Bacteria 6616990
680 2842320553 2842317721 Bacteria 6793725
681 2842346312 2842341865 Bacteria 7003929
682 2842357605 2842357229 Bacteria 6485165
683 2842369109 2842363717 Bacteria 6844742
684 2842372323 2842370503 Bacteria 7038661
685 2842378666 2842377471 Bacteria 7140707
686 2842385394 2842384541 Bacteria 7057858
687 2842401924 2842395702 Bacteria 6780583
688 2842403115 2842402390 Bacteria 6681310
689 2842409512 2842409023 Bacteria 6687331
690 2842416165 2842415677 Bacteria 6596907
691 2842423919 2842422224 Bacteria 6239196
692 2842436329 2842434925 Bacteria 6502746
693 2842442676 2842441272 Bacteria 6769273
694 2842452936 2842447887 Bacteria 6754142
695 2842464137 2842462802 Bacteria 6588055
696 2842470658 2842469257 Bacteria 6752936
697 2842476727 2842475841 Bacteria 6603183
698 2842490425 2842489311 Bacteria 6620893
699 2842496983 2842495871 Bacteria 6820686
700 2842503516 2842502639 Bacteria 6604161
701 2842511321 2842509118 Bacteria 6850950
702 2842516294 2842515876 Bacteria 5436280
703 2842522682 2842521101 Bacteria 6569494
704 2842923969 2842922631 Bacteria 5824079
705 2844167571 2844163670 Bacteria 7266046
706 2844458563 2844454524 Bacteria 7952546
707 2844528727 2844528606 Bacteria 4733806
708 2847087289 2847085930 Bacteria 5070450
709 2847419077 2847417321 Bacteria 6913799
710 2848994108 2848992105 Bacteria 6810864
711 2850081150 2850079185 Bacteria 6848280
712 2852390012 2852387548 Bacteria 8025568
713 2854602271 2854601825 Bacteria 4797592
714 2854899349 2854896431 Bacteria 5869725
715 2854916825 2854911287 Bacteria 5582813
716 2854917962 2854916844 Bacteria 5725939
717 2855825980 2855825444 Bacteria 6785811
718 2855841326 2855839649 Bacteria 7135830
719 2855876753 2855872281 Bacteria 6964271
720 2857517584 2857516855 Bacteria 7787325
721 2858467076 2858466076 Bacteria 4722413
722 2858802307 2858800743 Bacteria 6603254
723 2865018387 2865014394 Bacteria 4764573
724 2871275206 2871272651 Bacteria 5042015
725 2871285158 2871282230 Bacteria 4917173
726 2876603890 2876601092 Bacteria 5114497
727 2881611545 2881609920 Bacteria 4405319
728 2889795854 2889790730 Bacteria 5689708
729 2889917769 2889914905 Bacteria 5702301
730 2891050903 2891048133 Bacteria 4447501
731 2891373151 2891373044 Bacteria 5202277
732 2896389945 2896384573 Bacteria 7700774
733 2897808816 2897803580 Bacteria 7000062
734 2899796306 2899792073 Bacteria 4926588
735 2899809004 2899803654 Bacteria 5577784
736 2899849472 2899845264 Bacteria 5672268
737 2908669420 2908669403 Bacteria 5740494
738 2913300847 2913295892 Bacteria 6333755
739 2913310141 2913308742 Bacteria 5350706
740 2915652038 2915650412 Bacteria 4288180
741 2915981911 2915980308 Bacteria 6624279
742 2915991354 2915986958 Bacteria 6739310
743 2915994372 2915993759 Bacteria 7016183
744 2916002202 2916000859 Bacteria 6865702
745 2916009176 2916007675 Bacteria 6898660
746 2916018208 2916014648 Bacteria 6946486
747 2916022727 2916021584 Bacteria 6854472
748 2916029424 2916028427 Bacteria 6748433
749 2916035988 2916035215 Bacteria 6755766
750 2916042529 2916041962 Bacteria 6820487
751 2916052269 2916048683 Bacteria 6543552
752 2916061455 2916055098 Bacteria 6758838
753 2916067597 2916061851 Bacteria 6737736
754 2916080856 2916076590 Bacteria 6596108
755 2919106505 2919100787 Bacteria 7710546
756 2919115311 2919114240 Bacteria 5700270
757 2919167840 2919166419 Bacteria 4952238
758 2919174971 2919171160 Bacteria 6499771
759 2919411588 2919408235 Bacteria 6149349
760 2919495545 2919493220 Bacteria 4598500
761 2919544736 2919543075 Bacteria 4728703
762 2920766102 2920760137 Bacteria 7427611
763 2920824711 2920822456 Bacteria 6897201
764 2921201945 2921201388 Bacteria 6926299
765 2921210484 2921208531 Bacteria 6745326
766 2921238983 2921237296 Bacteria 6876710
767 2921244569 2921244191 Bacteria 6568419
768 2921251194 2921250672 Bacteria 6677771
769 2921262481 2921257292 Bacteria 6808382
770 2921270815 2921263974 Bacteria 6864552
771 2921284314 2921282425 Bacteria 6826397
772 2921291261 2921289301 Bacteria 7316391
773 2921300803 2921296804 Bacteria 7176999
774 2923526907 2923525760 Bacteria 4472324
775 2923558035 2923556063 Bacteria 6793593
776 2924144444 2924144063 Bacteria 6883928
777 2924152328 2924150972 Bacteria 7169444
778 2924160756 2924158325 Bacteria 7188855
779 2924173630 2924172951 Bacteria 6749356
780 2924181191 2924179722 Bacteria 6843264
781 2924187731 2924186466 Bacteria 6876637
782 2924200436 2924193448 Bacteria 6955718
783 2924206871 2924200457 Bacteria 6757188
784 2924213965 2924207177 Bacteria 6917007
785 2924214962 2924214083 Bacteria 7080103
786 2924222979 2924221636 Bacteria 7113495
787 2924229325 2924228884 Bacteria 6633132
788 2926756357 2926754445 Bacteria 5964435
789 2926760579 2926760298 Bacteria 5505990
790 2929140442 2929138655 Bacteria 5810547
791 2932404507 2932401849 Bacteria 4262978
792 2933008243 2933006813 Bacteria 4912075
793 2933013064 2933011516 Bacteria 5439334
794 2933018390 2933016740 Bacteria 6355406
795 2933570701 2933570622 Bacteria 7023390
796 2933591205 2933586486 Bacteria 7667493
797 2933597749 2933594066 Bacteria 5594265
798 2933601110 2933599457 Bacteria 5858799
799 2935900667 2935894831 Bacteria 6620579
800 2935902100 2935901341 Bacteria 7341747
801 2936372191 2936367885 Bacteria 7324495
802 2936381006 2936375103 Bacteria 6652732
803 2936383040 2936381700 Bacteria 7006523
804 2937002092 2936996657 Bacteria 6298727
805 2937003433 2937002841 Bacteria 6934057
806 2937014130 2937009748 Bacteria 6746052
807 2937018625 2937016420 Bacteria 6782579
808 2937028959 2937023124 Bacteria 6815156
809 2937033430 2937029754 Bacteria 6424026
810 2937038605 2937036028 Bacteria 6846469
811 2937044353 2937042894 Bacteria 6741576
812 2937051073 2937049772 Bacteria 6757901
813 2937062332 2937056579 Bacteria 7107896
814 2937065237 2937063883 Bacteria 7199456
815 2937072407 2937071275 Bacteria 6984483
816 2937079777 2937078374 Bacteria 6610289
817 2937088082 2937084907 Bacteria 6618516
818 2937097581 2937091812 Bacteria 6979387
819 2937099528 2937098957 Bacteria 7249374
820 2937110002 2937106411 Bacteria 6947143
821 2937119017 2937113482 Bacteria 6505872
822 2937126051 2937119839 Bacteria 6597547
823 2937126844 2937126314 Bacteria 6771275
824 2939606103 2939602548 Bacteria 4950493
825 2941504987 2941499720 Bacteria 7599444
826 2945952634 2945951305 Bacteria 4918162
827 2957376562 2957375807 Bacteria 6425588
828 2957388456 2957382221 Bacteria 6737050
829 2957394837 2957388812 Bacteria 6778072
830 2957398283 2957395598 Bacteria 6822399
831 2957408798 2957402308 Bacteria 6741770
832 2957414738 2957408893 Bacteria 6558585
833 2957416011 2957415311 Bacteria 6991633
834 2957424207 2957422303 Bacteria 7172205
835 2957430987 2957430029 Bacteria 7022557
836 2957441243 2957437181 Bacteria 6568994
837 2957444981 2957443900 Bacteria 6869977
838 2957451404 2957450854 Bacteria 6765715
839 2957458670 2957457609 Bacteria 6967680
840 2957471101 2957464669 Bacteria 6568877
841 2957472068 2957471148 Bacteria 6797643
842 2957484437 2957478035 Bacteria 6756658
843 2957486192 2957484790 Bacteria 6703082
844 2957492019 2957491536 Bacteria 6695180
845 2957503697 2957498199 Bacteria 7126688
846 2957507114 2957505466 Bacteria 7253085
847 2960586187 2960584000 Bacteria 6864594
848 2960592738 2960591022 Bacteria 6622873
849 2960598009 2960597568 Bacteria 6550735
850 2960604775 2960603979 Bacteria 6898737
851 2960612413 2960610863 Bacteria 6691244
852 2960620021 2960617483 Bacteria 6727748
853 2960629235 2960624210 Bacteria 6875384
854 2960632856 2960631154 Bacteria 6732508
855 2960640061 2960637947 Bacteria 7296468
856 2960647101 2960645483 Bacteria 7211087
857 2960655289 2960652885 Bacteria 7083688
858 2960660857 2960660292 Bacteria 7041660
859 2960673781 2960667422 Bacteria 6763020
860 2960675559 2960674078 Bacteria 6609048
861 2960681838 2960680706 Bacteria 6624464
862 2960688007 2960687367 Bacteria 6535474
863 2960700550 2960693952 Bacteria 6749742
864 2964609704 2964607997 Bacteria 7101408
865 2964616563 2964615318 Bacteria 6809089
866 2964623732 2964621998 Bacteria 6834995
867 2964629433 2964628898 Bacteria 7083044
868 2964640939 2964636051 Bacteria 7091832
869 2964649046 2964643177 Bacteria 6820887
870 2964651794 2964649959 Bacteria 6675118
871 2964661018 2964656573 Bacteria 7100150
872 2964670789 2964663802 Bacteria 7019362
873 2964673622 2964670856 Bacteria 6851364
874 2964680024 2964678106 Bacteria 6792020
875 2964686269 2964685014 Bacteria 6839111
876 2964693088 2964691889 Bacteria 6802758
877 2964699848 2964698721 Bacteria 6765331
878 2964706093 2964705432 Bacteria 7114648
879 2964713945 2964712639 Bacteria 6695970
880 2964721500 2964719344 Bacteria 7286602
881 2967665508 2967664464 Bacteria 6948836
882 2967671982 2967671571 Bacteria 7021409
883 2967681864 2967678726 Bacteria 7264382
884 2967691679 2967686174 Bacteria 6678622
885 2967695262 2967693043 Bacteria 6804451
886 2967701918 2967699805 Bacteria 6854538
887 2967708231 2967706974 Bacteria 7186053
888 2967716654 2967714385 Bacteria 7000047
889 2967721655 2967721400 Bacteria 7073753
890 2967734962 2967728569 Bacteria 6641507
891 2967736853 2967735183 Bacteria 6827012
892 2967744349 2967742019 Bacteria 6794534
893 2967753310 2967748971 Bacteria 6733771
894 2967758736 2967755722 Bacteria 6814706
895 2967765372 2967762386 Bacteria 6923502
896 2967770964 2967769361 Bacteria 6587838
897 2967778384 2967775926 Bacteria 6738189
898 2970026526 2970019648 Bacteria 7072033
899 2970031033 2970026789 Bacteria 6785236
900 2970039713 2970033650 Bacteria 7118744
901 2970041321 2970040964 Bacteria 6731123
902 2970053627 2970047711 Bacteria 7088379
903 2970061209 2970054988 Bacteria 6611507
904 2970063307 2970061556 Bacteria 7099761
905 2970073008 2970068827 Bacteria 7123112
906 2970082721 2970076120 Bacteria 6697332
907 2970083733 2970082768 Bacteria 6183754
908 2970089290 2970088815 Bacteria 6933825
909 2970096769 2970095765 Bacteria 6936963
910 2970107486 2970102677 Bacteria 6812532
911 2970116095 2970109326 Bacteria 6863976
912 2970122173 2970116247 Bacteria 6501857
913 2970122959 2970122695 Bacteria 6625855
914 2970131676 2970129317 Bacteria 6806560
915 2970138449 2970136068 Bacteria 7207982
916 2970144121 2970143518 Bacteria 6446480
917 2970150821 2970149975 Bacteria 6779706
918 2970170385 2970164137 Bacteria 6861252
919 2970178384 2970177841 Bacteria 6768001
920 2970186169 2970184632 Bacteria 7054431
921 2970192271 2970191845 Bacteria 7032787
922 2977522410 2977516862 Bacteria 6940108
923 2977524373 2977523885 Bacteria 6960446
924 2977531648 2977530762 Bacteria 6951399
925 2977544334 2977537788 Bacteria 6929320
926 2977549063 2977544691 Bacteria 6875412
927 2977554425 2977551784 Bacteria 7125765
928 2977560894 2977558990 Bacteria 6863948
929 2977572654 2977565890 Bacteria 6901543
930 2977579610 2977572785 Bacteria 6763888
931 2977580166 2977579622 Bacteria 6772100
932 2978974292 2978969890 Bacteria 5400756
933 2978979202 2978975091 Bacteria 4704313
934 2979094141 2979089926 Bacteria 5670289
935 2979098478 2979095461 Bacteria 5669583
936 2979106095 2979100975 Bacteria 5423623
937 2984496991 2984494565 Bacteria 5000175
938 2984512116 2984509177 Bacteria 5274802
939 2984521523 2984518228 Bacteria 5277463
940 2984540817 2984537506 Bacteria 5277481
941 2984589634 2984587000 Bacteria 5263363
942 2984603085 2984601300 Bacteria 5455244
943 2989349409 2989349275 Bacteria 6349068
944 2989773853 2989771324 Bacteria 5605128
945 2989778697 2989776772 Bacteria 4843317
946 2990262407 2990261002 Bacteria 4919493
947 2995393085 2995392953 Bacteria 4539380
948 2996891812 2996887358 Bacteria 5795980
949 2996898686 2996893221 Bacteria 5823108
950 3005414987 3005409236 Bacteria 7188837
951 3005420000 3005416602 Bacteria 7064308
952 3005448241 3005445848 Bacteria 6906074
953 3005454349 3005452660 Bacteria 5889319
954 639649049 639633055 Bacteria 7751309
955 643825963 643692032 Bacteria 6891900
956 648741750 648276728 Bacteria 6968865
957 650739993 650716007 Bacteria 5573770
958 8003570992 8003570095 Bacteria 5747666
959 8003993835 8003992118 Bacteria 7266902
960 8004001372 8003999396 Bacteria 7063185
961 8005250729 8005246636 Bacteria 4933972
962 8005263143 8005258706 Bacteria 6184835
963 8005280978 8005275841 Bacteria 6929066
964 8005285149 8005282627 Bacteria 6675747
965 8005293486 8005289223 Bacteria 6634003
966 8005302961 8005301065 Bacteria 6614431
967 8005312688 8005307578 Bacteria 7395396
968 8005316951 8005314921 Bacteria 7072929
969 8005326339 8005321885 Bacteria 5795980
970 8005380777 8005376324 Bacteria 6590079
971 8005386502 8005382845 Bacteria 6732062
972 8005396280 8005395548 Bacteria 6806915
973 8005434991 8005430974 Bacteria 6689030
974 8005463520 8005460587 Bacteria 7157962
975 8005485251 8005484373 Bacteria 6297373
976 8005500730 8005497431 Bacteria 6477605
977 8005545257 8005542996 Bacteria 7077758
978 8005557164 8005556819 Bacteria 6908598
979 8005567841 8005563573 Bacteria 7153261
980 8005573614 8005570704 Bacteria 6957481
981 8005622106 8005619151 Bacteria 7030230
982 8005632412 8005626139 Bacteria 6534237
983 8005649764 8005645114 Bacteria 6950293
984 8005659257 8005658619 Bacteria 4500593
985 8005672149 8005668836 Bacteria 6953162
986 8005683081 8005682033 Bacteria 6726518
987 8005692270 8005688590 Bacteria 6610080
988 8005699733 8005695170 Bacteria 6912330
989 8018133926 8018127388 Bacteria 7351159
990 8018155577 8018150411 Bacteria 5549903
991 8018166243 8018163183 Bacteria 7277977
992 8018181474 8018176218 Bacteria 6896178
993 8019501028 8019499862 Bacteria 5169538
994 8023683315 8023680758 Bacteria 7729763
995 8024483016 8024479707 Bacteria 6954785
996 8024503915 8024501048 Bacteria 6427847
997 8046770427 8046767195 Bacteria 7547379
998 8049294950 8049293176 Bacteria 6128433
999 8054002871 8054002106 Bacteria 7987183
1000 8054462316 8054460903 Bacteria 4872905
1001 8054560250 8054558443 Bacteria 5204801
1002 8055435894 8055431914 Bacteria 4551896
1003 8056378364 8056375014 Bacteria 7006639
1004 8056386570 8056382006 Bacteria 6408074
1005 8056877773 8056875544 Bacteria 4355797
1006 8057575932 8057575449 Bacteria 7367519
1007 8057877391 8057874678 Bacteria 7494653
1008 Ga0496111_0015511
1009 JGI25155J39150_1000001
1010 JGI25156J39149_1000001
1011 JGI25162J39368_1000209
1012 JGI25162J39368_1000245
1013 JGI25154J39366_1000011
1014 JGI25158J39367_1000764
1015 JGI25157J39369_1000030
1016 JGI25152J39213_1000570
1017 JGI25152J39213_1004071
1018 JGI25152J39213_1011917
1019 JGI25150J39212_1000326
1020 JGI25150J39212_1005593
1021 JGI25159J45721_1000078
1022 JGI25159J45721_1000199
1023 JGI25159J45721_1000530
1024 JGI25151J46595_10000083
1025 JGI25165J46597_1000302
1026 JGI25165J46597_1000682
1027 JGI25153J46596_10000377
1028 JGI25153J46596_10005215
1029 JGI25153J46596_10008879
1030 rootH2_10150379
1031 JGI25160J50197_1000087
1032 JGI25160J50197_1000216
1033 JGI25161J50226_1000066
1034 JGI25161J50226_1000207
1035 JGI25161J50226_1000412
1036 Ga0055526_1000594
1037 Ga0055526_1003679
1038 Ga0055526_1028194
1039 Ga0055524_1001754
1040 Ga0055524_1001805
1041 Ga0055524_1025058
1042 Ga0055528_1000358
1043 Ga0055528_1019378
1044 Ga0055540_1012253
1045 Ga0058692_1000085
1046 Ga0058692_1000167
1047 Ga0058692_1000350
1048 Ga0058692_1006447
1049 Ga0055543_1000053
1050 Ga0055543_1000068
1051 Ga0055543_1000301
1052 Ga0055543_1001883
1053 Ga0065165_1000717
1054 Ga0065165_1000839
1055 Ga0065165_1005533
1056 Ga0070668_100205064
1057 Ga0070669_100215989
1058 Ga0070671_100084132
1059 Ga0070667_100245343
1060 Ga0070665_100543480
1061 Ga0068854_100046155
1062 Ga0068856_100035514
1063 Ga0068851_10061721
1064 Ga0075365_10000404
1065 Ga0075365_10040694
1066 Ga0075364_10224605
1067 Ga0075362_10094396
1068 Ga0075367_10006190
1069 Ga0075367_10014267
1070 Ga0075367_10130254
1071 Ga0075367_10277944
1072 Ga0075369_10000812
1073 Ga0075369_10014994
1074 Ga0079104_1000610
1075 Ga0079104_1013531
1076 Ga0099826_10000091
1077 Ga0099826_10012274
1078 Ga0105250_10003428
1079 Ga0105240_10000005
1080 Ga0105243_10023405
1081 Ga0105237_10000766
1082 Ga0123342_1012633
1083 Ga0105239_10001069
1084 Ga0105246_10009831
1085 Ga0105246_10017249
1086 Ga0157373_10000137
1087 Ga0157373_10007245
1088 Ga0157371_10000015
1089 Ga0157371_10000810
1090 Ga0157371_10016604
1091 Ga0157370_10000046
1092 Ga0157370_10000402
1093 Ga0171463_1003
1094 Ga0163162_10259195
1095 Ga0157372_10029974
1096 Ga0183363_1047
1097 Ga0214544_1001682
1098 Ga0214542_1001614
1099 Ga0214543_1000078
1100 Ga0214543_1001395
1101 Ga0228711_1000016
1102 Ga0228710_1000013
1103 Ga0209435_100012
1104 Ga0209760_101106
1105 Ga0209436_100085
1106 Ga0209436_103034
1107 Ga0209436_105400
1108 Ga0209437_100047
1109 Ga0209437_100165
1110 Ga0207425_1000024
1111 Ga0207425_1001564
1112 Ga0209646_1000026
1113 Ga0209026_1000014
1114 Ga0209677_100656
1115 Ga0209759_1000012
1116 Ga0209129_1000069
1117 Ga0209129_1000184
1118 Ga0209129_1002960
1119 Ga0209129_1005886
1120 Ga0209233_1000048
1121 Ga0209233_1000069
1122 Ga0209233_1000195
1123 Ga0209565_1020981
1124 Ga0209455_1014550
1125 Ga0209673_1000010
1126 Ga0209673_1003537
1127 Ga0209673_1008196
1128 Ga0209130_1000021
1129 Ga0209130_1000029
1130 Ga0209130_1000081
1131 Ga0209130_1024642
1132 Ga0209676_1005409
1133 Ga0209676_1007095
1134 Ga0209025_1000050
1135 Ga0209025_1000094
1136 Ga0209025_1000119
1137 Ga0209025_1000959
1138 Ga0209025_1001225
1139 Ga0209025_1004412
1140 Ga0209025_1021372
1141 Ga0209025_1025145
1142 Ga0209025_1030438
1143 Ga0209025_1046039
1144 Ga0209564_1000260
1145 Ga0209564_1000278
1146 Ga0209758_1000083
1147 Ga0209758_1000418
1148 Ga0209758_1001270
1149 Ga0209758_1001756
1150 Ga0209758_1028658
1151 Ga0209050_1009223
1152 Ga0209050_1030063
1153 Ga0209256_1000042
1154 Ga0209256_1001127
1155 Ga0209256_1003234
1156 Ga0209256_1003768
1157 Ga0209256_1016068
1158 Ga0207426_1000008
1159 Ga0207426_1000010
1160 Ga0207426_1000074
1161 Ga0207426_1000952
1162 Ga0209051_1001051
1163 Ga0209051_1038275
1164 Ga0209051_1059233
1165 Ga0209257_1006328
1166 Ga0209257_1007766
1167 Ga0209257_1024647
1168 Ga0209257_1036739
1169 Ga0207696_1000062
1170 Ga0207655_1000007
1171 Ga0207655_1022807
1172 Ga0207695_10000011
1173 Ga0207671_10000241
1174 Ga0207681_10140175
1175 Ga0207668_10128587
1176 Ga0207640_10027070
1177 Ga0207702_10074236
1178 Ga0209281_1000036
1179 Ga0209281_1000047
1180 Ga0209281_1000221
1181 Ga0209371_1000005
1182 Ga0209371_1000021
1183 Ga0209371_1000039
1184 Ga0209371_1000199
1185 Ga0209371_1000229
1186 Ga0209371_1002365
1187 Ga0209371_1004936
1188 Ga0209282_1000041
1189 Ga0209282_1000251
1190 Ga0209282_1054726
1191 Ga0209813_10033758
1192 Ga0268266_10197077
1193 Ga0268266_10397157
1194 Ga0307515_10000023
1195 Ga0307515_10013391
1196 Ga0307515_10084680
1197 Ga0268256_1000006
1198 Ga0268256_1000020
1199 Ga0268256_1000033
1200 Ga0268256_1000618
1201 Ga0268256_1001050
1202 Ga0268256_1003171
1203 Ga0268256_1004176
1204 Ga0316181_1097185
1205 Ga0307408_100121756
1206 Ga0307412_10029449
1207 Ga0307412_10064336
1208 Ga0307412_10179015
1209 Ga0315914_1005042
1210 Ga0307409_100219905
1211 Ga0307416_100250920
1212 Ga0315913_1003257
1213 Ga0315915_1000017
1214 Ga0400483_079876
1215 Ga0400483_172620
1216 Ga0439438_004464
1217 Ga0439439_0052844
1218 Ga0439447_002812
1219 Ga0439465_0003881
1220 Ga0439465_0011462
1221 Ga0451791_1542990
1222 Ga0451833_0387060
1223 Ga0451835_0183697
1224 Ga0451835_0197663
1225 Ga0451837_0688979
1226 Ga0451839_0261576
1227 Ga0451841_0575577
1228 Ga0451846_11831
1229 Ga0451847_0545570
1230 Ga0451851_0185573
1231 Ga0451843_0557105
1232 Ga0439449_0010911
1233 Ga0439449_0015007
1234 Ga0450908_008115
1235 Ga0466968_0099450
1236 Ga0466970_0000517
1237 Ga0466970_0197868
1238 Ga0466958_0025411
1239 Ga0495617_007878
1240 Ga0495591_000007
1241 Ga0495591_000318
1242 Ga0495650_0000026
1243 Ga0495605_0015250
1244 Ga0495605_0042953
1245 Ga0495605_0162028
1246 Ga0495585_0019158
1247 Ga0495585_0019219
1248 Ga0495607_0014568
1249 Ga0495607_0066247
1250 Ga0495606_0001613
1251 Ga0495606_0012820
1252 Ga0495606_0108765
1253 Ga0495610_0027460
1254 Ga0495616_0051898
1255 Ga0495631_0005659
1256 Ga0495631_0039188
1257 Ga0495632_0016479
1258 Ga0495643_0039324
1259 Ga0495644_0001680
1260 Ga0495648_0009418
1261 Ga0495654_0000007
1262 Ga0495654_0000069
1263 Ga0495633_0015993
1264 Ga0495633_0082790
1265 Ga0495633_0147035
1266 Ga0495625_0047417
1267 Ga0495625_0202915
1268 Ga0495671_0022125
1269 Ga0495649_0019733
1270 Ga0495589_0003279
1271 Ga0495660_0000016
1272 Ga0495660_0029052
1273 Ga0495672_0000001
1274 Ga0495673_0000352
1275 Ga0495681_0005741
1276 Ga0495686_0000796
1277 Ga0495686_0023787
1278 Ga0496100_0017847
1279 Ga0496100_0080448
1280 Ga0496101_0000093
1281 Ga0496102_0010757
1282 Ga0496104_0200879
1283 Ga0496110_0370165
1284 Ga0496113_0076669
1285 Ga0496116_0000086
1286 Ga0496116_0005431
1287 Ga0496116_0006630
1288 Ga0496116_0057331
1289 Ga0496117_0000002
1290 Ga0496117_0000353
1291 Ga0496117_0006313
1292 Ga0496117_0071508
1293 Ga0496118_0000204
1294 Ga0496118_0000355
1295 Ga0496118_0022010
1296 Ga0496119_0003501
1297 Ga0496119_0004804
1298 Ga0496119_0014717
1299 Ga0496119_0035312
1300 Ga0496119_0087118
1301 Ga0496119_0133318
1302 Ga0496120_0000002
1303 Ga0496120_0000116
1304 Ga0496120_0000917
1305 Ga0496120_0000941
1306 Ga0496120_0002795
1307 Ga0496120_0009779
1308 Ga0496121_0000378
1309 Ga0496121_0009399
1310 Ga0496121_0043020
1311 Ga0496121_0071342
1312 Ga0496122_0000001
1313 Ga0496122_0000369
1314 Ga0496122_0000525
1315 Ga0496122_0003261
1316 Ga0496122_0004665
1317 Ga0496122_0008819
1318 Ga0496122_0012544
1319 Ga0496122_0024409
1320 Ga0496122_0032026
1321 Ga0496122_0072484
1322 Ga0496122_0243607
1323 Ga0496123_0000001
1324 Ga0496123_0000054
1325 Ga0496123_0001014
1326 Ga0496123_0002174
1327 Ga0496123_0002482
1328 Ga0496123_0003243
1329 Ga0496124_0000357
1330 Ga0496124_0001936
1331 Ga0496124_0006121
1332 Ga0496124_0010848
1333 Ga0496124_0014592
1334 Ga0496124_0049824
1335 Ga0496124_0065627
1336 Ga0496124_0075919
1337 Ga0496124_0324998
1338 Ga0496125_0000282
1339 Ga0496125_0002081
1340 Ga0496125_0011299
1341 Ga0496125_0024477
1342 Ga0496125_0028386
1343 Ga0496125_0041019
1344 Ga0496126_0000703
1345 Ga0496126_0001019
1346 Ga0496126_0041836
1347 Ga0496126_0061193
1348 Ga0496126_0070749
1349 Ga0496126_0189716
1350 Ga0496126_0255942
1351 Ga0495678_001115
1352 Ga0495682_0000001
1353 Ga0501032_0175424
1354 Ga0501033_0000167
1355 Ga0501033_0058254
1356 Ga0501034_0002538
1357 Ga0501034_0427279
1358 Ga0501037_0088749
1359 Ga0501037_0128592
1360 Ga0501043_0027267
1361 Ga0501070_0211017
1362 Ga0501083_0092066
1363 Ga0501280_000582
1364 Ga0501035_0006797
1365 Ga0501035_0195416
1366 Ga0501044_0091936
1367 Ga0501044_0263690
1368 Ga0501044_0280231
1369 Ga0501044_0355027
1370 nmdc:mga03683_2318_c1
1371 nmdc:mga03683_34891_c1
1372 nmdc:mga03n38_1786_c1
1373 nmdc:mga00v17_219758_c1
1374 nmdc:mga00v17_264213_c1
1375 nmdc:mga00v17_6_c1
1376 nmdc:mga0yw44_33191_c1
1377 nmdc:mga0yw44_72132_c1
1378 nmdc:mga06z11_55161_c1
1379 nmdc:mga06z11_817_c1
1380 nmdc:mga04h51_23321_c1
1381 nmdc:mga07m45_161522_c1
1382 nmdc:mga07m45_176094_c1
1383 nmdc:mga07m45_928_c1
1384 nmdc:mga0sz30_12802_c1
1385 nmdc:mga0sz30_215_c2
1386 nmdc:mga0sz30_708_c1
1387 Ga0500560_006454
1388 Ga0500569_018613
1389 Ga0500594_0016193
1390 Ga0500618_000313
1391 Ga0500618_000604
1392 Ga0500618_012244
1393 Ga0500621_000002
1394 Ga0500658_0000945
1395 Ga0500561_0000246
1396 Ga0500568_0001517
1397 Ga0500573_0000259
1398 Ga0500616_0000301
1399 Ga0500616_0004349
1400 Ga0500616_0019956
1401 Ga0500622_0001146
1402 Ga0500627_0063175
1403 Ga0500634_0079358
1404 Ga0500636_0000153
1405 Ga0500636_0001102
1406 2509111387
1407 2509375674
1408 2509392200
1409 2509446848
1410 2510133800
1411 2510303300
1412 2510841077
1413 2510895229
1414 2511135221
1415 2511171678
1416 2511181650
1417 2511194381
1418 2511382934
1419 2511435065
1420 2511501959
1421 2512038281
1422 2512533330
1423 2512971115
1424 2513574159
1425 2513576805
1426 2513584743
1427 2513594686
1428 2513604528
1429 2513615451
1430 2513629549
1431 2513708190
1432 2513864754
1433 2513881239
1434 2513902371
1435 2513914100
1436 2513926077
1437 2513984613
1438 2513997076
1439 2514007581
1440 2514020151
1441 2515112846
1442 2515608749
1443 2515636467
1444 2515640817
1445 2515655499
1446 2515739343
1447 2516209680
1448 2516893254
1449 2517036553
1450 2517076923
1451 2517095685
1452 2517407249
1453 2517570001
1454 2520381517
1455 2524448844
1456 2524460169
1457 2530646157
1458 2535485924
1459 2535516599
1460 2537877728
1461 2551674933
1462 2551680187
1463 2551684836
1464 2551695934
1465 2551704472
1466 2551711463
1467 2551720832
1468 2551728684
1469 2551735015
1470 2551739435
1471 2554247610
1472 2558867990
1473 2559294743
1474 2561466428
1475 2566038038
1476 2585166120
1477 2585200279
1478 2585222622
1479 2585229901
1480 2585254865
1481 2585267675
1482 2585270958
1483 2585277307
1484 2585323521
1485 2585331656
1486 2585386734
1487 2585393038
1488 2585402116
1489 2585527301
1490 2585533958
1491 2585538038
1492 2585545205
1493 2585552191
1494 2585558682
1495 2585821901
1496 2585835986
1497 2585846824
1498 2585898047
1499 2585904348
1500 2585996018
1501 2586000622
1502 2587980535
1503 2599331571
1504 2599417550
1505 2599604007
1506 2599720972
1507 2600193102
1508 2600375710
1509 2601608265
1510 2601745039
1511 2608669758
1512 2616293520
1513 2616308686
1514 2616557010
1515 2617385782
1516 2643803601
1517 2643811649
1518 2643857660
1519 2643909757
1520 2643919230
1521 2643964498
1522 2644003868
1523 2644050748
1524 2644067569
1525 2644107716
1526 2644148613
1527 2644192607
1528 2644205222
1529 2644210235
1530 2644239675
1531 2644300354
1532 2644309110
1533 2644332937
1534 2644375248
1535 2644413558
1536 2644418622
1537 2644451989
1538 2644483666
1539 2644491791
1540 2644501337
1541 2644522136
1542 2644545891
1543 2644615052
1544 2644653787
1545 2644658578
1546 2644676588
1547 2644690751
1548 2650896422
1549 2657681176
1550 2671111617
1551 2686353702
1552 2692315858
1553 2719181656
1554 2719386189
1555 2719665997
1556 2719732320
1557 2720492417
1558 2720613772
1559 2720620560
1560 2720631985
1561 2720775713
1562 2721147748
1563 2721159196
1564 2721164583
1565 2721399971
1566 2722840753
1567 2723027320
1568 2723560939
1569 2723567532
1570 2724038784
1571 2724045076
1572 2724090320
1573 2724104797
1574 2724110598
1575 2725952708
1576 2730108256
1577 2730164891
1578 2730298828
1579 2738714046
1580 2738804214
1581 2738945435
1582 2739032695
1583 2753357176
1584 2753461852
1585 2757571228
1586 2758639582
1587 2766065722
1588 2778174118
1589 2792581774
1590 2792620157
1591 2792626423
1592 2792639371
1593 2793298714
1594 2793314684
1595 2793320520
1596 2793330440
1597 2793338337
1598 2793344286
1599 2793348728
1600 2793351981
1601 2793363844
1602 2793370334
1603 2802719496
1604 2802726911
1605 2802732230
1606 2802739833
1607 2802745339
1608 2802752731
1609 2804752375
1610 2805931004
1611 2805937981
1612 2806043675
1613 2806050394
1614 2806057211
1615 2806064592
1616 2806071859
1617 2808985488
1618 2819242027
1619 2819559971
1620 2819608967
1621 2819637805
1622 2819684743
1623 2821129486
1624 2837652182
1625 2837679770
1626 2838017815
1627 2838028590
1628 2838029988
1629 2838038238
1630 2838043824
1631 2838051893
1632 2838068487
1633 2838070305
1634 2838079602
1635 2838661885
1636 2838674157
1637 2838676336
1638 2838681756
1639 2838687197
1640 2838696328
1641 2838706597
1642 2838710433
1643 2838715219
1644 2838720981
1645 2838725977
1646 2838729831
1647 2838738482
1648 2838743154
1649 2841841149
1650 2841847939
1651 2841852640
1652 2841859509
1653 2841869941
1654 2842078607
1655 2842114833
1656 2842118884
1657 2842126031
1658 2842131230
1659 2842140927
1660 2842151332
1661 2842153600
1662 2842157900
1663 2842167551
1664 2842171462
1665 2842177220
1666 2842181519
1667 2842188327
1668 2842198420
1669 2842204618
1670 2842205635
1671 2842212638
1672 2842217783
1673 2842225743
1674 2842230430
1675 2842239845
1676 2842244332
1677 2842256351
1678 2842257582
1679 2842265647
1680 2842271265
1681 2842279092
1682 2842285755
1683 2842292269
1684 2842301929
1685 2842304893
1686 2842315071
1687 2842320553
1688 2842346312
1689 2842357605
1690 2842369109
1691 2842372323
1692 2842378666
1693 2842385394
1694 2842401924
1695 2842403115
1696 2842409512
1697 2842416165
1698 2842423919
1699 2842436329
1700 2842442676
1701 2842452936
1702 2842464137
1703 2842470658
1704 2842476727
1705 2842490425
1706 2842496983
1707 2842503516
1708 2842511321
1709 2842516294
1710 2842522682
1711 2842923969
1712 2844167571
1713 2844458563
1714 2844528727
1715 2847087289
1716 2847419077
1717 2848994108
1718 2850081150
1719 2852390012
1720 2854602271
1721 2854899349
1722 2854916825
1723 2854917962
1724 2855825980
1725 2855841326
1726 2855876753
1727 2857517584
1728 2858467076
1729 2858802307
1730 2865018387
1731 2871275206
1732 2871285158
1733 2876603890
1734 2881611545
1735 2889795854
1736 2889917769
1737 2891050903
1738 2891373151
1739 2896389945
1740 2897808816
1741 2899796306
1742 2899809004
1743 2899849472
1744 2908669420
1745 2913300847
1746 2913310141
1747 2915652038
1748 2915981911
1749 2915991354
1750 2915994372
1751 2916002202
1752 2916009176
1753 2916018208
1754 2916022727
1755 2916029424
1756 2916035988
1757 2916042529
1758 2916052269
1759 2916061455
1760 2916067597
1761 2916080856
1762 2919106505
1763 2919115311
1764 2919167840
1765 2919174971
1766 2919411588
1767 2919495545
1768 2919544736
1769 2920766102
1770 2920824711
1771 2921201945
1772 2921210484
1773 2921238983
1774 2921244569
1775 2921251194
1776 2921262481
1777 2921270815
1778 2921284314
1779 2921291261
1780 2921300803
1781 2923526907
1782 2923558035
1783 2924144444
1784 2924152328
1785 2924160756
1786 2924173630
1787 2924181191
1788 2924187731
1789 2924200436
1790 2924206871
1791 2924213965
1792 2924214962
1793 2924222979
1794 2924229325
1795 2926756357
1796 2926760579
1797 2929140442
1798 2932404507
1799 2933008243
1800 2933013064
1801 2933018390
1802 2933570701
1803 2933591205
1804 2933597749
1805 2933601110
1806 2935900667
1807 2935902100
1808 2936372191
1809 2936381006
1810 2936383040
1811 2937002092
1812 2937003433
1813 2937014130
1814 2937018625
1815 2937028959
1816 2937033430
1817 2937038605
1818 2937044353
1819 2937051073
1820 2937062332
1821 2937065237
1822 2937072407
1823 2937079777
1824 2937088082
1825 2937097581
1826 2937099528
1827 2937110002
1828 2937119017
1829 2937126051
1830 2937126844
1831 2939606103
1832 2941504987
1833 2945952634
1834 2957376562
1835 2957388456
1836 2957394837
1837 2957398283
1838 2957408798
1839 2957414738
1840 2957416011
1841 2957424207
1842 2957430987
1843 2957441243
1844 2957444981
1845 2957451404
1846 2957458670
1847 2957471101
1848 2957472068
1849 2957484437
1850 2957486192
1851 2957492019
1852 2957503697
1853 2957507114
1854 2960586187
1855 2960592738
1856 2960598009
1857 2960604775
1858 2960612413
1859 2960620021
1860 2960629235
1861 2960632856
1862 2960640061
1863 2960647101
1864 2960655289
1865 2960660857
1866 2960673781
1867 2960675559
1868 2960681838
1869 2960688007
1870 2960700550
1871 2964609704
1872 2964616563
1873 2964623732
1874 2964629433
1875 2964640939
1876 2964649046
1877 2964651794
1878 2964661018
1879 2964670789
1880 2964673622
1881 2964680024
1882 2964686269
1883 2964693088
1884 2964699848
1885 2964706093
1886 2964713945
1887 2964721500
1888 2967665508
1889 2967671982
1890 2967681864
1891 2967691679
1892 2967695262
1893 2967701918
1894 2967708231
1895 2967716654
1896 2967721655
1897 2967734962
1898 2967736853
1899 2967744349
1900 2967753310
1901 2967758736
1902 2967765372
1903 2967770964
1904 2967778384
1905 2970026526
1906 2970031033
1907 2970039713
1908 2970041321
1909 2970053627
1910 2970061209
1911 2970063307
1912 2970073008
1913 2970082721
1914 2970083733
1915 2970089290
1916 2970096769
1917 2970107486
1918 2970116095
1919 2970122173
1920 2970122959
1921 2970131676
1922 2970138449
1923 2970144121
1924 2970150821
1925 2970170385
1926 2970178384
1927 2970186169
1928 2970192271
1929 2977522410
1930 2977524373
1931 2977531648
1932 2977544334
1933 2977549063
1934 2977554425
1935 2977560894
1936 2977572654
1937 2977579610
1938 2977580166
1939 2978974292
1940 2978979202
1941 2979094141
1942 2979098478
1943 2979106095
1944 2984496991
1945 2984512116
1946 2984521523
1947 2984540817
1948 2984589634
1949 2984603085
1950 2989349409
1951 2989773853
1952 2989778697
1953 2990262407
1954 2995393085
1955 2996891812
1956 2996898686
1957 3005414987
1958 3005420000
1959 3005448241
1960 3005454349
1961 639649049
1962 643825963
1963 648741750
1964 650739993
1965 8003570992
1966 8003993835
1967 8004001372
1968 8005250729
1969 8005263143
1970 8005280978
1971 8005285149
1972 8005293486
1973 8005302961
1974 8005312688
1975 8005316951
1976 8005326339
1977 8005380777
1978 8005386502
1979 8005396280
1980 8005434991
1981 8005463520
1982 8005485251
1983 8005500730
1984 8005545257
1985 8005557164
1986 8005567841
1987 8005573614
1988 8005622106
1989 8005632412
1990 8005649764
1991 8005659257
1992 8005672149
1993 8005683081
1994 8005692270
1995 8005699733
1996 8018133926
1997 8018155577
1998 8018166243
1999 8018181474
2000 8019501028
2001 8023683315
2002 8024483016
2003 8024503915
2004 8046770427
2005 8049294950
2006 8054002871
2007 8054462316
2008 8054560250
2009 8055435894
2010 8056378364
2011 8056386570
2012 8056877773
2013 8057575932
2014 8057877391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00950

ABC-3

ABC 3 transport family

44

301

0.99

Map