F488059
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1007 | 615 | 784 | 351 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8016522445|8016525646 |
| Length | 414 |
| Sequence | RQPAKTGHLNCNGKQIESRKAPHCSAFTQIRAEHASKRDTMAPSGTIATSVGLAPSAARVDWVDYAKGICIVMVVMMHSVLGVELAAGQTGFMHVAVAFAKPFRMPDFFLISGLFLPLVIDRDWRTYLDRKVVHFAYFYVVWVTIQFGFKAPASAAETSWRDAGLLYLESFVEPFGTLWFIYLLPIFFVVTKLTRRIPPPAIWLIAAALETARVATGWTAIDEFCARFVYFYSGYLFAPYVFALADRARNHPAWALAALATWALVNAGLVVCGASEWKIVSLVLGFAGACAIITMGTLLARARWLNFFRFCGEHSIVIYLAFFLPMAATRTLLLRTGVIPDIGTVSLIVTIVGVIGALAIWQAALRLNANFLFERPDAFWIVPKKAGARLQPGSLSSPGSTGRPSIPETAVIDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 29 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 33 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 34 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 35 | 2791355199 | |||
| 36 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 37 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 38 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 39 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 40 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 41 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 42 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 43 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 44 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 45 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 46 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 47 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 48 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 49 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 50 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 51 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 52 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 53 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 54 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 55 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 56 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 57 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 58 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 59 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 60 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 61 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 62 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 63 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 64 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 65 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 66 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 67 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 68 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 69 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 70 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 71 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 72 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 73 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 74 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 75 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 76 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 77 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 78 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 79 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 80 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 81 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 82 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 83 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 84 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 85 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 86 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 87 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 88 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 89 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 90 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 91 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 92 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 93 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 94 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 95 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 96 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 97 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 98 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 99 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 100 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 101 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 102 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 103 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 104 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 105 | 2906610324 | |||
| 106 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 107 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 108 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 109 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 110 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 111 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 112 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 113 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 114 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 115 | 2922368715 | |||
| 116 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 117 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 118 | 2922425934 | |||
| 119 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 120 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 121 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 122 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 123 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 124 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 125 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 126 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 127 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 128 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 129 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 130 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 131 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 132 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 133 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 134 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 135 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 136 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 137 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 138 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 139 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 140 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 141 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 142 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 143 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 144 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 145 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 146 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 147 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 148 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 149 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 150 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 151 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 152 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 153 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 154 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 155 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 156 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 157 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 158 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 159 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 160 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 161 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 162 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 163 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 164 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 165 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 166 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 167 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 168 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 169 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 170 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 171 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 172 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 173 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 174 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 175 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 176 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 177 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 178 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 179 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 180 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 181 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 182 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 183 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 184 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 185 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 186 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 187 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 188 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 189 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 190 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 191 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 192 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 193 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 194 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 195 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 196 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 197 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 198 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 200 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 201 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 203 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 205 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 206 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 207 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 211 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 214 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 218 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 220 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 221 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 222 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 223 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 226 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 228 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 229 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 230 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 231 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 232 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 233 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 234 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 235 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 236 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 237 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 238 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 239 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 240 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 241 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 242 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 244 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 245 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 246 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 247 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 248 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 249 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 250 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 251 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 252 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 253 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 254 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 255 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 256 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 257 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 259 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 260 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 261 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 262 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 263 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 275 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 287 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 292 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 294 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 336 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 337 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 338 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 339 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 342 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 343 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 344 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 345 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 346 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 347 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 348 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 349 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 350 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 351 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 352 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 353 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 354 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 355 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 356 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 357 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 358 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 359 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 360 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 361 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 362 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 363 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 364 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 365 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 366 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 367 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 368 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 369 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 370 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 371 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 372 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 373 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 374 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 375 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 376 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 377 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 378 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 379 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 380 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 381 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 382 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 383 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 384 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 385 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 386 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 387 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 388 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 389 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 390 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 391 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 392 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 393 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 394 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 395 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 396 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 397 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 398 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 399 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 400 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 401 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 402 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 471 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 472 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 473 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 474 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 475 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 476 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 477 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 478 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 479 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 480 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 481 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 482 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 483 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 484 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 485 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 486 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 487 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 488 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 489 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 490 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 491 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 492 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 493 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 494 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 521 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 525 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 526 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 527 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 528 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 529 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 531 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 532 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 533 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 534 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 535 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 536 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 539 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 542 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 543 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 544 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 545 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 546 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 547 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 548 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 549 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 550 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 551 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 552 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 553 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 554 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 555 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 556 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 557 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 558 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 559 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 560 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 561 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 562 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 563 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 564 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 565 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 566 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 567 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 568 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 570 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 571 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 572 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 573 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 574 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 575 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 576 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 577 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 578 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 580 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 581 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 582 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 583 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 584 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 585 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 586 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 587 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 588 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 589 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 590 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 591 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 592 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 593 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 594 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 595 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 596 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 597 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 598 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 599 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 600 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 601 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 602 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 603 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 604 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 605 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 606 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 607 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 608 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 609 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 610 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 611 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 612 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 613 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 614 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 615 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.17 |
| Metatranscriptomes | 0 |
| Isolates | 21.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.02 |
| Nodule | 16.68 |
| Rhizoplane | 3.08 |
| Rhizosphere | 57.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008712 | 3300001979 | Bacteria | 4027 |
| 2 | JGI24735J21928_10009585 | 3300002067 | Bacteria | 3104 |
| 3 | JGI25406J46586_10031159 | 3300003203 | Bacteria | 1998 |
| 4 | JGI25153J46596_10002562 | 3300003215 | Bacteria | 10427 |
| 5 | JGI25160J50197_1027344 | 3300003354 | Bacteria | 1555 |
| 6 | JGI25404J52841_10019198 | 3300003659 | Bacteria | 1481 |
| 7 | Ga0055539_1002104 | 3300003752 | Bacteria | 3238 |
| 8 | Ga0055542_1003949 | 3300003762 | Bacteria | 3788 |
| 9 | Ga0055531_10005750 | 3300003794 | Bacteria | 7183 |
| 10 | Ga0055543_1002854 | 3300004625 | Bacteria | 5449 |
| 11 | Ga0065165_1001543 | 3300005262 | Bacteria | 24050 |
| 12 | Ga0065165_1006649 | 3300005262 | Bacteria | 5973 |
| 13 | Ga0065165_1007651 | 3300005262 | Bacteria | 5248 |
| 14 | Ga0065165_1041813 | 3300005262 | Bacteria | 1358 |
| 15 | Ga0070658_10125207 | 3300005327 | Bacteria | 2138 |
| 16 | Ga0070683_100001565 | 3300005329 | Bacteria | 17682 |
| 17 | Ga0070683_100146710 | 3300005329 | Bacteria | 2236 |
| 18 | Ga0070677_10006891 | 3300005333 | Bacteria | 3777 |
| 19 | Ga0068869_100012775 | 3300005334 | Bacteria | 5555 |
| 20 | Ga0070680_100013900 | 3300005336 | Bacteria | 6280 |
| 21 | Ga0068868_100033616 | 3300005338 | Bacteria | 3953 |
| 22 | Ga0068868_100216671 | 3300005338 | Bacteria | 1602 |
| 23 | Ga0070661_100105407 | 3300005344 | Bacteria | 2101 |
| 24 | Ga0070668_100106944 | 3300005347 | Bacteria | 2223 |
| 25 | Ga0070669_100168450 | 3300005353 | Bacteria | 1706 |
| 26 | Ga0070669_100184879 | 3300005353 | Bacteria | 1632 |
| 27 | Ga0070709_10088483 | 3300005434 | Bacteria | 2037 |
| 28 | Ga0070714_100031635 | 3300005435 | Bacteria | 4417 |
| 29 | Ga0070714_100036306 | 3300005435 | Bacteria | 4132 |
| 30 | Ga0070713_100000894 | 3300005436 | Bacteria | 19127 |
| 31 | Ga0070710_10001586 | 3300005437 | Bacteria | 10738 |
| 32 | Ga0070711_100019339 | 3300005439 | Bacteria | 4368 |
| 33 | Ga0070711_100037502 | 3300005439 | Bacteria | 3253 |
| 34 | Ga0070663_100037052 | 3300005455 | Bacteria | 3393 |
| 35 | Ga0070663_100083563 | 3300005455 | Bacteria | 2351 |
| 36 | Ga0070663_100085621 | 3300005455 | Bacteria | 2326 |
| 37 | Ga0070662_100169078 | 3300005457 | Bacteria | 1716 |
| 38 | Ga0070681_10017623 | 3300005458 | Bacteria | 7137 |
| 39 | Ga0070681_10130932 | 3300005458 | Bacteria | 2441 |
| 40 | Ga0070681_10288955 | 3300005458 | Bacteria | 1550 |
| 41 | Ga0070699_100107339 | 3300005518 | Bacteria | 2449 |
| 42 | Ga0070679_100052438 | 3300005530 | Bacteria | 4062 |
| 43 | Ga0070679_100068439 | 3300005530 | Bacteria | 3541 |
| 44 | Ga0070679_100070108 | 3300005530 | Bacteria | 3497 |
| 45 | Ga0070679_100177156 | 3300005530 | Bacteria | 2105 |
| 46 | Ga0070684_100014375 | 3300005535 | Bacteria | 6410 |
| 47 | Ga0070684_100022655 | 3300005535 | Bacteria | 5243 |
| 48 | Ga0068853_100015356 | 3300005539 | Bacteria | 6294 |
| 49 | Ga0068853_100051620 | 3300005539 | Bacteria | 3540 |
| 50 | Ga0068853_100082005 | 3300005539 | Bacteria | 2824 |
| 51 | Ga0068853_100108527 | 3300005539 | Bacteria | 2463 |
| 52 | Ga0068853_100197522 | 3300005539 | Bacteria | 1830 |
| 53 | Ga0070686_100071473 | 3300005544 | Bacteria | 2272 |
| 54 | Ga0070693_100244506 | 3300005547 | Bacteria | 1187 |
| 55 | Ga0070665_100026270 | 3300005548 | Bacteria | 5864 |
| 56 | Ga0068855_100024730 | 3300005563 | Bacteria | 7185 |
| 57 | Ga0068855_100078376 | 3300005563 | Bacteria | 3833 |
| 58 | Ga0068855_100192544 | 3300005563 | Bacteria | 2299 |
| 59 | Ga0068855_100389103 | 3300005563 | Bacteria | 1530 |
| 60 | Ga0070664_100084505 | 3300005564 | Bacteria | 2740 |
| 61 | Ga0068857_100008796 | 3300005577 | Bacteria | 8744 |
| 62 | Ga0068857_100015818 | 3300005577 | Bacteria | 6601 |
| 63 | Ga0068857_100017740 | 3300005577 | Bacteria | 6240 |
| 64 | Ga0068857_100284534 | 3300005577 | Bacteria | 1521 |
| 65 | Ga0068854_100005353 | 3300005578 | Bacteria | 8103 |
| 66 | Ga0068856_100008062 | 3300005614 | Bacteria | 10279 |
| 67 | Ga0068856_100014980 | 3300005614 | Bacteria | 7489 |
| 68 | Ga0068856_100068386 | 3300005614 | Bacteria | 3511 |
| 69 | Ga0068856_100355798 | 3300005614 | Bacteria | 1483 |
| 70 | Ga0068852_100021412 | 3300005616 | Bacteria | 5162 |
| 71 | Ga0068852_100279286 | 3300005616 | Bacteria | 1609 |
| 72 | Ga0068859_100261505 | 3300005617 | Bacteria | 1822 |
| 73 | Ga0068864_100479675 | 3300005618 | Bacteria | 1193 |
| 74 | Ga0068861_100139649 | 3300005719 | Bacteria | 1976 |
| 75 | Ga0068851_10002011 | 3300005834 | Bacteria | 8961 |
| 76 | Ga0068851_10144390 | 3300005834 | Bacteria | 1297 |
| 77 | Ga0068858_100133880 | 3300005842 | Bacteria | 2325 |
| 78 | Ga0068858_100196525 | 3300005842 | Bacteria | 1906 |
| 79 | Ga0068858_100241544 | 3300005842 | Bacteria | 1714 |
| 80 | Ga0068860_100002293 | 3300005843 | Bacteria | 20101 |
| 81 | Ga0068862_100069003 | 3300005844 | Bacteria | 3050 |
| 82 | Ga0081455_10000694 | 3300005937 | Bacteria | 43697 |
| 83 | Ga0081455_10009590 | 3300005937 | Bacteria | 9943 |
| 84 | Ga0081455_10013202 | 3300005937 | Bacteria | 8181 |
| 85 | Ga0081455_10052828 | 3300005937 | Bacteria | 3476 |
| 86 | Ga0081538_10024227 | 3300005981 | Bacteria | 4329 |
| 87 | Ga0081540_1002390 | 3300005983 | Bacteria | 15316 |
| 88 | Ga0081540_1008166 | 3300005983 | Bacteria | 7341 |
| 89 | Ga0081540_1010619 | 3300005983 | Bacteria | 6217 |
| 90 | Ga0081540_1015853 | 3300005983 | Bacteria | 4750 |
| 91 | Ga0081540_1017401 | 3300005983 | Bacteria | 4452 |
| 92 | Ga0081540_1017481 | 3300005983 | Bacteria | 4438 |
| 93 | Ga0081540_1033754 | 3300005983 | Bacteria | 2772 |
| 94 | Ga0081540_1046396 | 3300005983 | Bacteria | 2195 |
| 95 | Ga0081539_10002152 | 3300005985 | Bacteria | 29064 |
| 96 | Ga0081539_10015391 | 3300005985 | Bacteria | 5561 |
| 97 | Ga0070717_10001686 | 3300006028 | Bacteria | 15364 |
| 98 | Ga0070717_10051304 | 3300006028 | Bacteria | 3395 |
| 99 | Ga0070717_10214156 | 3300006028 | Bacteria | 1692 |
| 100 | Ga0075365_10006703 | 3300006038 | Bacteria | 6367 |
| 101 | Ga0075365_10036594 | 3300006038 | Bacteria | 3180 |
| 102 | Ga0075365_10080375 | 3300006038 | Bacteria | 2207 |
| 103 | Ga0075365_10165007 | 3300006038 | Bacteria | 1545 |
| 104 | Ga0075365_10196846 | 3300006038 | Bacteria | 1411 |
| 105 | Ga0075368_10054432 | 3300006042 | Bacteria | 1594 |
| 106 | Ga0075363_100006169 | 3300006048 | Bacteria | 5418 |
| 107 | Ga0075364_10010755 | 3300006051 | Bacteria | 5536 |
| 108 | Ga0070712_100034887 | 3300006175 | Bacteria | 3411 |
| 109 | Ga0070712_100231797 | 3300006175 | Bacteria | 1467 |
| 110 | Ga0075362_10030289 | 3300006177 | Bacteria | 2336 |
| 111 | Ga0075362_10037389 | 3300006177 | Bacteria | 2128 |
| 112 | Ga0075367_10054294 | 3300006178 | Bacteria | 2376 |
| 113 | Ga0075366_10038337 | 3300006195 | Bacteria | 2830 |
| 114 | Ga0075366_10058775 | 3300006195 | Bacteria | 2284 |
| 115 | Ga0075366_10141581 | 3300006195 | Bacteria | 1454 |
| 116 | Ga0075370_10014208 | 3300006353 | Bacteria | 4243 |
| 117 | Ga0075370_10134378 | 3300006353 | Bacteria | 1444 |
| 118 | Ga0068871_100020428 | 3300006358 | Bacteria | 5073 |
| 119 | Ga0075430_100065067 | 3300006846 | Bacteria | 3063 |
| 120 | Ga0075431_100245228 | 3300006847 | Bacteria | 1821 |
| 121 | Ga0075434_100207360 | 3300006871 | Bacteria | 1981 |
| 122 | Ga0075436_100007805 | 3300006914 | Bacteria | 7320 |
| 123 | Ga0097620_100261533 | 3300006931 | Bacteria | 1822 |
| 124 | Ga0099825_1028536 | 3300006941 | Bacteria | 2702 |
| 125 | Ga0099824_1001145 | 3300006942 | Bacteria | 36195 |
| 126 | Ga0099824_1011035 | 3300006942 | Bacteria | 10394 |
| 127 | Ga0099822_1000135 | 3300006943 | Bacteria | 49135 |
| 128 | Ga0099823_1034197 | 3300006944 | Bacteria | 4037 |
| 129 | Ga0075435_100202135 | 3300007076 | Bacteria | 1684 |
| 130 | Ga0105240_10015213 | 3300009093 | Bacteria | 10468 |
| 131 | Ga0105240_10016353 | 3300009093 | Bacteria | 10046 |
| 132 | Ga0111539_10204300 | 3300009094 | Bacteria | 2303 |
| 133 | Ga0105245_10113486 | 3300009098 | Bacteria | 2523 |
| 134 | Ga0105247_10020077 | 3300009101 | Bacteria | 4016 |
| 135 | Ga0105247_10074790 | 3300009101 | Bacteria | 2125 |
| 136 | Ga0114129_10081574 | 3300009147 | Bacteria | 4496 |
| 137 | Ga0114129_10635750 | 3300009147 | Bacteria | 1379 |
| 138 | Ga0105243_10262613 | 3300009148 | Bacteria | 1546 |
| 139 | Ga0105241_10002904 | 3300009174 | Bacteria | 12800 |
| 140 | Ga0105241_10168183 | 3300009174 | Bacteria | 1808 |
| 141 | Ga0105242_10140477 | 3300009176 | Bacteria | 2095 |
| 142 | Ga0105248_10019495 | 3300009177 | Bacteria | 7506 |
| 143 | Ga0105248_10290037 | 3300009177 | Bacteria | 1842 |
| 144 | Ga0105237_10229935 | 3300009545 | Bacteria | 1855 |
| 145 | Ga0105237_10303872 | 3300009545 | Bacteria | 1598 |
| 146 | Ga0105238_10015659 | 3300009551 | Bacteria | 7677 |
| 147 | Ga0105238_10145976 | 3300009551 | Bacteria | 2342 |
| 148 | Ga0105238_10243468 | 3300009551 | Bacteria | 1776 |
| 149 | Ga0105238_10266982 | 3300009551 | Bacteria | 1692 |
| 150 | Ga0099796_10006477 | 3300010159 | Bacteria | 2999 |
| 151 | Ga0105239_10093089 | 3300010375 | Bacteria | 3327 |
| 152 | Ga0105246_10219576 | 3300011119 | Bacteria | 1489 |
| 153 | Ga0157370_10080759 | 3300013104 | Bacteria | 3061 |
| 154 | Ga0157370_10223467 | 3300013104 | Bacteria | 1744 |
| 155 | Ga0157370_10336985 | 3300013104 | Bacteria | 1390 |
| 156 | Ga0157369_10006988 | 3300013105 | Bacteria | 13021 |
| 157 | Ga0157369_10028226 | 3300013105 | Bacteria | 6212 |
| 158 | Ga0157374_10137921 | 3300013296 | Bacteria | 2366 |
| 159 | Ga0157378_10019120 | 3300013297 | Bacteria | 6019 |
| 160 | Ga0163162_10023410 | 3300013306 | Bacteria | 6095 |
| 161 | Ga0163162_10183875 | 3300013306 | Bacteria | 2217 |
| 162 | Ga0157372_10184205 | 3300013307 | Bacteria | 2418 |
| 163 | Ga0157372_10213221 | 3300013307 | Bacteria | 2238 |
| 164 | Ga0157375_10053209 | 3300013308 | Bacteria | 3982 |
| 165 | Ga0163163_10038761 | 3300014325 | Bacteria | 4645 |
| 166 | Ga0163163_10180779 | 3300014325 | Bacteria | 2156 |
| 167 | Ga0163163_10266422 | 3300014325 | Bacteria | 1764 |
| 168 | Ga0157376_10070725 | 3300014969 | Bacteria | 2963 |
| 169 | Ga0213876_10004532 | 3300021384 | Bacteria | 7760 |
| 170 | Ga0213876_10005943 | 3300021384 | Bacteria | 6669 |
| 171 | Ga0209677_100338 | 3300025253 | Bacteria | 29865 |
| 172 | Ga0209148_1000526 | 3300025254 | Bacteria | 37777 |
| 173 | Ga0209233_1001495 | 3300025261 | Bacteria | 9194 |
| 174 | Ga0209233_1002702 | 3300025261 | Bacteria | 6407 |
| 175 | Ga0209233_1003005 | 3300025261 | Bacteria | 6005 |
| 176 | Ga0209455_1000950 | 3300025272 | Bacteria | 14783 |
| 177 | Ga0209564_1000842 | 3300025295 | Bacteria | 41342 |
| 178 | Ga0209564_1002401 | 3300025295 | Bacteria | 14944 |
| 179 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 180 | Ga0209758_1001439 | 3300025297 | Bacteria | 28039 |
| 181 | Ga0209758_1016688 | 3300025297 | Bacteria | 3711 |
| 182 | Ga0209758_1025551 | 3300025297 | Bacteria | 2587 |
| 183 | Ga0209256_1012677 | 3300025299 | Bacteria | 3196 |
| 184 | Ga0209256_1033976 | 3300025299 | Bacteria | 1364 |
| 185 | Ga0207426_1001551 | 3300025302 | Bacteria | 18658 |
| 186 | Ga0207426_1014202 | 3300025302 | Bacteria | 2923 |
| 187 | Ga0207426_1017734 | 3300025302 | Bacteria | 2524 |
| 188 | Ga0209257_1000983 | 3300025304 | Bacteria | 38689 |
| 189 | Ga0209257_1013500 | 3300025304 | Bacteria | 3624 |
| 190 | Ga0209257_1027371 | 3300025304 | Bacteria | 1899 |
| 191 | Ga0207656_10001869 | 3300025321 | Bacteria | 7005 |
| 192 | Ga0207682_10003162 | 3300025893 | Bacteria | 7212 |
| 193 | Ga0207692_10020713 | 3300025898 | Bacteria | 2996 |
| 194 | Ga0207642_10016138 | 3300025899 | Bacteria | 2805 |
| 195 | Ga0207647_10014320 | 3300025904 | Bacteria | 5469 |
| 196 | Ga0207647_10039544 | 3300025904 | Bacteria | 2974 |
| 197 | Ga0207699_10003862 | 3300025906 | Bacteria | 7158 |
| 198 | Ga0207654_10000611 | 3300025911 | Bacteria | 20145 |
| 199 | Ga0207707_10258963 | 3300025912 | Bacteria | 1510 |
| 200 | Ga0207695_10002336 | 3300025913 | Bacteria | 28213 |
| 201 | Ga0207695_10153976 | 3300025913 | Bacteria | 2235 |
| 202 | Ga0207695_10295764 | 3300025913 | Bacteria | 1511 |
| 203 | Ga0207671_10020119 | 3300025914 | Bacteria | 5089 |
| 204 | Ga0207671_10079450 | 3300025914 | Bacteria | 2458 |
| 205 | Ga0207671_10153300 | 3300025914 | Bacteria | 1781 |
| 206 | Ga0207671_10200364 | 3300025914 | Bacteria | 1559 |
| 207 | Ga0207671_10225206 | 3300025914 | Bacteria | 1470 |
| 208 | Ga0207693_10033060 | 3300025915 | Bacteria | 4082 |
| 209 | Ga0207693_10203955 | 3300025915 | Bacteria | 1555 |
| 210 | Ga0207693_10238579 | 3300025915 | Bacteria | 1427 |
| 211 | Ga0207657_10018608 | 3300025919 | Bacteria | 6621 |
| 212 | Ga0207652_10084927 | 3300025921 | Bacteria | 2774 |
| 213 | Ga0207694_10004635 | 3300025924 | Bacteria | 10703 |
| 214 | Ga0207694_10024912 | 3300025924 | Bacteria | 4545 |
| 215 | Ga0207694_10227017 | 3300025924 | Bacteria | 1524 |
| 216 | Ga0207694_10300553 | 3300025924 | Bacteria | 1321 |
| 217 | Ga0207650_10325946 | 3300025925 | Bacteria | 1259 |
| 218 | Ga0207687_10017762 | 3300025927 | Bacteria | 4690 |
| 219 | Ga0207700_10017910 | 3300025928 | Bacteria | 4743 |
| 220 | Ga0207700_10135033 | 3300025928 | Bacteria | 2019 |
| 221 | Ga0207664_10029903 | 3300025929 | Bacteria | 4155 |
| 222 | Ga0207690_10040950 | 3300025932 | Bacteria | 3032 |
| 223 | Ga0207706_10231402 | 3300025933 | Bacteria | 1617 |
| 224 | Ga0207686_10193846 | 3300025934 | Bacteria | 1450 |
| 225 | Ga0207709_10176522 | 3300025935 | Bacteria | 1504 |
| 226 | Ga0207665_10013172 | 3300025939 | Bacteria | 5438 |
| 227 | Ga0207665_10117482 | 3300025939 | Bacteria | 1876 |
| 228 | Ga0207711_10010567 | 3300025941 | Bacteria | 7673 |
| 229 | Ga0207711_10148668 | 3300025941 | Bacteria | 2113 |
| 230 | Ga0207689_10061889 | 3300025942 | Bacteria | 3078 |
| 231 | Ga0207689_10078436 | 3300025942 | Bacteria | 2714 |
| 232 | Ga0207689_10117316 | 3300025942 | Bacteria | 2189 |
| 233 | Ga0207661_10001882 | 3300025944 | Bacteria | 14372 |
| 234 | Ga0207679_10061253 | 3300025945 | Bacteria | 2800 |
| 235 | Ga0207679_10186638 | 3300025945 | Bacteria | 1720 |
| 236 | Ga0207667_10030615 | 3300025949 | Bacteria | 5819 |
| 237 | Ga0207667_10057824 | 3300025949 | Bacteria | 4069 |
| 238 | Ga0207667_10522601 | 3300025949 | Bacteria | 1202 |
| 239 | Ga0207640_10007270 | 3300025981 | Bacteria | 6109 |
| 240 | Ga0207640_10013948 | 3300025981 | Bacteria | 4615 |
| 241 | Ga0207703_10011565 | 3300026035 | Bacteria | 6863 |
| 242 | Ga0207703_10200289 | 3300026035 | Bacteria | 1774 |
| 243 | Ga0207639_10023132 | 3300026041 | Bacteria | 4484 |
| 244 | Ga0207639_10454683 | 3300026041 | Bacteria | 1163 |
| 245 | Ga0207678_10105683 | 3300026067 | Bacteria | 2402 |
| 246 | Ga0207678_10154313 | 3300026067 | Bacteria | 1961 |
| 247 | Ga0207678_10178676 | 3300026067 | Bacteria | 1812 |
| 248 | Ga0207678_10245789 | 3300026067 | Bacteria | 1532 |
| 249 | Ga0207708_10098589 | 3300026075 | Bacteria | 2259 |
| 250 | Ga0207702_10000122 | 3300026078 | Bacteria | 91685 |
| 251 | Ga0207702_10037901 | 3300026078 | Bacteria | 4037 |
| 252 | Ga0207702_10184811 | 3300026078 | Bacteria | 1922 |
| 253 | Ga0207702_10356479 | 3300026078 | Bacteria | 1401 |
| 254 | Ga0207641_10111703 | 3300026088 | Bacteria | 2424 |
| 255 | Ga0207674_10005252 | 3300026116 | Bacteria | 15415 |
| 256 | Ga0207674_10012191 | 3300026116 | Bacteria | 9617 |
| 257 | Ga0207674_10252195 | 3300026116 | Bacteria | 1712 |
| 258 | Ga0207675_100316363 | 3300026118 | Bacteria | 1523 |
| 259 | Ga0207683_10040371 | 3300026121 | Bacteria | 4072 |
| 260 | Ga0207683_10049862 | 3300026121 | Bacteria | 3665 |
| 261 | Ga0207683_10077702 | 3300026121 | Bacteria | 2940 |
| 262 | Ga0207683_10086902 | 3300026121 | Bacteria | 2780 |
| 263 | Ga0207698_10119646 | 3300026142 | Bacteria | 2226 |
| 264 | Ga0209389_1000076 | 3300027296 | Bacteria | 92447 |
| 265 | Ga0209389_1000328 | 3300027296 | Bacteria | 29034 |
| 266 | Ga0209589_1003134 | 3300027357 | Bacteria | 29000 |
| 267 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 268 | Ga0209489_103754 | 3300027361 | Bacteria | 29057 |
| 269 | Ga0209489_108247 | 3300027361 | Bacteria | 14478 |
| 270 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 271 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 272 | Ga0268266_10001497 | 3300028379 | Bacteria | 27614 |
| 273 | Ga0268266_10299813 | 3300028379 | Bacteria | 1499 |
| 274 | Ga0268264_10000187 | 3300028381 | Bacteria | 129270 |
| 275 | Ga0268264_10091945 | 3300028381 | Bacteria | 2618 |
| 276 | Ga0265337_1018969 | 3300028556 | Bacteria | 2176 |
| 277 | Ga0265319_1009816 | 3300028563 | Bacteria | 4041 |
| 278 | Ga0265318_10015874 | 3300028577 | Bacteria | 3120 |
| 279 | Ga0265323_10001213 | 3300028653 | Bacteria | 13068 |
| 280 | Ga0265336_10001031 | 3300028666 | Bacteria | 13671 |
| 281 | Ga0307517_10000066 | 3300028786 | Bacteria | 141370 |
| 282 | Ga0265338_10000973 | 3300028800 | Bacteria | 48208 |
| 283 | Ga0265324_10001933 | 3300029957 | Bacteria | 11112 |
| 284 | Ga0265332_10019280 | 3300031238 | Bacteria | 3010 |
| 285 | Ga0265325_10015080 | 3300031241 | Bacteria | 4355 |
| 286 | Ga0265340_10000659 | 3300031247 | Bacteria | 19392 |
| 287 | Ga0265340_10010166 | 3300031247 | Bacteria | 5039 |
| 288 | Ga0265340_10011689 | 3300031247 | Bacteria | 4658 |
| 289 | Ga0265340_10067015 | 3300031247 | Bacteria | 1707 |
| 290 | Ga0265339_10001158 | 3300031249 | Bacteria | 19908 |
| 291 | Ga0265339_10004448 | 3300031249 | Bacteria | 9563 |
| 292 | Ga0265339_10011598 | 3300031249 | Bacteria | 5416 |
| 293 | Ga0265331_10036923 | 3300031250 | Bacteria | 2395 |
| 294 | Ga0265331_10096895 | 3300031250 | Bacteria | 1360 |
| 295 | Ga0265331_10105280 | 3300031250 | Bacteria | 1296 |
| 296 | Ga0265316_10009504 | 3300031344 | Bacteria | 8952 |
| 297 | Ga0265316_10055949 | 3300031344 | Bacteria | 3084 |
| 298 | Ga0265316_10069595 | 3300031344 | Bacteria | 2716 |
| 299 | Ga0265316_10121355 | 3300031344 | Bacteria | 1974 |
| 300 | Ga0265316_10167132 | 3300031344 | Bacteria | 1642 |
| 301 | Ga0307513_10279691 | 3300031456 | Bacteria | 1447 |
| 302 | Ga0307509_10197471 | 3300031507 | Bacteria | 1853 |
| 303 | Ga0307509_10257676 | 3300031507 | Bacteria | 1522 |
| 304 | Ga0265313_10002138 | 3300031595 | Bacteria | 17573 |
| 305 | Ga0265313_10009770 | 3300031595 | Bacteria | 6182 |
| 306 | Ga0265313_10031726 | 3300031595 | Bacteria | 2705 |
| 307 | Ga0265313_10032142 | 3300031595 | Bacteria | 2684 |
| 308 | Ga0307508_10000613 | 3300031616 | Bacteria | 42773 |
| 309 | Ga0307508_10034912 | 3300031616 | Bacteria | 4532 |
| 310 | Ga0307508_10041880 | 3300031616 | Bacteria | 4110 |
| 311 | Ga0307508_10053567 | 3300031616 | Bacteria | 3580 |
| 312 | Ga0307508_10106984 | 3300031616 | Bacteria | 2395 |
| 313 | Ga0265314_10129397 | 3300031711 | Bacteria | 1577 |
| 314 | Ga0265342_10001734 | 3300031712 | Bacteria | 19908 |
| 315 | Ga0265342_10002077 | 3300031712 | Bacteria | 17755 |
| 316 | Ga0265342_10028709 | 3300031712 | Bacteria | 3461 |
| 317 | Ga0307516_10011022 | 3300031730 | Bacteria | 9878 |
| 318 | Ga0307516_10170369 | 3300031730 | Bacteria | 1918 |
| 319 | Ga0307516_10219537 | 3300031730 | Bacteria | 1611 |
| 320 | Ga0307413_10210324 | 3300031824 | Bacteria | 1412 |
| 321 | Ga0307409_100260450 | 3300031995 | Bacteria | 1591 |
| 322 | Ga0307415_100038694 | 3300032126 | Bacteria | 3146 |
| 323 | Ga0307507_10006502 | 3300033179 | Bacteria | 17885 |
| 324 | Ga0307510_10005570 | 3300033180 | Bacteria | 15003 |
| 325 | Ga0307510_10093046 | 3300033180 | Bacteria | 2848 |
| 326 | Ga0315911_1000033 | 3300033442 | Bacteria | 67159 |
| 327 | Ga0373934_0001371 | 3300035086 | Bacteria | 8873 |
| 328 | Ga0373923_0000577 | 3300035111 | Bacteria | 9052 |
| 329 | Ga0373923_0016525 | 3300035111 | Bacteria | 2806 |
| 330 | Ga0373936_0010575 | 3300035113 | Bacteria | 3483 |
| 331 | Ga0373953_0004018 | 3300035117 | Bacteria | 4645 |
| 332 | Ga0373954_0010639 | 3300035118 | Bacteria | 4063 |
| 333 | Ga0373954_0020018 | 3300035118 | Bacteria | 3022 |
| 334 | Ga0373954_0039736 | 3300035118 | Bacteria | 2190 |
| 335 | Ga0373957_0005528 | 3300035120 | Bacteria | 3920 |
| 336 | Ga0373957_0013008 | 3300035120 | Bacteria | 2815 |
| 337 | Ga0373943_0000679 | 3300035170 | Bacteria | 14825 |
| 338 | Ga0373943_0021168 | 3300035170 | Bacteria | 3002 |
| 339 | Ga0373943_0073247 | 3300035170 | Bacteria | 1739 |
| 340 | Ga0373946_0000693 | 3300035171 | Bacteria | 11371 |
| 341 | Ga0373946_0009020 | 3300035171 | Bacteria | 3669 |
| 342 | Ga0373946_0023553 | 3300035171 | Bacteria | 2407 |
| 343 | Ga0373955_0000054 | 3300035172 | Bacteria | 44460 |
| 344 | Ga0373955_0001137 | 3300035172 | Bacteria | 11295 |
| 345 | Ga0373955_0041035 | 3300035172 | Bacteria | 2478 |
| 346 | Ga0373924_0000398 | 3300035410 | Bacteria | 13331 |
| 347 | Ga0373924_0009678 | 3300035410 | Bacteria | 3541 |
| 348 | Ga0373935_0000223 | 3300035692 | Bacteria | 27646 |
| 349 | Ga0373935_0025193 | 3300035692 | Bacteria | 3666 |
| 350 | Ga0373935_0172785 | 3300035692 | Bacteria | 1479 |
| 351 | Ga0373927_0004222 | 3300035695 | Bacteria | 10088 |
| 352 | Ga0373927_0007175 | 3300035695 | Bacteria | 7562 |
| 353 | Ga0373927_0010394 | 3300035695 | Bacteria | 6210 |
| 354 | Ga0373927_0199630 | 3300035695 | Bacteria | 1313 |
| 355 | Ga0373933_0001275 | 3300035724 | Bacteria | 14840 |
| 356 | Ga0373933_0002154 | 3300035724 | Bacteria | 11278 |
| 357 | Ga0373947_0000552 | 3300035725 | Bacteria | 21816 |
| 358 | Ga0373947_0006263 | 3300035725 | Bacteria | 6916 |
| 359 | Ga0373947_0018272 | 3300035725 | Bacteria | 4035 |
| 360 | Ga0373937_0000006 | 3300036401 | Bacteria | 194781 |
| 361 | Ga0373937_0014047 | 3300036401 | Bacteria | 7061 |
| 362 | Ga0373937_0055609 | 3300036401 | Bacteria | 3633 |
| 363 | Ga0373937_0149252 | 3300036401 | Bacteria | 2189 |
| 364 | Ga0316582_0088660 | 3300036647 | Bacteria | 2033 |
| 365 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 366 | Ga0373925_0003884 | 3300037068 | Bacteria | 11423 |
| 367 | Ga0373925_0019170 | 3300037068 | Bacteria | 4975 |
| 368 | Ga0373925_0020613 | 3300037068 | Bacteria | 4802 |
| 369 | Ga0395900_0005628 | 3300037418 | Bacteria | 13105 |
| 370 | Ga0395898_0010285 | 3300037466 | Bacteria | 9792 |
| 371 | Ga0395898_0013582 | 3300037466 | Bacteria | 8381 |
| 372 | Ga0395898_0017075 | 3300037466 | Bacteria | 7412 |
| 373 | Ga0395898_0164092 | 3300037466 | Bacteria | 2125 |
| 374 | Ga0395905_0039470 | 3300037471 | Bacteria | 4429 |
| 375 | Ga0436364_0716895 | 3300037853 | Bacteria | 3339 |
| 376 | Ga0436364_1428694 | 3300037853 | Bacteria | 1534 |
| 377 | Ga0395901_0059614 | 3300038443 | Bacteria | 3971 |
| 378 | Ga0436365_0253472 | 3300039437 | Bacteria | 28103 |
| 379 | Ga0436365_0856193 | 3300039437 | Bacteria | 5361 |
| 380 | Ga0436365_1272636 | 3300039437 | Bacteria | 5735 |
| 381 | Ga0436360_0752976 | 3300039438 | Bacteria | 2553 |
| 382 | Ga0436363_0815901 | 3300039450 | Bacteria | 5650 |
| 383 | Ga0436362_0199820 | 3300039453 | Bacteria | 2676 |
| 384 | Ga0439434_0013050 | 3300042435 | Bacteria | 2464 |
| 385 | Ga0466972_0018721 | 3300044658 | Bacteria | 3462 |
| 386 | Ga0466966_0013783 | 3300044684 | Bacteria | 5349 |
| 387 | Ga0466966_0073894 | 3300044684 | Bacteria | 2132 |
| 388 | Ga0466961_0001950 | 3300044693 | Bacteria | 12859 |
| 389 | Ga0466963_0253525 | 3300044694 | Bacteria | 1235 |
| 390 | Ga0466957_0051062 | 3300044842 | Bacteria | 2517 |
| 391 | Ga0466959_0027416 | 3300045049 | Bacteria | 4226 |
| 392 | Ga0466959_0073552 | 3300045049 | Bacteria | 2472 |
| 393 | Ga0466967_0081292 | 3300045976 | Bacteria | 2926 |
| 394 | Ga0495617_005797 | 3300046452 | Bacteria | 4360 |
| 395 | Ga0495592_0000086 | 3300046454 | Bacteria | 82248 |
| 396 | Ga0495592_0003994 | 3300046454 | Bacteria | 10701 |
| 397 | Ga0495592_0020082 | 3300046454 | Bacteria | 5079 |
| 398 | Ga0495603_0098736 | 3300046455 | Bacteria | 1705 |
| 399 | Ga0495590_0043476 | 3300046457 | Bacteria | 1567 |
| 400 | Ga0495629_0003367 | 3300046459 | Bacteria | 12076 |
| 401 | Ga0495629_0004779 | 3300046459 | Bacteria | 10153 |
| 402 | Ga0495651_0000562 | 3300046462 | Bacteria | 28694 |
| 403 | Ga0495651_0010838 | 3300046462 | Bacteria | 7009 |
| 404 | Ga0495651_0016408 | 3300046462 | Bacteria | 5736 |
| 405 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 406 | Ga0495653_0034560 | 3300046463 | Bacteria | 3997 |
| 407 | Ga0495580_0003379 | 3300046472 | Bacteria | 13637 |
| 408 | Ga0495582_0000063 | 3300046473 | Bacteria | 54381 |
| 409 | Ga0495582_0011820 | 3300046473 | Bacteria | 4808 |
| 410 | Ga0495605_0060869 | 3300046474 | Bacteria | 1808 |
| 411 | Ga0495605_0075976 | 3300046474 | Bacteria | 1579 |
| 412 | Ga0495639_0019155 | 3300046475 | Bacteria | 2986 |
| 413 | Ga0495639_0061591 | 3300046475 | Bacteria | 1721 |
| 414 | Ga0495662_0003113 | 3300046476 | Bacteria | 8366 |
| 415 | Ga0495662_0003942 | 3300046476 | Bacteria | 7484 |
| 416 | Ga0495662_0016897 | 3300046476 | Bacteria | 3531 |
| 417 | Ga0495662_0103256 | 3300046476 | Bacteria | 1395 |
| 418 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 419 | Ga0495664_0068451 | 3300046477 | Bacteria | 2118 |
| 420 | Ga0495664_0106785 | 3300046477 | Bacteria | 1688 |
| 421 | Ga0495594_0000983 | 3300046499 | Bacteria | 14813 |
| 422 | Ga0495607_0031784 | 3300046501 | Bacteria | 3229 |
| 423 | Ga0495606_0109856 | 3300046507 | Bacteria | 1665 |
| 424 | Ga0495608_0000009 | 3300046511 | Bacteria | 266614 |
| 425 | Ga0495608_0003227 | 3300046511 | Bacteria | 11663 |
| 426 | Ga0495616_0082070 | 3300046513 | Bacteria | 1540 |
| 427 | Ga0495616_0085737 | 3300046513 | Bacteria | 1499 |
| 428 | Ga0495618_0000005 | 3300046514 | Bacteria | 230421 |
| 429 | Ga0495618_0015285 | 3300046514 | Bacteria | 4684 |
| 430 | Ga0495620_0029575 | 3300046515 | Bacteria | 2533 |
| 431 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 432 | Ga0495628_0010286 | 3300046516 | Bacteria | 7951 |
| 433 | Ga0495628_0033112 | 3300046516 | Bacteria | 4167 |
| 434 | Ga0495630_0000240 | 3300046517 | Bacteria | 43911 |
| 435 | Ga0495631_0041240 | 3300046518 | Bacteria | 2043 |
| 436 | Ga0495632_0083939 | 3300046519 | Bacteria | 1516 |
| 437 | Ga0495643_0071976 | 3300046522 | Bacteria | 1813 |
| 438 | Ga0495648_0000581 | 3300046524 | Bacteria | 39115 |
| 439 | Ga0495648_0005379 | 3300046524 | Bacteria | 10647 |
| 440 | Ga0495648_0048824 | 3300046524 | Bacteria | 2601 |
| 441 | Ga0495648_0161246 | 3300046524 | Bacteria | 1159 |
| 442 | Ga0495666_0027895 | 3300046526 | Bacteria | 2779 |
| 443 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 444 | Ga0495654_0020401 | 3300046530 | Bacteria | 3454 |
| 445 | Ga0495665_0000163 | 3300046531 | Bacteria | 33358 |
| 446 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 447 | Ga0495640_0013346 | 3300046533 | Bacteria | 6243 |
| 448 | Ga0495640_0027733 | 3300046533 | Bacteria | 4082 |
| 449 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 450 | Ga0495587_0013963 | 3300046536 | Bacteria | 5043 |
| 451 | Ga0495587_0048865 | 3300046536 | Bacteria | 2505 |
| 452 | Ga0495587_0133702 | 3300046536 | Bacteria | 1417 |
| 453 | Ga0495609_0072592 | 3300046538 | Bacteria | 1511 |
| 454 | Ga0495597_0095283 | 3300046542 | Bacteria | 1259 |
| 455 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 456 | Ga0495645_0008551 | 3300046543 | Bacteria | 7149 |
| 457 | Ga0495645_0161988 | 3300046543 | Bacteria | 1546 |
| 458 | Ga0495622_0003604 | 3300046557 | Bacteria | 7272 |
| 459 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 460 | Ga0495667_0012398 | 3300046559 | Bacteria | 5778 |
| 461 | Ga0495667_0056717 | 3300046559 | Bacteria | 2575 |
| 462 | Ga0495668_0105270 | 3300046616 | Bacteria | 1543 |
| 463 | Ga0495634_0000370 | 3300046642 | Bacteria | 43881 |
| 464 | Ga0495611_0026482 | 3300046648 | Bacteria | 2530 |
| 465 | Ga0495625_0090138 | 3300046660 | Bacteria | 2122 |
| 466 | Ga0495635_0000020 | 3300046663 | Bacteria | 189698 |
| 467 | Ga0495635_0000220 | 3300046663 | Bacteria | 36107 |
| 468 | Ga0495659_0032352 | 3300046664 | Bacteria | 1830 |
| 469 | Ga0495661_0045231 | 3300046665 | Bacteria | 2693 |
| 470 | Ga0495588_0007149 | 3300046674 | Bacteria | 5063 |
| 471 | Ga0495588_0091896 | 3300046674 | Bacteria | 1590 |
| 472 | Ga0495588_0124810 | 3300046674 | Bacteria | 1357 |
| 473 | Ga0495657_0000240 | 3300046675 | Bacteria | 49927 |
| 474 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 475 | Ga0495599_0001306 | 3300046678 | Bacteria | 14176 |
| 476 | Ga0495599_0108425 | 3300046678 | Bacteria | 1730 |
| 477 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 478 | Ga0495623_0040331 | 3300046679 | Bacteria | 2981 |
| 479 | Ga0495623_0054944 | 3300046679 | Bacteria | 2511 |
| 480 | Ga0495623_0139293 | 3300046679 | Bacteria | 1445 |
| 481 | Ga0495646_0000013 | 3300046680 | Bacteria | 159700 |
| 482 | Ga0495646_0007434 | 3300046680 | Bacteria | 6965 |
| 483 | Ga0495646_0016383 | 3300046680 | Bacteria | 4703 |
| 484 | Ga0495646_0078644 | 3300046680 | Bacteria | 1927 |
| 485 | Ga0495647_0000198 | 3300046681 | Bacteria | 16065 |
| 486 | Ga0495658_0000366 | 3300046683 | Bacteria | 25377 |
| 487 | Ga0495613_0000449 | 3300046689 | Bacteria | 35095 |
| 488 | Ga0495613_0023466 | 3300046689 | Bacteria | 4596 |
| 489 | Ga0495624_0001125 | 3300046690 | Bacteria | 21160 |
| 490 | Ga0495624_0026919 | 3300046690 | Bacteria | 3767 |
| 491 | Ga0495624_0117597 | 3300046690 | Bacteria | 1633 |
| 492 | Ga0495670_0003885 | 3300046691 | Bacteria | 7338 |
| 493 | Ga0495670_0034095 | 3300046691 | Bacteria | 2534 |
| 494 | Ga0495600_0000041 | 3300046809 | Bacteria | 75747 |
| 495 | Ga0495600_0016918 | 3300046809 | Bacteria | 4635 |
| 496 | Ga0495600_0021771 | 3300046809 | Bacteria | 4110 |
| 497 | Ga0495600_0040334 | 3300046809 | Bacteria | 3040 |
| 498 | Ga0495600_0169077 | 3300046809 | Bacteria | 1411 |
| 499 | Ga0495660_0027364 | 3300046810 | Bacteria | 3227 |
| 500 | Ga0495581_0000291 | 3300047315 | Bacteria | 24325 |
| 501 | Ga0495581_0009344 | 3300047315 | Bacteria | 5675 |
| 502 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 503 | Ga0495604_0013280 | 3300047317 | Bacteria | 6558 |
| 504 | Ga0495604_0028647 | 3300047317 | Bacteria | 4431 |
| 505 | Ga0495604_0072107 | 3300047317 | Bacteria | 2611 |
| 506 | Ga0495604_0074633 | 3300047317 | Bacteria | 2555 |
| 507 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 508 | Ga0495674_0003711 | 3300047319 | Bacteria | 14850 |
| 509 | Ga0495674_0006640 | 3300047319 | Bacteria | 11084 |
| 510 | Ga0495674_0103843 | 3300047319 | Bacteria | 2416 |
| 511 | Ga0495672_0088022 | 3300047320 | Bacteria | 1713 |
| 512 | Ga0495676_0041740 | 3300047321 | Bacteria | 3773 |
| 513 | Ga0495680_0000002 | 3300047322 | Bacteria | 197533 |
| 514 | Ga0495680_0004170 | 3300047322 | Bacteria | 13895 |
| 515 | Ga0495680_0026130 | 3300047322 | Bacteria | 4819 |
| 516 | Ga0495680_0115113 | 3300047322 | Bacteria | 1990 |
| 517 | Ga0495675_0000010 | 3300047444 | Bacteria | 153375 |
| 518 | Ga0495675_0006969 | 3300047444 | Bacteria | 6947 |
| 519 | Ga0495675_0016527 | 3300047444 | Bacteria | 4668 |
| 520 | Ga0495684_0000020 | 3300047471 | Bacteria | 148507 |
| 521 | Ga0495684_0000133 | 3300047471 | Bacteria | 54433 |
| 522 | Ga0495684_0241806 | 3300047471 | Bacteria | 1316 |
| 523 | Ga0495686_0036398 | 3300047472 | Bacteria | 3159 |
| 524 | Ga0495593_0000108 | 3300047673 | Bacteria | 38360 |
| 525 | Ga0495593_0000323 | 3300047673 | Bacteria | 26455 |
| 526 | Ga0495593_0003730 | 3300047673 | Bacteria | 9087 |
| 527 | Ga0495602_0000027 | 3300048088 | Bacteria | 145010 |
| 528 | Ga0495602_0023495 | 3300048088 | Bacteria | 6003 |
| 529 | Ga0495615_0018412 | 3300048090 | Bacteria | 1537 |
| 530 | Ga0496100_0040920 | 3300048903 | Bacteria | 2952 |
| 531 | Ga0496101_0004227 | 3300048904 | Bacteria | 9005 |
| 532 | Ga0496102_0012581 | 3300048905 | Bacteria | 7329 |
| 533 | Ga0496102_0179781 | 3300048905 | Bacteria | 1993 |
| 534 | Ga0496103_0010963 | 3300048906 | Bacteria | 5365 |
| 535 | Ga0496103_0110634 | 3300048906 | Bacteria | 1745 |
| 536 | Ga0496105_0018947 | 3300048908 | Bacteria | 5544 |
| 537 | Ga0496105_0042265 | 3300048908 | Bacteria | 3757 |
| 538 | Ga0496106_0002313 | 3300048909 | Bacteria | 14208 |
| 539 | Ga0496106_0009042 | 3300048909 | Bacteria | 7363 |
| 540 | Ga0496106_0047142 | 3300048909 | Bacteria | 3242 |
| 541 | Ga0496106_0058681 | 3300048909 | Bacteria | 2914 |
| 542 | Ga0496107_0004737 | 3300048910 | Bacteria | 9242 |
| 543 | Ga0496107_0155255 | 3300048910 | Bacteria | 1694 |
| 544 | Ga0496108_0000442 | 3300048911 | Bacteria | 33309 |
| 545 | Ga0496108_0044295 | 3300048911 | Bacteria | 3715 |
| 546 | Ga0496108_0368993 | 3300048911 | Bacteria | 1253 |
| 547 | Ga0496109_0004462 | 3300048912 | Bacteria | 11691 |
| 548 | Ga0496109_0069224 | 3300048912 | Bacteria | 3236 |
| 549 | Ga0496110_0042506 | 3300048913 | Bacteria | 3967 |
| 550 | Ga0496110_0120346 | 3300048913 | Bacteria | 2365 |
| 551 | Ga0496110_0147709 | 3300048913 | Bacteria | 2127 |
| 552 | Ga0496112_0197363 | 3300048915 | Bacteria | 1973 |
| 553 | Ga0496113_0033938 | 3300048916 | Bacteria | 3720 |
| 554 | Ga0496113_0070936 | 3300048916 | Bacteria | 2649 |
| 555 | Ga0496114_0049691 | 3300048917 | Bacteria | 3490 |
| 556 | Ga0496114_0090029 | 3300048917 | Bacteria | 2605 |
| 557 | Ga0496115_0001756 | 3300048918 | Bacteria | 15546 |
| 558 | Ga0496115_0113445 | 3300048918 | Bacteria | 2227 |
| 559 | Ga0496117_0021787 | 3300048920 | Bacteria | 5170 |
| 560 | Ga0496118_0002489 | 3300048921 | Bacteria | 24727 |
| 561 | Ga0496118_0025329 | 3300048921 | Bacteria | 5091 |
| 562 | Ga0496118_0103304 | 3300048921 | Bacteria | 1917 |
| 563 | Ga0496119_0000308 | 3300048922 | Bacteria | 68303 |
| 564 | Ga0496119_0025270 | 3300048922 | Bacteria | 4152 |
| 565 | Ga0496119_0040867 | 3300048922 | Bacteria | 2960 |
| 566 | Ga0496120_0103401 | 3300048923 | Bacteria | 1501 |
| 567 | Ga0496121_0000144 | 3300048924 | Bacteria | 156856 |
| 568 | Ga0496121_0003740 | 3300048924 | Bacteria | 21314 |
| 569 | Ga0496121_0004310 | 3300048924 | Bacteria | 19264 |
| 570 | Ga0496121_0057626 | 3300048924 | Bacteria | 3218 |
| 571 | Ga0496121_0064926 | 3300048924 | Bacteria | 2973 |
| 572 | Ga0496121_0127234 | 3300048924 | Bacteria | 1913 |
| 573 | Ga0496122_0001649 | 3300048925 | Bacteria | 34644 |
| 574 | Ga0496122_0022588 | 3300048925 | Bacteria | 5585 |
| 575 | Ga0496123_0000602 | 3300048926 | Bacteria | 61127 |
| 576 | Ga0496124_0003743 | 3300048927 | Bacteria | 18323 |
| 577 | Ga0496125_0000595 | 3300048928 | Bacteria | 61641 |
| 578 | Ga0496125_0018116 | 3300048928 | Bacteria | 6693 |
| 579 | Ga0496125_0020298 | 3300048928 | Bacteria | 6237 |
| 580 | Ga0496125_0020399 | 3300048928 | Bacteria | 6220 |
| 581 | Ga0496125_0025285 | 3300048928 | Bacteria | 5440 |
| 582 | Ga0496125_0028888 | 3300048928 | Bacteria | 4995 |
| 583 | Ga0496125_0175258 | 3300048928 | Bacteria | 1436 |
| 584 | Ga0496126_0009944 | 3300048929 | Bacteria | 10044 |
| 585 | Ga0496126_0022532 | 3300048929 | Bacteria | 6125 |
| 586 | Ga0496126_0040649 | 3300048929 | Bacteria | 4310 |
| 587 | Ga0496126_0041278 | 3300048929 | Bacteria | 4271 |
| 588 | Ga0496126_0054677 | 3300048929 | Bacteria | 3614 |
| 589 | Ga0496126_0099966 | 3300048929 | Bacteria | 2539 |
| 590 | Ga0496126_0106456 | 3300048929 | Bacteria | 2447 |
| 591 | Ga0496126_0134009 | 3300048929 | Bacteria | 2138 |
| 592 | Ga0496126_0223294 | 3300048929 | Bacteria | 1581 |
| 593 | Ga0495678_054176 | 3300049459 | Bacteria | 1537 |
| 594 | Ga0501031_0009305 | 3300049568 | Bacteria | 6386 |
| 595 | Ga0501031_0063717 | 3300049568 | Bacteria | 2401 |
| 596 | Ga0501031_0112381 | 3300049568 | Bacteria | 1779 |
| 597 | Ga0501032_0003343 | 3300049569 | Bacteria | 12307 |
| 598 | Ga0501032_0037276 | 3300049569 | Bacteria | 3315 |
| 599 | Ga0501032_0077796 | 3300049569 | Bacteria | 2208 |
| 600 | Ga0501032_0268106 | 3300049569 | Bacteria | 1106 |
| 601 | Ga0501033_0000128 | 3300049570 | Bacteria | 73419 |
| 602 | Ga0501033_0052525 | 3300049570 | Bacteria | 3020 |
| 603 | Ga0501033_0119490 | 3300049570 | Bacteria | 1913 |
| 604 | Ga0501034_0000113 | 3300049571 | Bacteria | 149824 |
| 605 | Ga0501034_0000820 | 3300049571 | Bacteria | 46252 |
| 606 | Ga0501034_0081524 | 3300049571 | Bacteria | 3237 |
| 607 | Ga0501034_0086224 | 3300049571 | Bacteria | 3141 |
| 608 | Ga0501034_0180912 | 3300049571 | Bacteria | 2073 |
| 609 | Ga0501036_0000216 | 3300049572 | Bacteria | 38518 |
| 610 | Ga0501036_0000536 | 3300049572 | Bacteria | 27218 |
| 611 | Ga0501036_0037134 | 3300049572 | Bacteria | 4121 |
| 612 | Ga0501036_0053903 | 3300049572 | Bacteria | 3404 |
| 613 | Ga0501036_0067162 | 3300049572 | Bacteria | 3033 |
| 614 | Ga0501037_0000214 | 3300049573 | Bacteria | 51638 |
| 615 | Ga0501037_0042137 | 3300049573 | Bacteria | 3355 |
| 616 | Ga0501037_0079683 | 3300049573 | Bacteria | 2377 |
| 617 | Ga0501037_0221101 | 3300049573 | Bacteria | 1333 |
| 618 | Ga0501038_0003329 | 3300049574 | Bacteria | 14988 |
| 619 | Ga0501038_0004864 | 3300049574 | Bacteria | 12476 |
| 620 | Ga0501038_0029671 | 3300049574 | Bacteria | 4844 |
| 621 | Ga0501038_0102486 | 3300049574 | Bacteria | 2381 |
| 622 | Ga0501038_0132055 | 3300049574 | Bacteria | 2049 |
| 623 | Ga0501039_0001003 | 3300049575 | Bacteria | 20566 |
| 624 | Ga0501039_0028355 | 3300049575 | Bacteria | 4310 |
| 625 | Ga0501039_0157133 | 3300049575 | Bacteria | 1787 |
| 626 | Ga0501039_0256770 | 3300049575 | Bacteria | 1374 |
| 627 | Ga0501040_0066282 | 3300049576 | Bacteria | 2488 |
| 628 | Ga0501042_0156795 | 3300049578 | Bacteria | 1642 |
| 629 | Ga0501043_0001803 | 3300049579 | Bacteria | 18404 |
| 630 | Ga0501043_0002528 | 3300049579 | Bacteria | 15463 |
| 631 | Ga0501043_0014734 | 3300049579 | Bacteria | 6122 |
| 632 | Ga0501043_0253913 | 3300049579 | Bacteria | 1354 |
| 633 | Ga0501046_0002091 | 3300049580 | Bacteria | 18926 |
| 634 | Ga0501047_0000044 | 3300049581 | Bacteria | 174789 |
| 635 | Ga0501047_0000124 | 3300049581 | Bacteria | 94721 |
| 636 | Ga0501047_0010065 | 3300049581 | Bacteria | 8941 |
| 637 | Ga0501047_0042156 | 3300049581 | Bacteria | 4411 |
| 638 | Ga0501047_0042442 | 3300049581 | Bacteria | 4395 |
| 639 | Ga0501047_0092974 | 3300049581 | Bacteria | 2895 |
| 640 | Ga0501047_0106659 | 3300049581 | Bacteria | 2682 |
| 641 | Ga0501047_0229694 | 3300049581 | Bacteria | 1709 |
| 642 | Ga0501048_0000117 | 3300049582 | Bacteria | 45344 |
| 643 | Ga0501048_0000375 | 3300049582 | Bacteria | 31006 |
| 644 | Ga0501048_0144277 | 3300049582 | Bacteria | 1684 |
| 645 | Ga0501048_0258647 | 3300049582 | Bacteria | 1237 |
| 646 | Ga0501067_0004289 | 3300049583 | Bacteria | 7859 |
| 647 | Ga0501067_0031242 | 3300049583 | Bacteria | 2955 |
| 648 | Ga0501067_0045154 | 3300049583 | Bacteria | 2447 |
| 649 | Ga0501068_0000089 | 3300049584 | Bacteria | 38379 |
| 650 | Ga0501068_0057429 | 3300049584 | Bacteria | 2360 |
| 651 | Ga0501069_0003520 | 3300049585 | Bacteria | 8064 |
| 652 | Ga0501069_0006950 | 3300049585 | Bacteria | 5917 |
| 653 | Ga0501070_0000457 | 3300049586 | Bacteria | 37005 |
| 654 | Ga0501070_0002301 | 3300049586 | Bacteria | 16761 |
| 655 | Ga0501070_0008473 | 3300049586 | Bacteria | 8687 |
| 656 | Ga0501070_0010689 | 3300049586 | Bacteria | 7761 |
| 657 | Ga0501070_0034181 | 3300049586 | Bacteria | 4252 |
| 658 | Ga0501070_0063079 | 3300049586 | Bacteria | 3069 |
| 659 | Ga0501070_0082792 | 3300049586 | Bacteria | 2656 |
| 660 | Ga0501070_0094708 | 3300049586 | Bacteria | 2471 |
| 661 | Ga0501070_0126795 | 3300049586 | Bacteria | 2109 |
| 662 | Ga0501070_0129722 | 3300049586 | Bacteria | 2083 |
| 663 | Ga0501070_0137850 | 3300049586 | Bacteria | 2014 |
| 664 | Ga0501070_0334468 | 3300049586 | Bacteria | 1230 |
| 665 | Ga0501072_0017470 | 3300049588 | Bacteria | 5512 |
| 666 | Ga0501072_0072611 | 3300049588 | Bacteria | 2720 |
| 667 | Ga0501073_0000669 | 3300049589 | Bacteria | 24040 |
| 668 | Ga0501073_0055373 | 3300049589 | Bacteria | 2775 |
| 669 | Ga0501073_0125793 | 3300049589 | Bacteria | 1777 |
| 670 | Ga0501073_0203375 | 3300049589 | Bacteria | 1369 |
| 671 | Ga0501074_0000035 | 3300049590 | Bacteria | 64770 |
| 672 | Ga0501074_0041671 | 3300049590 | Bacteria | 3324 |
| 673 | Ga0501075_0394861 | 3300049591 | Bacteria | 1054 |
| 674 | Ga0501076_0041032 | 3300049592 | Bacteria | 3639 |
| 675 | Ga0501079_0020353 | 3300049741 | Bacteria | 5070 |
| 676 | Ga0501079_0318211 | 3300049741 | Bacteria | 1218 |
| 677 | Ga0501080_0000074 | 3300049742 | Bacteria | 66985 |
| 678 | Ga0501080_0001566 | 3300049742 | Bacteria | 19356 |
| 679 | Ga0501080_0003476 | 3300049742 | Bacteria | 13874 |
| 680 | Ga0501080_0063873 | 3300049742 | Bacteria | 3425 |
| 681 | Ga0501080_0121517 | 3300049742 | Bacteria | 2420 |
| 682 | Ga0501080_0138691 | 3300049742 | Bacteria | 2249 |
| 683 | Ga0501080_0259995 | 3300049742 | Bacteria | 1582 |
| 684 | Ga0501083_0004584 | 3300049744 | Bacteria | 9765 |
| 685 | Ga0501083_0118073 | 3300049744 | Bacteria | 1740 |
| 686 | Ga0501035_0000128 | 3300049822 | Bacteria | 92297 |
| 687 | Ga0501035_0033865 | 3300049822 | Bacteria | 4644 |
| 688 | Ga0501035_0055068 | 3300049822 | Bacteria | 3552 |
| 689 | Ga0501035_0252214 | 3300049822 | Bacteria | 1498 |
| 690 | Ga0501044_0000108 | 3300049823 | Bacteria | 100968 |
| 691 | Ga0501044_0001469 | 3300049823 | Bacteria | 27682 |
| 692 | Ga0501044_0019204 | 3300049823 | Bacteria | 7317 |
| 693 | Ga0501044_0019452 | 3300049823 | Bacteria | 7264 |
| 694 | Ga0501044_0022496 | 3300049823 | Bacteria | 6716 |
| 695 | Ga0501045_0019508 | 3300049824 | Bacteria | 4835 |
| 696 | Ga0501045_0230730 | 3300049824 | Bacteria | 1378 |
| 697 | nmdc:mga03683_60136_c1 | 3300050489 | Bacteria | 1604 |
| 698 | nmdc:mga00v17_79738_c1 | 3300050491 | Bacteria | 2042 |
| 699 | nmdc:mga00v17_99774_c1 | 3300050491 | Bacteria | 1832 |
| 700 | nmdc:mga0yw44_11667_c1 | 3300050492 | Bacteria | 4549 |
| 701 | nmdc:mga0yw44_23615_c1 | 3300050492 | Bacteria | 3467 |
| 702 | nmdc:mga06z11_130458_c1 | 3300050494 | Bacteria | 1411 |
| 703 | nmdc:mga06z11_98691_c1 | 3300050494 | Bacteria | 1599 |
| 704 | nmdc:mga07m45_17070_c1 | 3300050496 | Bacteria | 3892 |
| 705 | nmdc:mga05p37_114736_c1 | 3300050507 | Bacteria | 3311 |
| 706 | nmdc:mga05p37_75626_c1 | 3300050507 | Bacteria | 4145 |
| 707 | nmdc:mga08y16_15207_c1 | 3300050511 | Bacteria | 8094 |
| 708 | nmdc:mga0n895_19830_c1 | 3300050512 | Bacteria | 6258 |
| 709 | nmdc:mga0n895_70614_c1 | 3300050512 | Bacteria | 3461 |
| 710 | nmdc:mga0rr50_238337_c1 | 3300050513 | Bacteria | 1507 |
| 711 | nmdc:mga08x19_3956_c1 | 3300050514 | Bacteria | 8822 |
| 712 | nmdc:mga0a205_92095_c1 | 3300050515 | Bacteria | 2929 |
| 713 | nmdc:mga0sz30_64190_c1 | 3300050516 | Bacteria | 1573 |
| 714 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 715 | Ga0495601_0011904 | 3300053077 | Bacteria | 5214 |
| 716 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 717 | Ga0495612_0018968 | 3300053078 | Bacteria | 2753 |
| 718 | Ga0500635_0001128 | 3300053080 | Bacteria | 6389 |
| 719 | Ga0495595_0000008 | 3300053084 | Bacteria | 196206 |
| 720 | Ga0495595_0000419 | 3300053084 | Bacteria | 16064 |
| 721 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 722 | Ga0495619_0001836 | 3300053085 | Bacteria | 14121 |
| 723 | Ga0500578_0051641 | 3300053086 | Bacteria | 2634 |
| 724 | Ga0500643_000079 | 3300053087 | Bacteria | 104107 |
| 725 | Ga0500643_010505 | 3300053087 | Bacteria | 3440 |
| 726 | Ga0500647_0119723 | 3300053091 | Bacteria | 1247 |
| 727 | Ga0500583_0033457 | 3300053092 | Bacteria | 2275 |
| 728 | Ga0500651_0016501 | 3300053093 | Bacteria | 4545 |
| 729 | Ga0500651_0067853 | 3300053093 | Bacteria | 2221 |
| 730 | Ga0500566_0000509 | 3300053094 | Bacteria | 21703 |
| 731 | Ga0500566_0000836 | 3300053094 | Bacteria | 17548 |
| 732 | Ga0500566_0047535 | 3300053094 | Bacteria | 2463 |
| 733 | Ga0500641_0018835 | 3300053096 | Bacteria | 2602 |
| 734 | Ga0500555_015543 | 3300053103 | Bacteria | 2195 |
| 735 | Ga0500556_0000005 | 3300053104 | Bacteria | 581135 |
| 736 | Ga0500556_0000017 | 3300053104 | Bacteria | 192495 |
| 737 | Ga0500569_015625 | 3300053109 | Bacteria | 1905 |
| 738 | Ga0500572_001823 | 3300053111 | Bacteria | 5428 |
| 739 | Ga0500592_007166 | 3300053116 | Bacteria | 1774 |
| 740 | Ga0500593_064476 | 3300053117 | Bacteria | 1603 |
| 741 | Ga0500595_002736 | 3300053119 | Bacteria | 8531 |
| 742 | Ga0500595_004064 | 3300053119 | Bacteria | 6653 |
| 743 | Ga0500607_026323 | 3300053121 | Bacteria | 3235 |
| 744 | Ga0500614_007029 | 3300053123 | Bacteria | 2368 |
| 745 | Ga0500642_0000009 | 3300053130 | Bacteria | 286829 |
| 746 | Ga0500642_0087462 | 3300053130 | Bacteria | 1437 |
| 747 | Ga0500652_002026 | 3300053131 | Bacteria | 6100 |
| 748 | Ga0500658_0086823 | 3300053134 | Bacteria | 1346 |
| 749 | Ga0500559_0000723 | 3300053136 | Bacteria | 21728 |
| 750 | Ga0500559_0006019 | 3300053136 | Bacteria | 5504 |
| 751 | Ga0500559_0077692 | 3300053136 | Bacteria | 1504 |
| 752 | Ga0500577_0000569 | 3300053142 | Bacteria | 9541 |
| 753 | Ga0500577_0024549 | 3300053142 | Bacteria | 2029 |
| 754 | Ga0500588_0035840 | 3300053146 | Bacteria | 1463 |
| 755 | Ga0500589_120445 | 3300053147 | Bacteria | 1112 |
| 756 | Ga0500603_000487 | 3300053150 | Bacteria | 10153 |
| 757 | Ga0500604_0037226 | 3300053151 | Bacteria | 1454 |
| 758 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 759 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 760 | Ga0500616_0039517 | 3300053153 | Bacteria | 2543 |
| 761 | Ga0500620_005383 | 3300053155 | Bacteria | 2958 |
| 762 | Ga0500627_0063839 | 3300053158 | Bacteria | 1623 |
| 763 | Ga0500630_039439 | 3300053159 | Bacteria | 2306 |
| 764 | Ga0500638_034065 | 3300053162 | Bacteria | 2463 |
| 765 | Ga0500639_065420 | 3300053163 | Bacteria | 1865 |
| 766 | Ga0500636_0000059 | 3300053177 | Bacteria | 52601 |
| 767 | Ga0500636_0000344 | 3300053177 | Bacteria | 25582 |
| 768 | Ga0500636_0001095 | 3300053177 | Bacteria | 14493 |
| 769 | Ga0500636_0095485 | 3300053177 | Bacteria | 1697 |
| 770 | Ga0500636_0130986 | 3300053177 | Bacteria | 1397 |
| 771 | Ga0500637_0002787 | 3300053178 | Bacteria | 7847 |
| 772 | Ga0500645_008956 | 3300053730 | Bacteria | 3383 |
| 773 | Ga0500645_015588 | 3300053730 | Bacteria | 2406 |
| 774 | Ga0500596_005131 | 3300053735 | Bacteria | 2336 |
| 775 | Ga0500599_001543 | 3300053736 | Bacteria | 2668 |
| 776 | Ga0500601_005225 | 3300053737 | Bacteria | 1420 |
| 777 | Ga0501084_0002026 | 3300054114 | Bacteria | 16179 |
| 778 | Ga0501084_0112360 | 3300054114 | Bacteria | 2289 |
| 779 | Ga0501084_0283930 | 3300054114 | Bacteria | 1398 |
| 780 | Ga0500661_007935 | 3300055283 | Bacteria | 1956 |
| 781 | Ga0501082_0005129 | 3300060353 | Bacteria | 11401 |
| 782 | Ga0501082_0013852 | 3300060353 | Bacteria | 6934 |
| 783 | Ga0501082_0269309 | 3300060353 | Bacteria | 1482 |
| 784 | Ga0530510_0084401 | 3300061734 | Bacteria | 2313 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0042442 | Ga0501047_0042442_3497_4372 | 290 |
| 2 | 3300039450 | Ga0436363_0815901 | Ga0436363_0815901_731_1873 | 302 |
| 3 | 3300005577 | Ga0068857_100017740 | Ga0068857_1000177402 | 305 |
| 4 | 3300025924 | Ga0207694_10300553 | Ga0207694_103005532 | 305 |
| 5 | 3300035170 | Ga0373943_0073247 | Ga0373943_0073247_48_1088 | 319 |
| 6 | 3300035692 | Ga0373935_0025193 | Ga0373935_0025193_768_1808 | 319 |
| 7 | 3300035695 | Ga0373927_0199630 | Ga0373927_0199630_136_1251 | 319 |
| 8 | 3300046476 | Ga0495662_0103256 | Ga0495662_0103256_91_1131 | 319 |
| 9 | 3300006028 | Ga0070717_10214156 | Ga0070717_102141562 | 322 |
| 10 | 3300037068 | Ga0373925_0020613 | Ga0373925_0020613_2393_3514 | 322 |
| 11 | 3300005336 | Ga0070680_100013900 | Ga0070680_1000139002 | 323 |
| 12 | 3300005614 | Ga0068856_100068386 | Ga0068856_1000683863 | 323 |
| 13 | 3300013307 | Ga0157372_10213221 | Ga0157372_102132211 | 323 |
| 14 | 3300026078 | Ga0207702_10184811 | Ga0207702_101848112 | 323 |
| 15 | 3300006942 | Ga0099824_1011035 | Ga0099824_10110354 | 324 |
| 16 | 3300027296 | Ga0209389_1000328 | Ga0209389_100032824 | 324 |
| 17 | 3300027357 | Ga0209589_1003134 | Ga0209589_10031343 | 324 |
| 18 | 3300027361 | Ga0209489_103754 | Ga0209489_10375424 | 324 |
| 19 | 3300025942 | Ga0207689_10061889 | Ga0207689_100618892 | 325 |
| 20 | 3300048903 | Ga0496100_0040920 | Ga0496100_0040920_451_1485 | 325 |
| 21 | 3300048906 | Ga0496103_0110634 | Ga0496103_0110634_21_1142 | 325 |
| 22 | 3300005983 | Ga0081540_1017481 | Ga0081540_10174812 | 326 |
| 23 | 3300028379 | Ga0268266_10001497 | Ga0268266_1000149716 | 326 |
| 24 | 3300046452 | Ga0495617_005797 | Ga0495617_005797_2784_3914 | 326 |
| 25 | 3300046474 | Ga0495605_0060869 | Ga0495605_0060869_578_1708 | 326 |
| 26 | 3300046513 | Ga0495616_0082070 | Ga0495616_0082070_134_1264 | 326 |
| 27 | 3300046519 | Ga0495632_0083939 | Ga0495632_0083939_185_1315 | 326 |
| 28 | 3300046648 | Ga0495611_0026482 | Ga0495611_0026482_648_1778 | 326 |
| 29 | 3300048912 | Ga0496109_0069224 | Ga0496109_0069224_1086_2138 | 326 |
| 30 | 3300005338 | Ga0068868_100216671 | Ga0068868_1002166712 | 327 |
| 31 | 3300046515 | Ga0495620_0029575 | Ga0495620_0029575_1215_2264 | 327 |
| 32 | 3300049459 | Ga0495678_054176 | Ga0495678_054176_414_1466 | 327 |
| 33 | 3300005436 | Ga0070713_100000894 | Ga0070713_1000008944 | 328 |
| 34 | 3300005719 | Ga0068861_100139649 | Ga0068861_1001396492 | 328 |
| 35 | 3300006028 | Ga0070717_10001686 | Ga0070717_100016863 | 328 |
| 36 | 3300025297 | Ga0209758_1016688 | Ga0209758_10166883 | 328 |
| 37 | 3300037418 | Ga0395900_0005628 | Ga0395900_0005628_11982_13049 | 328 |
| 38 | 3300037466 | Ga0395898_0013582 | Ga0395898_0013582_4207_5274 | 328 |
| 39 | 3300037466 | Ga0395898_0164092 | Ga0395898_0164092_974_2038 | 328 |
| 40 | 3300038443 | Ga0395901_0059614 | Ga0395901_0059614_141_1208 | 328 |
| 41 | 3300005842 | Ga0068858_100196525 | Ga0068858_1001965251 | 329 |
| 42 | 3300044694 | Ga0466963_0253525 | Ga0466963_0253525_130_1194 | 329 |
| 43 | 3300046477 | Ga0495664_0068451 | Ga0495664_0068451_563_1630 | 329 |
| 44 | 3300046536 | Ga0495587_0048865 | Ga0495587_0048865_1256_2323 | 329 |
| 45 | 3300046679 | Ga0495623_0054944 | Ga0495623_0054944_1099_2166 | 329 |
| 46 | 3300046809 | Ga0495600_0169077 | Ga0495600_0169077_200_1267 | 329 |
| 47 | 3300047319 | Ga0495674_0103843 | Ga0495674_0103843_367_1434 | 329 |
| 48 | 3300047320 | Ga0495672_0088022 | Ga0495672_0088022_156_1202 | 329 |
| 49 | 3300047322 | Ga0495680_0004170 | Ga0495680_0004170_9534_10601 | 329 |
| 50 | 3300047444 | Ga0495675_0016527 | Ga0495675_0016527_3263_4330 | 329 |
| 51 | 3300049569 | Ga0501032_0037276 | Ga0501032_0037276_1313_2347 | 329 |
| 52 | 3300049572 | Ga0501036_0053903 | Ga0501036_0053903_732_1766 | 329 |
| 53 | 3300049576 | Ga0501040_0066282 | Ga0501040_0066282_1186_2220 | 329 |
| 54 | 3300049583 | Ga0501067_0045154 | Ga0501067_0045154_101_1135 | 329 |
| 55 | 3300049586 | Ga0501070_0137850 | Ga0501070_0137850_802_1836 | 329 |
| 56 | 3300049742 | Ga0501080_0138691 | Ga0501080_0138691_1115_2149 | 329 |
| 57 | 3300060353 | Ga0501082_0013852 | Ga0501082_0013852_1587_2621 | 329 |
| 58 | 3300005518 | Ga0070699_100107339 | Ga0070699_1001073391 | 330 |
| 59 | 3300009147 | Ga0114129_10081574 | Ga0114129_100815742 | 330 |
| 60 | 3300049579 | Ga0501043_0253913 | Ga0501043_0253913_201_1262 | 330 |
| 61 | 3300049581 | Ga0501047_0042156 | Ga0501047_0042156_207_1268 | 330 |
| 62 | 3300049586 | Ga0501070_0126795 | Ga0501070_0126795_220_1281 | 330 |
| 63 | 3300049822 | Ga0501035_0055068 | Ga0501035_0055068_798_1859 | 330 |
| 64 | 3300005434 | Ga0070709_10088483 | Ga0070709_100884832 | 331 |
| 65 | 3300005435 | Ga0070714_100036306 | Ga0070714_1000363062 | 331 |
| 66 | 3300005437 | Ga0070710_10001586 | Ga0070710_100015862 | 331 |
| 67 | 3300006175 | Ga0070712_100034887 | Ga0070712_1000348872 | 331 |
| 68 | 3300025898 | Ga0207692_10020713 | Ga0207692_100207132 | 331 |
| 69 | 3300025906 | Ga0207699_10003862 | Ga0207699_100038622 | 331 |
| 70 | 3300025915 | Ga0207693_10033060 | Ga0207693_100330602 | 331 |
| 71 | 3300025928 | Ga0207700_10135033 | Ga0207700_101350332 | 331 |
| 72 | 3300025939 | Ga0207665_10013172 | Ga0207665_100131723 | 331 |
| 73 | 3300046678 | Ga0495599_0108425 | Ga0495599_0108425_442_1509 | 331 |
| 74 | 3300047317 | Ga0495604_0013280 | Ga0495604_0013280_2848_3915 | 331 |
| 75 | 3300047471 | Ga0495684_0241806 | Ga0495684_0241806_224_1291 | 331 |
| 76 | 3300048928 | Ga0496125_0020298 | Ga0496125_0020298_38_1105 | 331 |
| 77 | 3300049571 | Ga0501034_0000820 | Ga0501034_0000820_33218_34252 | 331 |
| 78 | 3300049572 | Ga0501036_0000216 | Ga0501036_0000216_11656_12690 | 331 |
| 79 | 3300049573 | Ga0501037_0042137 | Ga0501037_0042137_2099_3133 | 331 |
| 80 | 3300049579 | Ga0501043_0002528 | Ga0501043_0002528_13710_14744 | 331 |
| 81 | 3300049581 | Ga0501047_0000124 | Ga0501047_0000124_50586_51620 | 331 |
| 82 | 3300049582 | Ga0501048_0000375 | Ga0501048_0000375_8839_9873 | 331 |
| 83 | 3300049586 | Ga0501070_0008473 | Ga0501070_0008473_377_1411 | 331 |
| 84 | 3300049589 | Ga0501073_0203375 | Ga0501073_0203375_250_1284 | 331 |
| 85 | 3300049742 | Ga0501080_0000074 | Ga0501080_0000074_24530_25564 | 331 |
| 86 | 3300049823 | Ga0501044_0001469 | Ga0501044_0001469_15740_16774 | 331 |
| 87 | 3300049824 | Ga0501045_0230730 | Ga0501045_0230730_74_1108 | 331 |
| 88 | 3300060353 | Ga0501082_0269309 | Ga0501082_0269309_345_1379 | 331 |
| 89 | 3300005937 | Ga0081455_10013202 | Ga0081455_100132023 | 332 |
| 90 | 3300009148 | Ga0105243_10262613 | Ga0105243_102626132 | 332 |
| 91 | 3300028786 | Ga0307517_10000066 | Ga0307517_1000006640 | 332 |
| 92 | 3300031730 | Ga0307516_10219537 | Ga0307516_102195371 | 332 |
| 93 | 3300035170 | Ga0373943_0021168 | Ga0373943_0021168_652_1650 | 332 |
| 94 | 3300035171 | Ga0373946_0000693 | Ga0373946_0000693_3112_4110 | 332 |
| 95 | 3300035172 | Ga0373955_0041035 | Ga0373955_0041035_885_1883 | 332 |
| 96 | 3300035695 | Ga0373927_0004222 | Ga0373927_0004222_6753_7751 | 332 |
| 97 | 3300037068 | Ga0373925_0003884 | Ga0373925_0003884_5054_6052 | 332 |
| 98 | 3300046454 | Ga0495592_0003994 | Ga0495592_0003994_46_1044 | 332 |
| 99 | 3300046473 | Ga0495582_0000063 | Ga0495582_0000063_2959_3957 | 332 |
| 100 | 3300046476 | Ga0495662_0003113 | Ga0495662_0003113_3416_4414 | 332 |
| 101 | 3300046477 | Ga0495664_0106785 | Ga0495664_0106785_419_1417 | 332 |
| 102 | 3300046499 | Ga0495594_0000983 | Ga0495594_0000983_2004_3002 | 332 |
| 103 | 3300046531 | Ga0495665_0000163 | Ga0495665_0000163_25735_26733 | 332 |
| 104 | 3300046533 | Ga0495640_0013346 | Ga0495640_0013346_1349_2347 | 332 |
| 105 | 3300046557 | Ga0495622_0003604 | Ga0495622_0003604_5461_6459 | 332 |
| 106 | 3300046674 | Ga0495588_0124810 | Ga0495588_0124810_340_1338 | 332 |
| 107 | 3300046680 | Ga0495646_0007434 | Ga0495646_0007434_4877_5875 | 332 |
| 108 | 3300046681 | Ga0495647_0000198 | Ga0495647_0000198_1498_2496 | 332 |
| 109 | 3300046689 | Ga0495613_0000449 | Ga0495613_0000449_10615_11613 | 332 |
| 110 | 3300046690 | Ga0495624_0001125 | Ga0495624_0001125_13605_14603 | 332 |
| 111 | 3300047315 | Ga0495581_0000291 | Ga0495581_0000291_13753_14751 | 332 |
| 112 | 3300047319 | Ga0495674_0003711 | Ga0495674_0003711_9021_10019 | 332 |
| 113 | 3300047321 | Ga0495676_0041740 | Ga0495676_0041740_541_1539 | 332 |
| 114 | 3300047322 | Ga0495680_0115113 | Ga0495680_0115113_981_1979 | 332 |
| 115 | 3300047673 | Ga0495593_0000323 | Ga0495593_0000323_9574_10572 | 332 |
| 116 | 3300048929 | Ga0496126_0054677 | Ga0496126_0054677_1670_2734 | 332 |
| 117 | 3300049579 | Ga0501043_0014734 | Ga0501043_0014734_1584_2618 | 332 |
| 118 | 3300049591 | Ga0501075_0394861 | Ga0501075_0394861_17_1027 | 332 |
| 119 | 3300053737 | Ga0500601_005225 | Ga0500601_005225_40_1107 | 332 |
| 120 | 3300025939 | Ga0207665_10117482 | Ga0207665_101174822 | 333 |
| 121 | 3300028381 | Ga0268264_10091945 | Ga0268264_100919452 | 333 |
| 122 | 3300036401 | Ga0373937_0149252 | Ga0373937_0149252_30_1088 | 333 |
| 123 | 3300046526 | Ga0495666_0027895 | Ga0495666_0027895_1624_2754 | 333 |
| 124 | 3300048929 | Ga0496126_0106456 | Ga0496126_0106456_1278_2345 | 333 |
| 125 | 3300053153 | Ga0500616_0039517 | Ga0500616_0039517_1052_2119 | 333 |
| 126 | iso_pu_bacteria | 2917554339 | 2917558176 | 333 |
| 127 | 3300005544 | Ga0070686_100071473 | Ga0070686_1000714732 | 334 |
| 128 | 3300005547 | Ga0070693_100244506 | Ga0070693_1002445061 | 334 |
| 129 | 3300005564 | Ga0070664_100084505 | Ga0070664_1000845052 | 334 |
| 130 | 3300006038 | Ga0075365_10165007 | Ga0075365_101650071 | 334 |
| 131 | 3300025945 | Ga0207679_10061253 | Ga0207679_100612532 | 334 |
| 132 | 3300037853 | Ga0436364_1428694 | Ga0436364_1428694_354_1391 | 334 |
| 133 | 3300045976 | Ga0466967_0081292 | Ga0466967_0081292_1631_2695 | 334 |
| 134 | 3300046524 | Ga0495648_0000581 | Ga0495648_0000581_28694_29770 | 334 |
| 135 | 3300053094 | Ga0500566_0047535 | Ga0500566_0047535_1357_2424 | 334 |
| 136 | 3300053111 | Ga0500572_001823 | Ga0500572_001823_1154_2215 | 334 |
| 137 | 3300009093 | Ga0105240_10015213 | Ga0105240_100152135 | 335 |
| 138 | 3300009093 | Ga0105240_10016353 | Ga0105240_100163536 | 335 |
| 139 | 3300009174 | Ga0105241_10002904 | Ga0105241_100029047 | 335 |
| 140 | 3300009177 | Ga0105248_10019495 | Ga0105248_100194954 | 335 |
| 141 | 3300009551 | Ga0105238_10015659 | Ga0105238_100156592 | 335 |
| 142 | 3300010375 | Ga0105239_10093089 | Ga0105239_100930892 | 335 |
| 143 | 3300025941 | Ga0207711_10010567 | Ga0207711_100105673 | 335 |
| 144 | 3300048909 | Ga0496106_0047142 | Ga0496106_0047142_44_1051 | 335 |
| 145 | 3300049571 | Ga0501034_0086224 | Ga0501034_0086224_705_1721 | 335 |
| 146 | 3300049586 | Ga0501070_0094708 | Ga0501070_0094708_201_1217 | 335 |
| 147 | 3300053091 | Ga0500647_0119723 | Ga0500647_0119723_43_1080 | 335 |
| 148 | 3300053094 | Ga0500566_0000836 | Ga0500566_0000836_1129_2166 | 335 |
| 149 | 3300053121 | Ga0500607_026323 | Ga0500607_026323_1773_2840 | 335 |
| 150 | 3300053123 | Ga0500614_007029 | Ga0500614_007029_326_1363 | 335 |
| 151 | 3300005333 | Ga0070677_10006891 | Ga0070677_100068912 | 336 |
| 152 | 3300005618 | Ga0068864_100479675 | Ga0068864_1004796751 | 336 |
| 153 | 3300009101 | Ga0105247_10074790 | Ga0105247_100747902 | 336 |
| 154 | 3300011119 | Ga0105246_10219576 | Ga0105246_102195762 | 336 |
| 155 | 3300014325 | Ga0163163_10038761 | Ga0163163_100387614 | 336 |
| 156 | 3300025893 | Ga0207682_10003162 | Ga0207682_100031622 | 336 |
| 157 | 3300026116 | Ga0207674_10252195 | Ga0207674_102521952 | 336 |
| 158 | 3300026118 | Ga0207675_100316363 | Ga0207675_1003163632 | 336 |
| 159 | 3300031238 | Ga0265332_10019280 | Ga0265332_100192802 | 336 |
| 160 | 3300031456 | Ga0307513_10279691 | Ga0307513_102796911 | 336 |
| 161 | 3300044684 | Ga0466966_0073894 | Ga0466966_0073894_1022_2113 | 336 |
| 162 | 3300044842 | Ga0466957_0051062 | Ga0466957_0051062_814_1905 | 336 |
| 163 | 3300045049 | Ga0466959_0073552 | Ga0466959_0073552_1270_2361 | 336 |
| 164 | 3300046474 | Ga0495605_0075976 | Ga0495605_0075976_61_1104 | 336 |
| 165 | 3300048090 | Ga0495615_0018412 | Ga0495615_0018412_173_1195 | 336 |
| 166 | 3300049568 | Ga0501031_0063717 | Ga0501031_0063717_1370_2389 | 336 |
| 167 | 3300049572 | Ga0501036_0037134 | Ga0501036_0037134_2175_3194 | 336 |
| 168 | 3300049573 | Ga0501037_0079683 | Ga0501037_0079683_178_1197 | 336 |
| 169 | 3300049574 | Ga0501038_0029671 | Ga0501038_0029671_31_1050 | 336 |
| 170 | 3300049575 | Ga0501039_0157133 | Ga0501039_0157133_225_1244 | 336 |
| 171 | 3300049581 | Ga0501047_0092974 | Ga0501047_0092974_422_1441 | 336 |
| 172 | 3300049586 | Ga0501070_0063079 | Ga0501070_0063079_1596_2615 | 336 |
| 173 | 3300049589 | Ga0501073_0055373 | Ga0501073_0055373_1501_2520 | 336 |
| 174 | 3300049742 | Ga0501080_0063873 | Ga0501080_0063873_2101_3120 | 336 |
| 175 | 3300049744 | Ga0501083_0118073 | Ga0501083_0118073_627_1655 | 336 |
| 176 | 3300005842 | Ga0068858_100133880 | Ga0068858_1001338802 | 337 |
| 177 | 3300025295 | Ga0209564_1000842 | Ga0209564_10008422 | 337 |
| 178 | 3300025949 | Ga0207667_10522601 | Ga0207667_105226011 | 337 |
| 179 | 3300031247 | Ga0265340_10000659 | Ga0265340_1000065915 | 337 |
| 180 | 3300031247 | Ga0265340_10011689 | Ga0265340_100116896 | 337 |
| 181 | 3300031249 | Ga0265339_10004448 | Ga0265339_100044482 | 337 |
| 182 | 3300031250 | Ga0265331_10105280 | Ga0265331_101052801 | 337 |
| 183 | 3300031344 | Ga0265316_10009504 | Ga0265316_100095048 | 337 |
| 184 | 3300031595 | Ga0265313_10002138 | Ga0265313_1000213814 | 337 |
| 185 | 3300031712 | Ga0265342_10001734 | Ga0265342_100017348 | 337 |
| 186 | 3300046516 | Ga0495628_0010286 | Ga0495628_0010286_6493_7506 | 337 |
| 187 | 3300046559 | Ga0495667_0012398 | Ga0495667_0012398_4167_5180 | 337 |
| 188 | 3300049581 | Ga0501047_0010065 | Ga0501047_0010065_454_1494 | 337 |
| 189 | 3300049585 | Ga0501069_0006950 | Ga0501069_0006950_1969_2997 | 337 |
| 190 | 3300049586 | Ga0501070_0010689 | Ga0501070_0010689_1401_2441 | 337 |
| 191 | 3300049586 | Ga0501070_0334468 | Ga0501070_0334468_45_1073 | 337 |
| 192 | 3300049590 | Ga0501074_0041671 | Ga0501074_0041671_1483_2523 | 337 |
| 193 | 3300049742 | Ga0501080_0003476 | Ga0501080_0003476_12103_13143 | 337 |
| 194 | 3300050507 | nmdc:mga05p37_75626_c1 | nmdc:mga05p37_75626_c1_2924_3943 | 337 |
| 195 | 3300053177 | Ga0500636_0001095 | Ga0500636_0001095_5113_6195 | 337 |
| 196 | 3300054114 | Ga0501084_0283930 | Ga0501084_0283930_255_1280 | 337 |
| 197 | 3300003203 | JGI25406J46586_10031159 | JGI25406J46586_100311591 | 338 |
| 198 | 3300005535 | Ga0070684_100022655 | Ga0070684_1000226553 | 338 |
| 199 | 3300005539 | Ga0068853_100108527 | Ga0068853_1001085272 | 338 |
| 200 | 3300005577 | Ga0068857_100284534 | Ga0068857_1002845342 | 338 |
| 201 | 3300006038 | Ga0075365_10006703 | Ga0075365_100067037 | 338 |
| 202 | 3300006048 | Ga0075363_100006169 | Ga0075363_1000061693 | 338 |
| 203 | 3300006051 | Ga0075364_10010755 | Ga0075364_100107554 | 338 |
| 204 | 3300006177 | Ga0075362_10037389 | Ga0075362_100373892 | 338 |
| 205 | 3300006195 | Ga0075366_10038337 | Ga0075366_100383373 | 338 |
| 206 | 3300006353 | Ga0075370_10014208 | Ga0075370_100142082 | 338 |
| 207 | 3300009174 | Ga0105241_10168183 | Ga0105241_101681831 | 338 |
| 208 | 3300009551 | Ga0105238_10266982 | Ga0105238_102669822 | 338 |
| 209 | 3300013104 | Ga0157370_10080759 | Ga0157370_100807592 | 338 |
| 210 | 3300013104 | Ga0157370_10336985 | Ga0157370_103369851 | 338 |
| 211 | 3300013105 | Ga0157369_10028226 | Ga0157369_100282263 | 338 |
| 212 | 3300013306 | Ga0163162_10183875 | Ga0163162_101838753 | 338 |
| 213 | 3300013307 | Ga0157372_10184205 | Ga0157372_101842052 | 338 |
| 214 | 3300025924 | Ga0207694_10227017 | Ga0207694_102270171 | 338 |
| 215 | 3300025941 | Ga0207711_10148668 | Ga0207711_101486682 | 338 |
| 216 | 3300031241 | Ga0265325_10015080 | Ga0265325_100150803 | 338 |
| 217 | 3300031249 | Ga0265339_10011598 | Ga0265339_100115981 | 338 |
| 218 | 3300031250 | Ga0265331_10036923 | Ga0265331_100369232 | 338 |
| 219 | 3300031344 | Ga0265316_10167132 | Ga0265316_101671322 | 338 |
| 220 | 3300031595 | Ga0265313_10031726 | Ga0265313_100317262 | 338 |
| 221 | 3300031595 | Ga0265313_10032142 | Ga0265313_100321421 | 338 |
| 222 | 3300031712 | Ga0265342_10028709 | Ga0265342_100287092 | 338 |
| 223 | 3300035118 | Ga0373954_0020018 | Ga0373954_0020018_1671_2738 | 338 |
| 224 | 3300035171 | Ga0373946_0023553 | Ga0373946_0023553_1029_2096 | 338 |
| 225 | 3300035725 | Ga0373947_0018272 | Ga0373947_0018272_625_1692 | 338 |
| 226 | 3300042435 | Ga0439434_0013050 | Ga0439434_0013050_1358_2398 | 338 |
| 227 | 3300046475 | Ga0495639_0019155 | Ga0495639_0019155_1839_2906 | 338 |
| 228 | 3300046476 | Ga0495662_0016897 | Ga0495662_0016897_1787_2854 | 338 |
| 229 | 3300046514 | Ga0495618_0015285 | Ga0495618_0015285_3057_4124 | 338 |
| 230 | 3300046680 | Ga0495646_0078644 | Ga0495646_0078644_83_1150 | 338 |
| 231 | 3300046690 | Ga0495624_0026919 | Ga0495624_0026919_56_1123 | 338 |
| 232 | 3300048928 | Ga0496125_0018116 | Ga0496125_0018116_1937_2989 | 338 |
| 233 | 3300049584 | Ga0501068_0057429 | Ga0501068_0057429_709_1749 | 338 |
| 234 | 3300049586 | Ga0501070_0129722 | Ga0501070_0129722_502_1533 | 338 |
| 235 | 3300049588 | Ga0501072_0072611 | Ga0501072_0072611_1182_2222 | 338 |
| 236 | 3300049592 | Ga0501076_0041032 | Ga0501076_0041032_1005_2045 | 338 |
| 237 | 3300049741 | Ga0501079_0318211 | Ga0501079_0318211_143_1174 | 338 |
| 238 | 3300049742 | Ga0501080_0121517 | Ga0501080_0121517_288_1319 | 338 |
| 239 | 3300049742 | Ga0501080_0259995 | Ga0501080_0259995_72_1112 | 338 |
| 240 | 3300050496 | nmdc:mga07m45_17070_c1 | nmdc:mga07m45_17070_c1_405_1427 | 338 |
| 241 | 3300053078 | Ga0495612_0018968 | Ga0495612_0018968_566_1633 | 338 |
| 242 | 3300053177 | Ga0500636_0130986 | Ga0500636_0130986_228_1307 | 338 |
| 243 | 3300054114 | Ga0501084_0112360 | Ga0501084_0112360_134_1174 | 338 |
| 244 | 3300061734 | Ga0530510_0084401 | Ga0530510_0084401_1061_2101 | 338 |
| 245 | 3300005329 | Ga0070683_100001565 | Ga0070683_10000156512 | 339 |
| 246 | 3300005458 | Ga0070681_10017623 | Ga0070681_100176237 | 339 |
| 247 | 3300005539 | Ga0068853_100197522 | Ga0068853_1001975221 | 339 |
| 248 | 3300028379 | Ga0268266_10299813 | Ga0268266_102998131 | 339 |
| 249 | 3300028556 | Ga0265337_1018969 | Ga0265337_10189692 | 339 |
| 250 | 3300028563 | Ga0265319_1009816 | Ga0265319_10098162 | 339 |
| 251 | 3300028653 | Ga0265323_10001213 | Ga0265323_100012137 | 339 |
| 252 | 3300028666 | Ga0265336_10001031 | Ga0265336_100010313 | 339 |
| 253 | 3300028800 | Ga0265338_10000973 | Ga0265338_1000097333 | 339 |
| 254 | 3300029957 | Ga0265324_10001933 | Ga0265324_100019337 | 339 |
| 255 | 3300035725 | Ga0373947_0000552 | Ga0373947_0000552_3731_4816 | 339 |
| 256 | 3300036647 | Ga0316582_0088660 | Ga0316582_0088660_198_1223 | 339 |
| 257 | 3300046472 | Ga0495580_0003379 | Ga0495580_0003379_9882_10967 | 339 |
| 258 | 3300048928 | Ga0496125_0000595 | Ga0496125_0000595_14918_15985 | 339 |
| 259 | 3300049568 | Ga0501031_0009305 | Ga0501031_0009305_4604_5650 | 339 |
| 260 | 3300049569 | Ga0501032_0003343 | Ga0501032_0003343_6094_7140 | 339 |
| 261 | 3300049570 | Ga0501033_0000128 | Ga0501033_0000128_15334_16380 | 339 |
| 262 | 3300049571 | Ga0501034_0000113 | Ga0501034_0000113_130597_131643 | 339 |
| 263 | 3300049572 | Ga0501036_0000536 | Ga0501036_0000536_1848_2894 | 339 |
| 264 | 3300049573 | Ga0501037_0000214 | Ga0501037_0000214_47396_48442 | 339 |
| 265 | 3300049574 | Ga0501038_0003329 | Ga0501038_0003329_10270_11316 | 339 |
| 266 | 3300049575 | Ga0501039_0001003 | Ga0501039_0001003_1729_2775 | 339 |
| 267 | 3300049578 | Ga0501042_0156795 | Ga0501042_0156795_363_1409 | 339 |
| 268 | 3300049579 | Ga0501043_0001803 | Ga0501043_0001803_5069_6115 | 339 |
| 269 | 3300049580 | Ga0501046_0002091 | Ga0501046_0002091_5139_6185 | 339 |
| 270 | 3300049581 | Ga0501047_0000044 | Ga0501047_0000044_121611_122657 | 339 |
| 271 | 3300049582 | Ga0501048_0000117 | Ga0501048_0000117_16958_18004 | 339 |
| 272 | 3300049583 | Ga0501067_0004289 | Ga0501067_0004289_1751_2797 | 339 |
| 273 | 3300049584 | Ga0501068_0000089 | Ga0501068_0000089_262_1308 | 339 |
| 274 | 3300049585 | Ga0501069_0003520 | Ga0501069_0003520_1894_2940 | 339 |
| 275 | 3300049586 | Ga0501070_0000457 | Ga0501070_0000457_33160_34212 | 339 |
| 276 | 3300049586 | Ga0501070_0002301 | Ga0501070_0002301_5172_6218 | 339 |
| 277 | 3300049588 | Ga0501072_0017470 | Ga0501072_0017470_1662_2708 | 339 |
| 278 | 3300049589 | Ga0501073_0000669 | Ga0501073_0000669_15373_16419 | 339 |
| 279 | 3300049590 | Ga0501074_0000035 | Ga0501074_0000035_57517_58563 | 339 |
| 280 | 3300049741 | Ga0501079_0020353 | Ga0501079_0020353_2106_3152 | 339 |
| 281 | 3300049742 | Ga0501080_0001566 | Ga0501080_0001566_12428_13474 | 339 |
| 282 | 3300049744 | Ga0501083_0004584 | Ga0501083_0004584_3698_4744 | 339 |
| 283 | 3300049822 | Ga0501035_0000128 | Ga0501035_0000128_85613_86659 | 339 |
| 284 | 3300049823 | Ga0501044_0000108 | Ga0501044_0000108_54832_55878 | 339 |
| 285 | 3300049824 | Ga0501045_0019508 | Ga0501045_0019508_758_1804 | 339 |
| 286 | 3300054114 | Ga0501084_0002026 | Ga0501084_0002026_5181_6227 | 339 |
| 287 | 3300060353 | Ga0501082_0005129 | Ga0501082_0005129_8318_9364 | 339 |
| 288 | 3300005458 | Ga0070681_10288955 | Ga0070681_102889552 | 340 |
| 289 | 3300006871 | Ga0075434_100207360 | Ga0075434_1002073602 | 340 |
| 290 | 3300009094 | Ga0111539_10204300 | Ga0111539_102043002 | 340 |
| 291 | 3300025912 | Ga0207707_10258963 | Ga0207707_102589632 | 340 |
| 292 | 3300028577 | Ga0265318_10015874 | Ga0265318_100158742 | 340 |
| 293 | 3300031247 | Ga0265340_10010166 | Ga0265340_100101662 | 340 |
| 294 | 3300031595 | Ga0265313_10009770 | Ga0265313_100097701 | 340 |
| 295 | 3300048922 | Ga0496119_0000308 | Ga0496119_0000308_29319_30365 | 340 |
| 296 | 3300048925 | Ga0496122_0001649 | Ga0496122_0001649_33481_34527 | 340 |
| 297 | 3300048926 | Ga0496123_0000602 | Ga0496123_0000602_5877_6923 | 340 |
| 298 | 3300050511 | nmdc:mga08y16_15207_c1 | nmdc:mga08y16_15207_c1_1123_2151 | 340 |
| 299 | 3300050512 | nmdc:mga0n895_19830_c1 | nmdc:mga0n895_19830_c1_2381_3409 | 340 |
| 300 | 3300050515 | nmdc:mga0a205_92095_c1 | nmdc:mga0a205_92095_c1_1335_2363 | 340 |
| 301 | 3300053117 | Ga0500593_064476 | Ga0500593_064476_470_1510 | 340 |
| 302 | 3300053136 | Ga0500559_0077692 | Ga0500559_0077692_36_1103 | 340 |
| 303 | 3300053155 | Ga0500620_005383 | Ga0500620_005383_288_1355 | 340 |
| 304 | 3300053177 | Ga0500636_0000059 | Ga0500636_0000059_21906_22973 | 340 |
| 305 | iso_pu_bacteria | 2643221547 | 2643758774 | 340 |
| 306 | 3300005439 | Ga0070711_100037502 | Ga0070711_1000375022 | 341 |
| 307 | 3300005455 | Ga0070663_100085621 | Ga0070663_1000856212 | 341 |
| 308 | 3300005458 | Ga0070681_10130932 | Ga0070681_101309322 | 341 |
| 309 | 3300005530 | Ga0070679_100068439 | Ga0070679_1000684392 | 341 |
| 310 | 3300005530 | Ga0070679_100177156 | Ga0070679_1001771562 | 341 |
| 311 | 3300005563 | Ga0068855_100192544 | Ga0068855_1001925442 | 341 |
| 312 | 3300005614 | Ga0068856_100355798 | Ga0068856_1003557981 | 341 |
| 313 | 3300005617 | Ga0068859_100261505 | Ga0068859_1002615052 | 341 |
| 314 | 3300006028 | Ga0070717_10051304 | Ga0070717_100513042 | 341 |
| 315 | 3300006846 | Ga0075430_100065067 | Ga0075430_1000650672 | 341 |
| 316 | 3300006847 | Ga0075431_100245228 | Ga0075431_1002452282 | 341 |
| 317 | 3300006931 | Ga0097620_100261533 | Ga0097620_1002615332 | 341 |
| 318 | 3300009101 | Ga0105247_10020077 | Ga0105247_100200772 | 341 |
| 319 | 3300010159 | Ga0099796_10006477 | Ga0099796_100064772 | 341 |
| 320 | 3300025913 | Ga0207695_10153976 | Ga0207695_101539762 | 341 |
| 321 | 3300025921 | Ga0207652_10084927 | Ga0207652_100849272 | 341 |
| 322 | 3300031730 | Ga0307516_10011022 | Ga0307516_100110222 | 341 |
| 323 | 3300033180 | Ga0307510_10093046 | Ga0307510_100930462 | 341 |
| 324 | 3300035111 | Ga0373923_0000577 | Ga0373923_0000577_2910_4103 | 341 |
| 325 | 3300035113 | Ga0373936_0010575 | Ga0373936_0010575_317_1351 | 341 |
| 326 | 3300035118 | Ga0373954_0010639 | Ga0373954_0010639_1616_2809 | 341 |
| 327 | 3300035120 | Ga0373957_0013008 | Ga0373957_0013008_435_1628 | 341 |
| 328 | 3300035170 | Ga0373943_0000679 | Ga0373943_0000679_10008_11201 | 341 |
| 329 | 3300035171 | Ga0373946_0009020 | Ga0373946_0009020_1195_2388 | 341 |
| 330 | 3300035172 | Ga0373955_0000054 | Ga0373955_0000054_9186_10379 | 341 |
| 331 | 3300035410 | Ga0373924_0000398 | Ga0373924_0000398_9231_10424 | 341 |
| 332 | 3300035692 | Ga0373935_0000223 | Ga0373935_0000223_17790_18983 | 341 |
| 333 | 3300035724 | Ga0373933_0001275 | Ga0373933_0001275_3213_4406 | 341 |
| 334 | 3300035725 | Ga0373947_0006263 | Ga0373947_0006263_2782_3975 | 341 |
| 335 | 3300036401 | Ga0373937_0000006 | Ga0373937_0000006_182285_183478 | 341 |
| 336 | 3300037068 | Ga0373925_0000002 | Ga0373925_0000002_313861_315054 | 341 |
| 337 | 3300046454 | Ga0495592_0000086 | Ga0495592_0000086_18502_19695 | 341 |
| 338 | 3300046459 | Ga0495629_0003367 | Ga0495629_0003367_4231_5424 | 341 |
| 339 | 3300046462 | Ga0495651_0000562 | Ga0495651_0000562_23299_24492 | 341 |
| 340 | 3300046463 | Ga0495653_0000006 | Ga0495653_0000006_314009_315202 | 341 |
| 341 | 3300046473 | Ga0495582_0011820 | Ga0495582_0011820_466_1659 | 341 |
| 342 | 3300046476 | Ga0495662_0003942 | Ga0495662_0003942_1192_2385 | 341 |
| 343 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_349643_350836 | 341 |
| 344 | 3300046511 | Ga0495608_0000009 | Ga0495608_0000009_129599_130792 | 341 |
| 345 | 3300046514 | Ga0495618_0000005 | Ga0495618_0000005_127002_128195 | 341 |
| 346 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_314028_315221 | 341 |
| 347 | 3300046517 | Ga0495630_0000240 | Ga0495630_0000240_5661_6854 | 341 |
| 348 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_273662_274855 | 341 |
| 349 | 3300046533 | Ga0495640_0000005 | Ga0495640_0000005_129614_130807 | 341 |
| 350 | 3300046536 | Ga0495587_0000007 | Ga0495587_0000007_187435_188628 | 341 |
| 351 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_295279_296472 | 341 |
| 352 | 3300046559 | Ga0495667_0000002 | Ga0495667_0000002_122502_123695 | 341 |
| 353 | 3300046642 | Ga0495634_0000370 | Ga0495634_0000370_24177_25370 | 341 |
| 354 | 3300046663 | Ga0495635_0000020 | Ga0495635_0000020_123401_124594 | 341 |
| 355 | 3300046675 | Ga0495657_0000240 | Ga0495657_0000240_30360_31553 | 341 |
| 356 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_452706_453899 | 341 |
| 357 | 3300046679 | Ga0495623_0000001 | Ga0495623_0000001_221651_222844 | 341 |
| 358 | 3300046680 | Ga0495646_0000013 | Ga0495646_0000013_72284_73477 | 341 |
| 359 | 3300046689 | Ga0495613_0023466 | Ga0495613_0023466_324_1517 | 341 |
| 360 | 3300046690 | Ga0495624_0117597 | Ga0495624_0117597_220_1413 | 341 |
| 361 | 3300046691 | Ga0495670_0034095 | Ga0495670_0034095_445_1494 | 341 |
| 362 | 3300046809 | Ga0495600_0000041 | Ga0495600_0000041_31273_32466 | 341 |
| 363 | 3300047315 | Ga0495581_0009344 | Ga0495581_0009344_2551_3783 | 341 |
| 364 | 3300047317 | Ga0495604_0000005 | Ga0495604_0000005_339672_340865 | 341 |
| 365 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_246905_248098 | 341 |
| 366 | 3300047322 | Ga0495680_0000002 | Ga0495680_0000002_117095_118288 | 341 |
| 367 | 3300047444 | Ga0495675_0000010 | Ga0495675_0000010_1766_2959 | 341 |
| 368 | 3300047471 | Ga0495684_0000020 | Ga0495684_0000020_63688_64881 | 341 |
| 369 | 3300047673 | Ga0495593_0003730 | Ga0495593_0003730_3018_4211 | 341 |
| 370 | 3300048088 | Ga0495602_0000027 | Ga0495602_0000027_41588_42781 | 341 |
| 371 | 3300048924 | Ga0496121_0057626 | Ga0496121_0057626_799_1869 | 341 |
| 372 | 3300048929 | Ga0496126_0022532 | Ga0496126_0022532_4745_5812 | 341 |
| 373 | 3300048929 | Ga0496126_0040649 | Ga0496126_0040649_830_1900 | 341 |
| 374 | 3300049582 | Ga0501048_0258647 | Ga0501048_0258647_41_1072 | 341 |
| 375 | 3300053077 | Ga0495601_0000008 | Ga0495601_0000008_7521_8714 | 341 |
| 376 | 3300053078 | Ga0495612_0000002 | Ga0495612_0000002_225624_226817 | 341 |
| 377 | 3300053084 | Ga0495595_0000008 | Ga0495595_0000008_7649_8842 | 341 |
| 378 | 3300053085 | Ga0495619_0000002 | Ga0495619_0000002_314031_315224 | 341 |
| 379 | iso_pu_bacteria | 2842694124 | 2842695921 | 341 |
| 380 | 3300006941 | Ga0099825_1028536 | Ga0099825_10285362 | 342 |
| 381 | 3300006944 | Ga0099823_1034197 | Ga0099823_10341971 | 342 |
| 382 | 3300021384 | Ga0213876_10005943 | Ga0213876_100059432 | 342 |
| 383 | 3300027296 | Ga0209389_1000076 | Ga0209389_100007664 | 342 |
| 384 | 3300027361 | Ga0209489_108247 | Ga0209489_10824713 | 342 |
| 385 | 3300027363 | Ga0209700_100014 | Ga0209700_10001463 | 342 |
| 386 | 3300031344 | Ga0265316_10055949 | Ga0265316_100559492 | 342 |
| 387 | 3300031995 | Ga0307409_100260450 | Ga0307409_1002604502 | 342 |
| 388 | 3300039437 | Ga0436365_0253472 | Ga0436365_0253472_18460_19500 | 342 |
| 389 | 3300039453 | Ga0436362_0199820 | Ga0436362_0199820_289_1329 | 342 |
| 390 | 3300048929 | Ga0496126_0223294 | Ga0496126_0223294_431_1468 | 342 |
| 391 | 3300049569 | Ga0501032_0077796 | Ga0501032_0077796_364_1404 | 342 |
| 392 | 3300049570 | Ga0501033_0119490 | Ga0501033_0119490_373_1413 | 342 |
| 393 | 3300049572 | Ga0501036_0067162 | Ga0501036_0067162_540_1580 | 342 |
| 394 | 3300049574 | Ga0501038_0102486 | Ga0501038_0102486_969_2009 | 342 |
| 395 | 3300049575 | Ga0501039_0028355 | Ga0501039_0028355_3148_4188 | 342 |
| 396 | 3300049581 | Ga0501047_0106659 | Ga0501047_0106659_621_1664 | 342 |
| 397 | 3300049586 | Ga0501070_0034181 | Ga0501070_0034181_2580_3620 | 342 |
| 398 | 3300049822 | Ga0501035_0252214 | Ga0501035_0252214_307_1362 | 342 |
| 399 | 3300049823 | Ga0501044_0019204 | Ga0501044_0019204_233_1273 | 342 |
| 400 | iso_pu_bacteria | 2889033259 | 2889036137 | 342 |
| 401 | 3300003762 | Ga0055542_1003949 | Ga0055542_10039492 | 343 |
| 402 | 3300025254 | Ga0209148_1000526 | Ga0209148_100052615 | 343 |
| 403 | 3300025272 | Ga0209455_1000950 | Ga0209455_100095014 | 343 |
| 404 | 3300048909 | Ga0496106_0009042 | Ga0496106_0009042_3095_4162 | 343 |
| 405 | 3300048910 | Ga0496107_0004737 | Ga0496107_0004737_1804_2871 | 343 |
| 406 | 3300048911 | Ga0496108_0000442 | Ga0496108_0000442_29180_30247 | 343 |
| 407 | 3300048912 | Ga0496109_0004462 | Ga0496109_0004462_3181_4248 | 343 |
| 408 | 3300048913 | Ga0496110_0042506 | Ga0496110_0042506_1829_2896 | 343 |
| 409 | 3300048916 | Ga0496113_0033938 | Ga0496113_0033938_1828_2895 | 343 |
| 410 | 3300053080 | Ga0500635_0001128 | Ga0500635_0001128_3383_4456 | 343 |
| 411 | 3300053150 | Ga0500603_000487 | Ga0500603_000487_4235_5308 | 343 |
| 412 | 3300053178 | Ga0500637_0002787 | Ga0500637_0002787_3347_4420 | 343 |
| 413 | iso_pu_bacteria | 2513237141 | 2513889644 | 343 |
| 414 | iso_pu_bacteria | 2876808645 | 2876812014 | 343 |
| 415 | iso_pu_bacteria | 2879110137 | 2879112598 | 343 |
| 416 | 3300003659 | JGI25404J52841_10019198 | JGI25404J52841_100191981 | 344 |
| 417 | 3300005937 | Ga0081455_10052828 | Ga0081455_100528282 | 344 |
| 418 | 3300005985 | Ga0081539_10015391 | Ga0081539_100153914 | 344 |
| 419 | 3300013104 | Ga0157370_10223467 | Ga0157370_102234672 | 344 |
| 420 | 3300026078 | Ga0207702_10356479 | Ga0207702_103564791 | 344 |
| 421 | 3300048915 | Ga0496112_0197363 | Ga0496112_0197363_759_1793 | 344 |
| 422 | 3300048924 | Ga0496121_0064926 | Ga0496121_0064926_229_1296 | 344 |
| 423 | iso_pu_bacteria | 2513237101 | 2513698118 | 344 |
| 424 | iso_pu_bacteria | 2721755755 | 2723849168 | 344 |
| 425 | iso_pu_bacteria | 2791355199 | 2793078474 | 344 |
| 426 | iso_pu_bacteria | 2874604998 | 2874606894 | 344 |
| 427 | iso_pu_bacteria | 2922361189 | 2922364516 | 344 |
| 428 | iso_pu_bacteria | 2922386360 | 2922389199 | 344 |
| 429 | iso_pu_bacteria | 8006964411 | 8006967708 | 344 |
| 430 | iso_pu_bacteria | 8006984368 | 8006992634 | 344 |
| 431 | iso_pu_bacteria | 8056673599 | 8056678417 | 344 |
| 432 | 3300031250 | Ga0265331_10096895 | Ga0265331_100968952 | 345 |
| 433 | 3300031711 | Ga0265314_10129397 | Ga0265314_101293972 | 345 |
| 434 | 3300031712 | Ga0265342_10002077 | Ga0265342_1000207710 | 345 |
| 435 | 3300053093 | Ga0500651_0067853 | Ga0500651_0067853_374_1438 | 345 |
| 436 | 3300053159 | Ga0500630_039439 | Ga0500630_039439_960_1997 | 345 |
| 437 | 3300053163 | Ga0500639_065420 | Ga0500639_065420_350_1411 | 345 |
| 438 | 3300053177 | Ga0500636_0000344 | Ga0500636_0000344_23416_24480 | 345 |
| 439 | 3300053735 | Ga0500596_005131 | Ga0500596_005131_298_1335 | 345 |
| 440 | iso_pu_bacteria | 2513237098 | 2513678464 | 345 |
| 441 | iso_pu_bacteria | 2643221651 | 2644290604 | 345 |
| 442 | iso_pu_bacteria | 2885383462 | 2885389683 | 345 |
| 443 | iso_pu_bacteria | 2903768456 | 2903774732 | 345 |
| 444 | iso_pu_bacteria | 8056681323 | 8056687780 | 345 |
| 445 | 3300005435 | Ga0070714_100031635 | Ga0070714_1000316353 | 346 |
| 446 | 3300005937 | Ga0081455_10000694 | Ga0081455_1000069429 | 346 |
| 447 | 3300009545 | Ga0105237_10229935 | Ga0105237_102299352 | 346 |
| 448 | 3300009545 | Ga0105237_10303872 | Ga0105237_103038722 | 346 |
| 449 | 3300009551 | Ga0105238_10145976 | Ga0105238_101459762 | 346 |
| 450 | 3300013105 | Ga0157369_10006988 | Ga0157369_1000698811 | 346 |
| 451 | 3300013296 | Ga0157374_10137921 | Ga0157374_101379212 | 346 |
| 452 | 3300025914 | Ga0207671_10225206 | Ga0207671_102252062 | 346 |
| 453 | 3300025924 | Ga0207694_10024912 | Ga0207694_100249123 | 346 |
| 454 | 3300025928 | Ga0207700_10017910 | Ga0207700_100179102 | 346 |
| 455 | 3300025929 | Ga0207664_10029903 | Ga0207664_100299033 | 346 |
| 456 | 3300037466 | Ga0395898_0010285 | Ga0395898_0010285_3205_4245 | 346 |
| 457 | 3300039437 | Ga0436365_0856193 | Ga0436365_0856193_3024_4064 | 346 |
| 458 | 3300039438 | Ga0436360_0752976 | Ga0436360_0752976_1041_2081 | 346 |
| 459 | 3300048924 | Ga0496121_0127234 | Ga0496121_0127234_321_1361 | 346 |
| 460 | iso_pu_bacteria | 2507262055 | 2507504672 | 346 |
| 461 | iso_pu_bacteria | 2508501009 | 2508539912 | 346 |
| 462 | iso_pu_bacteria | 2508501042 | 2508694951 | 346 |
| 463 | iso_pu_bacteria | 2511231028 | 2511397050 | 346 |
| 464 | iso_pu_bacteria | 2513237092 | 2513626631 | 346 |
| 465 | iso_pu_bacteria | 2513237094 | 2513640686 | 346 |
| 466 | iso_pu_bacteria | 2513237095 | 2513653430 | 346 |
| 467 | iso_pu_bacteria | 2513237102 | 2513699171 | 346 |
| 468 | iso_pu_bacteria | 2513237104 | 2513714874 | 346 |
| 469 | iso_pu_bacteria | 2513237161 | 2514016339 | 346 |
| 470 | iso_pu_bacteria | 2515154112 | 2515627758 | 346 |
| 471 | iso_pu_bacteria | 2517093001 | 2517108701 | 346 |
| 472 | iso_pu_bacteria | 2524023205 | 2524438612 | 346 |
| 473 | iso_pu_bacteria | 2524023210 | 2524466165 | 346 |
| 474 | iso_pu_bacteria | 2528768022 | 2528858318 | 346 |
| 475 | iso_pu_bacteria | 2602042107 | 2603857944 | 346 |
| 476 | iso_pu_bacteria | 2617270741 | 2617377118 | 346 |
| 477 | iso_pu_bacteria | 2744054633 | 2745077671 | 346 |
| 478 | iso_pu_bacteria | 2791355196 | 2793063250 | 346 |
| 479 | iso_pu_bacteria | 2816332527 | 2818243487 | 346 |
| 480 | iso_pu_bacteria | 2824600985 | 2824605809 | 346 |
| 481 | iso_pu_bacteria | 2824609381 | 2824611977 | 346 |
| 482 | iso_pu_bacteria | 2824617872 | 2824626014 | 346 |
| 483 | iso_pu_bacteria | 2824626560 | 2824632533 | 346 |
| 484 | iso_pu_bacteria | 2824635225 | 2824642703 | 346 |
| 485 | iso_pu_bacteria | 2824644064 | 2824650585 | 346 |
| 486 | iso_pu_bacteria | 2824653114 | 2824661069 | 346 |
| 487 | iso_pu_bacteria | 2824661429 | 2824669178 | 346 |
| 488 | iso_pu_bacteria | 2824671348 | 2824674726 | 346 |
| 489 | iso_pu_bacteria | 2824679649 | 2824685426 | 346 |
| 490 | iso_pu_bacteria | 2824687955 | 2824692602 | 346 |
| 491 | iso_pu_bacteria | 2824696289 | 2824700959 | 346 |
| 492 | iso_pu_bacteria | 2824704595 | 2824709367 | 346 |
| 493 | iso_pu_bacteria | 2824714736 | 2824720574 | 346 |
| 494 | iso_pu_bacteria | 2824723954 | 2824730659 | 346 |
| 495 | iso_pu_bacteria | 2824732956 | 2824734096 | 346 |
| 496 | iso_pu_bacteria | 2824746037 | 2824749157 | 346 |
| 497 | iso_pu_bacteria | 2824753945 | 2824761954 | 346 |
| 498 | iso_pu_bacteria | 2824763712 | 2824770603 | 346 |
| 499 | iso_pu_bacteria | 2824773399 | 2824780153 | 346 |
| 500 | iso_pu_bacteria | 2838122688 | 2838130253 | 346 |
| 501 | iso_pu_bacteria | 2841941048 | 2841944304 | 346 |
| 502 | iso_pu_bacteria | 2841949485 | 2841954519 | 346 |
| 503 | iso_pu_bacteria | 2841957949 | 2841963432 | 346 |
| 504 | iso_pu_bacteria | 2841966195 | 2841969081 | 346 |
| 505 | iso_pu_bacteria | 2841974524 | 2841979855 | 346 |
| 506 | iso_pu_bacteria | 2841983080 | 2841989547 | 346 |
| 507 | iso_pu_bacteria | 2842038055 | 2842044044 | 346 |
| 508 | iso_pu_bacteria | 2842045827 | 2842051967 | 346 |
| 509 | iso_pu_bacteria | 2844315083 | 2844316020 | 346 |
| 510 | iso_pu_bacteria | 2847930680 | 2847931508 | 346 |
| 511 | iso_pu_bacteria | 2847939898 | 2847941600 | 346 |
| 512 | iso_pu_bacteria | 2849076700 | 2849082526 | 346 |
| 513 | iso_pu_bacteria | 2857509624 | 2857515789 | 346 |
| 514 | iso_pu_bacteria | 2857524615 | 2857527324 | 346 |
| 515 | iso_pu_bacteria | 2874590934 | 2874593753 | 346 |
| 516 | iso_pu_bacteria | 2874612657 | 2874619630 | 346 |
| 517 | iso_pu_bacteria | 2874620515 | 2874624281 | 346 |
| 518 | iso_pu_bacteria | 2874628541 | 2874634043 | 346 |
| 519 | iso_pu_bacteria | 2874645413 | 2874647992 | 346 |
| 520 | iso_pu_bacteria | 2876771140 | 2876772844 | 346 |
| 521 | iso_pu_bacteria | 2876818435 | 2876826427 | 346 |
| 522 | iso_pu_bacteria | 2879074833 | 2879077540 | 346 |
| 523 | iso_pu_bacteria | 2879083081 | 2879091368 | 346 |
| 524 | iso_pu_bacteria | 2879099564 | 2879100075 | 346 |
| 525 | iso_pu_bacteria | 2879127579 | 2879134380 | 346 |
| 526 | iso_pu_bacteria | 2879142872 | 2879147338 | 346 |
| 527 | iso_pu_bacteria | 2881364244 | 2881364946 | 346 |
| 528 | iso_pu_bacteria | 2881665667 | 2881673196 | 346 |
| 529 | iso_pu_bacteria | 2885366525 | 2885368149 | 346 |
| 530 | iso_pu_bacteria | 2885409591 | 2885410958 | 346 |
| 531 | iso_pu_bacteria | 2888378607 | 2888378843 | 346 |
| 532 | iso_pu_bacteria | 2888388044 | 2888391174 | 346 |
| 533 | iso_pu_bacteria | 2888419890 | 2888427270 | 346 |
| 534 | iso_pu_bacteria | 2893066018 | 2893071864 | 346 |
| 535 | iso_pu_bacteria | 2903727486 | 2903729586 | 346 |
| 536 | iso_pu_bacteria | 2904666416 | 2904672380 | 346 |
| 537 | iso_pu_bacteria | 2904711408 | 2904717966 | 346 |
| 538 | iso_pu_bacteria | 2906602504 | 2906606089 | 346 |
| 539 | iso_pu_bacteria | 2906626472 | 2906635084 | 346 |
| 540 | iso_pu_bacteria | 2906643746 | 2906645627 | 346 |
| 541 | iso_pu_bacteria | 2908775508 | 2908783030 | 346 |
| 542 | iso_pu_bacteria | 2919073203 | 2919078435 | 346 |
| 543 | iso_pu_bacteria | 2922368715 | 2922378514 | 346 |
| 544 | iso_pu_bacteria | 2922393267 | 2922400933 | 346 |
| 545 | iso_pu_bacteria | 2929615660 | 2929622400 | 346 |
| 546 | iso_pu_bacteria | 2929624759 | 2929631383 | 346 |
| 547 | iso_pu_bacteria | 2932784394 | 2932786171 | 346 |
| 548 | iso_pu_bacteria | 2932794094 | 2932800055 | 346 |
| 549 | iso_pu_bacteria | 2932801729 | 2932808357 | 346 |
| 550 | iso_pu_bacteria | 2932809354 | 2932816868 | 346 |
| 551 | iso_pu_bacteria | 2932818245 | 2932826008 | 346 |
| 552 | iso_pu_bacteria | 2932828146 | 2932829435 | 346 |
| 553 | iso_pu_bacteria | 2933577622 | 2933584520 | 346 |
| 554 | iso_pu_bacteria | 2935608549 | 2935615133 | 346 |
| 555 | iso_pu_bacteria | 2935616580 | 2935617867 | 346 |
| 556 | iso_pu_bacteria | 2935638405 | 2935647840 | 346 |
| 557 | iso_pu_bacteria | 2935648319 | 2935651509 | 346 |
| 558 | iso_pu_bacteria | 2935656913 | 2935659723 | 346 |
| 559 | iso_pu_bacteria | 2935665750 | 2935674747 | 346 |
| 560 | iso_pu_bacteria | 2935675223 | 2935678109 | 346 |
| 561 | iso_pu_bacteria | 2935684952 | 2935692397 | 346 |
| 562 | iso_pu_bacteria | 2935694250 | 2935702892 | 346 |
| 563 | iso_pu_bacteria | 2935703347 | 2935707116 | 346 |
| 564 | iso_pu_bacteria | 2935713505 | 2935721015 | 346 |
| 565 | iso_pu_bacteria | 2935722832 | 2935722840 | 346 |
| 566 | iso_pu_bacteria | 2935732158 | 2935739704 | 346 |
| 567 | iso_pu_bacteria | 2935741537 | 2935748742 | 346 |
| 568 | iso_pu_bacteria | 2935750917 | 2935758612 | 346 |
| 569 | iso_pu_bacteria | 2935760218 | 2935764592 | 346 |
| 570 | iso_pu_bacteria | 2935769743 | 2935775487 | 346 |
| 571 | iso_pu_bacteria | 2935777560 | 2935779734 | 346 |
| 572 | iso_pu_bacteria | 2935785616 | 2935789983 | 346 |
| 573 | iso_pu_bacteria | 2935793552 | 2935798412 | 346 |
| 574 | iso_pu_bacteria | 2935801545 | 2935806641 | 346 |
| 575 | iso_pu_bacteria | 2935810662 | 2935819098 | 346 |
| 576 | iso_pu_bacteria | 2935819856 | 2935825829 | 346 |
| 577 | iso_pu_bacteria | 2935827899 | 2935837324 | 346 |
| 578 | iso_pu_bacteria | 2935837841 | 2935841989 | 346 |
| 579 | iso_pu_bacteria | 2935847175 | 2935851448 | 346 |
| 580 | iso_pu_bacteria | 2935855204 | 2935856634 | 346 |
| 581 | iso_pu_bacteria | 2935864058 | 2935872922 | 346 |
| 582 | iso_pu_bacteria | 2935873716 | 2935874401 | 346 |
| 583 | iso_pu_bacteria | 2935883170 | 2935883465 | 346 |
| 584 | iso_pu_bacteria | 2935908558 | 2935910525 | 346 |
| 585 | iso_pu_bacteria | 2935916978 | 2935918071 | 346 |
| 586 | iso_pu_bacteria | 2935926038 | 2935927564 | 346 |
| 587 | iso_pu_bacteria | 2935934488 | 2935936564 | 346 |
| 588 | iso_pu_bacteria | 2935942939 | 2935943883 | 346 |
| 589 | iso_pu_bacteria | 2935951376 | 2935952320 | 346 |
| 590 | iso_pu_bacteria | 2935959822 | 2935964394 | 346 |
| 591 | iso_pu_bacteria | 2935967501 | 2935969160 | 346 |
| 592 | iso_pu_bacteria | 2935975950 | 2935978423 | 346 |
| 593 | iso_pu_bacteria | 2935984226 | 2935984611 | 346 |
| 594 | iso_pu_bacteria | 2935992306 | 2936001115 | 346 |
| 595 | iso_pu_bacteria | 2936002035 | 2936010769 | 346 |
| 596 | iso_pu_bacteria | 2936011229 | 2936014139 | 346 |
| 597 | iso_pu_bacteria | 2936019824 | 2936022952 | 346 |
| 598 | iso_pu_bacteria | 2936028420 | 2936031088 | 346 |
| 599 | iso_pu_bacteria | 2936037263 | 2936045751 | 346 |
| 600 | iso_pu_bacteria | 2936046547 | 2936049210 | 346 |
| 601 | iso_pu_bacteria | 2936055302 | 2936055656 | 346 |
| 602 | iso_pu_bacteria | 2940556831 | 2940564798 | 346 |
| 603 | iso_pu_bacteria | 2941531003 | 2941535882 | 346 |
| 604 | iso_pu_bacteria | 2941538514 | 2941547040 | 346 |
| 605 | iso_pu_bacteria | 3005483717 | 3005490517 | 346 |
| 606 | iso_pu_bacteria | 3005506211 | 3005509694 | 346 |
| 607 | iso_pu_bacteria | 3005587118 | 3005588893 | 346 |
| 608 | iso_pu_bacteria | 3005594810 | 3005595608 | 346 |
| 609 | iso_pu_bacteria | 3005710791 | 3005711599 | 346 |
| 610 | iso_pu_bacteria | 3005718088 | 3005718854 | 346 |
| 611 | iso_pu_bacteria | 8006926726 | 8006930821 | 346 |
| 612 | iso_pu_bacteria | 8016511872 | 8016518801 | 346 |
| 613 | iso_pu_bacteria | 8016583857 | 8016587072 | 346 |
| 614 | iso_pu_bacteria | 8016595262 | 8016596181 | 346 |
| 615 | iso_pu_bacteria | 8016622563 | 8016622569 | 346 |
| 616 | iso_pu_bacteria | 8016630954 | 8016636490 | 346 |
| 617 | iso_pu_bacteria | 8019538911 | 8019541066 | 346 |
| 618 | iso_pu_bacteria | 8019576017 | 8019577848 | 346 |
| 619 | iso_pu_bacteria | 8019586578 | 8019595949 | 346 |
| 620 | iso_pu_bacteria | 8019597564 | 8019605807 | 346 |
| 621 | iso_pu_bacteria | 8019608314 | 8019612727 | 346 |
| 622 | iso_pu_bacteria | 8019619141 | 8019622184 | 346 |
| 623 | iso_pu_bacteria | 8019629233 | 8019631130 | 346 |
| 624 | iso_pu_bacteria | 8019659431 | 8019667935 | 346 |
| 625 | iso_pu_bacteria | 8019668869 | 8019677353 | 346 |
| 626 | iso_pu_bacteria | 8019687851 | 8019696880 | 346 |
| 627 | iso_pu_bacteria | 8055742211 | 8055750851 | 346 |
| 628 | iso_pu_bacteria | 8056967851 | 8056970677 | 346 |
| 629 | 3300005344 | Ga0070661_100105407 | Ga0070661_1001054071 | 347 |
| 630 | 3300005539 | Ga0068853_100082005 | Ga0068853_1000820052 | 347 |
| 631 | 3300005843 | Ga0068860_100002293 | Ga0068860_1000022935 | 347 |
| 632 | 3300005983 | Ga0081540_1046396 | Ga0081540_10463962 | 347 |
| 633 | 3300006914 | Ga0075436_100007805 | Ga0075436_1000078055 | 347 |
| 634 | 3300007076 | Ga0075435_100202135 | Ga0075435_1002021352 | 347 |
| 635 | 3300025914 | Ga0207671_10200364 | Ga0207671_102003641 | 347 |
| 636 | 3300025925 | Ga0207650_10325946 | Ga0207650_103259461 | 347 |
| 637 | 3300026041 | Ga0207639_10454683 | Ga0207639_104546831 | 347 |
| 638 | 3300026067 | Ga0207678_10178676 | Ga0207678_101786761 | 347 |
| 639 | 3300026088 | Ga0207641_10111703 | Ga0207641_101117032 | 347 |
| 640 | 3300028381 | Ga0268264_10000187 | Ga0268264_1000018745 | 347 |
| 641 | 3300031247 | Ga0265340_10067015 | Ga0265340_100670152 | 347 |
| 642 | 3300031507 | Ga0307509_10197471 | Ga0307509_101974712 | 347 |
| 643 | 3300031507 | Ga0307509_10257676 | Ga0307509_102576762 | 347 |
| 644 | 3300031616 | Ga0307508_10106984 | Ga0307508_101069842 | 347 |
| 645 | 3300031730 | Ga0307516_10170369 | Ga0307516_101703692 | 347 |
| 646 | 3300031824 | Ga0307413_10210324 | Ga0307413_102103242 | 347 |
| 647 | 3300033179 | Ga0307507_10006502 | Ga0307507_100065024 | 347 |
| 648 | 3300035692 | Ga0373935_0172785 | Ga0373935_0172785_362_1432 | 347 |
| 649 | 3300035695 | Ga0373927_0007175 | Ga0373927_0007175_6476_7546 | 347 |
| 650 | 3300046475 | Ga0495639_0061591 | Ga0495639_0061591_251_1300 | 347 |
| 651 | 3300046664 | Ga0495659_0032352 | Ga0495659_0032352_463_1512 | 347 |
| 652 | 3300046674 | Ga0495588_0007149 | Ga0495588_0007149_1878_2927 | 347 |
| 653 | 3300047317 | Ga0495604_0072107 | Ga0495604_0072107_304_1347 | 347 |
| 654 | 3300048909 | Ga0496106_0002313 | Ga0496106_0002313_322_1392 | 347 |
| 655 | 3300048920 | Ga0496117_0021787 | Ga0496117_0021787_587_1657 | 347 |
| 656 | 3300048921 | Ga0496118_0002489 | Ga0496118_0002489_10098_11168 | 347 |
| 657 | 3300048922 | Ga0496119_0025270 | Ga0496119_0025270_1133_2230 | 347 |
| 658 | 3300048924 | Ga0496121_0000144 | Ga0496121_0000144_20262_21332 | 347 |
| 659 | 3300048924 | Ga0496121_0004310 | Ga0496121_0004310_11473_12570 | 347 |
| 660 | 3300048927 | Ga0496124_0003743 | Ga0496124_0003743_4670_5740 | 347 |
| 661 | 3300048928 | Ga0496125_0020399 | Ga0496125_0020399_1187_2257 | 347 |
| 662 | 3300048929 | Ga0496126_0041278 | Ga0496126_0041278_1346_2416 | 347 |
| 663 | 3300049569 | Ga0501032_0268106 | Ga0501032_0268106_13_1059 | 347 |
| 664 | 3300049571 | Ga0501034_0081524 | Ga0501034_0081524_1933_2979 | 347 |
| 665 | 3300049573 | Ga0501037_0221101 | Ga0501037_0221101_98_1144 | 347 |
| 666 | 3300049574 | Ga0501038_0004864 | Ga0501038_0004864_6042_7088 | 347 |
| 667 | 3300049581 | Ga0501047_0229694 | Ga0501047_0229694_316_1362 | 347 |
| 668 | 3300049586 | Ga0501070_0082792 | Ga0501070_0082792_184_1230 | 347 |
| 669 | 3300049589 | Ga0501073_0125793 | Ga0501073_0125793_379_1425 | 347 |
| 670 | 3300049823 | Ga0501044_0022496 | Ga0501044_0022496_2974_4020 | 347 |
| 671 | 3300050512 | nmdc:mga0n895_70614_c1 | nmdc:mga0n895_70614_c1_295_1341 | 347 |
| 672 | 3300050513 | nmdc:mga0rr50_238337_c1 | nmdc:mga0rr50_238337_c1_372_1418 | 347 |
| 673 | 3300050514 | nmdc:mga08x19_3956_c1 | nmdc:mga08x19_3956_c1_7361_8464 | 347 |
| 674 | 3300053119 | Ga0500595_004064 | Ga0500595_004064_1708_2805 | 347 |
| 675 | 3300053136 | Ga0500559_0006019 | Ga0500559_0006019_4206_5276 | 347 |
| 676 | 3300053147 | Ga0500589_120445 | Ga0500589_120445_49_1098 | 347 |
| 677 | 3300053151 | Ga0500604_0037226 | Ga0500604_0037226_193_1404 | 347 |
| 678 | 3300053177 | Ga0500636_0095485 | Ga0500636_0095485_218_1288 | 347 |
| 679 | iso_pu_bacteria | 2508501128 | 2509149907 | 347 |
| 680 | 3300005334 | Ga0068869_100012775 | Ga0068869_1000127752 | 348 |
| 681 | 3300005338 | Ga0068868_100033616 | Ga0068868_1000336163 | 348 |
| 682 | 3300005353 | Ga0070669_100184879 | Ga0070669_1001848792 | 348 |
| 683 | 3300005455 | Ga0070663_100037052 | Ga0070663_1000370522 | 348 |
| 684 | 3300005530 | Ga0070679_100070108 | Ga0070679_1000701082 | 348 |
| 685 | 3300005548 | Ga0070665_100026270 | Ga0070665_1000262702 | 348 |
| 686 | 3300005834 | Ga0068851_10144390 | Ga0068851_101443901 | 348 |
| 687 | 3300005842 | Ga0068858_100241544 | Ga0068858_1002415442 | 348 |
| 688 | 3300005844 | Ga0068862_100069003 | Ga0068862_1000690032 | 348 |
| 689 | 3300005981 | Ga0081538_10024227 | Ga0081538_100242272 | 348 |
| 690 | 3300005983 | Ga0081540_1008166 | Ga0081540_10081663 | 348 |
| 691 | 3300006195 | Ga0075366_10058775 | Ga0075366_100587752 | 348 |
| 692 | 3300006358 | Ga0068871_100020428 | Ga0068871_1000204282 | 348 |
| 693 | 3300009098 | Ga0105245_10113486 | Ga0105245_101134861 | 348 |
| 694 | 3300009147 | Ga0114129_10635750 | Ga0114129_106357501 | 348 |
| 695 | 3300009551 | Ga0105238_10243468 | Ga0105238_102434681 | 348 |
| 696 | 3300014325 | Ga0163163_10266422 | Ga0163163_102664222 | 348 |
| 697 | 3300025297 | Ga0209758_1025551 | Ga0209758_10255512 | 348 |
| 698 | 3300025899 | Ga0207642_10016138 | Ga0207642_100161382 | 348 |
| 699 | 3300025914 | Ga0207671_10079450 | Ga0207671_100794502 | 348 |
| 700 | 3300025919 | Ga0207657_10018608 | Ga0207657_100186082 | 348 |
| 701 | 3300025927 | Ga0207687_10017762 | Ga0207687_100177622 | 348 |
| 702 | 3300025932 | Ga0207690_10040950 | Ga0207690_100409502 | 348 |
| 703 | 3300025942 | Ga0207689_10078436 | Ga0207689_100784362 | 348 |
| 704 | 3300025942 | Ga0207689_10117316 | Ga0207689_101173162 | 348 |
| 705 | 3300025945 | Ga0207679_10186638 | Ga0207679_101866381 | 348 |
| 706 | 3300026035 | Ga0207703_10011565 | Ga0207703_100115655 | 348 |
| 707 | 3300026035 | Ga0207703_10200289 | Ga0207703_102002891 | 348 |
| 708 | 3300026075 | Ga0207708_10098589 | Ga0207708_100985892 | 348 |
| 709 | 3300026121 | Ga0207683_10040371 | Ga0207683_100403712 | 348 |
| 710 | 3300026121 | Ga0207683_10077702 | Ga0207683_100777022 | 348 |
| 711 | 3300031616 | Ga0307508_10000613 | Ga0307508_1000061338 | 348 |
| 712 | 3300032126 | Ga0307415_100038694 | Ga0307415_1000386941 | 348 |
| 713 | 3300035695 | Ga0373927_0010394 | Ga0373927_0010394_3965_5017 | 348 |
| 714 | 3300037068 | Ga0373925_0019170 | Ga0373925_0019170_2346_3398 | 348 |
| 715 | 3300046543 | Ga0495645_0161988 | Ga0495645_0161988_385_1437 | 348 |
| 716 | 3300048905 | Ga0496102_0179781 | Ga0496102_0179781_734_1795 | 348 |
| 717 | 3300048908 | Ga0496105_0042265 | Ga0496105_0042265_425_1486 | 348 |
| 718 | 3300048909 | Ga0496106_0058681 | Ga0496106_0058681_275_1336 | 348 |
| 719 | 3300048910 | Ga0496107_0155255 | Ga0496107_0155255_61_1122 | 348 |
| 720 | 3300049568 | Ga0501031_0112381 | Ga0501031_0112381_445_1509 | 348 |
| 721 | 3300049575 | Ga0501039_0256770 | Ga0501039_0256770_259_1311 | 348 |
| 722 | 3300049583 | Ga0501067_0031242 | Ga0501067_0031242_834_1886 | 348 |
| 723 | 3300049823 | Ga0501044_0019452 | Ga0501044_0019452_4360_5412 | 348 |
| 724 | 3300050489 | nmdc:mga03683_60136_c1 | nmdc:mga03683_60136_c1_324_1538 | 348 |
| 725 | 3300050507 | nmdc:mga05p37_114736_c1 | nmdc:mga05p37_114736_c1_1603_2655 | 348 |
| 726 | 3300053086 | Ga0500578_0051641 | Ga0500578_0051641_450_1550 | 348 |
| 727 | 3300053092 | Ga0500583_0033457 | Ga0500583_0033457_953_2005 | 348 |
| 728 | 3300053130 | Ga0500642_0087462 | Ga0500642_0087462_46_1146 | 348 |
| 729 | 3300053146 | Ga0500588_0035840 | Ga0500588_0035840_333_1433 | 348 |
| 730 | 3300053730 | Ga0500645_008956 | Ga0500645_008956_1626_2840 | 348 |
| 731 | iso_pu_bacteria | 8056689827 | 8056694093 | 348 |
| 732 | 3300005439 | Ga0070711_100019339 | Ga0070711_1000193392 | 349 |
| 733 | 3300005937 | Ga0081455_10009590 | Ga0081455_100095903 | 349 |
| 734 | 3300005983 | Ga0081540_1002390 | Ga0081540_10023904 | 349 |
| 735 | 3300005983 | Ga0081540_1015853 | Ga0081540_10158533 | 349 |
| 736 | 3300005983 | Ga0081540_1017401 | Ga0081540_10174012 | 349 |
| 737 | 3300005985 | Ga0081539_10002152 | Ga0081539_1000215214 | 349 |
| 738 | 3300021384 | Ga0213876_10004532 | Ga0213876_100045325 | 349 |
| 739 | 3300031616 | Ga0307508_10053567 | Ga0307508_100535673 | 349 |
| 740 | 3300039437 | Ga0436365_1272636 | Ga0436365_1272636_1024_2082 | 349 |
| 741 | 3300046455 | Ga0495603_0098736 | Ga0495603_0098736_273_1331 | 349 |
| 742 | 3300046536 | Ga0495587_0133702 | Ga0495587_0133702_31_1116 | 349 |
| 743 | 3300046809 | Ga0495600_0040334 | Ga0495600_0040334_311_1432 | 349 |
| 744 | 3300048925 | Ga0496122_0022588 | Ga0496122_0022588_2176_3240 | 349 |
| 745 | 3300048929 | Ga0496126_0009944 | Ga0496126_0009944_2926_3990 | 349 |
| 746 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_229545_230603 | 349 |
| 747 | iso_pu_bacteria | 2513237096 | 2513658985 | 349 |
| 748 | iso_pu_bacteria | 2513237137 | 2513862914 | 349 |
| 749 | iso_pu_bacteria | 2513237145 | 2513921249 | 349 |
| 750 | iso_pu_bacteria | 2517572143 | 2517889324 | 349 |
| 751 | iso_pu_bacteria | 2524023228 | 2524540372 | 349 |
| 752 | iso_pu_bacteria | 2667528175 | 2671121393 | 349 |
| 753 | iso_pu_bacteria | 2728368998 | 2728755381 | 349 |
| 754 | iso_pu_bacteria | 2904690495 | 2904692478 | 349 |
| 755 | iso_pu_bacteria | 2906610324 | 2906613199 | 349 |
| 756 | iso_pu_bacteria | 2906635258 | 2906635513 | 349 |
| 757 | iso_pu_bacteria | 2906660503 | 2906668644 | 349 |
| 758 | iso_pu_bacteria | 2908756301 | 2908764368 | 349 |
| 759 | iso_pu_bacteria | 2922425934 | 2922433697 | 349 |
| 760 | iso_pu_bacteria | 2935630451 | 2935634743 | 349 |
| 761 | iso_pu_bacteria | 2941507105 | 2941511927 | 349 |
| 762 | iso_pu_bacteria | 2941515067 | 2941519629 | 349 |
| 763 | iso_pu_bacteria | 2941523033 | 2941527679 | 349 |
| 764 | iso_pu_bacteria | 3005474847 | 3005483350 | 349 |
| 765 | iso_pu_bacteria | 8006933436 | 8006935733 | 349 |
| 766 | iso_pu_bacteria | 8006973647 | 8006975652 | 349 |
| 767 | iso_pu_bacteria | 8019555841 | 8019563061 | 349 |
| 768 | iso_pu_bacteria | 8019565922 | 8019573144 | 349 |
| 769 | 3300003215 | JGI25153J46596_10002562 | JGI25153J46596_100025622 | 350 |
| 770 | 3300003354 | JGI25160J50197_1027344 | JGI25160J50197_10273441 | 350 |
| 771 | 3300003752 | Ga0055539_1002104 | Ga0055539_10021043 | 350 |
| 772 | 3300003794 | Ga0055531_10005750 | Ga0055531_100057503 | 350 |
| 773 | 3300004625 | Ga0055543_1002854 | Ga0055543_10028541 | 350 |
| 774 | 3300005262 | Ga0065165_1001543 | Ga0065165_100154321 | 350 |
| 775 | 3300005262 | Ga0065165_1006649 | Ga0065165_10066494 | 350 |
| 776 | 3300005262 | Ga0065165_1007651 | Ga0065165_10076512 | 350 |
| 777 | 3300005262 | Ga0065165_1041813 | Ga0065165_10418131 | 350 |
| 778 | 3300005327 | Ga0070658_10125207 | Ga0070658_101252072 | 350 |
| 779 | 3300005347 | Ga0070668_100106944 | Ga0070668_1001069441 | 350 |
| 780 | 3300005353 | Ga0070669_100168450 | Ga0070669_1001684502 | 350 |
| 781 | 3300005457 | Ga0070662_100169078 | Ga0070662_1001690781 | 350 |
| 782 | 3300005616 | Ga0068852_100279286 | Ga0068852_1002792861 | 350 |
| 783 | 3300006038 | Ga0075365_10036594 | Ga0075365_100365942 | 350 |
| 784 | 3300006038 | Ga0075365_10080375 | Ga0075365_100803753 | 350 |
| 785 | 3300006038 | Ga0075365_10196846 | Ga0075365_101968462 | 350 |
| 786 | 3300006042 | Ga0075368_10054432 | Ga0075368_100544322 | 350 |
| 787 | 3300006175 | Ga0070712_100231797 | Ga0070712_1002317971 | 350 |
| 788 | 3300006177 | Ga0075362_10030289 | Ga0075362_100302892 | 350 |
| 789 | 3300006178 | Ga0075367_10054294 | Ga0075367_100542943 | 350 |
| 790 | 3300006195 | Ga0075366_10141581 | Ga0075366_101415811 | 350 |
| 791 | 3300006353 | Ga0075370_10134378 | Ga0075370_101343782 | 350 |
| 792 | 3300009176 | Ga0105242_10140477 | Ga0105242_101404772 | 350 |
| 793 | 3300009177 | Ga0105248_10290037 | Ga0105248_102900372 | 350 |
| 794 | 3300014325 | Ga0163163_10180779 | Ga0163163_101807792 | 350 |
| 795 | 3300025253 | Ga0209677_100338 | Ga0209677_10033812 | 350 |
| 796 | 3300025261 | Ga0209233_1001495 | Ga0209233_10014957 | 350 |
| 797 | 3300025261 | Ga0209233_1002702 | Ga0209233_10027024 | 350 |
| 798 | 3300025261 | Ga0209233_1003005 | Ga0209233_10030052 | 350 |
| 799 | 3300025295 | Ga0209564_1002401 | Ga0209564_100240113 | 350 |
| 800 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015319 | 350 |
| 801 | 3300025297 | Ga0209758_1001439 | Ga0209758_100143913 | 350 |
| 802 | 3300025299 | Ga0209256_1012677 | Ga0209256_10126773 | 350 |
| 803 | 3300025299 | Ga0209256_1033976 | Ga0209256_10339761 | 350 |
| 804 | 3300025302 | Ga0207426_1001551 | Ga0207426_10015512 | 350 |
| 805 | 3300025302 | Ga0207426_1014202 | Ga0207426_10142022 | 350 |
| 806 | 3300025302 | Ga0207426_1017734 | Ga0207426_10177341 | 350 |
| 807 | 3300025304 | Ga0209257_1000983 | Ga0209257_100098327 | 350 |
| 808 | 3300025304 | Ga0209257_1013500 | Ga0209257_10135002 | 350 |
| 809 | 3300025304 | Ga0209257_1027371 | Ga0209257_10273712 | 350 |
| 810 | 3300025904 | Ga0207647_10014320 | Ga0207647_100143202 | 350 |
| 811 | 3300025914 | Ga0207671_10153300 | Ga0207671_101533002 | 350 |
| 812 | 3300025915 | Ga0207693_10238579 | Ga0207693_102385792 | 350 |
| 813 | 3300025934 | Ga0207686_10193846 | Ga0207686_101938461 | 350 |
| 814 | 3300026067 | Ga0207678_10154313 | Ga0207678_101543132 | 350 |
| 815 | 3300026067 | Ga0207678_10245789 | Ga0207678_102457891 | 350 |
| 816 | 3300031249 | Ga0265339_10001158 | Ga0265339_100011587 | 350 |
| 817 | 3300033180 | Ga0307510_10005570 | Ga0307510_100055704 | 350 |
| 818 | 3300037853 | Ga0436364_0716895 | Ga0436364_0716895_100_1161 | 350 |
| 819 | 3300044658 | Ga0466972_0018721 | Ga0466972_0018721_2075_3142 | 350 |
| 820 | 3300044684 | Ga0466966_0013783 | Ga0466966_0013783_2489_3547 | 350 |
| 821 | 3300044693 | Ga0466961_0001950 | Ga0466961_0001950_1106_2176 | 350 |
| 822 | 3300045049 | Ga0466959_0027416 | Ga0466959_0027416_347_1417 | 350 |
| 823 | 3300046457 | Ga0495590_0043476 | Ga0495590_0043476_296_1360 | 350 |
| 824 | 3300046501 | Ga0495607_0031784 | Ga0495607_0031784_504_1568 | 350 |
| 825 | 3300046507 | Ga0495606_0109856 | Ga0495606_0109856_99_1163 | 350 |
| 826 | 3300046513 | Ga0495616_0085737 | Ga0495616_0085737_280_1344 | 350 |
| 827 | 3300046518 | Ga0495631_0041240 | Ga0495631_0041240_417_1481 | 350 |
| 828 | 3300046522 | Ga0495643_0071976 | Ga0495643_0071976_649_1716 | 350 |
| 829 | 3300046524 | Ga0495648_0005379 | Ga0495648_0005379_4487_5569 | 350 |
| 830 | 3300046524 | Ga0495648_0048824 | Ga0495648_0048824_1314_2378 | 350 |
| 831 | 3300046524 | Ga0495648_0161246 | Ga0495648_0161246_64_1131 | 350 |
| 832 | 3300046530 | Ga0495654_0020401 | Ga0495654_0020401_1787_2851 | 350 |
| 833 | 3300046538 | Ga0495609_0072592 | Ga0495609_0072592_259_1326 | 350 |
| 834 | 3300046542 | Ga0495597_0095283 | Ga0495597_0095283_147_1211 | 350 |
| 835 | 3300046616 | Ga0495668_0105270 | Ga0495668_0105270_320_1387 | 350 |
| 836 | 3300046660 | Ga0495625_0090138 | Ga0495625_0090138_342_1406 | 350 |
| 837 | 3300046665 | Ga0495661_0045231 | Ga0495661_0045231_1533_2597 | 350 |
| 838 | 3300046674 | Ga0495588_0091896 | Ga0495588_0091896_278_1342 | 350 |
| 839 | 3300046691 | Ga0495670_0003885 | Ga0495670_0003885_1491_2555 | 350 |
| 840 | 3300046810 | Ga0495660_0027364 | Ga0495660_0027364_1757_2821 | 350 |
| 841 | 3300047317 | Ga0495604_0074633 | Ga0495604_0074633_1176_2243 | 350 |
| 842 | 3300047472 | Ga0495686_0036398 | Ga0495686_0036398_673_1737 | 350 |
| 843 | 3300048911 | Ga0496108_0368993 | Ga0496108_0368993_99_1166 | 350 |
| 844 | 3300048916 | Ga0496113_0070936 | Ga0496113_0070936_101_1186 | 350 |
| 845 | 3300048921 | Ga0496118_0025329 | Ga0496118_0025329_2405_3466 | 350 |
| 846 | 3300048921 | Ga0496118_0103304 | Ga0496118_0103304_805_1869 | 350 |
| 847 | 3300048922 | Ga0496119_0040867 | Ga0496119_0040867_367_1431 | 350 |
| 848 | 3300048923 | Ga0496120_0103401 | Ga0496120_0103401_110_1174 | 350 |
| 849 | 3300048924 | Ga0496121_0003740 | Ga0496121_0003740_17353_18417 | 350 |
| 850 | 3300048928 | Ga0496125_0025285 | Ga0496125_0025285_2811_3875 | 350 |
| 851 | 3300048928 | Ga0496125_0028888 | Ga0496125_0028888_903_1967 | 350 |
| 852 | 3300048928 | Ga0496125_0175258 | Ga0496125_0175258_313_1380 | 350 |
| 853 | 3300048929 | Ga0496126_0099966 | Ga0496126_0099966_239_1303 | 350 |
| 854 | 3300049570 | Ga0501033_0052525 | Ga0501033_0052525_1669_2730 | 350 |
| 855 | 3300049571 | Ga0501034_0180912 | Ga0501034_0180912_597_1658 | 350 |
| 856 | 3300049574 | Ga0501038_0132055 | Ga0501038_0132055_27_1088 | 350 |
| 857 | 3300049582 | Ga0501048_0144277 | Ga0501048_0144277_477_1538 | 350 |
| 858 | 3300049822 | Ga0501035_0033865 | Ga0501035_0033865_1071_2132 | 350 |
| 859 | 3300050491 | nmdc:mga00v17_79738_c1 | nmdc:mga00v17_79738_c1_61_1128 | 350 |
| 860 | 3300050491 | nmdc:mga00v17_99774_c1 | nmdc:mga00v17_99774_c1_394_1461 | 350 |
| 861 | 3300050492 | nmdc:mga0yw44_11667_c1 | nmdc:mga0yw44_11667_c1_2336_3400 | 350 |
| 862 | 3300050492 | nmdc:mga0yw44_23615_c1 | nmdc:mga0yw44_23615_c1_2136_3200 | 350 |
| 863 | 3300050494 | nmdc:mga06z11_130458_c1 | nmdc:mga06z11_130458_c1_145_1209 | 350 |
| 864 | 3300050494 | nmdc:mga06z11_98691_c1 | nmdc:mga06z11_98691_c1_313_1380 | 350 |
| 865 | 3300050516 | nmdc:mga0sz30_64190_c1 | nmdc:mga0sz30_64190_c1_212_1279 | 350 |
| 866 | 3300053087 | Ga0500643_000079 | Ga0500643_000079_1240_2307 | 350 |
| 867 | 3300053087 | Ga0500643_010505 | Ga0500643_010505_1439_2503 | 350 |
| 868 | 3300053093 | Ga0500651_0016501 | Ga0500651_0016501_3347_4411 | 350 |
| 869 | 3300053094 | Ga0500566_0000509 | Ga0500566_0000509_7614_8681 | 350 |
| 870 | 3300053096 | Ga0500641_0018835 | Ga0500641_0018835_1003_2067 | 350 |
| 871 | 3300053103 | Ga0500555_015543 | Ga0500555_015543_560_1627 | 350 |
| 872 | 3300053104 | Ga0500556_0000005 | Ga0500556_0000005_541399_542463 | 350 |
| 873 | 3300053109 | Ga0500569_015625 | Ga0500569_015625_538_1605 | 350 |
| 874 | 3300053116 | Ga0500592_007166 | Ga0500592_007166_375_1439 | 350 |
| 875 | 3300053130 | Ga0500642_0000009 | Ga0500642_0000009_13531_14595 | 350 |
| 876 | 3300053131 | Ga0500652_002026 | Ga0500652_002026_3220_4284 | 350 |
| 877 | 3300053134 | Ga0500658_0086823 | Ga0500658_0086823_166_1230 | 350 |
| 878 | 3300053136 | Ga0500559_0000723 | Ga0500559_0000723_2591_3655 | 350 |
| 879 | 3300053142 | Ga0500577_0000569 | Ga0500577_0000569_3333_4397 | 350 |
| 880 | 3300053142 | Ga0500577_0024549 | Ga0500577_0024549_243_1307 | 350 |
| 881 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_93589_94653 | 350 |
| 882 | 3300053158 | Ga0500627_0063839 | Ga0500627_0063839_40_1107 | 350 |
| 883 | 3300053736 | Ga0500599_001543 | Ga0500599_001543_1106_2173 | 350 |
| 884 | iso_pu_bacteria | 2513237139 | 2513875673 | 350 |
| 885 | iso_pu_bacteria | 2802429603 | 2805919349 | 350 |
| 886 | iso_pu_bacteria | 8016522445 | 8016525646 | 350 |
| 887 | iso_pu_bacteria | 8016539877 | 8016543530 | 350 |
| 888 | iso_pu_bacteria | 8016548790 | 8016549763 | 350 |
| 889 | iso_pu_bacteria | 8016566248 | 8016568931 | 350 |
| 890 | iso_pu_bacteria | 8016575299 | 8016581579 | 350 |
| 891 | iso_pu_bacteria | 8016613128 | 8016618979 | 350 |
| 892 | iso_pu_bacteria | 8019530166 | 8019530516 | 350 |
| 893 | 3300005563 | Ga0068855_100389103 | Ga0068855_1003891032 | 351 |
| 894 | 3300031616 | Ga0307508_10041880 | Ga0307508_100418803 | 351 |
| 895 | 3300037466 | Ga0395898_0017075 | Ga0395898_0017075_4167_5234 | 351 |
| 896 | 3300005983 | Ga0081540_1010619 | Ga0081540_10106191 | 352 |
| 897 | 3300025915 | Ga0207693_10203955 | Ga0207693_102039551 | 352 |
| 898 | 3300048929 | Ga0496126_0134009 | Ga0496126_0134009_329_1393 | 352 |
| 899 | 3300053104 | Ga0500556_0000017 | Ga0500556_0000017_177255_178439 | 352 |
| 900 | 3300053730 | Ga0500645_015588 | Ga0500645_015588_970_2154 | 352 |
| 901 | 3300005983 | Ga0081540_1033754 | Ga0081540_10337542 | 353 |
| 902 | 3300006942 | Ga0099824_1001145 | Ga0099824_100114535 | 353 |
| 903 | 3300006943 | Ga0099822_1000135 | Ga0099822_100013535 | 353 |
| 904 | 3300026121 | Ga0207683_10086902 | Ga0207683_100869022 | 353 |
| 905 | 3300027361 | Ga0209489_100018 | Ga0209489_100018127 | 353 |
| 906 | 3300027363 | Ga0209700_100028 | Ga0209700_100028127 | 353 |
| 907 | 3300031344 | Ga0265316_10069595 | Ga0265316_100695952 | 353 |
| 908 | 3300031344 | Ga0265316_10121355 | Ga0265316_101213552 | 353 |
| 909 | 3300033442 | Ga0315911_1000033 | Ga0315911_100003342 | 353 |
| 910 | 3300035086 | Ga0373934_0001371 | Ga0373934_0001371_1122_2189 | 353 |
| 911 | 3300035111 | Ga0373923_0016525 | Ga0373923_0016525_474_1541 | 353 |
| 912 | 3300035117 | Ga0373953_0004018 | Ga0373953_0004018_3278_4345 | 353 |
| 913 | 3300035118 | Ga0373954_0039736 | Ga0373954_0039736_931_1998 | 353 |
| 914 | 3300035120 | Ga0373957_0005528 | Ga0373957_0005528_2221_3288 | 353 |
| 915 | 3300035172 | Ga0373955_0001137 | Ga0373955_0001137_9903_10970 | 353 |
| 916 | 3300035410 | Ga0373924_0009678 | Ga0373924_0009678_913_1980 | 353 |
| 917 | 3300035724 | Ga0373933_0002154 | Ga0373933_0002154_7601_8668 | 353 |
| 918 | 3300036401 | Ga0373937_0014047 | Ga0373937_0014047_302_1369 | 353 |
| 919 | 3300037471 | Ga0395905_0039470 | Ga0395905_0039470_1415_2482 | 353 |
| 920 | 3300046454 | Ga0495592_0020082 | Ga0495592_0020082_2398_3465 | 353 |
| 921 | 3300046459 | Ga0495629_0004779 | Ga0495629_0004779_4616_5683 | 353 |
| 922 | 3300046462 | Ga0495651_0010838 | Ga0495651_0010838_5853_6920 | 353 |
| 923 | 3300046462 | Ga0495651_0016408 | Ga0495651_0016408_332_1399 | 353 |
| 924 | 3300046463 | Ga0495653_0034560 | Ga0495653_0034560_552_1619 | 353 |
| 925 | 3300046511 | Ga0495608_0003227 | Ga0495608_0003227_4722_5789 | 353 |
| 926 | 3300046516 | Ga0495628_0033112 | Ga0495628_0033112_2940_4007 | 353 |
| 927 | 3300046533 | Ga0495640_0027733 | Ga0495640_0027733_1276_2343 | 353 |
| 928 | 3300046536 | Ga0495587_0013963 | Ga0495587_0013963_2739_3806 | 353 |
| 929 | 3300046543 | Ga0495645_0008551 | Ga0495645_0008551_5847_6914 | 353 |
| 930 | 3300046559 | Ga0495667_0056717 | Ga0495667_0056717_494_1561 | 353 |
| 931 | 3300046663 | Ga0495635_0000220 | Ga0495635_0000220_34097_35164 | 353 |
| 932 | 3300046678 | Ga0495599_0001306 | Ga0495599_0001306_12253_13320 | 353 |
| 933 | 3300046679 | Ga0495623_0040331 | Ga0495623_0040331_1366_2433 | 353 |
| 934 | 3300046679 | Ga0495623_0139293 | Ga0495623_0139293_235_1302 | 353 |
| 935 | 3300046680 | Ga0495646_0016383 | Ga0495646_0016383_1512_2579 | 353 |
| 936 | 3300046809 | Ga0495600_0021771 | Ga0495600_0021771_305_1372 | 353 |
| 937 | 3300047317 | Ga0495604_0028647 | Ga0495604_0028647_754_1821 | 353 |
| 938 | 3300047319 | Ga0495674_0006640 | Ga0495674_0006640_4388_5455 | 353 |
| 939 | 3300047322 | Ga0495680_0026130 | Ga0495680_0026130_90_1157 | 353 |
| 940 | 3300047444 | Ga0495675_0006969 | Ga0495675_0006969_3284_4351 | 353 |
| 941 | 3300047471 | Ga0495684_0000133 | Ga0495684_0000133_19801_20868 | 353 |
| 942 | 3300047673 | Ga0495593_0000108 | Ga0495593_0000108_10823_11890 | 353 |
| 943 | 3300048088 | Ga0495602_0023495 | Ga0495602_0023495_295_1362 | 353 |
| 944 | 3300048918 | Ga0496115_0113445 | Ga0496115_0113445_874_1941 | 353 |
| 945 | 3300053077 | Ga0495601_0011904 | Ga0495601_0011904_1608_2675 | 353 |
| 946 | 3300053084 | Ga0495595_0000419 | Ga0495595_0000419_4802_5869 | 353 |
| 947 | 3300053085 | Ga0495619_0001836 | Ga0495619_0001836_1227_2294 | 353 |
| 948 | 3300005329 | Ga0070683_100146710 | Ga0070683_1001467101 | 354 |
| 949 | 3300005530 | Ga0070679_100052438 | Ga0070679_1000524382 | 354 |
| 950 | 3300005535 | Ga0070684_100014375 | Ga0070684_1000143752 | 354 |
| 951 | 3300025913 | Ga0207695_10295764 | Ga0207695_102957641 | 354 |
| 952 | 3300025944 | Ga0207661_10001882 | Ga0207661_1000188211 | 354 |
| 953 | 3300036401 | Ga0373937_0055609 | Ga0373937_0055609_344_1429 | 354 |
| 954 | 3300046683 | Ga0495658_0000366 | Ga0495658_0000366_13804_14889 | 354 |
| 955 | 3300046809 | Ga0495600_0016918 | Ga0495600_0016918_2078_3163 | 354 |
| 956 | 3300001979 | JGI24740J21852_10008712 | JGI24740J21852_100087122 | 355 |
| 957 | 3300002067 | JGI24735J21928_10009585 | JGI24735J21928_100095851 | 355 |
| 958 | 3300005455 | Ga0070663_100083563 | Ga0070663_1000835632 | 355 |
| 959 | 3300005539 | Ga0068853_100015356 | Ga0068853_1000153561 | 355 |
| 960 | 3300005539 | Ga0068853_100051620 | Ga0068853_1000516202 | 355 |
| 961 | 3300005563 | Ga0068855_100024730 | Ga0068855_1000247304 | 355 |
| 962 | 3300005563 | Ga0068855_100078376 | Ga0068855_1000783762 | 355 |
| 963 | 3300005577 | Ga0068857_100008796 | Ga0068857_1000087966 | 355 |
| 964 | 3300005577 | Ga0068857_100015818 | Ga0068857_1000158182 | 355 |
| 965 | 3300005578 | Ga0068854_100005353 | Ga0068854_1000053533 | 355 |
| 966 | 3300005614 | Ga0068856_100008062 | Ga0068856_1000080625 | 355 |
| 967 | 3300005614 | Ga0068856_100014980 | Ga0068856_1000149805 | 355 |
| 968 | 3300005616 | Ga0068852_100021412 | Ga0068852_1000214122 | 355 |
| 969 | 3300005834 | Ga0068851_10002011 | Ga0068851_100020115 | 355 |
| 970 | 3300013297 | Ga0157378_10019120 | Ga0157378_100191202 | 355 |
| 971 | 3300013306 | Ga0163162_10023410 | Ga0163162_100234102 | 355 |
| 972 | 3300013308 | Ga0157375_10053209 | Ga0157375_100532092 | 355 |
| 973 | 3300014969 | Ga0157376_10070725 | Ga0157376_100707252 | 355 |
| 974 | 3300025321 | Ga0207656_10001869 | Ga0207656_100018692 | 355 |
| 975 | 3300025904 | Ga0207647_10039544 | Ga0207647_100395442 | 355 |
| 976 | 3300025911 | Ga0207654_10000611 | Ga0207654_100006116 | 355 |
| 977 | 3300025913 | Ga0207695_10002336 | Ga0207695_1000233614 | 355 |
| 978 | 3300025914 | Ga0207671_10020119 | Ga0207671_100201193 | 355 |
| 979 | 3300025924 | Ga0207694_10004635 | Ga0207694_100046357 | 355 |
| 980 | 3300025933 | Ga0207706_10231402 | Ga0207706_102314022 | 355 |
| 981 | 3300025935 | Ga0207709_10176522 | Ga0207709_101765221 | 355 |
| 982 | 3300025949 | Ga0207667_10030615 | Ga0207667_100306152 | 355 |
| 983 | 3300025949 | Ga0207667_10057824 | Ga0207667_100578242 | 355 |
| 984 | 3300025981 | Ga0207640_10007270 | Ga0207640_100072704 | 355 |
| 985 | 3300025981 | Ga0207640_10013948 | Ga0207640_100139482 | 355 |
| 986 | 3300026041 | Ga0207639_10023132 | Ga0207639_100231322 | 355 |
| 987 | 3300026067 | Ga0207678_10105683 | Ga0207678_101056832 | 355 |
| 988 | 3300026078 | Ga0207702_10000122 | Ga0207702_1000012237 | 355 |
| 989 | 3300026078 | Ga0207702_10037901 | Ga0207702_100379012 | 355 |
| 990 | 3300026116 | Ga0207674_10005252 | Ga0207674_100052525 | 355 |
| 991 | 3300026116 | Ga0207674_10012191 | Ga0207674_100121913 | 355 |
| 992 | 3300026121 | Ga0207683_10049862 | Ga0207683_100498621 | 355 |
| 993 | 3300026142 | Ga0207698_10119646 | Ga0207698_101196462 | 355 |
| 994 | 3300031616 | Ga0307508_10034912 | Ga0307508_100349122 | 355 |
| 995 | 3300048904 | Ga0496101_0004227 | Ga0496101_0004227_1904_2989 | 355 |
| 996 | 3300048905 | Ga0496102_0012581 | Ga0496102_0012581_970_2055 | 355 |
| 997 | 3300048906 | Ga0496103_0010963 | Ga0496103_0010963_2032_3117 | 355 |
| 998 | 3300048908 | Ga0496105_0018947 | Ga0496105_0018947_2127_3212 | 355 |
| 999 | 3300048911 | Ga0496108_0044295 | Ga0496108_0044295_582_1667 | 355 |
| 1000 | 3300048913 | Ga0496110_0120346 | Ga0496110_0120346_1085_2158 | 355 |
| 1001 | 3300048913 | Ga0496110_0147709 | Ga0496110_0147709_529_1614 | 355 |
| 1002 | 3300048917 | Ga0496114_0049691 | Ga0496114_0049691_1074_2147 | 355 |
| 1003 | 3300048917 | Ga0496114_0090029 | Ga0496114_0090029_828_1913 | 355 |
| 1004 | 3300048918 | Ga0496115_0001756 | Ga0496115_0001756_12835_13920 | 355 |
| 1005 | 3300053119 | Ga0500595_002736 | Ga0500595_002736_4531_5619 | 355 |
| 1006 | 3300053162 | Ga0500638_034065 | Ga0500638_034065_1302_2390 | 355 |
| 1007 | 3300055283 | Ga0500661_007935 | Ga0500661_007935_273_1361 | 355 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ob6-assembly2.cif.gz_B | human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned | 0.2578 | 27 | 288 |
| 6btm-assembly1.cif.gz_F | structure of alternative complex iii from flavobacterium johnsoniae (wild type) | 0.2564 | 22 | 274 |
| 8g92-assembly1.cif.gz_A | structure of inhibitor 16d-bound spns2 | 0.2508 | 21 | 331 |
| 7lo7-assembly1.cif.gz_Z | nora in complex with fab25 | 0.2501 | 23 | 335 |
| 6fmr-assembly1.cif.gz_A | imisx-ep of se-peptst | 0.2374 | 15 | 333 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54E68_44_188_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3832 | 196 | 302 | 1.20.1250.20 |
| af_E7F1E5_45_195_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3428 | 198 | 339 | 1.20.1070.10 |
| af_E7F1E5_45_195_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3213 | 198 | 339 | 1.20.1070.10 |
| af_A0A1D6PCH9_40_269_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.3062 | 128 | 337 | 1.50.40.10 |
| af_Q54E68_44_188_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3012 | 196 | 302 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A089NXR0-F1-model_v4 | Acyltransferase | 0.9773 | 22 | 350 |
GO:0005886
GO:0009246 GO:0016413 |
| AF-A0A2A4P7E2-F1-model_v4 | Acyltransferase | 0.9742 | 15 | 347 |
GO:0005886
GO:0009246 GO:0016413 |
| AF-A0A1H6H986-F1-model_v4 | Uncharacterized membrane protein YcfT | 0.9688 | 22 | 342 |
GO:0005886
GO:0009246 GO:0016413 |
| AF-A0A1I4S872-F1-model_v4 | Uncharacterized membrane protein YcfT | 0.9658 | 22 | 349 |
GO:0005886
GO:0009246 GO:0016413 |
| AF-A0A258L3X8-F1-model_v4 | Acyltransferase 3 domain-containing protein | 0.9637 | 22 | 355 |
GO:0005886
GO:0009246 GO:0016413 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar