F488059

General Info

Members Datasets Scaffolds Average Seq Length
1007 615 784 351

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016522445|8016525646
Length 414
Sequence RQPAKTGHLNCNGKQIESRKAPHCSAFTQIRAEHASKRDTMAPSGTIATSVGLAPSAARVDWVDYAKGICIVMVVMMHSVLGVELAAGQTGFMHVAVAFAKPFRMPDFFLISGLFLPLVIDRDWRTYLDRKVVHFAYFYVVWVTIQFGFKAPASAAETSWRDAGLLYLESFVEPFGTLWFIYLLPIFFVVTKLTRRIPPPAIWLIAAALETARVATGWTAIDEFCARFVYFYSGYLFAPYVFALADRARNHPAWALAALATWALVNAGLVVCGASEWKIVSLVLGFAGACAIITMGTLLARARWLNFFRFCGEHSIVIYLAFFLPMAATRTLLLRTGVIPDIGTVSLIVTIVGVIGALAIWQAALRLNANFLFERPDAFWIVPKKAGARLQPGSLSSPGSTGRPSIPETAVIDR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
35 2791355199
36 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
37 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
38 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
39 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
40 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
41 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
42 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
43 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
44 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
45 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
46 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
47 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
48 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
49 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
50 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
51 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
52 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
53 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
54 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
55 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
56 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
57 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
58 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
59 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
60 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
61 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
62 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
63 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
64 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
65 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
66 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
67 2842694124 Methylopila sp. R-72369 Isolate Unclassified
68 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
69 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
74 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
75 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
76 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
77 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
78 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
79 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
80 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
81 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
82 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
85 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
86 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
90 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
91 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
92 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
93 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
94 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
95 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
96 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
97 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
98 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
99 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
100 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
101 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
102 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
103 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
104 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
105 2906610324
106 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
107 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
108 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
109 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
110 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
111 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
112 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
113 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
114 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
115 2922368715
116 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
117 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
118 2922425934
119 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
120 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
121 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
122 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
123 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
124 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
125 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
126 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
127 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
128 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
129 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
130 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
131 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
132 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
133 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
134 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
135 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
136 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
137 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
138 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
139 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
140 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
141 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
142 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
143 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
144 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
145 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
146 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
147 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
148 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
149 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
150 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
151 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
152 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
153 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
154 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
155 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
156 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
157 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
158 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
159 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
160 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
161 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
162 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
163 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
164 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
165 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
166 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
167 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
168 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
169 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
170 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
171 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
172 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
173 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
174 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
175 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
176 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
177 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
178 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
179 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
180 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
181 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
182 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
183 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
184 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
185 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
186 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
187 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
188 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
189 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
190 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
191 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
192 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
193 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
194 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
195 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
196 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
197 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
198 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
199 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
200 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
201 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
202 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
203 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
204 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
205 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
206 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
207 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
208 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
209 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
210 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
211 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
212 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
213 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
214 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
215 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
216 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
217 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
218 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
219 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
220 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
221 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
222 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
223 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
224 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
225 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
226 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
227 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
228 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
229 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
230 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
231 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
232 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
233 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
234 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
235 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
236 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
237 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
238 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
239 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
240 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
241 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
242 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
243 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
244 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
245 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
246 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
247 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
248 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
249 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
250 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
251 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
252 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
253 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
254 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
255 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
256 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
257 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
258 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
259 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
260 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
261 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
262 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
263 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
264 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
265 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
266 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
267 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
268 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
269 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
270 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
271 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
272 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
273 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
274 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
275 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
276 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
277 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
278 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
279 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
280 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
281 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
282 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
283 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
284 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
285 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
286 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
287 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
290 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
292 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
293 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
295 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
336 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
337 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
338 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
339 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
342 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
343 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
344 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
345 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
346 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
347 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
348 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
349 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
350 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
351 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
352 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
353 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
354 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
355 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
356 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
357 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
358 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
359 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
360 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
361 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
362 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
363 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
364 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
365 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
366 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
367 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
368 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
369 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
370 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
371 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
372 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
373 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
374 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
375 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
376 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
377 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
378 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
379 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
380 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
381 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
382 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
383 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
384 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
385 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
386 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
387 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
388 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
389 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
390 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
391 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
392 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
393 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
394 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
395 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
396 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
397 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
398 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
399 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
400 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
401 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
402 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
403 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
404 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
405 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
406 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
407 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
408 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
409 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
410 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
411 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
412 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
413 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
414 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
415 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
416 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
417 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
418 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
419 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
420 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
421 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
422 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
423 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
424 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
425 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
426 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
427 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
428 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
429 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
430 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
431 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
432 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
433 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
434 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
435 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
436 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
437 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
438 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
439 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
440 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
441 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
442 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
443 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
444 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
445 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
446 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
447 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
448 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
449 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
450 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
451 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
452 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
453 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
454 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
455 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
456 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
457 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
458 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
459 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
460 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
461 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
462 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
463 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
464 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
465 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
466 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
467 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
468 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
469 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
470 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
471 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
472 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
473 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
474 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
475 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
476 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
477 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
478 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
479 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
480 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
481 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
482 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
483 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
484 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
485 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
486 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
487 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
488 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
489 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
490 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
491 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
492 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
493 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
494 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
495 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
498 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
499 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
503 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
510 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
511 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
512 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
513 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
514 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
515 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
516 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
517 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
518 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
519 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
520 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
521 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
522 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
523 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
524 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
525 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
526 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
527 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
528 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
529 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
530 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
531 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
532 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
533 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
534 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
535 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
536 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
537 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
538 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
539 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
540 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
541 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
542 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
543 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
544 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
545 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
546 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
547 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
548 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
549 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
550 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
551 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
552 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
553 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
554 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
555 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
556 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
557 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
558 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
559 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
560 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
561 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
562 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
563 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
564 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
565 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
566 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
567 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
568 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
569 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
570 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
571 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
572 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
573 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
574 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
575 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
576 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
577 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
578 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
579 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
580 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
581 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
582 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
583 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
584 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
585 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
586 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
587 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
588 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
589 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
590 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
591 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
592 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
593 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
594 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
595 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
596 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
597 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
598 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
599 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
600 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
601 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
602 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
603 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
604 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
605 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
606 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
607 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
608 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
609 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
610 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
611 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
612 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
613 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
614 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
615 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.17
Metatranscriptomes 0
Isolates 21.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.02
Nodule 16.68
Rhizoplane 3.08
Rhizosphere 57.1
Stem 0
Stem Tuber 0
Unclassified 12.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008712 3300001979 Bacteria 4027
2 JGI24735J21928_10009585 3300002067 Bacteria 3104
3 JGI25406J46586_10031159 3300003203 Bacteria 1998
4 JGI25153J46596_10002562 3300003215 Bacteria 10427
5 JGI25160J50197_1027344 3300003354 Bacteria 1555
6 JGI25404J52841_10019198 3300003659 Bacteria 1481
7 Ga0055539_1002104 3300003752 Bacteria 3238
8 Ga0055542_1003949 3300003762 Bacteria 3788
9 Ga0055531_10005750 3300003794 Bacteria 7183
10 Ga0055543_1002854 3300004625 Bacteria 5449
11 Ga0065165_1001543 3300005262 Bacteria 24050
12 Ga0065165_1006649 3300005262 Bacteria 5973
13 Ga0065165_1007651 3300005262 Bacteria 5248
14 Ga0065165_1041813 3300005262 Bacteria 1358
15 Ga0070658_10125207 3300005327 Bacteria 2138
16 Ga0070683_100001565 3300005329 Bacteria 17682
17 Ga0070683_100146710 3300005329 Bacteria 2236
18 Ga0070677_10006891 3300005333 Bacteria 3777
19 Ga0068869_100012775 3300005334 Bacteria 5555
20 Ga0070680_100013900 3300005336 Bacteria 6280
21 Ga0068868_100033616 3300005338 Bacteria 3953
22 Ga0068868_100216671 3300005338 Bacteria 1602
23 Ga0070661_100105407 3300005344 Bacteria 2101
24 Ga0070668_100106944 3300005347 Bacteria 2223
25 Ga0070669_100168450 3300005353 Bacteria 1706
26 Ga0070669_100184879 3300005353 Bacteria 1632
27 Ga0070709_10088483 3300005434 Bacteria 2037
28 Ga0070714_100031635 3300005435 Bacteria 4417
29 Ga0070714_100036306 3300005435 Bacteria 4132
30 Ga0070713_100000894 3300005436 Bacteria 19127
31 Ga0070710_10001586 3300005437 Bacteria 10738
32 Ga0070711_100019339 3300005439 Bacteria 4368
33 Ga0070711_100037502 3300005439 Bacteria 3253
34 Ga0070663_100037052 3300005455 Bacteria 3393
35 Ga0070663_100083563 3300005455 Bacteria 2351
36 Ga0070663_100085621 3300005455 Bacteria 2326
37 Ga0070662_100169078 3300005457 Bacteria 1716
38 Ga0070681_10017623 3300005458 Bacteria 7137
39 Ga0070681_10130932 3300005458 Bacteria 2441
40 Ga0070681_10288955 3300005458 Bacteria 1550
41 Ga0070699_100107339 3300005518 Bacteria 2449
42 Ga0070679_100052438 3300005530 Bacteria 4062
43 Ga0070679_100068439 3300005530 Bacteria 3541
44 Ga0070679_100070108 3300005530 Bacteria 3497
45 Ga0070679_100177156 3300005530 Bacteria 2105
46 Ga0070684_100014375 3300005535 Bacteria 6410
47 Ga0070684_100022655 3300005535 Bacteria 5243
48 Ga0068853_100015356 3300005539 Bacteria 6294
49 Ga0068853_100051620 3300005539 Bacteria 3540
50 Ga0068853_100082005 3300005539 Bacteria 2824
51 Ga0068853_100108527 3300005539 Bacteria 2463
52 Ga0068853_100197522 3300005539 Bacteria 1830
53 Ga0070686_100071473 3300005544 Bacteria 2272
54 Ga0070693_100244506 3300005547 Bacteria 1187
55 Ga0070665_100026270 3300005548 Bacteria 5864
56 Ga0068855_100024730 3300005563 Bacteria 7185
57 Ga0068855_100078376 3300005563 Bacteria 3833
58 Ga0068855_100192544 3300005563 Bacteria 2299
59 Ga0068855_100389103 3300005563 Bacteria 1530
60 Ga0070664_100084505 3300005564 Bacteria 2740
61 Ga0068857_100008796 3300005577 Bacteria 8744
62 Ga0068857_100015818 3300005577 Bacteria 6601
63 Ga0068857_100017740 3300005577 Bacteria 6240
64 Ga0068857_100284534 3300005577 Bacteria 1521
65 Ga0068854_100005353 3300005578 Bacteria 8103
66 Ga0068856_100008062 3300005614 Bacteria 10279
67 Ga0068856_100014980 3300005614 Bacteria 7489
68 Ga0068856_100068386 3300005614 Bacteria 3511
69 Ga0068856_100355798 3300005614 Bacteria 1483
70 Ga0068852_100021412 3300005616 Bacteria 5162
71 Ga0068852_100279286 3300005616 Bacteria 1609
72 Ga0068859_100261505 3300005617 Bacteria 1822
73 Ga0068864_100479675 3300005618 Bacteria 1193
74 Ga0068861_100139649 3300005719 Bacteria 1976
75 Ga0068851_10002011 3300005834 Bacteria 8961
76 Ga0068851_10144390 3300005834 Bacteria 1297
77 Ga0068858_100133880 3300005842 Bacteria 2325
78 Ga0068858_100196525 3300005842 Bacteria 1906
79 Ga0068858_100241544 3300005842 Bacteria 1714
80 Ga0068860_100002293 3300005843 Bacteria 20101
81 Ga0068862_100069003 3300005844 Bacteria 3050
82 Ga0081455_10000694 3300005937 Bacteria 43697
83 Ga0081455_10009590 3300005937 Bacteria 9943
84 Ga0081455_10013202 3300005937 Bacteria 8181
85 Ga0081455_10052828 3300005937 Bacteria 3476
86 Ga0081538_10024227 3300005981 Bacteria 4329
87 Ga0081540_1002390 3300005983 Bacteria 15316
88 Ga0081540_1008166 3300005983 Bacteria 7341
89 Ga0081540_1010619 3300005983 Bacteria 6217
90 Ga0081540_1015853 3300005983 Bacteria 4750
91 Ga0081540_1017401 3300005983 Bacteria 4452
92 Ga0081540_1017481 3300005983 Bacteria 4438
93 Ga0081540_1033754 3300005983 Bacteria 2772
94 Ga0081540_1046396 3300005983 Bacteria 2195
95 Ga0081539_10002152 3300005985 Bacteria 29064
96 Ga0081539_10015391 3300005985 Bacteria 5561
97 Ga0070717_10001686 3300006028 Bacteria 15364
98 Ga0070717_10051304 3300006028 Bacteria 3395
99 Ga0070717_10214156 3300006028 Bacteria 1692
100 Ga0075365_10006703 3300006038 Bacteria 6367
101 Ga0075365_10036594 3300006038 Bacteria 3180
102 Ga0075365_10080375 3300006038 Bacteria 2207
103 Ga0075365_10165007 3300006038 Bacteria 1545
104 Ga0075365_10196846 3300006038 Bacteria 1411
105 Ga0075368_10054432 3300006042 Bacteria 1594
106 Ga0075363_100006169 3300006048 Bacteria 5418
107 Ga0075364_10010755 3300006051 Bacteria 5536
108 Ga0070712_100034887 3300006175 Bacteria 3411
109 Ga0070712_100231797 3300006175 Bacteria 1467
110 Ga0075362_10030289 3300006177 Bacteria 2336
111 Ga0075362_10037389 3300006177 Bacteria 2128
112 Ga0075367_10054294 3300006178 Bacteria 2376
113 Ga0075366_10038337 3300006195 Bacteria 2830
114 Ga0075366_10058775 3300006195 Bacteria 2284
115 Ga0075366_10141581 3300006195 Bacteria 1454
116 Ga0075370_10014208 3300006353 Bacteria 4243
117 Ga0075370_10134378 3300006353 Bacteria 1444
118 Ga0068871_100020428 3300006358 Bacteria 5073
119 Ga0075430_100065067 3300006846 Bacteria 3063
120 Ga0075431_100245228 3300006847 Bacteria 1821
121 Ga0075434_100207360 3300006871 Bacteria 1981
122 Ga0075436_100007805 3300006914 Bacteria 7320
123 Ga0097620_100261533 3300006931 Bacteria 1822
124 Ga0099825_1028536 3300006941 Bacteria 2702
125 Ga0099824_1001145 3300006942 Bacteria 36195
126 Ga0099824_1011035 3300006942 Bacteria 10394
127 Ga0099822_1000135 3300006943 Bacteria 49135
128 Ga0099823_1034197 3300006944 Bacteria 4037
129 Ga0075435_100202135 3300007076 Bacteria 1684
130 Ga0105240_10015213 3300009093 Bacteria 10468
131 Ga0105240_10016353 3300009093 Bacteria 10046
132 Ga0111539_10204300 3300009094 Bacteria 2303
133 Ga0105245_10113486 3300009098 Bacteria 2523
134 Ga0105247_10020077 3300009101 Bacteria 4016
135 Ga0105247_10074790 3300009101 Bacteria 2125
136 Ga0114129_10081574 3300009147 Bacteria 4496
137 Ga0114129_10635750 3300009147 Bacteria 1379
138 Ga0105243_10262613 3300009148 Bacteria 1546
139 Ga0105241_10002904 3300009174 Bacteria 12800
140 Ga0105241_10168183 3300009174 Bacteria 1808
141 Ga0105242_10140477 3300009176 Bacteria 2095
142 Ga0105248_10019495 3300009177 Bacteria 7506
143 Ga0105248_10290037 3300009177 Bacteria 1842
144 Ga0105237_10229935 3300009545 Bacteria 1855
145 Ga0105237_10303872 3300009545 Bacteria 1598
146 Ga0105238_10015659 3300009551 Bacteria 7677
147 Ga0105238_10145976 3300009551 Bacteria 2342
148 Ga0105238_10243468 3300009551 Bacteria 1776
149 Ga0105238_10266982 3300009551 Bacteria 1692
150 Ga0099796_10006477 3300010159 Bacteria 2999
151 Ga0105239_10093089 3300010375 Bacteria 3327
152 Ga0105246_10219576 3300011119 Bacteria 1489
153 Ga0157370_10080759 3300013104 Bacteria 3061
154 Ga0157370_10223467 3300013104 Bacteria 1744
155 Ga0157370_10336985 3300013104 Bacteria 1390
156 Ga0157369_10006988 3300013105 Bacteria 13021
157 Ga0157369_10028226 3300013105 Bacteria 6212
158 Ga0157374_10137921 3300013296 Bacteria 2366
159 Ga0157378_10019120 3300013297 Bacteria 6019
160 Ga0163162_10023410 3300013306 Bacteria 6095
161 Ga0163162_10183875 3300013306 Bacteria 2217
162 Ga0157372_10184205 3300013307 Bacteria 2418
163 Ga0157372_10213221 3300013307 Bacteria 2238
164 Ga0157375_10053209 3300013308 Bacteria 3982
165 Ga0163163_10038761 3300014325 Bacteria 4645
166 Ga0163163_10180779 3300014325 Bacteria 2156
167 Ga0163163_10266422 3300014325 Bacteria 1764
168 Ga0157376_10070725 3300014969 Bacteria 2963
169 Ga0213876_10004532 3300021384 Bacteria 7760
170 Ga0213876_10005943 3300021384 Bacteria 6669
171 Ga0209677_100338 3300025253 Bacteria 29865
172 Ga0209148_1000526 3300025254 Bacteria 37777
173 Ga0209233_1001495 3300025261 Bacteria 9194
174 Ga0209233_1002702 3300025261 Bacteria 6407
175 Ga0209233_1003005 3300025261 Bacteria 6005
176 Ga0209455_1000950 3300025272 Bacteria 14783
177 Ga0209564_1000842 3300025295 Bacteria 41342
178 Ga0209564_1002401 3300025295 Bacteria 14944
179 Ga0209758_1000015 3300025297 Bacteria 851943
180 Ga0209758_1001439 3300025297 Bacteria 28039
181 Ga0209758_1016688 3300025297 Bacteria 3711
182 Ga0209758_1025551 3300025297 Bacteria 2587
183 Ga0209256_1012677 3300025299 Bacteria 3196
184 Ga0209256_1033976 3300025299 Bacteria 1364
185 Ga0207426_1001551 3300025302 Bacteria 18658
186 Ga0207426_1014202 3300025302 Bacteria 2923
187 Ga0207426_1017734 3300025302 Bacteria 2524
188 Ga0209257_1000983 3300025304 Bacteria 38689
189 Ga0209257_1013500 3300025304 Bacteria 3624
190 Ga0209257_1027371 3300025304 Bacteria 1899
191 Ga0207656_10001869 3300025321 Bacteria 7005
192 Ga0207682_10003162 3300025893 Bacteria 7212
193 Ga0207692_10020713 3300025898 Bacteria 2996
194 Ga0207642_10016138 3300025899 Bacteria 2805
195 Ga0207647_10014320 3300025904 Bacteria 5469
196 Ga0207647_10039544 3300025904 Bacteria 2974
197 Ga0207699_10003862 3300025906 Bacteria 7158
198 Ga0207654_10000611 3300025911 Bacteria 20145
199 Ga0207707_10258963 3300025912 Bacteria 1510
200 Ga0207695_10002336 3300025913 Bacteria 28213
201 Ga0207695_10153976 3300025913 Bacteria 2235
202 Ga0207695_10295764 3300025913 Bacteria 1511
203 Ga0207671_10020119 3300025914 Bacteria 5089
204 Ga0207671_10079450 3300025914 Bacteria 2458
205 Ga0207671_10153300 3300025914 Bacteria 1781
206 Ga0207671_10200364 3300025914 Bacteria 1559
207 Ga0207671_10225206 3300025914 Bacteria 1470
208 Ga0207693_10033060 3300025915 Bacteria 4082
209 Ga0207693_10203955 3300025915 Bacteria 1555
210 Ga0207693_10238579 3300025915 Bacteria 1427
211 Ga0207657_10018608 3300025919 Bacteria 6621
212 Ga0207652_10084927 3300025921 Bacteria 2774
213 Ga0207694_10004635 3300025924 Bacteria 10703
214 Ga0207694_10024912 3300025924 Bacteria 4545
215 Ga0207694_10227017 3300025924 Bacteria 1524
216 Ga0207694_10300553 3300025924 Bacteria 1321
217 Ga0207650_10325946 3300025925 Bacteria 1259
218 Ga0207687_10017762 3300025927 Bacteria 4690
219 Ga0207700_10017910 3300025928 Bacteria 4743
220 Ga0207700_10135033 3300025928 Bacteria 2019
221 Ga0207664_10029903 3300025929 Bacteria 4155
222 Ga0207690_10040950 3300025932 Bacteria 3032
223 Ga0207706_10231402 3300025933 Bacteria 1617
224 Ga0207686_10193846 3300025934 Bacteria 1450
225 Ga0207709_10176522 3300025935 Bacteria 1504
226 Ga0207665_10013172 3300025939 Bacteria 5438
227 Ga0207665_10117482 3300025939 Bacteria 1876
228 Ga0207711_10010567 3300025941 Bacteria 7673
229 Ga0207711_10148668 3300025941 Bacteria 2113
230 Ga0207689_10061889 3300025942 Bacteria 3078
231 Ga0207689_10078436 3300025942 Bacteria 2714
232 Ga0207689_10117316 3300025942 Bacteria 2189
233 Ga0207661_10001882 3300025944 Bacteria 14372
234 Ga0207679_10061253 3300025945 Bacteria 2800
235 Ga0207679_10186638 3300025945 Bacteria 1720
236 Ga0207667_10030615 3300025949 Bacteria 5819
237 Ga0207667_10057824 3300025949 Bacteria 4069
238 Ga0207667_10522601 3300025949 Bacteria 1202
239 Ga0207640_10007270 3300025981 Bacteria 6109
240 Ga0207640_10013948 3300025981 Bacteria 4615
241 Ga0207703_10011565 3300026035 Bacteria 6863
242 Ga0207703_10200289 3300026035 Bacteria 1774
243 Ga0207639_10023132 3300026041 Bacteria 4484
244 Ga0207639_10454683 3300026041 Bacteria 1163
245 Ga0207678_10105683 3300026067 Bacteria 2402
246 Ga0207678_10154313 3300026067 Bacteria 1961
247 Ga0207678_10178676 3300026067 Bacteria 1812
248 Ga0207678_10245789 3300026067 Bacteria 1532
249 Ga0207708_10098589 3300026075 Bacteria 2259
250 Ga0207702_10000122 3300026078 Bacteria 91685
251 Ga0207702_10037901 3300026078 Bacteria 4037
252 Ga0207702_10184811 3300026078 Bacteria 1922
253 Ga0207702_10356479 3300026078 Bacteria 1401
254 Ga0207641_10111703 3300026088 Bacteria 2424
255 Ga0207674_10005252 3300026116 Bacteria 15415
256 Ga0207674_10012191 3300026116 Bacteria 9617
257 Ga0207674_10252195 3300026116 Bacteria 1712
258 Ga0207675_100316363 3300026118 Bacteria 1523
259 Ga0207683_10040371 3300026121 Bacteria 4072
260 Ga0207683_10049862 3300026121 Bacteria 3665
261 Ga0207683_10077702 3300026121 Bacteria 2940
262 Ga0207683_10086902 3300026121 Bacteria 2780
263 Ga0207698_10119646 3300026142 Bacteria 2226
264 Ga0209389_1000076 3300027296 Bacteria 92447
265 Ga0209389_1000328 3300027296 Bacteria 29034
266 Ga0209589_1003134 3300027357 Bacteria 29000
267 Ga0209489_100018 3300027361 Bacteria 215546
268 Ga0209489_103754 3300027361 Bacteria 29057
269 Ga0209489_108247 3300027361 Bacteria 14478
270 Ga0209700_100014 3300027363 Bacteria 299349
271 Ga0209700_100028 3300027363 Bacteria 215546
272 Ga0268266_10001497 3300028379 Bacteria 27614
273 Ga0268266_10299813 3300028379 Bacteria 1499
274 Ga0268264_10000187 3300028381 Bacteria 129270
275 Ga0268264_10091945 3300028381 Bacteria 2618
276 Ga0265337_1018969 3300028556 Bacteria 2176
277 Ga0265319_1009816 3300028563 Bacteria 4041
278 Ga0265318_10015874 3300028577 Bacteria 3120
279 Ga0265323_10001213 3300028653 Bacteria 13068
280 Ga0265336_10001031 3300028666 Bacteria 13671
281 Ga0307517_10000066 3300028786 Bacteria 141370
282 Ga0265338_10000973 3300028800 Bacteria 48208
283 Ga0265324_10001933 3300029957 Bacteria 11112
284 Ga0265332_10019280 3300031238 Bacteria 3010
285 Ga0265325_10015080 3300031241 Bacteria 4355
286 Ga0265340_10000659 3300031247 Bacteria 19392
287 Ga0265340_10010166 3300031247 Bacteria 5039
288 Ga0265340_10011689 3300031247 Bacteria 4658
289 Ga0265340_10067015 3300031247 Bacteria 1707
290 Ga0265339_10001158 3300031249 Bacteria 19908
291 Ga0265339_10004448 3300031249 Bacteria 9563
292 Ga0265339_10011598 3300031249 Bacteria 5416
293 Ga0265331_10036923 3300031250 Bacteria 2395
294 Ga0265331_10096895 3300031250 Bacteria 1360
295 Ga0265331_10105280 3300031250 Bacteria 1296
296 Ga0265316_10009504 3300031344 Bacteria 8952
297 Ga0265316_10055949 3300031344 Bacteria 3084
298 Ga0265316_10069595 3300031344 Bacteria 2716
299 Ga0265316_10121355 3300031344 Bacteria 1974
300 Ga0265316_10167132 3300031344 Bacteria 1642
301 Ga0307513_10279691 3300031456 Bacteria 1447
302 Ga0307509_10197471 3300031507 Bacteria 1853
303 Ga0307509_10257676 3300031507 Bacteria 1522
304 Ga0265313_10002138 3300031595 Bacteria 17573
305 Ga0265313_10009770 3300031595 Bacteria 6182
306 Ga0265313_10031726 3300031595 Bacteria 2705
307 Ga0265313_10032142 3300031595 Bacteria 2684
308 Ga0307508_10000613 3300031616 Bacteria 42773
309 Ga0307508_10034912 3300031616 Bacteria 4532
310 Ga0307508_10041880 3300031616 Bacteria 4110
311 Ga0307508_10053567 3300031616 Bacteria 3580
312 Ga0307508_10106984 3300031616 Bacteria 2395
313 Ga0265314_10129397 3300031711 Bacteria 1577
314 Ga0265342_10001734 3300031712 Bacteria 19908
315 Ga0265342_10002077 3300031712 Bacteria 17755
316 Ga0265342_10028709 3300031712 Bacteria 3461
317 Ga0307516_10011022 3300031730 Bacteria 9878
318 Ga0307516_10170369 3300031730 Bacteria 1918
319 Ga0307516_10219537 3300031730 Bacteria 1611
320 Ga0307413_10210324 3300031824 Bacteria 1412
321 Ga0307409_100260450 3300031995 Bacteria 1591
322 Ga0307415_100038694 3300032126 Bacteria 3146
323 Ga0307507_10006502 3300033179 Bacteria 17885
324 Ga0307510_10005570 3300033180 Bacteria 15003
325 Ga0307510_10093046 3300033180 Bacteria 2848
326 Ga0315911_1000033 3300033442 Bacteria 67159
327 Ga0373934_0001371 3300035086 Bacteria 8873
328 Ga0373923_0000577 3300035111 Bacteria 9052
329 Ga0373923_0016525 3300035111 Bacteria 2806
330 Ga0373936_0010575 3300035113 Bacteria 3483
331 Ga0373953_0004018 3300035117 Bacteria 4645
332 Ga0373954_0010639 3300035118 Bacteria 4063
333 Ga0373954_0020018 3300035118 Bacteria 3022
334 Ga0373954_0039736 3300035118 Bacteria 2190
335 Ga0373957_0005528 3300035120 Bacteria 3920
336 Ga0373957_0013008 3300035120 Bacteria 2815
337 Ga0373943_0000679 3300035170 Bacteria 14825
338 Ga0373943_0021168 3300035170 Bacteria 3002
339 Ga0373943_0073247 3300035170 Bacteria 1739
340 Ga0373946_0000693 3300035171 Bacteria 11371
341 Ga0373946_0009020 3300035171 Bacteria 3669
342 Ga0373946_0023553 3300035171 Bacteria 2407
343 Ga0373955_0000054 3300035172 Bacteria 44460
344 Ga0373955_0001137 3300035172 Bacteria 11295
345 Ga0373955_0041035 3300035172 Bacteria 2478
346 Ga0373924_0000398 3300035410 Bacteria 13331
347 Ga0373924_0009678 3300035410 Bacteria 3541
348 Ga0373935_0000223 3300035692 Bacteria 27646
349 Ga0373935_0025193 3300035692 Bacteria 3666
350 Ga0373935_0172785 3300035692 Bacteria 1479
351 Ga0373927_0004222 3300035695 Bacteria 10088
352 Ga0373927_0007175 3300035695 Bacteria 7562
353 Ga0373927_0010394 3300035695 Bacteria 6210
354 Ga0373927_0199630 3300035695 Bacteria 1313
355 Ga0373933_0001275 3300035724 Bacteria 14840
356 Ga0373933_0002154 3300035724 Bacteria 11278
357 Ga0373947_0000552 3300035725 Bacteria 21816
358 Ga0373947_0006263 3300035725 Bacteria 6916
359 Ga0373947_0018272 3300035725 Bacteria 4035
360 Ga0373937_0000006 3300036401 Bacteria 194781
361 Ga0373937_0014047 3300036401 Bacteria 7061
362 Ga0373937_0055609 3300036401 Bacteria 3633
363 Ga0373937_0149252 3300036401 Bacteria 2189
364 Ga0316582_0088660 3300036647 Bacteria 2033
365 Ga0373925_0000002 3300037068 Bacteria 368879
366 Ga0373925_0003884 3300037068 Bacteria 11423
367 Ga0373925_0019170 3300037068 Bacteria 4975
368 Ga0373925_0020613 3300037068 Bacteria 4802
369 Ga0395900_0005628 3300037418 Bacteria 13105
370 Ga0395898_0010285 3300037466 Bacteria 9792
371 Ga0395898_0013582 3300037466 Bacteria 8381
372 Ga0395898_0017075 3300037466 Bacteria 7412
373 Ga0395898_0164092 3300037466 Bacteria 2125
374 Ga0395905_0039470 3300037471 Bacteria 4429
375 Ga0436364_0716895 3300037853 Bacteria 3339
376 Ga0436364_1428694 3300037853 Bacteria 1534
377 Ga0395901_0059614 3300038443 Bacteria 3971
378 Ga0436365_0253472 3300039437 Bacteria 28103
379 Ga0436365_0856193 3300039437 Bacteria 5361
380 Ga0436365_1272636 3300039437 Bacteria 5735
381 Ga0436360_0752976 3300039438 Bacteria 2553
382 Ga0436363_0815901 3300039450 Bacteria 5650
383 Ga0436362_0199820 3300039453 Bacteria 2676
384 Ga0439434_0013050 3300042435 Bacteria 2464
385 Ga0466972_0018721 3300044658 Bacteria 3462
386 Ga0466966_0013783 3300044684 Bacteria 5349
387 Ga0466966_0073894 3300044684 Bacteria 2132
388 Ga0466961_0001950 3300044693 Bacteria 12859
389 Ga0466963_0253525 3300044694 Bacteria 1235
390 Ga0466957_0051062 3300044842 Bacteria 2517
391 Ga0466959_0027416 3300045049 Bacteria 4226
392 Ga0466959_0073552 3300045049 Bacteria 2472
393 Ga0466967_0081292 3300045976 Bacteria 2926
394 Ga0495617_005797 3300046452 Bacteria 4360
395 Ga0495592_0000086 3300046454 Bacteria 82248
396 Ga0495592_0003994 3300046454 Bacteria 10701
397 Ga0495592_0020082 3300046454 Bacteria 5079
398 Ga0495603_0098736 3300046455 Bacteria 1705
399 Ga0495590_0043476 3300046457 Bacteria 1567
400 Ga0495629_0003367 3300046459 Bacteria 12076
401 Ga0495629_0004779 3300046459 Bacteria 10153
402 Ga0495651_0000562 3300046462 Bacteria 28694
403 Ga0495651_0010838 3300046462 Bacteria 7009
404 Ga0495651_0016408 3300046462 Bacteria 5736
405 Ga0495653_0000006 3300046463 Bacteria 363285
406 Ga0495653_0034560 3300046463 Bacteria 3997
407 Ga0495580_0003379 3300046472 Bacteria 13637
408 Ga0495582_0000063 3300046473 Bacteria 54381
409 Ga0495582_0011820 3300046473 Bacteria 4808
410 Ga0495605_0060869 3300046474 Bacteria 1808
411 Ga0495605_0075976 3300046474 Bacteria 1579
412 Ga0495639_0019155 3300046475 Bacteria 2986
413 Ga0495639_0061591 3300046475 Bacteria 1721
414 Ga0495662_0003113 3300046476 Bacteria 8366
415 Ga0495662_0003942 3300046476 Bacteria 7484
416 Ga0495662_0016897 3300046476 Bacteria 3531
417 Ga0495662_0103256 3300046476 Bacteria 1395
418 Ga0495664_0000002 3300046477 Bacteria 625183
419 Ga0495664_0068451 3300046477 Bacteria 2118
420 Ga0495664_0106785 3300046477 Bacteria 1688
421 Ga0495594_0000983 3300046499 Bacteria 14813
422 Ga0495607_0031784 3300046501 Bacteria 3229
423 Ga0495606_0109856 3300046507 Bacteria 1665
424 Ga0495608_0000009 3300046511 Bacteria 266614
425 Ga0495608_0003227 3300046511 Bacteria 11663
426 Ga0495616_0082070 3300046513 Bacteria 1540
427 Ga0495616_0085737 3300046513 Bacteria 1499
428 Ga0495618_0000005 3300046514 Bacteria 230421
429 Ga0495618_0015285 3300046514 Bacteria 4684
430 Ga0495620_0029575 3300046515 Bacteria 2533
431 Ga0495628_0000002 3300046516 Bacteria 589399
432 Ga0495628_0010286 3300046516 Bacteria 7951
433 Ga0495628_0033112 3300046516 Bacteria 4167
434 Ga0495630_0000240 3300046517 Bacteria 43911
435 Ga0495631_0041240 3300046518 Bacteria 2043
436 Ga0495632_0083939 3300046519 Bacteria 1516
437 Ga0495643_0071976 3300046522 Bacteria 1813
438 Ga0495648_0000581 3300046524 Bacteria 39115
439 Ga0495648_0005379 3300046524 Bacteria 10647
440 Ga0495648_0048824 3300046524 Bacteria 2601
441 Ga0495648_0161246 3300046524 Bacteria 1159
442 Ga0495666_0027895 3300046526 Bacteria 2779
443 Ga0495652_0000004 3300046529 Bacteria 588877
444 Ga0495654_0020401 3300046530 Bacteria 3454
445 Ga0495665_0000163 3300046531 Bacteria 33358
446 Ga0495640_0000005 3300046533 Bacteria 318271
447 Ga0495640_0013346 3300046533 Bacteria 6243
448 Ga0495640_0027733 3300046533 Bacteria 4082
449 Ga0495587_0000007 3300046536 Bacteria 290788
450 Ga0495587_0013963 3300046536 Bacteria 5043
451 Ga0495587_0048865 3300046536 Bacteria 2505
452 Ga0495587_0133702 3300046536 Bacteria 1417
453 Ga0495609_0072592 3300046538 Bacteria 1511
454 Ga0495597_0095283 3300046542 Bacteria 1259
455 Ga0495645_0000003 3300046543 Bacteria 570133
456 Ga0495645_0008551 3300046543 Bacteria 7149
457 Ga0495645_0161988 3300046543 Bacteria 1546
458 Ga0495622_0003604 3300046557 Bacteria 7272
459 Ga0495667_0000002 3300046559 Bacteria 437535
460 Ga0495667_0012398 3300046559 Bacteria 5778
461 Ga0495667_0056717 3300046559 Bacteria 2575
462 Ga0495668_0105270 3300046616 Bacteria 1543
463 Ga0495634_0000370 3300046642 Bacteria 43881
464 Ga0495611_0026482 3300046648 Bacteria 2530
465 Ga0495625_0090138 3300046660 Bacteria 2122
466 Ga0495635_0000020 3300046663 Bacteria 189698
467 Ga0495635_0000220 3300046663 Bacteria 36107
468 Ga0495659_0032352 3300046664 Bacteria 1830
469 Ga0495661_0045231 3300046665 Bacteria 2693
470 Ga0495588_0007149 3300046674 Bacteria 5063
471 Ga0495588_0091896 3300046674 Bacteria 1590
472 Ga0495588_0124810 3300046674 Bacteria 1357
473 Ga0495657_0000240 3300046675 Bacteria 49927
474 Ga0495599_0000001 3300046678 Bacteria 537563
475 Ga0495599_0001306 3300046678 Bacteria 14176
476 Ga0495599_0108425 3300046678 Bacteria 1730
477 Ga0495623_0000001 3300046679 Bacteria 313861
478 Ga0495623_0040331 3300046679 Bacteria 2981
479 Ga0495623_0054944 3300046679 Bacteria 2511
480 Ga0495623_0139293 3300046679 Bacteria 1445
481 Ga0495646_0000013 3300046680 Bacteria 159700
482 Ga0495646_0007434 3300046680 Bacteria 6965
483 Ga0495646_0016383 3300046680 Bacteria 4703
484 Ga0495646_0078644 3300046680 Bacteria 1927
485 Ga0495647_0000198 3300046681 Bacteria 16065
486 Ga0495658_0000366 3300046683 Bacteria 25377
487 Ga0495613_0000449 3300046689 Bacteria 35095
488 Ga0495613_0023466 3300046689 Bacteria 4596
489 Ga0495624_0001125 3300046690 Bacteria 21160
490 Ga0495624_0026919 3300046690 Bacteria 3767
491 Ga0495624_0117597 3300046690 Bacteria 1633
492 Ga0495670_0003885 3300046691 Bacteria 7338
493 Ga0495670_0034095 3300046691 Bacteria 2534
494 Ga0495600_0000041 3300046809 Bacteria 75747
495 Ga0495600_0016918 3300046809 Bacteria 4635
496 Ga0495600_0021771 3300046809 Bacteria 4110
497 Ga0495600_0040334 3300046809 Bacteria 3040
498 Ga0495600_0169077 3300046809 Bacteria 1411
499 Ga0495660_0027364 3300046810 Bacteria 3227
500 Ga0495581_0000291 3300047315 Bacteria 24325
501 Ga0495581_0009344 3300047315 Bacteria 5675
502 Ga0495604_0000005 3300047317 Bacteria 424516
503 Ga0495604_0013280 3300047317 Bacteria 6558
504 Ga0495604_0028647 3300047317 Bacteria 4431
505 Ga0495604_0072107 3300047317 Bacteria 2611
506 Ga0495604_0074633 3300047317 Bacteria 2555
507 Ga0495674_0000003 3300047319 Bacteria 562126
508 Ga0495674_0003711 3300047319 Bacteria 14850
509 Ga0495674_0006640 3300047319 Bacteria 11084
510 Ga0495674_0103843 3300047319 Bacteria 2416
511 Ga0495672_0088022 3300047320 Bacteria 1713
512 Ga0495676_0041740 3300047321 Bacteria 3773
513 Ga0495680_0000002 3300047322 Bacteria 197533
514 Ga0495680_0004170 3300047322 Bacteria 13895
515 Ga0495680_0026130 3300047322 Bacteria 4819
516 Ga0495680_0115113 3300047322 Bacteria 1990
517 Ga0495675_0000010 3300047444 Bacteria 153375
518 Ga0495675_0006969 3300047444 Bacteria 6947
519 Ga0495675_0016527 3300047444 Bacteria 4668
520 Ga0495684_0000020 3300047471 Bacteria 148507
521 Ga0495684_0000133 3300047471 Bacteria 54433
522 Ga0495684_0241806 3300047471 Bacteria 1316
523 Ga0495686_0036398 3300047472 Bacteria 3159
524 Ga0495593_0000108 3300047673 Bacteria 38360
525 Ga0495593_0000323 3300047673 Bacteria 26455
526 Ga0495593_0003730 3300047673 Bacteria 9087
527 Ga0495602_0000027 3300048088 Bacteria 145010
528 Ga0495602_0023495 3300048088 Bacteria 6003
529 Ga0495615_0018412 3300048090 Bacteria 1537
530 Ga0496100_0040920 3300048903 Bacteria 2952
531 Ga0496101_0004227 3300048904 Bacteria 9005
532 Ga0496102_0012581 3300048905 Bacteria 7329
533 Ga0496102_0179781 3300048905 Bacteria 1993
534 Ga0496103_0010963 3300048906 Bacteria 5365
535 Ga0496103_0110634 3300048906 Bacteria 1745
536 Ga0496105_0018947 3300048908 Bacteria 5544
537 Ga0496105_0042265 3300048908 Bacteria 3757
538 Ga0496106_0002313 3300048909 Bacteria 14208
539 Ga0496106_0009042 3300048909 Bacteria 7363
540 Ga0496106_0047142 3300048909 Bacteria 3242
541 Ga0496106_0058681 3300048909 Bacteria 2914
542 Ga0496107_0004737 3300048910 Bacteria 9242
543 Ga0496107_0155255 3300048910 Bacteria 1694
544 Ga0496108_0000442 3300048911 Bacteria 33309
545 Ga0496108_0044295 3300048911 Bacteria 3715
546 Ga0496108_0368993 3300048911 Bacteria 1253
547 Ga0496109_0004462 3300048912 Bacteria 11691
548 Ga0496109_0069224 3300048912 Bacteria 3236
549 Ga0496110_0042506 3300048913 Bacteria 3967
550 Ga0496110_0120346 3300048913 Bacteria 2365
551 Ga0496110_0147709 3300048913 Bacteria 2127
552 Ga0496112_0197363 3300048915 Bacteria 1973
553 Ga0496113_0033938 3300048916 Bacteria 3720
554 Ga0496113_0070936 3300048916 Bacteria 2649
555 Ga0496114_0049691 3300048917 Bacteria 3490
556 Ga0496114_0090029 3300048917 Bacteria 2605
557 Ga0496115_0001756 3300048918 Bacteria 15546
558 Ga0496115_0113445 3300048918 Bacteria 2227
559 Ga0496117_0021787 3300048920 Bacteria 5170
560 Ga0496118_0002489 3300048921 Bacteria 24727
561 Ga0496118_0025329 3300048921 Bacteria 5091
562 Ga0496118_0103304 3300048921 Bacteria 1917
563 Ga0496119_0000308 3300048922 Bacteria 68303
564 Ga0496119_0025270 3300048922 Bacteria 4152
565 Ga0496119_0040867 3300048922 Bacteria 2960
566 Ga0496120_0103401 3300048923 Bacteria 1501
567 Ga0496121_0000144 3300048924 Bacteria 156856
568 Ga0496121_0003740 3300048924 Bacteria 21314
569 Ga0496121_0004310 3300048924 Bacteria 19264
570 Ga0496121_0057626 3300048924 Bacteria 3218
571 Ga0496121_0064926 3300048924 Bacteria 2973
572 Ga0496121_0127234 3300048924 Bacteria 1913
573 Ga0496122_0001649 3300048925 Bacteria 34644
574 Ga0496122_0022588 3300048925 Bacteria 5585
575 Ga0496123_0000602 3300048926 Bacteria 61127
576 Ga0496124_0003743 3300048927 Bacteria 18323
577 Ga0496125_0000595 3300048928 Bacteria 61641
578 Ga0496125_0018116 3300048928 Bacteria 6693
579 Ga0496125_0020298 3300048928 Bacteria 6237
580 Ga0496125_0020399 3300048928 Bacteria 6220
581 Ga0496125_0025285 3300048928 Bacteria 5440
582 Ga0496125_0028888 3300048928 Bacteria 4995
583 Ga0496125_0175258 3300048928 Bacteria 1436
584 Ga0496126_0009944 3300048929 Bacteria 10044
585 Ga0496126_0022532 3300048929 Bacteria 6125
586 Ga0496126_0040649 3300048929 Bacteria 4310
587 Ga0496126_0041278 3300048929 Bacteria 4271
588 Ga0496126_0054677 3300048929 Bacteria 3614
589 Ga0496126_0099966 3300048929 Bacteria 2539
590 Ga0496126_0106456 3300048929 Bacteria 2447
591 Ga0496126_0134009 3300048929 Bacteria 2138
592 Ga0496126_0223294 3300048929 Bacteria 1581
593 Ga0495678_054176 3300049459 Bacteria 1537
594 Ga0501031_0009305 3300049568 Bacteria 6386
595 Ga0501031_0063717 3300049568 Bacteria 2401
596 Ga0501031_0112381 3300049568 Bacteria 1779
597 Ga0501032_0003343 3300049569 Bacteria 12307
598 Ga0501032_0037276 3300049569 Bacteria 3315
599 Ga0501032_0077796 3300049569 Bacteria 2208
600 Ga0501032_0268106 3300049569 Bacteria 1106
601 Ga0501033_0000128 3300049570 Bacteria 73419
602 Ga0501033_0052525 3300049570 Bacteria 3020
603 Ga0501033_0119490 3300049570 Bacteria 1913
604 Ga0501034_0000113 3300049571 Bacteria 149824
605 Ga0501034_0000820 3300049571 Bacteria 46252
606 Ga0501034_0081524 3300049571 Bacteria 3237
607 Ga0501034_0086224 3300049571 Bacteria 3141
608 Ga0501034_0180912 3300049571 Bacteria 2073
609 Ga0501036_0000216 3300049572 Bacteria 38518
610 Ga0501036_0000536 3300049572 Bacteria 27218
611 Ga0501036_0037134 3300049572 Bacteria 4121
612 Ga0501036_0053903 3300049572 Bacteria 3404
613 Ga0501036_0067162 3300049572 Bacteria 3033
614 Ga0501037_0000214 3300049573 Bacteria 51638
615 Ga0501037_0042137 3300049573 Bacteria 3355
616 Ga0501037_0079683 3300049573 Bacteria 2377
617 Ga0501037_0221101 3300049573 Bacteria 1333
618 Ga0501038_0003329 3300049574 Bacteria 14988
619 Ga0501038_0004864 3300049574 Bacteria 12476
620 Ga0501038_0029671 3300049574 Bacteria 4844
621 Ga0501038_0102486 3300049574 Bacteria 2381
622 Ga0501038_0132055 3300049574 Bacteria 2049
623 Ga0501039_0001003 3300049575 Bacteria 20566
624 Ga0501039_0028355 3300049575 Bacteria 4310
625 Ga0501039_0157133 3300049575 Bacteria 1787
626 Ga0501039_0256770 3300049575 Bacteria 1374
627 Ga0501040_0066282 3300049576 Bacteria 2488
628 Ga0501042_0156795 3300049578 Bacteria 1642
629 Ga0501043_0001803 3300049579 Bacteria 18404
630 Ga0501043_0002528 3300049579 Bacteria 15463
631 Ga0501043_0014734 3300049579 Bacteria 6122
632 Ga0501043_0253913 3300049579 Bacteria 1354
633 Ga0501046_0002091 3300049580 Bacteria 18926
634 Ga0501047_0000044 3300049581 Bacteria 174789
635 Ga0501047_0000124 3300049581 Bacteria 94721
636 Ga0501047_0010065 3300049581 Bacteria 8941
637 Ga0501047_0042156 3300049581 Bacteria 4411
638 Ga0501047_0042442 3300049581 Bacteria 4395
639 Ga0501047_0092974 3300049581 Bacteria 2895
640 Ga0501047_0106659 3300049581 Bacteria 2682
641 Ga0501047_0229694 3300049581 Bacteria 1709
642 Ga0501048_0000117 3300049582 Bacteria 45344
643 Ga0501048_0000375 3300049582 Bacteria 31006
644 Ga0501048_0144277 3300049582 Bacteria 1684
645 Ga0501048_0258647 3300049582 Bacteria 1237
646 Ga0501067_0004289 3300049583 Bacteria 7859
647 Ga0501067_0031242 3300049583 Bacteria 2955
648 Ga0501067_0045154 3300049583 Bacteria 2447
649 Ga0501068_0000089 3300049584 Bacteria 38379
650 Ga0501068_0057429 3300049584 Bacteria 2360
651 Ga0501069_0003520 3300049585 Bacteria 8064
652 Ga0501069_0006950 3300049585 Bacteria 5917
653 Ga0501070_0000457 3300049586 Bacteria 37005
654 Ga0501070_0002301 3300049586 Bacteria 16761
655 Ga0501070_0008473 3300049586 Bacteria 8687
656 Ga0501070_0010689 3300049586 Bacteria 7761
657 Ga0501070_0034181 3300049586 Bacteria 4252
658 Ga0501070_0063079 3300049586 Bacteria 3069
659 Ga0501070_0082792 3300049586 Bacteria 2656
660 Ga0501070_0094708 3300049586 Bacteria 2471
661 Ga0501070_0126795 3300049586 Bacteria 2109
662 Ga0501070_0129722 3300049586 Bacteria 2083
663 Ga0501070_0137850 3300049586 Bacteria 2014
664 Ga0501070_0334468 3300049586 Bacteria 1230
665 Ga0501072_0017470 3300049588 Bacteria 5512
666 Ga0501072_0072611 3300049588 Bacteria 2720
667 Ga0501073_0000669 3300049589 Bacteria 24040
668 Ga0501073_0055373 3300049589 Bacteria 2775
669 Ga0501073_0125793 3300049589 Bacteria 1777
670 Ga0501073_0203375 3300049589 Bacteria 1369
671 Ga0501074_0000035 3300049590 Bacteria 64770
672 Ga0501074_0041671 3300049590 Bacteria 3324
673 Ga0501075_0394861 3300049591 Bacteria 1054
674 Ga0501076_0041032 3300049592 Bacteria 3639
675 Ga0501079_0020353 3300049741 Bacteria 5070
676 Ga0501079_0318211 3300049741 Bacteria 1218
677 Ga0501080_0000074 3300049742 Bacteria 66985
678 Ga0501080_0001566 3300049742 Bacteria 19356
679 Ga0501080_0003476 3300049742 Bacteria 13874
680 Ga0501080_0063873 3300049742 Bacteria 3425
681 Ga0501080_0121517 3300049742 Bacteria 2420
682 Ga0501080_0138691 3300049742 Bacteria 2249
683 Ga0501080_0259995 3300049742 Bacteria 1582
684 Ga0501083_0004584 3300049744 Bacteria 9765
685 Ga0501083_0118073 3300049744 Bacteria 1740
686 Ga0501035_0000128 3300049822 Bacteria 92297
687 Ga0501035_0033865 3300049822 Bacteria 4644
688 Ga0501035_0055068 3300049822 Bacteria 3552
689 Ga0501035_0252214 3300049822 Bacteria 1498
690 Ga0501044_0000108 3300049823 Bacteria 100968
691 Ga0501044_0001469 3300049823 Bacteria 27682
692 Ga0501044_0019204 3300049823 Bacteria 7317
693 Ga0501044_0019452 3300049823 Bacteria 7264
694 Ga0501044_0022496 3300049823 Bacteria 6716
695 Ga0501045_0019508 3300049824 Bacteria 4835
696 Ga0501045_0230730 3300049824 Bacteria 1378
697 nmdc:mga03683_60136_c1 3300050489 Bacteria 1604
698 nmdc:mga00v17_79738_c1 3300050491 Bacteria 2042
699 nmdc:mga00v17_99774_c1 3300050491 Bacteria 1832
700 nmdc:mga0yw44_11667_c1 3300050492 Bacteria 4549
701 nmdc:mga0yw44_23615_c1 3300050492 Bacteria 3467
702 nmdc:mga06z11_130458_c1 3300050494 Bacteria 1411
703 nmdc:mga06z11_98691_c1 3300050494 Bacteria 1599
704 nmdc:mga07m45_17070_c1 3300050496 Bacteria 3892
705 nmdc:mga05p37_114736_c1 3300050507 Bacteria 3311
706 nmdc:mga05p37_75626_c1 3300050507 Bacteria 4145
707 nmdc:mga08y16_15207_c1 3300050511 Bacteria 8094
708 nmdc:mga0n895_19830_c1 3300050512 Bacteria 6258
709 nmdc:mga0n895_70614_c1 3300050512 Bacteria 3461
710 nmdc:mga0rr50_238337_c1 3300050513 Bacteria 1507
711 nmdc:mga08x19_3956_c1 3300050514 Bacteria 8822
712 nmdc:mga0a205_92095_c1 3300050515 Bacteria 2929
713 nmdc:mga0sz30_64190_c1 3300050516 Bacteria 1573
714 Ga0495601_0000008 3300053077 Bacteria 362152
715 Ga0495601_0011904 3300053077 Bacteria 5214
716 Ga0495612_0000002 3300053078 Bacteria 310466
717 Ga0495612_0018968 3300053078 Bacteria 2753
718 Ga0500635_0001128 3300053080 Bacteria 6389
719 Ga0495595_0000008 3300053084 Bacteria 196206
720 Ga0495595_0000419 3300053084 Bacteria 16064
721 Ga0495619_0000002 3300053085 Bacteria 530226
722 Ga0495619_0001836 3300053085 Bacteria 14121
723 Ga0500578_0051641 3300053086 Bacteria 2634
724 Ga0500643_000079 3300053087 Bacteria 104107
725 Ga0500643_010505 3300053087 Bacteria 3440
726 Ga0500647_0119723 3300053091 Bacteria 1247
727 Ga0500583_0033457 3300053092 Bacteria 2275
728 Ga0500651_0016501 3300053093 Bacteria 4545
729 Ga0500651_0067853 3300053093 Bacteria 2221
730 Ga0500566_0000509 3300053094 Bacteria 21703
731 Ga0500566_0000836 3300053094 Bacteria 17548
732 Ga0500566_0047535 3300053094 Bacteria 2463
733 Ga0500641_0018835 3300053096 Bacteria 2602
734 Ga0500555_015543 3300053103 Bacteria 2195
735 Ga0500556_0000005 3300053104 Bacteria 581135
736 Ga0500556_0000017 3300053104 Bacteria 192495
737 Ga0500569_015625 3300053109 Bacteria 1905
738 Ga0500572_001823 3300053111 Bacteria 5428
739 Ga0500592_007166 3300053116 Bacteria 1774
740 Ga0500593_064476 3300053117 Bacteria 1603
741 Ga0500595_002736 3300053119 Bacteria 8531
742 Ga0500595_004064 3300053119 Bacteria 6653
743 Ga0500607_026323 3300053121 Bacteria 3235
744 Ga0500614_007029 3300053123 Bacteria 2368
745 Ga0500642_0000009 3300053130 Bacteria 286829
746 Ga0500642_0087462 3300053130 Bacteria 1437
747 Ga0500652_002026 3300053131 Bacteria 6100
748 Ga0500658_0086823 3300053134 Bacteria 1346
749 Ga0500559_0000723 3300053136 Bacteria 21728
750 Ga0500559_0006019 3300053136 Bacteria 5504
751 Ga0500559_0077692 3300053136 Bacteria 1504
752 Ga0500577_0000569 3300053142 Bacteria 9541
753 Ga0500577_0024549 3300053142 Bacteria 2029
754 Ga0500588_0035840 3300053146 Bacteria 1463
755 Ga0500589_120445 3300053147 Bacteria 1112
756 Ga0500603_000487 3300053150 Bacteria 10153
757 Ga0500604_0037226 3300053151 Bacteria 1454
758 Ga0500616_0000035 3300053153 Bacteria 394242
759 Ga0500616_0000038 3300053153 Bacteria 386801
760 Ga0500616_0039517 3300053153 Bacteria 2543
761 Ga0500620_005383 3300053155 Bacteria 2958
762 Ga0500627_0063839 3300053158 Bacteria 1623
763 Ga0500630_039439 3300053159 Bacteria 2306
764 Ga0500638_034065 3300053162 Bacteria 2463
765 Ga0500639_065420 3300053163 Bacteria 1865
766 Ga0500636_0000059 3300053177 Bacteria 52601
767 Ga0500636_0000344 3300053177 Bacteria 25582
768 Ga0500636_0001095 3300053177 Bacteria 14493
769 Ga0500636_0095485 3300053177 Bacteria 1697
770 Ga0500636_0130986 3300053177 Bacteria 1397
771 Ga0500637_0002787 3300053178 Bacteria 7847
772 Ga0500645_008956 3300053730 Bacteria 3383
773 Ga0500645_015588 3300053730 Bacteria 2406
774 Ga0500596_005131 3300053735 Bacteria 2336
775 Ga0500599_001543 3300053736 Bacteria 2668
776 Ga0500601_005225 3300053737 Bacteria 1420
777 Ga0501084_0002026 3300054114 Bacteria 16179
778 Ga0501084_0112360 3300054114 Bacteria 2289
779 Ga0501084_0283930 3300054114 Bacteria 1398
780 Ga0500661_007935 3300055283 Bacteria 1956
781 Ga0501082_0005129 3300060353 Bacteria 11401
782 Ga0501082_0013852 3300060353 Bacteria 6934
783 Ga0501082_0269309 3300060353 Bacteria 1482
784 Ga0530510_0084401 3300061734 Bacteria 2313

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0042442 Ga0501047_0042442_3497_4372 290
2 3300039450 Ga0436363_0815901 Ga0436363_0815901_731_1873 302
3 3300005577 Ga0068857_100017740 Ga0068857_1000177402 305
4 3300025924 Ga0207694_10300553 Ga0207694_103005532 305
5 3300035170 Ga0373943_0073247 Ga0373943_0073247_48_1088 319
6 3300035692 Ga0373935_0025193 Ga0373935_0025193_768_1808 319
7 3300035695 Ga0373927_0199630 Ga0373927_0199630_136_1251 319
8 3300046476 Ga0495662_0103256 Ga0495662_0103256_91_1131 319
9 3300006028 Ga0070717_10214156 Ga0070717_102141562 322
10 3300037068 Ga0373925_0020613 Ga0373925_0020613_2393_3514 322
11 3300005336 Ga0070680_100013900 Ga0070680_1000139002 323
12 3300005614 Ga0068856_100068386 Ga0068856_1000683863 323
13 3300013307 Ga0157372_10213221 Ga0157372_102132211 323
14 3300026078 Ga0207702_10184811 Ga0207702_101848112 323
15 3300006942 Ga0099824_1011035 Ga0099824_10110354 324
16 3300027296 Ga0209389_1000328 Ga0209389_100032824 324
17 3300027357 Ga0209589_1003134 Ga0209589_10031343 324
18 3300027361 Ga0209489_103754 Ga0209489_10375424 324
19 3300025942 Ga0207689_10061889 Ga0207689_100618892 325
20 3300048903 Ga0496100_0040920 Ga0496100_0040920_451_1485 325
21 3300048906 Ga0496103_0110634 Ga0496103_0110634_21_1142 325
22 3300005983 Ga0081540_1017481 Ga0081540_10174812 326
23 3300028379 Ga0268266_10001497 Ga0268266_1000149716 326
24 3300046452 Ga0495617_005797 Ga0495617_005797_2784_3914 326
25 3300046474 Ga0495605_0060869 Ga0495605_0060869_578_1708 326
26 3300046513 Ga0495616_0082070 Ga0495616_0082070_134_1264 326
27 3300046519 Ga0495632_0083939 Ga0495632_0083939_185_1315 326
28 3300046648 Ga0495611_0026482 Ga0495611_0026482_648_1778 326
29 3300048912 Ga0496109_0069224 Ga0496109_0069224_1086_2138 326
30 3300005338 Ga0068868_100216671 Ga0068868_1002166712 327
31 3300046515 Ga0495620_0029575 Ga0495620_0029575_1215_2264 327
32 3300049459 Ga0495678_054176 Ga0495678_054176_414_1466 327
33 3300005436 Ga0070713_100000894 Ga0070713_1000008944 328
34 3300005719 Ga0068861_100139649 Ga0068861_1001396492 328
35 3300006028 Ga0070717_10001686 Ga0070717_100016863 328
36 3300025297 Ga0209758_1016688 Ga0209758_10166883 328
37 3300037418 Ga0395900_0005628 Ga0395900_0005628_11982_13049 328
38 3300037466 Ga0395898_0013582 Ga0395898_0013582_4207_5274 328
39 3300037466 Ga0395898_0164092 Ga0395898_0164092_974_2038 328
40 3300038443 Ga0395901_0059614 Ga0395901_0059614_141_1208 328
41 3300005842 Ga0068858_100196525 Ga0068858_1001965251 329
42 3300044694 Ga0466963_0253525 Ga0466963_0253525_130_1194 329
43 3300046477 Ga0495664_0068451 Ga0495664_0068451_563_1630 329
44 3300046536 Ga0495587_0048865 Ga0495587_0048865_1256_2323 329
45 3300046679 Ga0495623_0054944 Ga0495623_0054944_1099_2166 329
46 3300046809 Ga0495600_0169077 Ga0495600_0169077_200_1267 329
47 3300047319 Ga0495674_0103843 Ga0495674_0103843_367_1434 329
48 3300047320 Ga0495672_0088022 Ga0495672_0088022_156_1202 329
49 3300047322 Ga0495680_0004170 Ga0495680_0004170_9534_10601 329
50 3300047444 Ga0495675_0016527 Ga0495675_0016527_3263_4330 329
51 3300049569 Ga0501032_0037276 Ga0501032_0037276_1313_2347 329
52 3300049572 Ga0501036_0053903 Ga0501036_0053903_732_1766 329
53 3300049576 Ga0501040_0066282 Ga0501040_0066282_1186_2220 329
54 3300049583 Ga0501067_0045154 Ga0501067_0045154_101_1135 329
55 3300049586 Ga0501070_0137850 Ga0501070_0137850_802_1836 329
56 3300049742 Ga0501080_0138691 Ga0501080_0138691_1115_2149 329
57 3300060353 Ga0501082_0013852 Ga0501082_0013852_1587_2621 329
58 3300005518 Ga0070699_100107339 Ga0070699_1001073391 330
59 3300009147 Ga0114129_10081574 Ga0114129_100815742 330
60 3300049579 Ga0501043_0253913 Ga0501043_0253913_201_1262 330
61 3300049581 Ga0501047_0042156 Ga0501047_0042156_207_1268 330
62 3300049586 Ga0501070_0126795 Ga0501070_0126795_220_1281 330
63 3300049822 Ga0501035_0055068 Ga0501035_0055068_798_1859 330
64 3300005434 Ga0070709_10088483 Ga0070709_100884832 331
65 3300005435 Ga0070714_100036306 Ga0070714_1000363062 331
66 3300005437 Ga0070710_10001586 Ga0070710_100015862 331
67 3300006175 Ga0070712_100034887 Ga0070712_1000348872 331
68 3300025898 Ga0207692_10020713 Ga0207692_100207132 331
69 3300025906 Ga0207699_10003862 Ga0207699_100038622 331
70 3300025915 Ga0207693_10033060 Ga0207693_100330602 331
71 3300025928 Ga0207700_10135033 Ga0207700_101350332 331
72 3300025939 Ga0207665_10013172 Ga0207665_100131723 331
73 3300046678 Ga0495599_0108425 Ga0495599_0108425_442_1509 331
74 3300047317 Ga0495604_0013280 Ga0495604_0013280_2848_3915 331
75 3300047471 Ga0495684_0241806 Ga0495684_0241806_224_1291 331
76 3300048928 Ga0496125_0020298 Ga0496125_0020298_38_1105 331
77 3300049571 Ga0501034_0000820 Ga0501034_0000820_33218_34252 331
78 3300049572 Ga0501036_0000216 Ga0501036_0000216_11656_12690 331
79 3300049573 Ga0501037_0042137 Ga0501037_0042137_2099_3133 331
80 3300049579 Ga0501043_0002528 Ga0501043_0002528_13710_14744 331
81 3300049581 Ga0501047_0000124 Ga0501047_0000124_50586_51620 331
82 3300049582 Ga0501048_0000375 Ga0501048_0000375_8839_9873 331
83 3300049586 Ga0501070_0008473 Ga0501070_0008473_377_1411 331
84 3300049589 Ga0501073_0203375 Ga0501073_0203375_250_1284 331
85 3300049742 Ga0501080_0000074 Ga0501080_0000074_24530_25564 331
86 3300049823 Ga0501044_0001469 Ga0501044_0001469_15740_16774 331
87 3300049824 Ga0501045_0230730 Ga0501045_0230730_74_1108 331
88 3300060353 Ga0501082_0269309 Ga0501082_0269309_345_1379 331
89 3300005937 Ga0081455_10013202 Ga0081455_100132023 332
90 3300009148 Ga0105243_10262613 Ga0105243_102626132 332
91 3300028786 Ga0307517_10000066 Ga0307517_1000006640 332
92 3300031730 Ga0307516_10219537 Ga0307516_102195371 332
93 3300035170 Ga0373943_0021168 Ga0373943_0021168_652_1650 332
94 3300035171 Ga0373946_0000693 Ga0373946_0000693_3112_4110 332
95 3300035172 Ga0373955_0041035 Ga0373955_0041035_885_1883 332
96 3300035695 Ga0373927_0004222 Ga0373927_0004222_6753_7751 332
97 3300037068 Ga0373925_0003884 Ga0373925_0003884_5054_6052 332
98 3300046454 Ga0495592_0003994 Ga0495592_0003994_46_1044 332
99 3300046473 Ga0495582_0000063 Ga0495582_0000063_2959_3957 332
100 3300046476 Ga0495662_0003113 Ga0495662_0003113_3416_4414 332
101 3300046477 Ga0495664_0106785 Ga0495664_0106785_419_1417 332
102 3300046499 Ga0495594_0000983 Ga0495594_0000983_2004_3002 332
103 3300046531 Ga0495665_0000163 Ga0495665_0000163_25735_26733 332
104 3300046533 Ga0495640_0013346 Ga0495640_0013346_1349_2347 332
105 3300046557 Ga0495622_0003604 Ga0495622_0003604_5461_6459 332
106 3300046674 Ga0495588_0124810 Ga0495588_0124810_340_1338 332
107 3300046680 Ga0495646_0007434 Ga0495646_0007434_4877_5875 332
108 3300046681 Ga0495647_0000198 Ga0495647_0000198_1498_2496 332
109 3300046689 Ga0495613_0000449 Ga0495613_0000449_10615_11613 332
110 3300046690 Ga0495624_0001125 Ga0495624_0001125_13605_14603 332
111 3300047315 Ga0495581_0000291 Ga0495581_0000291_13753_14751 332
112 3300047319 Ga0495674_0003711 Ga0495674_0003711_9021_10019 332
113 3300047321 Ga0495676_0041740 Ga0495676_0041740_541_1539 332
114 3300047322 Ga0495680_0115113 Ga0495680_0115113_981_1979 332
115 3300047673 Ga0495593_0000323 Ga0495593_0000323_9574_10572 332
116 3300048929 Ga0496126_0054677 Ga0496126_0054677_1670_2734 332
117 3300049579 Ga0501043_0014734 Ga0501043_0014734_1584_2618 332
118 3300049591 Ga0501075_0394861 Ga0501075_0394861_17_1027 332
119 3300053737 Ga0500601_005225 Ga0500601_005225_40_1107 332
120 3300025939 Ga0207665_10117482 Ga0207665_101174822 333
121 3300028381 Ga0268264_10091945 Ga0268264_100919452 333
122 3300036401 Ga0373937_0149252 Ga0373937_0149252_30_1088 333
123 3300046526 Ga0495666_0027895 Ga0495666_0027895_1624_2754 333
124 3300048929 Ga0496126_0106456 Ga0496126_0106456_1278_2345 333
125 3300053153 Ga0500616_0039517 Ga0500616_0039517_1052_2119 333
126 iso_pu_bacteria 2917554339 2917558176 333
127 3300005544 Ga0070686_100071473 Ga0070686_1000714732 334
128 3300005547 Ga0070693_100244506 Ga0070693_1002445061 334
129 3300005564 Ga0070664_100084505 Ga0070664_1000845052 334
130 3300006038 Ga0075365_10165007 Ga0075365_101650071 334
131 3300025945 Ga0207679_10061253 Ga0207679_100612532 334
132 3300037853 Ga0436364_1428694 Ga0436364_1428694_354_1391 334
133 3300045976 Ga0466967_0081292 Ga0466967_0081292_1631_2695 334
134 3300046524 Ga0495648_0000581 Ga0495648_0000581_28694_29770 334
135 3300053094 Ga0500566_0047535 Ga0500566_0047535_1357_2424 334
136 3300053111 Ga0500572_001823 Ga0500572_001823_1154_2215 334
137 3300009093 Ga0105240_10015213 Ga0105240_100152135 335
138 3300009093 Ga0105240_10016353 Ga0105240_100163536 335
139 3300009174 Ga0105241_10002904 Ga0105241_100029047 335
140 3300009177 Ga0105248_10019495 Ga0105248_100194954 335
141 3300009551 Ga0105238_10015659 Ga0105238_100156592 335
142 3300010375 Ga0105239_10093089 Ga0105239_100930892 335
143 3300025941 Ga0207711_10010567 Ga0207711_100105673 335
144 3300048909 Ga0496106_0047142 Ga0496106_0047142_44_1051 335
145 3300049571 Ga0501034_0086224 Ga0501034_0086224_705_1721 335
146 3300049586 Ga0501070_0094708 Ga0501070_0094708_201_1217 335
147 3300053091 Ga0500647_0119723 Ga0500647_0119723_43_1080 335
148 3300053094 Ga0500566_0000836 Ga0500566_0000836_1129_2166 335
149 3300053121 Ga0500607_026323 Ga0500607_026323_1773_2840 335
150 3300053123 Ga0500614_007029 Ga0500614_007029_326_1363 335
151 3300005333 Ga0070677_10006891 Ga0070677_100068912 336
152 3300005618 Ga0068864_100479675 Ga0068864_1004796751 336
153 3300009101 Ga0105247_10074790 Ga0105247_100747902 336
154 3300011119 Ga0105246_10219576 Ga0105246_102195762 336
155 3300014325 Ga0163163_10038761 Ga0163163_100387614 336
156 3300025893 Ga0207682_10003162 Ga0207682_100031622 336
157 3300026116 Ga0207674_10252195 Ga0207674_102521952 336
158 3300026118 Ga0207675_100316363 Ga0207675_1003163632 336
159 3300031238 Ga0265332_10019280 Ga0265332_100192802 336
160 3300031456 Ga0307513_10279691 Ga0307513_102796911 336
161 3300044684 Ga0466966_0073894 Ga0466966_0073894_1022_2113 336
162 3300044842 Ga0466957_0051062 Ga0466957_0051062_814_1905 336
163 3300045049 Ga0466959_0073552 Ga0466959_0073552_1270_2361 336
164 3300046474 Ga0495605_0075976 Ga0495605_0075976_61_1104 336
165 3300048090 Ga0495615_0018412 Ga0495615_0018412_173_1195 336
166 3300049568 Ga0501031_0063717 Ga0501031_0063717_1370_2389 336
167 3300049572 Ga0501036_0037134 Ga0501036_0037134_2175_3194 336
168 3300049573 Ga0501037_0079683 Ga0501037_0079683_178_1197 336
169 3300049574 Ga0501038_0029671 Ga0501038_0029671_31_1050 336
170 3300049575 Ga0501039_0157133 Ga0501039_0157133_225_1244 336
171 3300049581 Ga0501047_0092974 Ga0501047_0092974_422_1441 336
172 3300049586 Ga0501070_0063079 Ga0501070_0063079_1596_2615 336
173 3300049589 Ga0501073_0055373 Ga0501073_0055373_1501_2520 336
174 3300049742 Ga0501080_0063873 Ga0501080_0063873_2101_3120 336
175 3300049744 Ga0501083_0118073 Ga0501083_0118073_627_1655 336
176 3300005842 Ga0068858_100133880 Ga0068858_1001338802 337
177 3300025295 Ga0209564_1000842 Ga0209564_10008422 337
178 3300025949 Ga0207667_10522601 Ga0207667_105226011 337
179 3300031247 Ga0265340_10000659 Ga0265340_1000065915 337
180 3300031247 Ga0265340_10011689 Ga0265340_100116896 337
181 3300031249 Ga0265339_10004448 Ga0265339_100044482 337
182 3300031250 Ga0265331_10105280 Ga0265331_101052801 337
183 3300031344 Ga0265316_10009504 Ga0265316_100095048 337
184 3300031595 Ga0265313_10002138 Ga0265313_1000213814 337
185 3300031712 Ga0265342_10001734 Ga0265342_100017348 337
186 3300046516 Ga0495628_0010286 Ga0495628_0010286_6493_7506 337
187 3300046559 Ga0495667_0012398 Ga0495667_0012398_4167_5180 337
188 3300049581 Ga0501047_0010065 Ga0501047_0010065_454_1494 337
189 3300049585 Ga0501069_0006950 Ga0501069_0006950_1969_2997 337
190 3300049586 Ga0501070_0010689 Ga0501070_0010689_1401_2441 337
191 3300049586 Ga0501070_0334468 Ga0501070_0334468_45_1073 337
192 3300049590 Ga0501074_0041671 Ga0501074_0041671_1483_2523 337
193 3300049742 Ga0501080_0003476 Ga0501080_0003476_12103_13143 337
194 3300050507 nmdc:mga05p37_75626_c1 nmdc:mga05p37_75626_c1_2924_3943 337
195 3300053177 Ga0500636_0001095 Ga0500636_0001095_5113_6195 337
196 3300054114 Ga0501084_0283930 Ga0501084_0283930_255_1280 337
197 3300003203 JGI25406J46586_10031159 JGI25406J46586_100311591 338
198 3300005535 Ga0070684_100022655 Ga0070684_1000226553 338
199 3300005539 Ga0068853_100108527 Ga0068853_1001085272 338
200 3300005577 Ga0068857_100284534 Ga0068857_1002845342 338
201 3300006038 Ga0075365_10006703 Ga0075365_100067037 338
202 3300006048 Ga0075363_100006169 Ga0075363_1000061693 338
203 3300006051 Ga0075364_10010755 Ga0075364_100107554 338
204 3300006177 Ga0075362_10037389 Ga0075362_100373892 338
205 3300006195 Ga0075366_10038337 Ga0075366_100383373 338
206 3300006353 Ga0075370_10014208 Ga0075370_100142082 338
207 3300009174 Ga0105241_10168183 Ga0105241_101681831 338
208 3300009551 Ga0105238_10266982 Ga0105238_102669822 338
209 3300013104 Ga0157370_10080759 Ga0157370_100807592 338
210 3300013104 Ga0157370_10336985 Ga0157370_103369851 338
211 3300013105 Ga0157369_10028226 Ga0157369_100282263 338
212 3300013306 Ga0163162_10183875 Ga0163162_101838753 338
213 3300013307 Ga0157372_10184205 Ga0157372_101842052 338
214 3300025924 Ga0207694_10227017 Ga0207694_102270171 338
215 3300025941 Ga0207711_10148668 Ga0207711_101486682 338
216 3300031241 Ga0265325_10015080 Ga0265325_100150803 338
217 3300031249 Ga0265339_10011598 Ga0265339_100115981 338
218 3300031250 Ga0265331_10036923 Ga0265331_100369232 338
219 3300031344 Ga0265316_10167132 Ga0265316_101671322 338
220 3300031595 Ga0265313_10031726 Ga0265313_100317262 338
221 3300031595 Ga0265313_10032142 Ga0265313_100321421 338
222 3300031712 Ga0265342_10028709 Ga0265342_100287092 338
223 3300035118 Ga0373954_0020018 Ga0373954_0020018_1671_2738 338
224 3300035171 Ga0373946_0023553 Ga0373946_0023553_1029_2096 338
225 3300035725 Ga0373947_0018272 Ga0373947_0018272_625_1692 338
226 3300042435 Ga0439434_0013050 Ga0439434_0013050_1358_2398 338
227 3300046475 Ga0495639_0019155 Ga0495639_0019155_1839_2906 338
228 3300046476 Ga0495662_0016897 Ga0495662_0016897_1787_2854 338
229 3300046514 Ga0495618_0015285 Ga0495618_0015285_3057_4124 338
230 3300046680 Ga0495646_0078644 Ga0495646_0078644_83_1150 338
231 3300046690 Ga0495624_0026919 Ga0495624_0026919_56_1123 338
232 3300048928 Ga0496125_0018116 Ga0496125_0018116_1937_2989 338
233 3300049584 Ga0501068_0057429 Ga0501068_0057429_709_1749 338
234 3300049586 Ga0501070_0129722 Ga0501070_0129722_502_1533 338
235 3300049588 Ga0501072_0072611 Ga0501072_0072611_1182_2222 338
236 3300049592 Ga0501076_0041032 Ga0501076_0041032_1005_2045 338
237 3300049741 Ga0501079_0318211 Ga0501079_0318211_143_1174 338
238 3300049742 Ga0501080_0121517 Ga0501080_0121517_288_1319 338
239 3300049742 Ga0501080_0259995 Ga0501080_0259995_72_1112 338
240 3300050496 nmdc:mga07m45_17070_c1 nmdc:mga07m45_17070_c1_405_1427 338
241 3300053078 Ga0495612_0018968 Ga0495612_0018968_566_1633 338
242 3300053177 Ga0500636_0130986 Ga0500636_0130986_228_1307 338
243 3300054114 Ga0501084_0112360 Ga0501084_0112360_134_1174 338
244 3300061734 Ga0530510_0084401 Ga0530510_0084401_1061_2101 338
245 3300005329 Ga0070683_100001565 Ga0070683_10000156512 339
246 3300005458 Ga0070681_10017623 Ga0070681_100176237 339
247 3300005539 Ga0068853_100197522 Ga0068853_1001975221 339
248 3300028379 Ga0268266_10299813 Ga0268266_102998131 339
249 3300028556 Ga0265337_1018969 Ga0265337_10189692 339
250 3300028563 Ga0265319_1009816 Ga0265319_10098162 339
251 3300028653 Ga0265323_10001213 Ga0265323_100012137 339
252 3300028666 Ga0265336_10001031 Ga0265336_100010313 339
253 3300028800 Ga0265338_10000973 Ga0265338_1000097333 339
254 3300029957 Ga0265324_10001933 Ga0265324_100019337 339
255 3300035725 Ga0373947_0000552 Ga0373947_0000552_3731_4816 339
256 3300036647 Ga0316582_0088660 Ga0316582_0088660_198_1223 339
257 3300046472 Ga0495580_0003379 Ga0495580_0003379_9882_10967 339
258 3300048928 Ga0496125_0000595 Ga0496125_0000595_14918_15985 339
259 3300049568 Ga0501031_0009305 Ga0501031_0009305_4604_5650 339
260 3300049569 Ga0501032_0003343 Ga0501032_0003343_6094_7140 339
261 3300049570 Ga0501033_0000128 Ga0501033_0000128_15334_16380 339
262 3300049571 Ga0501034_0000113 Ga0501034_0000113_130597_131643 339
263 3300049572 Ga0501036_0000536 Ga0501036_0000536_1848_2894 339
264 3300049573 Ga0501037_0000214 Ga0501037_0000214_47396_48442 339
265 3300049574 Ga0501038_0003329 Ga0501038_0003329_10270_11316 339
266 3300049575 Ga0501039_0001003 Ga0501039_0001003_1729_2775 339
267 3300049578 Ga0501042_0156795 Ga0501042_0156795_363_1409 339
268 3300049579 Ga0501043_0001803 Ga0501043_0001803_5069_6115 339
269 3300049580 Ga0501046_0002091 Ga0501046_0002091_5139_6185 339
270 3300049581 Ga0501047_0000044 Ga0501047_0000044_121611_122657 339
271 3300049582 Ga0501048_0000117 Ga0501048_0000117_16958_18004 339
272 3300049583 Ga0501067_0004289 Ga0501067_0004289_1751_2797 339
273 3300049584 Ga0501068_0000089 Ga0501068_0000089_262_1308 339
274 3300049585 Ga0501069_0003520 Ga0501069_0003520_1894_2940 339
275 3300049586 Ga0501070_0000457 Ga0501070_0000457_33160_34212 339
276 3300049586 Ga0501070_0002301 Ga0501070_0002301_5172_6218 339
277 3300049588 Ga0501072_0017470 Ga0501072_0017470_1662_2708 339
278 3300049589 Ga0501073_0000669 Ga0501073_0000669_15373_16419 339
279 3300049590 Ga0501074_0000035 Ga0501074_0000035_57517_58563 339
280 3300049741 Ga0501079_0020353 Ga0501079_0020353_2106_3152 339
281 3300049742 Ga0501080_0001566 Ga0501080_0001566_12428_13474 339
282 3300049744 Ga0501083_0004584 Ga0501083_0004584_3698_4744 339
283 3300049822 Ga0501035_0000128 Ga0501035_0000128_85613_86659 339
284 3300049823 Ga0501044_0000108 Ga0501044_0000108_54832_55878 339
285 3300049824 Ga0501045_0019508 Ga0501045_0019508_758_1804 339
286 3300054114 Ga0501084_0002026 Ga0501084_0002026_5181_6227 339
287 3300060353 Ga0501082_0005129 Ga0501082_0005129_8318_9364 339
288 3300005458 Ga0070681_10288955 Ga0070681_102889552 340
289 3300006871 Ga0075434_100207360 Ga0075434_1002073602 340
290 3300009094 Ga0111539_10204300 Ga0111539_102043002 340
291 3300025912 Ga0207707_10258963 Ga0207707_102589632 340
292 3300028577 Ga0265318_10015874 Ga0265318_100158742 340
293 3300031247 Ga0265340_10010166 Ga0265340_100101662 340
294 3300031595 Ga0265313_10009770 Ga0265313_100097701 340
295 3300048922 Ga0496119_0000308 Ga0496119_0000308_29319_30365 340
296 3300048925 Ga0496122_0001649 Ga0496122_0001649_33481_34527 340
297 3300048926 Ga0496123_0000602 Ga0496123_0000602_5877_6923 340
298 3300050511 nmdc:mga08y16_15207_c1 nmdc:mga08y16_15207_c1_1123_2151 340
299 3300050512 nmdc:mga0n895_19830_c1 nmdc:mga0n895_19830_c1_2381_3409 340
300 3300050515 nmdc:mga0a205_92095_c1 nmdc:mga0a205_92095_c1_1335_2363 340
301 3300053117 Ga0500593_064476 Ga0500593_064476_470_1510 340
302 3300053136 Ga0500559_0077692 Ga0500559_0077692_36_1103 340
303 3300053155 Ga0500620_005383 Ga0500620_005383_288_1355 340
304 3300053177 Ga0500636_0000059 Ga0500636_0000059_21906_22973 340
305 iso_pu_bacteria 2643221547 2643758774 340
306 3300005439 Ga0070711_100037502 Ga0070711_1000375022 341
307 3300005455 Ga0070663_100085621 Ga0070663_1000856212 341
308 3300005458 Ga0070681_10130932 Ga0070681_101309322 341
309 3300005530 Ga0070679_100068439 Ga0070679_1000684392 341
310 3300005530 Ga0070679_100177156 Ga0070679_1001771562 341
311 3300005563 Ga0068855_100192544 Ga0068855_1001925442 341
312 3300005614 Ga0068856_100355798 Ga0068856_1003557981 341
313 3300005617 Ga0068859_100261505 Ga0068859_1002615052 341
314 3300006028 Ga0070717_10051304 Ga0070717_100513042 341
315 3300006846 Ga0075430_100065067 Ga0075430_1000650672 341
316 3300006847 Ga0075431_100245228 Ga0075431_1002452282 341
317 3300006931 Ga0097620_100261533 Ga0097620_1002615332 341
318 3300009101 Ga0105247_10020077 Ga0105247_100200772 341
319 3300010159 Ga0099796_10006477 Ga0099796_100064772 341
320 3300025913 Ga0207695_10153976 Ga0207695_101539762 341
321 3300025921 Ga0207652_10084927 Ga0207652_100849272 341
322 3300031730 Ga0307516_10011022 Ga0307516_100110222 341
323 3300033180 Ga0307510_10093046 Ga0307510_100930462 341
324 3300035111 Ga0373923_0000577 Ga0373923_0000577_2910_4103 341
325 3300035113 Ga0373936_0010575 Ga0373936_0010575_317_1351 341
326 3300035118 Ga0373954_0010639 Ga0373954_0010639_1616_2809 341
327 3300035120 Ga0373957_0013008 Ga0373957_0013008_435_1628 341
328 3300035170 Ga0373943_0000679 Ga0373943_0000679_10008_11201 341
329 3300035171 Ga0373946_0009020 Ga0373946_0009020_1195_2388 341
330 3300035172 Ga0373955_0000054 Ga0373955_0000054_9186_10379 341
331 3300035410 Ga0373924_0000398 Ga0373924_0000398_9231_10424 341
332 3300035692 Ga0373935_0000223 Ga0373935_0000223_17790_18983 341
333 3300035724 Ga0373933_0001275 Ga0373933_0001275_3213_4406 341
334 3300035725 Ga0373947_0006263 Ga0373947_0006263_2782_3975 341
335 3300036401 Ga0373937_0000006 Ga0373937_0000006_182285_183478 341
336 3300037068 Ga0373925_0000002 Ga0373925_0000002_313861_315054 341
337 3300046454 Ga0495592_0000086 Ga0495592_0000086_18502_19695 341
338 3300046459 Ga0495629_0003367 Ga0495629_0003367_4231_5424 341
339 3300046462 Ga0495651_0000562 Ga0495651_0000562_23299_24492 341
340 3300046463 Ga0495653_0000006 Ga0495653_0000006_314009_315202 341
341 3300046473 Ga0495582_0011820 Ga0495582_0011820_466_1659 341
342 3300046476 Ga0495662_0003942 Ga0495662_0003942_1192_2385 341
343 3300046477 Ga0495664_0000002 Ga0495664_0000002_349643_350836 341
344 3300046511 Ga0495608_0000009 Ga0495608_0000009_129599_130792 341
345 3300046514 Ga0495618_0000005 Ga0495618_0000005_127002_128195 341
346 3300046516 Ga0495628_0000002 Ga0495628_0000002_314028_315221 341
347 3300046517 Ga0495630_0000240 Ga0495630_0000240_5661_6854 341
348 3300046529 Ga0495652_0000004 Ga0495652_0000004_273662_274855 341
349 3300046533 Ga0495640_0000005 Ga0495640_0000005_129614_130807 341
350 3300046536 Ga0495587_0000007 Ga0495587_0000007_187435_188628 341
351 3300046543 Ga0495645_0000003 Ga0495645_0000003_295279_296472 341
352 3300046559 Ga0495667_0000002 Ga0495667_0000002_122502_123695 341
353 3300046642 Ga0495634_0000370 Ga0495634_0000370_24177_25370 341
354 3300046663 Ga0495635_0000020 Ga0495635_0000020_123401_124594 341
355 3300046675 Ga0495657_0000240 Ga0495657_0000240_30360_31553 341
356 3300046678 Ga0495599_0000001 Ga0495599_0000001_452706_453899 341
357 3300046679 Ga0495623_0000001 Ga0495623_0000001_221651_222844 341
358 3300046680 Ga0495646_0000013 Ga0495646_0000013_72284_73477 341
359 3300046689 Ga0495613_0023466 Ga0495613_0023466_324_1517 341
360 3300046690 Ga0495624_0117597 Ga0495624_0117597_220_1413 341
361 3300046691 Ga0495670_0034095 Ga0495670_0034095_445_1494 341
362 3300046809 Ga0495600_0000041 Ga0495600_0000041_31273_32466 341
363 3300047315 Ga0495581_0009344 Ga0495581_0009344_2551_3783 341
364 3300047317 Ga0495604_0000005 Ga0495604_0000005_339672_340865 341
365 3300047319 Ga0495674_0000003 Ga0495674_0000003_246905_248098 341
366 3300047322 Ga0495680_0000002 Ga0495680_0000002_117095_118288 341
367 3300047444 Ga0495675_0000010 Ga0495675_0000010_1766_2959 341
368 3300047471 Ga0495684_0000020 Ga0495684_0000020_63688_64881 341
369 3300047673 Ga0495593_0003730 Ga0495593_0003730_3018_4211 341
370 3300048088 Ga0495602_0000027 Ga0495602_0000027_41588_42781 341
371 3300048924 Ga0496121_0057626 Ga0496121_0057626_799_1869 341
372 3300048929 Ga0496126_0022532 Ga0496126_0022532_4745_5812 341
373 3300048929 Ga0496126_0040649 Ga0496126_0040649_830_1900 341
374 3300049582 Ga0501048_0258647 Ga0501048_0258647_41_1072 341
375 3300053077 Ga0495601_0000008 Ga0495601_0000008_7521_8714 341
376 3300053078 Ga0495612_0000002 Ga0495612_0000002_225624_226817 341
377 3300053084 Ga0495595_0000008 Ga0495595_0000008_7649_8842 341
378 3300053085 Ga0495619_0000002 Ga0495619_0000002_314031_315224 341
379 iso_pu_bacteria 2842694124 2842695921 341
380 3300006941 Ga0099825_1028536 Ga0099825_10285362 342
381 3300006944 Ga0099823_1034197 Ga0099823_10341971 342
382 3300021384 Ga0213876_10005943 Ga0213876_100059432 342
383 3300027296 Ga0209389_1000076 Ga0209389_100007664 342
384 3300027361 Ga0209489_108247 Ga0209489_10824713 342
385 3300027363 Ga0209700_100014 Ga0209700_10001463 342
386 3300031344 Ga0265316_10055949 Ga0265316_100559492 342
387 3300031995 Ga0307409_100260450 Ga0307409_1002604502 342
388 3300039437 Ga0436365_0253472 Ga0436365_0253472_18460_19500 342
389 3300039453 Ga0436362_0199820 Ga0436362_0199820_289_1329 342
390 3300048929 Ga0496126_0223294 Ga0496126_0223294_431_1468 342
391 3300049569 Ga0501032_0077796 Ga0501032_0077796_364_1404 342
392 3300049570 Ga0501033_0119490 Ga0501033_0119490_373_1413 342
393 3300049572 Ga0501036_0067162 Ga0501036_0067162_540_1580 342
394 3300049574 Ga0501038_0102486 Ga0501038_0102486_969_2009 342
395 3300049575 Ga0501039_0028355 Ga0501039_0028355_3148_4188 342
396 3300049581 Ga0501047_0106659 Ga0501047_0106659_621_1664 342
397 3300049586 Ga0501070_0034181 Ga0501070_0034181_2580_3620 342
398 3300049822 Ga0501035_0252214 Ga0501035_0252214_307_1362 342
399 3300049823 Ga0501044_0019204 Ga0501044_0019204_233_1273 342
400 iso_pu_bacteria 2889033259 2889036137 342
401 3300003762 Ga0055542_1003949 Ga0055542_10039492 343
402 3300025254 Ga0209148_1000526 Ga0209148_100052615 343
403 3300025272 Ga0209455_1000950 Ga0209455_100095014 343
404 3300048909 Ga0496106_0009042 Ga0496106_0009042_3095_4162 343
405 3300048910 Ga0496107_0004737 Ga0496107_0004737_1804_2871 343
406 3300048911 Ga0496108_0000442 Ga0496108_0000442_29180_30247 343
407 3300048912 Ga0496109_0004462 Ga0496109_0004462_3181_4248 343
408 3300048913 Ga0496110_0042506 Ga0496110_0042506_1829_2896 343
409 3300048916 Ga0496113_0033938 Ga0496113_0033938_1828_2895 343
410 3300053080 Ga0500635_0001128 Ga0500635_0001128_3383_4456 343
411 3300053150 Ga0500603_000487 Ga0500603_000487_4235_5308 343
412 3300053178 Ga0500637_0002787 Ga0500637_0002787_3347_4420 343
413 iso_pu_bacteria 2513237141 2513889644 343
414 iso_pu_bacteria 2876808645 2876812014 343
415 iso_pu_bacteria 2879110137 2879112598 343
416 3300003659 JGI25404J52841_10019198 JGI25404J52841_100191981 344
417 3300005937 Ga0081455_10052828 Ga0081455_100528282 344
418 3300005985 Ga0081539_10015391 Ga0081539_100153914 344
419 3300013104 Ga0157370_10223467 Ga0157370_102234672 344
420 3300026078 Ga0207702_10356479 Ga0207702_103564791 344
421 3300048915 Ga0496112_0197363 Ga0496112_0197363_759_1793 344
422 3300048924 Ga0496121_0064926 Ga0496121_0064926_229_1296 344
423 iso_pu_bacteria 2513237101 2513698118 344
424 iso_pu_bacteria 2721755755 2723849168 344
425 iso_pu_bacteria 2791355199 2793078474 344
426 iso_pu_bacteria 2874604998 2874606894 344
427 iso_pu_bacteria 2922361189 2922364516 344
428 iso_pu_bacteria 2922386360 2922389199 344
429 iso_pu_bacteria 8006964411 8006967708 344
430 iso_pu_bacteria 8006984368 8006992634 344
431 iso_pu_bacteria 8056673599 8056678417 344
432 3300031250 Ga0265331_10096895 Ga0265331_100968952 345
433 3300031711 Ga0265314_10129397 Ga0265314_101293972 345
434 3300031712 Ga0265342_10002077 Ga0265342_1000207710 345
435 3300053093 Ga0500651_0067853 Ga0500651_0067853_374_1438 345
436 3300053159 Ga0500630_039439 Ga0500630_039439_960_1997 345
437 3300053163 Ga0500639_065420 Ga0500639_065420_350_1411 345
438 3300053177 Ga0500636_0000344 Ga0500636_0000344_23416_24480 345
439 3300053735 Ga0500596_005131 Ga0500596_005131_298_1335 345
440 iso_pu_bacteria 2513237098 2513678464 345
441 iso_pu_bacteria 2643221651 2644290604 345
442 iso_pu_bacteria 2885383462 2885389683 345
443 iso_pu_bacteria 2903768456 2903774732 345
444 iso_pu_bacteria 8056681323 8056687780 345
445 3300005435 Ga0070714_100031635 Ga0070714_1000316353 346
446 3300005937 Ga0081455_10000694 Ga0081455_1000069429 346
447 3300009545 Ga0105237_10229935 Ga0105237_102299352 346
448 3300009545 Ga0105237_10303872 Ga0105237_103038722 346
449 3300009551 Ga0105238_10145976 Ga0105238_101459762 346
450 3300013105 Ga0157369_10006988 Ga0157369_1000698811 346
451 3300013296 Ga0157374_10137921 Ga0157374_101379212 346
452 3300025914 Ga0207671_10225206 Ga0207671_102252062 346
453 3300025924 Ga0207694_10024912 Ga0207694_100249123 346
454 3300025928 Ga0207700_10017910 Ga0207700_100179102 346
455 3300025929 Ga0207664_10029903 Ga0207664_100299033 346
456 3300037466 Ga0395898_0010285 Ga0395898_0010285_3205_4245 346
457 3300039437 Ga0436365_0856193 Ga0436365_0856193_3024_4064 346
458 3300039438 Ga0436360_0752976 Ga0436360_0752976_1041_2081 346
459 3300048924 Ga0496121_0127234 Ga0496121_0127234_321_1361 346
460 iso_pu_bacteria 2507262055 2507504672 346
461 iso_pu_bacteria 2508501009 2508539912 346
462 iso_pu_bacteria 2508501042 2508694951 346
463 iso_pu_bacteria 2511231028 2511397050 346
464 iso_pu_bacteria 2513237092 2513626631 346
465 iso_pu_bacteria 2513237094 2513640686 346
466 iso_pu_bacteria 2513237095 2513653430 346
467 iso_pu_bacteria 2513237102 2513699171 346
468 iso_pu_bacteria 2513237104 2513714874 346
469 iso_pu_bacteria 2513237161 2514016339 346
470 iso_pu_bacteria 2515154112 2515627758 346
471 iso_pu_bacteria 2517093001 2517108701 346
472 iso_pu_bacteria 2524023205 2524438612 346
473 iso_pu_bacteria 2524023210 2524466165 346
474 iso_pu_bacteria 2528768022 2528858318 346
475 iso_pu_bacteria 2602042107 2603857944 346
476 iso_pu_bacteria 2617270741 2617377118 346
477 iso_pu_bacteria 2744054633 2745077671 346
478 iso_pu_bacteria 2791355196 2793063250 346
479 iso_pu_bacteria 2816332527 2818243487 346
480 iso_pu_bacteria 2824600985 2824605809 346
481 iso_pu_bacteria 2824609381 2824611977 346
482 iso_pu_bacteria 2824617872 2824626014 346
483 iso_pu_bacteria 2824626560 2824632533 346
484 iso_pu_bacteria 2824635225 2824642703 346
485 iso_pu_bacteria 2824644064 2824650585 346
486 iso_pu_bacteria 2824653114 2824661069 346
487 iso_pu_bacteria 2824661429 2824669178 346
488 iso_pu_bacteria 2824671348 2824674726 346
489 iso_pu_bacteria 2824679649 2824685426 346
490 iso_pu_bacteria 2824687955 2824692602 346
491 iso_pu_bacteria 2824696289 2824700959 346
492 iso_pu_bacteria 2824704595 2824709367 346
493 iso_pu_bacteria 2824714736 2824720574 346
494 iso_pu_bacteria 2824723954 2824730659 346
495 iso_pu_bacteria 2824732956 2824734096 346
496 iso_pu_bacteria 2824746037 2824749157 346
497 iso_pu_bacteria 2824753945 2824761954 346
498 iso_pu_bacteria 2824763712 2824770603 346
499 iso_pu_bacteria 2824773399 2824780153 346
500 iso_pu_bacteria 2838122688 2838130253 346
501 iso_pu_bacteria 2841941048 2841944304 346
502 iso_pu_bacteria 2841949485 2841954519 346
503 iso_pu_bacteria 2841957949 2841963432 346
504 iso_pu_bacteria 2841966195 2841969081 346
505 iso_pu_bacteria 2841974524 2841979855 346
506 iso_pu_bacteria 2841983080 2841989547 346
507 iso_pu_bacteria 2842038055 2842044044 346
508 iso_pu_bacteria 2842045827 2842051967 346
509 iso_pu_bacteria 2844315083 2844316020 346
510 iso_pu_bacteria 2847930680 2847931508 346
511 iso_pu_bacteria 2847939898 2847941600 346
512 iso_pu_bacteria 2849076700 2849082526 346
513 iso_pu_bacteria 2857509624 2857515789 346
514 iso_pu_bacteria 2857524615 2857527324 346
515 iso_pu_bacteria 2874590934 2874593753 346
516 iso_pu_bacteria 2874612657 2874619630 346
517 iso_pu_bacteria 2874620515 2874624281 346
518 iso_pu_bacteria 2874628541 2874634043 346
519 iso_pu_bacteria 2874645413 2874647992 346
520 iso_pu_bacteria 2876771140 2876772844 346
521 iso_pu_bacteria 2876818435 2876826427 346
522 iso_pu_bacteria 2879074833 2879077540 346
523 iso_pu_bacteria 2879083081 2879091368 346
524 iso_pu_bacteria 2879099564 2879100075 346
525 iso_pu_bacteria 2879127579 2879134380 346
526 iso_pu_bacteria 2879142872 2879147338 346
527 iso_pu_bacteria 2881364244 2881364946 346
528 iso_pu_bacteria 2881665667 2881673196 346
529 iso_pu_bacteria 2885366525 2885368149 346
530 iso_pu_bacteria 2885409591 2885410958 346
531 iso_pu_bacteria 2888378607 2888378843 346
532 iso_pu_bacteria 2888388044 2888391174 346
533 iso_pu_bacteria 2888419890 2888427270 346
534 iso_pu_bacteria 2893066018 2893071864 346
535 iso_pu_bacteria 2903727486 2903729586 346
536 iso_pu_bacteria 2904666416 2904672380 346
537 iso_pu_bacteria 2904711408 2904717966 346
538 iso_pu_bacteria 2906602504 2906606089 346
539 iso_pu_bacteria 2906626472 2906635084 346
540 iso_pu_bacteria 2906643746 2906645627 346
541 iso_pu_bacteria 2908775508 2908783030 346
542 iso_pu_bacteria 2919073203 2919078435 346
543 iso_pu_bacteria 2922368715 2922378514 346
544 iso_pu_bacteria 2922393267 2922400933 346
545 iso_pu_bacteria 2929615660 2929622400 346
546 iso_pu_bacteria 2929624759 2929631383 346
547 iso_pu_bacteria 2932784394 2932786171 346
548 iso_pu_bacteria 2932794094 2932800055 346
549 iso_pu_bacteria 2932801729 2932808357 346
550 iso_pu_bacteria 2932809354 2932816868 346
551 iso_pu_bacteria 2932818245 2932826008 346
552 iso_pu_bacteria 2932828146 2932829435 346
553 iso_pu_bacteria 2933577622 2933584520 346
554 iso_pu_bacteria 2935608549 2935615133 346
555 iso_pu_bacteria 2935616580 2935617867 346
556 iso_pu_bacteria 2935638405 2935647840 346
557 iso_pu_bacteria 2935648319 2935651509 346
558 iso_pu_bacteria 2935656913 2935659723 346
559 iso_pu_bacteria 2935665750 2935674747 346
560 iso_pu_bacteria 2935675223 2935678109 346
561 iso_pu_bacteria 2935684952 2935692397 346
562 iso_pu_bacteria 2935694250 2935702892 346
563 iso_pu_bacteria 2935703347 2935707116 346
564 iso_pu_bacteria 2935713505 2935721015 346
565 iso_pu_bacteria 2935722832 2935722840 346
566 iso_pu_bacteria 2935732158 2935739704 346
567 iso_pu_bacteria 2935741537 2935748742 346
568 iso_pu_bacteria 2935750917 2935758612 346
569 iso_pu_bacteria 2935760218 2935764592 346
570 iso_pu_bacteria 2935769743 2935775487 346
571 iso_pu_bacteria 2935777560 2935779734 346
572 iso_pu_bacteria 2935785616 2935789983 346
573 iso_pu_bacteria 2935793552 2935798412 346
574 iso_pu_bacteria 2935801545 2935806641 346
575 iso_pu_bacteria 2935810662 2935819098 346
576 iso_pu_bacteria 2935819856 2935825829 346
577 iso_pu_bacteria 2935827899 2935837324 346
578 iso_pu_bacteria 2935837841 2935841989 346
579 iso_pu_bacteria 2935847175 2935851448 346
580 iso_pu_bacteria 2935855204 2935856634 346
581 iso_pu_bacteria 2935864058 2935872922 346
582 iso_pu_bacteria 2935873716 2935874401 346
583 iso_pu_bacteria 2935883170 2935883465 346
584 iso_pu_bacteria 2935908558 2935910525 346
585 iso_pu_bacteria 2935916978 2935918071 346
586 iso_pu_bacteria 2935926038 2935927564 346
587 iso_pu_bacteria 2935934488 2935936564 346
588 iso_pu_bacteria 2935942939 2935943883 346
589 iso_pu_bacteria 2935951376 2935952320 346
590 iso_pu_bacteria 2935959822 2935964394 346
591 iso_pu_bacteria 2935967501 2935969160 346
592 iso_pu_bacteria 2935975950 2935978423 346
593 iso_pu_bacteria 2935984226 2935984611 346
594 iso_pu_bacteria 2935992306 2936001115 346
595 iso_pu_bacteria 2936002035 2936010769 346
596 iso_pu_bacteria 2936011229 2936014139 346
597 iso_pu_bacteria 2936019824 2936022952 346
598 iso_pu_bacteria 2936028420 2936031088 346
599 iso_pu_bacteria 2936037263 2936045751 346
600 iso_pu_bacteria 2936046547 2936049210 346
601 iso_pu_bacteria 2936055302 2936055656 346
602 iso_pu_bacteria 2940556831 2940564798 346
603 iso_pu_bacteria 2941531003 2941535882 346
604 iso_pu_bacteria 2941538514 2941547040 346
605 iso_pu_bacteria 3005483717 3005490517 346
606 iso_pu_bacteria 3005506211 3005509694 346
607 iso_pu_bacteria 3005587118 3005588893 346
608 iso_pu_bacteria 3005594810 3005595608 346
609 iso_pu_bacteria 3005710791 3005711599 346
610 iso_pu_bacteria 3005718088 3005718854 346
611 iso_pu_bacteria 8006926726 8006930821 346
612 iso_pu_bacteria 8016511872 8016518801 346
613 iso_pu_bacteria 8016583857 8016587072 346
614 iso_pu_bacteria 8016595262 8016596181 346
615 iso_pu_bacteria 8016622563 8016622569 346
616 iso_pu_bacteria 8016630954 8016636490 346
617 iso_pu_bacteria 8019538911 8019541066 346
618 iso_pu_bacteria 8019576017 8019577848 346
619 iso_pu_bacteria 8019586578 8019595949 346
620 iso_pu_bacteria 8019597564 8019605807 346
621 iso_pu_bacteria 8019608314 8019612727 346
622 iso_pu_bacteria 8019619141 8019622184 346
623 iso_pu_bacteria 8019629233 8019631130 346
624 iso_pu_bacteria 8019659431 8019667935 346
625 iso_pu_bacteria 8019668869 8019677353 346
626 iso_pu_bacteria 8019687851 8019696880 346
627 iso_pu_bacteria 8055742211 8055750851 346
628 iso_pu_bacteria 8056967851 8056970677 346
629 3300005344 Ga0070661_100105407 Ga0070661_1001054071 347
630 3300005539 Ga0068853_100082005 Ga0068853_1000820052 347
631 3300005843 Ga0068860_100002293 Ga0068860_1000022935 347
632 3300005983 Ga0081540_1046396 Ga0081540_10463962 347
633 3300006914 Ga0075436_100007805 Ga0075436_1000078055 347
634 3300007076 Ga0075435_100202135 Ga0075435_1002021352 347
635 3300025914 Ga0207671_10200364 Ga0207671_102003641 347
636 3300025925 Ga0207650_10325946 Ga0207650_103259461 347
637 3300026041 Ga0207639_10454683 Ga0207639_104546831 347
638 3300026067 Ga0207678_10178676 Ga0207678_101786761 347
639 3300026088 Ga0207641_10111703 Ga0207641_101117032 347
640 3300028381 Ga0268264_10000187 Ga0268264_1000018745 347
641 3300031247 Ga0265340_10067015 Ga0265340_100670152 347
642 3300031507 Ga0307509_10197471 Ga0307509_101974712 347
643 3300031507 Ga0307509_10257676 Ga0307509_102576762 347
644 3300031616 Ga0307508_10106984 Ga0307508_101069842 347
645 3300031730 Ga0307516_10170369 Ga0307516_101703692 347
646 3300031824 Ga0307413_10210324 Ga0307413_102103242 347
647 3300033179 Ga0307507_10006502 Ga0307507_100065024 347
648 3300035692 Ga0373935_0172785 Ga0373935_0172785_362_1432 347
649 3300035695 Ga0373927_0007175 Ga0373927_0007175_6476_7546 347
650 3300046475 Ga0495639_0061591 Ga0495639_0061591_251_1300 347
651 3300046664 Ga0495659_0032352 Ga0495659_0032352_463_1512 347
652 3300046674 Ga0495588_0007149 Ga0495588_0007149_1878_2927 347
653 3300047317 Ga0495604_0072107 Ga0495604_0072107_304_1347 347
654 3300048909 Ga0496106_0002313 Ga0496106_0002313_322_1392 347
655 3300048920 Ga0496117_0021787 Ga0496117_0021787_587_1657 347
656 3300048921 Ga0496118_0002489 Ga0496118_0002489_10098_11168 347
657 3300048922 Ga0496119_0025270 Ga0496119_0025270_1133_2230 347
658 3300048924 Ga0496121_0000144 Ga0496121_0000144_20262_21332 347
659 3300048924 Ga0496121_0004310 Ga0496121_0004310_11473_12570 347
660 3300048927 Ga0496124_0003743 Ga0496124_0003743_4670_5740 347
661 3300048928 Ga0496125_0020399 Ga0496125_0020399_1187_2257 347
662 3300048929 Ga0496126_0041278 Ga0496126_0041278_1346_2416 347
663 3300049569 Ga0501032_0268106 Ga0501032_0268106_13_1059 347
664 3300049571 Ga0501034_0081524 Ga0501034_0081524_1933_2979 347
665 3300049573 Ga0501037_0221101 Ga0501037_0221101_98_1144 347
666 3300049574 Ga0501038_0004864 Ga0501038_0004864_6042_7088 347
667 3300049581 Ga0501047_0229694 Ga0501047_0229694_316_1362 347
668 3300049586 Ga0501070_0082792 Ga0501070_0082792_184_1230 347
669 3300049589 Ga0501073_0125793 Ga0501073_0125793_379_1425 347
670 3300049823 Ga0501044_0022496 Ga0501044_0022496_2974_4020 347
671 3300050512 nmdc:mga0n895_70614_c1 nmdc:mga0n895_70614_c1_295_1341 347
672 3300050513 nmdc:mga0rr50_238337_c1 nmdc:mga0rr50_238337_c1_372_1418 347
673 3300050514 nmdc:mga08x19_3956_c1 nmdc:mga08x19_3956_c1_7361_8464 347
674 3300053119 Ga0500595_004064 Ga0500595_004064_1708_2805 347
675 3300053136 Ga0500559_0006019 Ga0500559_0006019_4206_5276 347
676 3300053147 Ga0500589_120445 Ga0500589_120445_49_1098 347
677 3300053151 Ga0500604_0037226 Ga0500604_0037226_193_1404 347
678 3300053177 Ga0500636_0095485 Ga0500636_0095485_218_1288 347
679 iso_pu_bacteria 2508501128 2509149907 347
680 3300005334 Ga0068869_100012775 Ga0068869_1000127752 348
681 3300005338 Ga0068868_100033616 Ga0068868_1000336163 348
682 3300005353 Ga0070669_100184879 Ga0070669_1001848792 348
683 3300005455 Ga0070663_100037052 Ga0070663_1000370522 348
684 3300005530 Ga0070679_100070108 Ga0070679_1000701082 348
685 3300005548 Ga0070665_100026270 Ga0070665_1000262702 348
686 3300005834 Ga0068851_10144390 Ga0068851_101443901 348
687 3300005842 Ga0068858_100241544 Ga0068858_1002415442 348
688 3300005844 Ga0068862_100069003 Ga0068862_1000690032 348
689 3300005981 Ga0081538_10024227 Ga0081538_100242272 348
690 3300005983 Ga0081540_1008166 Ga0081540_10081663 348
691 3300006195 Ga0075366_10058775 Ga0075366_100587752 348
692 3300006358 Ga0068871_100020428 Ga0068871_1000204282 348
693 3300009098 Ga0105245_10113486 Ga0105245_101134861 348
694 3300009147 Ga0114129_10635750 Ga0114129_106357501 348
695 3300009551 Ga0105238_10243468 Ga0105238_102434681 348
696 3300014325 Ga0163163_10266422 Ga0163163_102664222 348
697 3300025297 Ga0209758_1025551 Ga0209758_10255512 348
698 3300025899 Ga0207642_10016138 Ga0207642_100161382 348
699 3300025914 Ga0207671_10079450 Ga0207671_100794502 348
700 3300025919 Ga0207657_10018608 Ga0207657_100186082 348
701 3300025927 Ga0207687_10017762 Ga0207687_100177622 348
702 3300025932 Ga0207690_10040950 Ga0207690_100409502 348
703 3300025942 Ga0207689_10078436 Ga0207689_100784362 348
704 3300025942 Ga0207689_10117316 Ga0207689_101173162 348
705 3300025945 Ga0207679_10186638 Ga0207679_101866381 348
706 3300026035 Ga0207703_10011565 Ga0207703_100115655 348
707 3300026035 Ga0207703_10200289 Ga0207703_102002891 348
708 3300026075 Ga0207708_10098589 Ga0207708_100985892 348
709 3300026121 Ga0207683_10040371 Ga0207683_100403712 348
710 3300026121 Ga0207683_10077702 Ga0207683_100777022 348
711 3300031616 Ga0307508_10000613 Ga0307508_1000061338 348
712 3300032126 Ga0307415_100038694 Ga0307415_1000386941 348
713 3300035695 Ga0373927_0010394 Ga0373927_0010394_3965_5017 348
714 3300037068 Ga0373925_0019170 Ga0373925_0019170_2346_3398 348
715 3300046543 Ga0495645_0161988 Ga0495645_0161988_385_1437 348
716 3300048905 Ga0496102_0179781 Ga0496102_0179781_734_1795 348
717 3300048908 Ga0496105_0042265 Ga0496105_0042265_425_1486 348
718 3300048909 Ga0496106_0058681 Ga0496106_0058681_275_1336 348
719 3300048910 Ga0496107_0155255 Ga0496107_0155255_61_1122 348
720 3300049568 Ga0501031_0112381 Ga0501031_0112381_445_1509 348
721 3300049575 Ga0501039_0256770 Ga0501039_0256770_259_1311 348
722 3300049583 Ga0501067_0031242 Ga0501067_0031242_834_1886 348
723 3300049823 Ga0501044_0019452 Ga0501044_0019452_4360_5412 348
724 3300050489 nmdc:mga03683_60136_c1 nmdc:mga03683_60136_c1_324_1538 348
725 3300050507 nmdc:mga05p37_114736_c1 nmdc:mga05p37_114736_c1_1603_2655 348
726 3300053086 Ga0500578_0051641 Ga0500578_0051641_450_1550 348
727 3300053092 Ga0500583_0033457 Ga0500583_0033457_953_2005 348
728 3300053130 Ga0500642_0087462 Ga0500642_0087462_46_1146 348
729 3300053146 Ga0500588_0035840 Ga0500588_0035840_333_1433 348
730 3300053730 Ga0500645_008956 Ga0500645_008956_1626_2840 348
731 iso_pu_bacteria 8056689827 8056694093 348
732 3300005439 Ga0070711_100019339 Ga0070711_1000193392 349
733 3300005937 Ga0081455_10009590 Ga0081455_100095903 349
734 3300005983 Ga0081540_1002390 Ga0081540_10023904 349
735 3300005983 Ga0081540_1015853 Ga0081540_10158533 349
736 3300005983 Ga0081540_1017401 Ga0081540_10174012 349
737 3300005985 Ga0081539_10002152 Ga0081539_1000215214 349
738 3300021384 Ga0213876_10004532 Ga0213876_100045325 349
739 3300031616 Ga0307508_10053567 Ga0307508_100535673 349
740 3300039437 Ga0436365_1272636 Ga0436365_1272636_1024_2082 349
741 3300046455 Ga0495603_0098736 Ga0495603_0098736_273_1331 349
742 3300046536 Ga0495587_0133702 Ga0495587_0133702_31_1116 349
743 3300046809 Ga0495600_0040334 Ga0495600_0040334_311_1432 349
744 3300048925 Ga0496122_0022588 Ga0496122_0022588_2176_3240 349
745 3300048929 Ga0496126_0009944 Ga0496126_0009944_2926_3990 349
746 3300053153 Ga0500616_0000038 Ga0500616_0000038_229545_230603 349
747 iso_pu_bacteria 2513237096 2513658985 349
748 iso_pu_bacteria 2513237137 2513862914 349
749 iso_pu_bacteria 2513237145 2513921249 349
750 iso_pu_bacteria 2517572143 2517889324 349
751 iso_pu_bacteria 2524023228 2524540372 349
752 iso_pu_bacteria 2667528175 2671121393 349
753 iso_pu_bacteria 2728368998 2728755381 349
754 iso_pu_bacteria 2904690495 2904692478 349
755 iso_pu_bacteria 2906610324 2906613199 349
756 iso_pu_bacteria 2906635258 2906635513 349
757 iso_pu_bacteria 2906660503 2906668644 349
758 iso_pu_bacteria 2908756301 2908764368 349
759 iso_pu_bacteria 2922425934 2922433697 349
760 iso_pu_bacteria 2935630451 2935634743 349
761 iso_pu_bacteria 2941507105 2941511927 349
762 iso_pu_bacteria 2941515067 2941519629 349
763 iso_pu_bacteria 2941523033 2941527679 349
764 iso_pu_bacteria 3005474847 3005483350 349
765 iso_pu_bacteria 8006933436 8006935733 349
766 iso_pu_bacteria 8006973647 8006975652 349
767 iso_pu_bacteria 8019555841 8019563061 349
768 iso_pu_bacteria 8019565922 8019573144 349
769 3300003215 JGI25153J46596_10002562 JGI25153J46596_100025622 350
770 3300003354 JGI25160J50197_1027344 JGI25160J50197_10273441 350
771 3300003752 Ga0055539_1002104 Ga0055539_10021043 350
772 3300003794 Ga0055531_10005750 Ga0055531_100057503 350
773 3300004625 Ga0055543_1002854 Ga0055543_10028541 350
774 3300005262 Ga0065165_1001543 Ga0065165_100154321 350
775 3300005262 Ga0065165_1006649 Ga0065165_10066494 350
776 3300005262 Ga0065165_1007651 Ga0065165_10076512 350
777 3300005262 Ga0065165_1041813 Ga0065165_10418131 350
778 3300005327 Ga0070658_10125207 Ga0070658_101252072 350
779 3300005347 Ga0070668_100106944 Ga0070668_1001069441 350
780 3300005353 Ga0070669_100168450 Ga0070669_1001684502 350
781 3300005457 Ga0070662_100169078 Ga0070662_1001690781 350
782 3300005616 Ga0068852_100279286 Ga0068852_1002792861 350
783 3300006038 Ga0075365_10036594 Ga0075365_100365942 350
784 3300006038 Ga0075365_10080375 Ga0075365_100803753 350
785 3300006038 Ga0075365_10196846 Ga0075365_101968462 350
786 3300006042 Ga0075368_10054432 Ga0075368_100544322 350
787 3300006175 Ga0070712_100231797 Ga0070712_1002317971 350
788 3300006177 Ga0075362_10030289 Ga0075362_100302892 350
789 3300006178 Ga0075367_10054294 Ga0075367_100542943 350
790 3300006195 Ga0075366_10141581 Ga0075366_101415811 350
791 3300006353 Ga0075370_10134378 Ga0075370_101343782 350
792 3300009176 Ga0105242_10140477 Ga0105242_101404772 350
793 3300009177 Ga0105248_10290037 Ga0105248_102900372 350
794 3300014325 Ga0163163_10180779 Ga0163163_101807792 350
795 3300025253 Ga0209677_100338 Ga0209677_10033812 350
796 3300025261 Ga0209233_1001495 Ga0209233_10014957 350
797 3300025261 Ga0209233_1002702 Ga0209233_10027024 350
798 3300025261 Ga0209233_1003005 Ga0209233_10030052 350
799 3300025295 Ga0209564_1002401 Ga0209564_100240113 350
800 3300025297 Ga0209758_1000015 Ga0209758_1000015319 350
801 3300025297 Ga0209758_1001439 Ga0209758_100143913 350
802 3300025299 Ga0209256_1012677 Ga0209256_10126773 350
803 3300025299 Ga0209256_1033976 Ga0209256_10339761 350
804 3300025302 Ga0207426_1001551 Ga0207426_10015512 350
805 3300025302 Ga0207426_1014202 Ga0207426_10142022 350
806 3300025302 Ga0207426_1017734 Ga0207426_10177341 350
807 3300025304 Ga0209257_1000983 Ga0209257_100098327 350
808 3300025304 Ga0209257_1013500 Ga0209257_10135002 350
809 3300025304 Ga0209257_1027371 Ga0209257_10273712 350
810 3300025904 Ga0207647_10014320 Ga0207647_100143202 350
811 3300025914 Ga0207671_10153300 Ga0207671_101533002 350
812 3300025915 Ga0207693_10238579 Ga0207693_102385792 350
813 3300025934 Ga0207686_10193846 Ga0207686_101938461 350
814 3300026067 Ga0207678_10154313 Ga0207678_101543132 350
815 3300026067 Ga0207678_10245789 Ga0207678_102457891 350
816 3300031249 Ga0265339_10001158 Ga0265339_100011587 350
817 3300033180 Ga0307510_10005570 Ga0307510_100055704 350
818 3300037853 Ga0436364_0716895 Ga0436364_0716895_100_1161 350
819 3300044658 Ga0466972_0018721 Ga0466972_0018721_2075_3142 350
820 3300044684 Ga0466966_0013783 Ga0466966_0013783_2489_3547 350
821 3300044693 Ga0466961_0001950 Ga0466961_0001950_1106_2176 350
822 3300045049 Ga0466959_0027416 Ga0466959_0027416_347_1417 350
823 3300046457 Ga0495590_0043476 Ga0495590_0043476_296_1360 350
824 3300046501 Ga0495607_0031784 Ga0495607_0031784_504_1568 350
825 3300046507 Ga0495606_0109856 Ga0495606_0109856_99_1163 350
826 3300046513 Ga0495616_0085737 Ga0495616_0085737_280_1344 350
827 3300046518 Ga0495631_0041240 Ga0495631_0041240_417_1481 350
828 3300046522 Ga0495643_0071976 Ga0495643_0071976_649_1716 350
829 3300046524 Ga0495648_0005379 Ga0495648_0005379_4487_5569 350
830 3300046524 Ga0495648_0048824 Ga0495648_0048824_1314_2378 350
831 3300046524 Ga0495648_0161246 Ga0495648_0161246_64_1131 350
832 3300046530 Ga0495654_0020401 Ga0495654_0020401_1787_2851 350
833 3300046538 Ga0495609_0072592 Ga0495609_0072592_259_1326 350
834 3300046542 Ga0495597_0095283 Ga0495597_0095283_147_1211 350
835 3300046616 Ga0495668_0105270 Ga0495668_0105270_320_1387 350
836 3300046660 Ga0495625_0090138 Ga0495625_0090138_342_1406 350
837 3300046665 Ga0495661_0045231 Ga0495661_0045231_1533_2597 350
838 3300046674 Ga0495588_0091896 Ga0495588_0091896_278_1342 350
839 3300046691 Ga0495670_0003885 Ga0495670_0003885_1491_2555 350
840 3300046810 Ga0495660_0027364 Ga0495660_0027364_1757_2821 350
841 3300047317 Ga0495604_0074633 Ga0495604_0074633_1176_2243 350
842 3300047472 Ga0495686_0036398 Ga0495686_0036398_673_1737 350
843 3300048911 Ga0496108_0368993 Ga0496108_0368993_99_1166 350
844 3300048916 Ga0496113_0070936 Ga0496113_0070936_101_1186 350
845 3300048921 Ga0496118_0025329 Ga0496118_0025329_2405_3466 350
846 3300048921 Ga0496118_0103304 Ga0496118_0103304_805_1869 350
847 3300048922 Ga0496119_0040867 Ga0496119_0040867_367_1431 350
848 3300048923 Ga0496120_0103401 Ga0496120_0103401_110_1174 350
849 3300048924 Ga0496121_0003740 Ga0496121_0003740_17353_18417 350
850 3300048928 Ga0496125_0025285 Ga0496125_0025285_2811_3875 350
851 3300048928 Ga0496125_0028888 Ga0496125_0028888_903_1967 350
852 3300048928 Ga0496125_0175258 Ga0496125_0175258_313_1380 350
853 3300048929 Ga0496126_0099966 Ga0496126_0099966_239_1303 350
854 3300049570 Ga0501033_0052525 Ga0501033_0052525_1669_2730 350
855 3300049571 Ga0501034_0180912 Ga0501034_0180912_597_1658 350
856 3300049574 Ga0501038_0132055 Ga0501038_0132055_27_1088 350
857 3300049582 Ga0501048_0144277 Ga0501048_0144277_477_1538 350
858 3300049822 Ga0501035_0033865 Ga0501035_0033865_1071_2132 350
859 3300050491 nmdc:mga00v17_79738_c1 nmdc:mga00v17_79738_c1_61_1128 350
860 3300050491 nmdc:mga00v17_99774_c1 nmdc:mga00v17_99774_c1_394_1461 350
861 3300050492 nmdc:mga0yw44_11667_c1 nmdc:mga0yw44_11667_c1_2336_3400 350
862 3300050492 nmdc:mga0yw44_23615_c1 nmdc:mga0yw44_23615_c1_2136_3200 350
863 3300050494 nmdc:mga06z11_130458_c1 nmdc:mga06z11_130458_c1_145_1209 350
864 3300050494 nmdc:mga06z11_98691_c1 nmdc:mga06z11_98691_c1_313_1380 350
865 3300050516 nmdc:mga0sz30_64190_c1 nmdc:mga0sz30_64190_c1_212_1279 350
866 3300053087 Ga0500643_000079 Ga0500643_000079_1240_2307 350
867 3300053087 Ga0500643_010505 Ga0500643_010505_1439_2503 350
868 3300053093 Ga0500651_0016501 Ga0500651_0016501_3347_4411 350
869 3300053094 Ga0500566_0000509 Ga0500566_0000509_7614_8681 350
870 3300053096 Ga0500641_0018835 Ga0500641_0018835_1003_2067 350
871 3300053103 Ga0500555_015543 Ga0500555_015543_560_1627 350
872 3300053104 Ga0500556_0000005 Ga0500556_0000005_541399_542463 350
873 3300053109 Ga0500569_015625 Ga0500569_015625_538_1605 350
874 3300053116 Ga0500592_007166 Ga0500592_007166_375_1439 350
875 3300053130 Ga0500642_0000009 Ga0500642_0000009_13531_14595 350
876 3300053131 Ga0500652_002026 Ga0500652_002026_3220_4284 350
877 3300053134 Ga0500658_0086823 Ga0500658_0086823_166_1230 350
878 3300053136 Ga0500559_0000723 Ga0500559_0000723_2591_3655 350
879 3300053142 Ga0500577_0000569 Ga0500577_0000569_3333_4397 350
880 3300053142 Ga0500577_0024549 Ga0500577_0024549_243_1307 350
881 3300053153 Ga0500616_0000035 Ga0500616_0000035_93589_94653 350
882 3300053158 Ga0500627_0063839 Ga0500627_0063839_40_1107 350
883 3300053736 Ga0500599_001543 Ga0500599_001543_1106_2173 350
884 iso_pu_bacteria 2513237139 2513875673 350
885 iso_pu_bacteria 2802429603 2805919349 350
886 iso_pu_bacteria 8016522445 8016525646 350
887 iso_pu_bacteria 8016539877 8016543530 350
888 iso_pu_bacteria 8016548790 8016549763 350
889 iso_pu_bacteria 8016566248 8016568931 350
890 iso_pu_bacteria 8016575299 8016581579 350
891 iso_pu_bacteria 8016613128 8016618979 350
892 iso_pu_bacteria 8019530166 8019530516 350
893 3300005563 Ga0068855_100389103 Ga0068855_1003891032 351
894 3300031616 Ga0307508_10041880 Ga0307508_100418803 351
895 3300037466 Ga0395898_0017075 Ga0395898_0017075_4167_5234 351
896 3300005983 Ga0081540_1010619 Ga0081540_10106191 352
897 3300025915 Ga0207693_10203955 Ga0207693_102039551 352
898 3300048929 Ga0496126_0134009 Ga0496126_0134009_329_1393 352
899 3300053104 Ga0500556_0000017 Ga0500556_0000017_177255_178439 352
900 3300053730 Ga0500645_015588 Ga0500645_015588_970_2154 352
901 3300005983 Ga0081540_1033754 Ga0081540_10337542 353
902 3300006942 Ga0099824_1001145 Ga0099824_100114535 353
903 3300006943 Ga0099822_1000135 Ga0099822_100013535 353
904 3300026121 Ga0207683_10086902 Ga0207683_100869022 353
905 3300027361 Ga0209489_100018 Ga0209489_100018127 353
906 3300027363 Ga0209700_100028 Ga0209700_100028127 353
907 3300031344 Ga0265316_10069595 Ga0265316_100695952 353
908 3300031344 Ga0265316_10121355 Ga0265316_101213552 353
909 3300033442 Ga0315911_1000033 Ga0315911_100003342 353
910 3300035086 Ga0373934_0001371 Ga0373934_0001371_1122_2189 353
911 3300035111 Ga0373923_0016525 Ga0373923_0016525_474_1541 353
912 3300035117 Ga0373953_0004018 Ga0373953_0004018_3278_4345 353
913 3300035118 Ga0373954_0039736 Ga0373954_0039736_931_1998 353
914 3300035120 Ga0373957_0005528 Ga0373957_0005528_2221_3288 353
915 3300035172 Ga0373955_0001137 Ga0373955_0001137_9903_10970 353
916 3300035410 Ga0373924_0009678 Ga0373924_0009678_913_1980 353
917 3300035724 Ga0373933_0002154 Ga0373933_0002154_7601_8668 353
918 3300036401 Ga0373937_0014047 Ga0373937_0014047_302_1369 353
919 3300037471 Ga0395905_0039470 Ga0395905_0039470_1415_2482 353
920 3300046454 Ga0495592_0020082 Ga0495592_0020082_2398_3465 353
921 3300046459 Ga0495629_0004779 Ga0495629_0004779_4616_5683 353
922 3300046462 Ga0495651_0010838 Ga0495651_0010838_5853_6920 353
923 3300046462 Ga0495651_0016408 Ga0495651_0016408_332_1399 353
924 3300046463 Ga0495653_0034560 Ga0495653_0034560_552_1619 353
925 3300046511 Ga0495608_0003227 Ga0495608_0003227_4722_5789 353
926 3300046516 Ga0495628_0033112 Ga0495628_0033112_2940_4007 353
927 3300046533 Ga0495640_0027733 Ga0495640_0027733_1276_2343 353
928 3300046536 Ga0495587_0013963 Ga0495587_0013963_2739_3806 353
929 3300046543 Ga0495645_0008551 Ga0495645_0008551_5847_6914 353
930 3300046559 Ga0495667_0056717 Ga0495667_0056717_494_1561 353
931 3300046663 Ga0495635_0000220 Ga0495635_0000220_34097_35164 353
932 3300046678 Ga0495599_0001306 Ga0495599_0001306_12253_13320 353
933 3300046679 Ga0495623_0040331 Ga0495623_0040331_1366_2433 353
934 3300046679 Ga0495623_0139293 Ga0495623_0139293_235_1302 353
935 3300046680 Ga0495646_0016383 Ga0495646_0016383_1512_2579 353
936 3300046809 Ga0495600_0021771 Ga0495600_0021771_305_1372 353
937 3300047317 Ga0495604_0028647 Ga0495604_0028647_754_1821 353
938 3300047319 Ga0495674_0006640 Ga0495674_0006640_4388_5455 353
939 3300047322 Ga0495680_0026130 Ga0495680_0026130_90_1157 353
940 3300047444 Ga0495675_0006969 Ga0495675_0006969_3284_4351 353
941 3300047471 Ga0495684_0000133 Ga0495684_0000133_19801_20868 353
942 3300047673 Ga0495593_0000108 Ga0495593_0000108_10823_11890 353
943 3300048088 Ga0495602_0023495 Ga0495602_0023495_295_1362 353
944 3300048918 Ga0496115_0113445 Ga0496115_0113445_874_1941 353
945 3300053077 Ga0495601_0011904 Ga0495601_0011904_1608_2675 353
946 3300053084 Ga0495595_0000419 Ga0495595_0000419_4802_5869 353
947 3300053085 Ga0495619_0001836 Ga0495619_0001836_1227_2294 353
948 3300005329 Ga0070683_100146710 Ga0070683_1001467101 354
949 3300005530 Ga0070679_100052438 Ga0070679_1000524382 354
950 3300005535 Ga0070684_100014375 Ga0070684_1000143752 354
951 3300025913 Ga0207695_10295764 Ga0207695_102957641 354
952 3300025944 Ga0207661_10001882 Ga0207661_1000188211 354
953 3300036401 Ga0373937_0055609 Ga0373937_0055609_344_1429 354
954 3300046683 Ga0495658_0000366 Ga0495658_0000366_13804_14889 354
955 3300046809 Ga0495600_0016918 Ga0495600_0016918_2078_3163 354
956 3300001979 JGI24740J21852_10008712 JGI24740J21852_100087122 355
957 3300002067 JGI24735J21928_10009585 JGI24735J21928_100095851 355
958 3300005455 Ga0070663_100083563 Ga0070663_1000835632 355
959 3300005539 Ga0068853_100015356 Ga0068853_1000153561 355
960 3300005539 Ga0068853_100051620 Ga0068853_1000516202 355
961 3300005563 Ga0068855_100024730 Ga0068855_1000247304 355
962 3300005563 Ga0068855_100078376 Ga0068855_1000783762 355
963 3300005577 Ga0068857_100008796 Ga0068857_1000087966 355
964 3300005577 Ga0068857_100015818 Ga0068857_1000158182 355
965 3300005578 Ga0068854_100005353 Ga0068854_1000053533 355
966 3300005614 Ga0068856_100008062 Ga0068856_1000080625 355
967 3300005614 Ga0068856_100014980 Ga0068856_1000149805 355
968 3300005616 Ga0068852_100021412 Ga0068852_1000214122 355
969 3300005834 Ga0068851_10002011 Ga0068851_100020115 355
970 3300013297 Ga0157378_10019120 Ga0157378_100191202 355
971 3300013306 Ga0163162_10023410 Ga0163162_100234102 355
972 3300013308 Ga0157375_10053209 Ga0157375_100532092 355
973 3300014969 Ga0157376_10070725 Ga0157376_100707252 355
974 3300025321 Ga0207656_10001869 Ga0207656_100018692 355
975 3300025904 Ga0207647_10039544 Ga0207647_100395442 355
976 3300025911 Ga0207654_10000611 Ga0207654_100006116 355
977 3300025913 Ga0207695_10002336 Ga0207695_1000233614 355
978 3300025914 Ga0207671_10020119 Ga0207671_100201193 355
979 3300025924 Ga0207694_10004635 Ga0207694_100046357 355
980 3300025933 Ga0207706_10231402 Ga0207706_102314022 355
981 3300025935 Ga0207709_10176522 Ga0207709_101765221 355
982 3300025949 Ga0207667_10030615 Ga0207667_100306152 355
983 3300025949 Ga0207667_10057824 Ga0207667_100578242 355
984 3300025981 Ga0207640_10007270 Ga0207640_100072704 355
985 3300025981 Ga0207640_10013948 Ga0207640_100139482 355
986 3300026041 Ga0207639_10023132 Ga0207639_100231322 355
987 3300026067 Ga0207678_10105683 Ga0207678_101056832 355
988 3300026078 Ga0207702_10000122 Ga0207702_1000012237 355
989 3300026078 Ga0207702_10037901 Ga0207702_100379012 355
990 3300026116 Ga0207674_10005252 Ga0207674_100052525 355
991 3300026116 Ga0207674_10012191 Ga0207674_100121913 355
992 3300026121 Ga0207683_10049862 Ga0207683_100498621 355
993 3300026142 Ga0207698_10119646 Ga0207698_101196462 355
994 3300031616 Ga0307508_10034912 Ga0307508_100349122 355
995 3300048904 Ga0496101_0004227 Ga0496101_0004227_1904_2989 355
996 3300048905 Ga0496102_0012581 Ga0496102_0012581_970_2055 355
997 3300048906 Ga0496103_0010963 Ga0496103_0010963_2032_3117 355
998 3300048908 Ga0496105_0018947 Ga0496105_0018947_2127_3212 355
999 3300048911 Ga0496108_0044295 Ga0496108_0044295_582_1667 355
1000 3300048913 Ga0496110_0120346 Ga0496110_0120346_1085_2158 355
1001 3300048913 Ga0496110_0147709 Ga0496110_0147709_529_1614 355
1002 3300048917 Ga0496114_0049691 Ga0496114_0049691_1074_2147 355
1003 3300048917 Ga0496114_0090029 Ga0496114_0090029_828_1913 355
1004 3300048918 Ga0496115_0001756 Ga0496115_0001756_12835_13920 355
1005 3300053119 Ga0500595_002736 Ga0500595_002736_4531_5619 355
1006 3300053162 Ga0500638_034065 Ga0500638_034065_1302_2390 355
1007 3300055283 Ga0500661_007935 Ga0500661_007935_273_1361 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01757

Acyl_transf_3

Acyltransferase family

60

366

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ob6-assembly2.cif.gz_B human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.2578 27 288
6btm-assembly1.cif.gz_F structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.2564 22 274
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.2508 21 331
7lo7-assembly1.cif.gz_Z nora in complex with fab25 0.2501 23 335
6fmr-assembly1.cif.gz_A imisx-ep of se-peptst 0.2374 15 333
ID Description Score Start End Superfamily
af_Q54E68_44_188_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3832 196 302 1.20.1250.20
af_E7F1E5_45_195_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3428 198 339 1.20.1070.10
af_E7F1E5_45_195_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3213 198 339 1.20.1070.10
af_A0A1D6PCH9_40_269_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.3062 128 337 1.50.40.10
af_Q54E68_44_188_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3012 196 302 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A089NXR0-F1-model_v4 Acyltransferase 0.9773 22 350 GO:0005886
GO:0009246
GO:0016413
AF-A0A2A4P7E2-F1-model_v4 Acyltransferase 0.9742 15 347 GO:0005886
GO:0009246
GO:0016413
AF-A0A1H6H986-F1-model_v4 Uncharacterized membrane protein YcfT 0.9688 22 342 GO:0005886
GO:0009246
GO:0016413
AF-A0A1I4S872-F1-model_v4 Uncharacterized membrane protein YcfT 0.9658 22 349 GO:0005886
GO:0009246
GO:0016413
AF-A0A258L3X8-F1-model_v4 Acyltransferase 3 domain-containing protein 0.9637 22 355 GO:0005886
GO:0009246
GO:0016413

Feature Viewer

pLDDT pTM Quality
88.27 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map