F488062

General Info

Members Datasets Scaffolds Average Seq Length
1008 298 1007 631

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100004992|Ga0070707_1000049928
Length 679
Sequence MPWGRAAPAAPASRGSGRGRAHWPPERGFAPRPSHSLAHVSDFVWSPTDELRERANIARLMRRLGAQKYEELHAISVEEPERFWPEVIADLGLAFSQPWNRVLDTSRGIEWATWFVGGKLNLAQSCVHRWVDERGGDEAAVWQAEDGTRTALTWRELSDEVRRLAEGLASLGIGPGDAVGIFLPMSPQVAIASHAIAHLGAVQVPIFSGFAPPAISARLADAKAKALITADGSLRRGQVVPMKTIADEALERAPTVTHTVVWRRLGDDDVPMVIDRDRFWDELVDGASGDLESAQVDSEHPYLLAYTSGTTGRPKGALHVQGGFLVSIARETAYQSDVHPGDRVHFATDMGWIMGPWTVVGCGAVGATVIYTEGAPDFPDDRLWKLVESERVTMLGISPTLVRALIPKGDPTTDLSSLRTMTTTGEPWNRDPYLWLFEKVGGGRAPIVNISGGTEVGACFLSTCITEPVKPVALGFPALGQDMDVLGPDGSSVRGEVGELVCRRPWPGMTRGIWGNAERYLESYWRRFPGVWTHGDWASVDKDGYWFLHGRSDDTLNIAGKRIGPAELESAAVSHPSVAEAAAIGVPHDVKGEVALIFCVPKPGIDVSDQLADEVGVAVTDELGKAFKPDRVVFVSALPKTRSAKIVRRAVRARAIGADPGDLSALENPEVLDEISRVL

Samples

Sample ID Description Type Environment
1 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.3
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 9.52
Rhizosphere 90.08
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10010917 3300003203 Bacteria 4000
2 JGI25407J50210_10001197 3300003373 Bacteria 5780
3 Ga0070658_10021473 3300005327 Bacteria 5174
4 Ga0070683_100000386 3300005329 Bacteria 30508
5 Ga0070683_100004803 3300005329 Bacteria 11186
6 Ga0070683_100029922 3300005329 Bacteria 4938
7 Ga0070683_100034510 3300005329 Bacteria 4622
8 Ga0070683_100041044 3300005329 Bacteria 4255
9 Ga0070683_100050303 3300005329 Bacteria 3857
10 Ga0070670_100000812 3300005331 Bacteria 24328
11 Ga0070670_100017978 3300005331 Bacteria 6067
12 Ga0070666_10058430 3300005335 Bacteria 2608
13 Ga0070680_100007438 3300005336 Bacteria 8355
14 Ga0070680_100010865 3300005336 Bacteria 7034
15 Ga0070680_100088366 3300005336 Bacteria 2563
16 Ga0070682_100006396 3300005337 Bacteria 6614
17 Ga0068868_100003392 3300005338 Bacteria 11085
18 Ga0070660_100002458 3300005339 Bacteria 12706
19 Ga0070660_100004049 3300005339 Bacteria 10116
20 Ga0070660_100004634 3300005339 Bacteria 9521
21 Ga0070660_100005641 3300005339 Bacteria 8672
22 Ga0070660_100019362 3300005339 Bacteria 4986
23 Ga0070660_100045420 3300005339 Bacteria 3362
24 Ga0070689_100010798 3300005340 Bacteria 6525
25 Ga0070691_10013350 3300005341 Bacteria 3762
26 Ga0070691_10025959 3300005341 Bacteria 2729
27 Ga0070661_100015433 3300005344 Bacteria 5392
28 Ga0070661_100056056 3300005344 Bacteria 2886
29 Ga0070692_10003291 3300005345 Bacteria 6521
30 Ga0070692_10005008 3300005345 Bacteria 5596
31 Ga0070668_100055286 3300005347 Bacteria 3063
32 Ga0070671_100012207 3300005355 Bacteria 6912
33 Ga0070671_100067837 3300005355 Bacteria 2975
34 Ga0070674_100004968 3300005356 Bacteria 7622
35 Ga0070674_100018143 3300005356 Bacteria 4442
36 Ga0070673_100077886 3300005364 Bacteria 2680
37 Ga0070688_100002653 3300005365 Bacteria 9077
38 Ga0070688_100037856 3300005365 Bacteria 2942
39 Ga0070659_100043312 3300005366 Bacteria 3521
40 Ga0070703_10000001 3300005406 Bacteria 202194
41 Ga0070714_100026666 3300005435 Bacteria 4778
42 Ga0070714_100041527 3300005435 Bacteria 3882
43 Ga0070713_100037973 3300005436 Bacteria 3898
44 Ga0070713_100067357 3300005436 Bacteria 3014
45 Ga0070713_100099589 3300005436 Bacteria 2515
46 Ga0070710_10016280 3300005437 Bacteria 3780
47 Ga0070710_10023947 3300005437 Bacteria 3215
48 Ga0070711_100003234 3300005439 Bacteria 9455
49 Ga0070711_100004428 3300005439 Bacteria 8290
50 Ga0070711_100009319 3300005439 Bacteria 6042
51 Ga0070711_100016246 3300005439 Bacteria 4724
52 Ga0070700_100004326 3300005441 Bacteria 7411
53 Ga0070694_100000704 3300005444 Bacteria 18646
54 Ga0070694_100027400 3300005444 Bacteria 3700
55 Ga0070708_100002195 3300005445 Bacteria 15083
56 Ga0070708_100002794 3300005445 Bacteria 13556
57 Ga0070708_100003212 3300005445 Bacteria 12751
58 Ga0070708_100020586 3300005445 Bacteria 5566
59 Ga0070708_100048686 3300005445 Archaea 3748
60 Ga0070708_100071796 3300005445 Bacteria 3117
61 Ga0070663_100021872 3300005455 Bacteria 4263
62 Ga0070663_100051613 3300005455 Bacteria 2931
63 Ga0070678_100006896 3300005456 Bacteria 6699
64 Ga0070678_100049775 3300005456 Bacteria 3026
65 Ga0070662_100010040 3300005457 Bacteria 6203
66 Ga0070681_10033577 3300005458 Bacteria 5150
67 Ga0070681_10065077 3300005458 Bacteria 3615
68 Ga0070681_10179092 3300005458 Bacteria 2041
69 Ga0068867_100001828 3300005459 Bacteria 14831
70 Ga0070706_100003986 3300005467 Bacteria 14371
71 Ga0070706_100019230 3300005467 Bacteria 6301
72 Ga0070706_100061519 3300005467 Bacteria 3467
73 Ga0070706_100066422 3300005467 Bacteria 3336
74 Ga0070706_100114182 3300005467 Bacteria 2515
75 Ga0070707_100004992 3300005468 Bacteria 12429
76 Ga0070707_100007336 3300005468 Bacteria 10240
77 Ga0070707_100015833 3300005468 Bacteria 7080
78 Ga0070707_100040980 3300005468 Bacteria 4432
79 Ga0070698_100010086 3300005471 Bacteria 10090
80 Ga0070698_100014636 3300005471 Bacteria 8289
81 Ga0070698_100042116 3300005471 Bacteria 4684
82 Ga0070679_100007223 3300005530 Bacteria 10374
83 Ga0070679_100009394 3300005530 Bacteria 9249
84 Ga0070679_100023514 3300005530 Bacteria 6032
85 Ga0070679_100023700 3300005530 Bacteria 6013
86 Ga0070679_100024335 3300005530 Bacteria 5934
87 Ga0070679_100040175 3300005530 Bacteria 4654
88 Ga0070679_100069896 3300005530 Bacteria 3502
89 Ga0070684_100004541 3300005535 Bacteria 10574
90 Ga0070684_100018235 3300005535 Bacteria 5778
91 Ga0070684_100032630 3300005535 Bacteria 4439
92 Ga0070697_100030126 3300005536 Bacteria 4357
93 Ga0068853_100006599 3300005539 Bacteria 9240
94 Ga0070686_100000943 3300005544 Bacteria 16754
95 Ga0070686_100011217 3300005544 Bacteria 5077
96 Ga0070686_100061000 3300005544 Bacteria 2435
97 Ga0070695_100051818 3300005545 Bacteria 2635
98 Ga0070696_100005413 3300005546 Bacteria 8509
99 Ga0070693_100008411 3300005547 Bacteria 5087
100 Ga0070693_100018093 3300005547 Bacteria 3675
101 Ga0070665_100009747 3300005548 Bacteria 9712
102 Ga0070665_100016576 3300005548 Bacteria 7386
103 Ga0070665_100017883 3300005548 Bacteria 7117
104 Ga0070704_100055585 3300005549 Bacteria 2807
105 Ga0068855_100005058 3300005563 Bacteria 16092
106 Ga0068855_100009470 3300005563 Bacteria 11764
107 Ga0068855_100012319 3300005563 Bacteria 10331
108 Ga0068855_100030905 3300005563 Bacteria 6400
109 Ga0068855_100039047 3300005563 Bacteria 5637
110 Ga0068855_100107571 3300005563 Bacteria 3204
111 Ga0068855_100122806 3300005563 Bacteria 2971
112 Ga0070664_100003282 3300005564 Bacteria 13061
113 Ga0070664_100051834 3300005564 Bacteria 3475
114 Ga0068857_100118386 3300005577 Bacteria 2384
115 Ga0068857_100159342 3300005577 Bacteria 2047
116 Ga0068856_100099345 3300005614 Bacteria 2901
117 Ga0068864_100003608 3300005618 Bacteria 12794
118 Ga0068864_100101593 3300005618 Bacteria 2551
119 Ga0068866_10000474 3300005718 Bacteria 18425
120 Ga0068861_100004853 3300005719 Bacteria 9046
121 Ga0068861_100035750 3300005719 Bacteria 3682
122 Ga0068870_10000660 3300005840 Bacteria 13161
123 Ga0081455_10001632 3300005937 Bacteria 27349
124 Ga0081455_10003035 3300005937 Bacteria 19570
125 Ga0081455_10008204 3300005937 Bacteria 10889
126 Ga0081455_10016026 3300005937 Bacteria 7251
127 Ga0081455_10017541 3300005937 Bacteria 6858
128 Ga0081455_10028683 3300005937 Bacteria 5081
129 Ga0081455_10057998 3300005937 Bacteria 3279
130 Ga0081538_10000026 3300005981 Bacteria 126575
131 Ga0081538_10000144 3300005981 Bacteria 73787
132 Ga0081538_10003640 3300005981 Bacteria 14490
133 Ga0081538_10004394 3300005981 Bacteria 13016
134 Ga0081538_10004398 3300005981 Bacteria 13010
135 Ga0081538_10007781 3300005981 Bacteria 9206
136 Ga0081538_10012502 3300005981 Bacteria 6801
137 Ga0081540_1002674 3300005983 Bacteria 14506
138 Ga0081540_1007427 3300005983 Bacteria 7814
139 Ga0081540_1015487 3300005983 Bacteria 4827
140 Ga0081540_1044867 3300005983 Bacteria 2252
141 Ga0081539_10001238 3300005985 Bacteria 45456
142 Ga0081539_10001603 3300005985 Bacteria 37270
143 Ga0081539_10001695 3300005985 Bacteria 35543
144 Ga0081539_10001744 3300005985 Bacteria 34702
145 Ga0081539_10002467 3300005985 Bacteria 26041
146 Ga0070717_10009361 3300006028 Bacteria 7357
147 Ga0070717_10021733 3300006028 Bacteria 5060
148 Ga0070717_10023224 3300006028 Bacteria 4911
149 Ga0075365_10032436 3300006038 Bacteria 3357
150 Ga0075365_10053960 3300006038 Bacteria 2664
151 Ga0070715_10005573 3300006163 Bacteria 4209
152 Ga0070712_100020541 3300006175 Bacteria 4322
153 Ga0068871_100008129 3300006358 Bacteria 7532
154 Ga0075428_100009214 3300006844 Bacteria 10952
155 Ga0075428_100021634 3300006844 Bacteria 7120
156 Ga0075428_100031527 3300006844 Bacteria 5857
157 Ga0075428_100041218 3300006844 Bacteria 5078
158 Ga0075428_100042353 3300006844 Bacteria 5006
159 Ga0075428_100143897 3300006844 Bacteria 2591
160 Ga0075430_100000145 3300006846 Bacteria 45323
161 Ga0075430_100000493 3300006846 Bacteria 29659
162 Ga0075430_100021782 3300006846 Bacteria 5447
163 Ga0075431_100000215 3300006847 Bacteria 42757
164 Ga0075431_100017146 3300006847 Bacteria 7362
165 Ga0075431_100038646 3300006847 Bacteria 4915
166 Ga0075431_100103418 3300006847 Bacteria 2940
167 Ga0075433_10000183 3300006852 Bacteria 35214
168 Ga0075433_10006740 3300006852 Bacteria 9101
169 Ga0075433_10007444 3300006852 Bacteria 8694
170 Ga0075434_100001199 3300006871 Bacteria 21526
171 Ga0075434_100011468 3300006871 Bacteria 8363
172 Ga0075434_100012986 3300006871 Bacteria 7911
173 Ga0075434_100016752 3300006871 Bacteria 7051
174 Ga0075434_100022473 3300006871 Bacteria 6143
175 Ga0075429_100000588 3300006880 Bacteria 27972
176 Ga0075429_100022644 3300006880 Bacteria 5447
177 Ga0068865_100001504 3300006881 Bacteria 13602
178 Ga0075436_100002866 3300006914 Bacteria 11814
179 Ga0075436_100015333 3300006914 Bacteria 5251
180 Ga0075436_100016196 3300006914 Bacteria 5105
181 Ga0075436_100033015 3300006914 Bacteria 3566
182 Ga0075435_100008499 3300007076 Bacteria 7371
183 Ga0075435_100010516 3300007076 Bacteria 6768
184 Ga0075435_100020496 3300007076 Bacteria 5067
185 Ga0075435_100029520 3300007076 Bacteria 4304
186 Ga0105240_10008964 3300009093 Bacteria 14221
187 Ga0105240_10015495 3300009093 Bacteria 10362
188 Ga0105240_10033843 3300009093 Bacteria 6599
189 Ga0105240_10134757 3300009093 Bacteria 2958
190 Ga0105240_10145482 3300009093 Bacteria 2828
191 Ga0105240_10149645 3300009093 Bacteria 2782
192 Ga0111539_10001159 3300009094 Bacteria 34840
193 Ga0111539_10006801 3300009094 Bacteria 14709
194 Ga0111539_10021145 3300009094 Bacteria 8012
195 Ga0105245_10003127 3300009098 Bacteria 14810
196 Ga0105245_10007097 3300009098 Bacteria 9831
197 Ga0105245_10105693 3300009098 Bacteria 2611
198 Ga0114129_10000449 3300009147 Bacteria 49109
199 Ga0114129_10003593 3300009147 Bacteria 21816
200 Ga0114129_10006238 3300009147 Bacteria 16900
201 Ga0114129_10007461 3300009147 Bacteria 15578
202 Ga0114129_10019762 3300009147 Bacteria 9587
203 Ga0114129_10026358 3300009147 Bacteria 8230
204 Ga0114129_10029773 3300009147 Bacteria 7730
205 Ga0114129_10033600 3300009147 Bacteria 7247
206 Ga0114129_10045084 3300009147 Bacteria 6200
207 Ga0114129_10068366 3300009147 Bacteria 4953
208 Ga0114129_10079122 3300009147 Bacteria 4571
209 Ga0114129_10118259 3300009147 Bacteria 3651
210 Ga0105243_10006619 3300009148 Bacteria 8948
211 Ga0105242_10022364 3300009176 Bacteria 4970
212 Ga0105242_10028885 3300009176 Bacteria 4418
213 Ga0105242_10042999 3300009176 Bacteria 3652
214 Ga0105242_10053401 3300009176 Bacteria 3300
215 Ga0105242_10094813 3300009176 Bacteria 2518
216 Ga0105248_10018672 3300009177 Bacteria 7666
217 Ga0105248_10028500 3300009177 Bacteria 6221
218 Ga0105248_10099618 3300009177 Bacteria 3275
219 Ga0105238_10019519 3300009551 Bacteria 6903
220 Ga0105249_10000587 3300009553 Bacteria 33206
221 Ga0105249_10003122 3300009553 Bacteria 14318
222 Ga0105249_10142982 3300009553 Bacteria 2296
223 Ga0105030_100636 3300009987 Bacteria 3121
224 Ga0105239_10014060 3300010375 Bacteria 8885
225 Ga0105239_10031155 3300010375 Bacteria 5868
226 Ga0105239_10096388 3300010375 Bacteria 3268
227 Ga0105239_10189391 3300010375 Bacteria 2303
228 Ga0105246_10016269 3300011119 Bacteria 4708
229 Ga0105246_10040428 3300011119 Bacteria 3147
230 Ga0157369_10002933 3300013105 Bacteria 20404
231 Ga0157369_10032024 3300013105 Bacteria 5784
232 Ga0157369_10047972 3300013105 Bacteria 4635
233 Ga0157369_10161047 3300013105 Bacteria 2369
234 Ga0157378_10005708 3300013297 Bacteria 10891
235 Ga0157378_10033396 3300013297 Bacteria 4548
236 Ga0163162_10001280 3300013306 Bacteria 23542
237 Ga0163162_10095468 3300013306 Bacteria 3060
238 Ga0157372_10059797 3300013307 Bacteria 4263
239 Ga0157372_10113791 3300013307 Bacteria 3101
240 Ga0157372_10130872 3300013307 Bacteria 2887
241 Ga0157372_10138018 3300013307 Bacteria 2809
242 Ga0157375_10003333 3300013308 Bacteria 13916
243 Ga0157375_10004527 3300013308 Bacteria 12081
244 Ga0157375_10049716 3300013308 Bacteria 4110
245 Ga0157375_10086020 3300013308 Bacteria 3194
246 Ga0163163_10002871 3300014325 Bacteria 14576
247 Ga0163163_10039000 3300014325 Bacteria 4634
248 Ga0163163_10039669 3300014325 Bacteria 4597
249 Ga0163163_10074682 3300014325 Bacteria 3383
250 Ga0157380_10003890 3300014326 Bacteria 10299
251 Ga0182008_10000361 3300014497 Bacteria 35414
252 Ga0157377_10000519 3300014745 Bacteria 16326
253 Ga0157377_10019156 3300014745 Bacteria 3573
254 Ga0157376_10013471 3300014969 Bacteria 6101
255 Ga0206354_11309496 3300020081 Bacteria 2653
256 Ga0206353_10274955 3300020082 Bacteria 10182
257 Ga0206353_10523491 3300020082 Bacteria 4982
258 Ga0207653_10000004 3300025885 Bacteria 263142
259 Ga0207653_10001283 3300025885 Bacteria 8182
260 Ga0207692_10022193 3300025898 Bacteria 2917
261 Ga0207688_10004328 3300025901 Bacteria 7746
262 Ga0207688_10016056 3300025901 Bacteria 4059
263 Ga0207680_10032036 3300025903 Bacteria 2984
264 Ga0207699_10056313 3300025906 Bacteria 2343
265 Ga0207645_10014375 3300025907 Bacteria 5297
266 Ga0207643_10000271 3300025908 Bacteria 36116
267 Ga0207643_10010383 3300025908 Bacteria 5014
268 Ga0207684_10000271 3300025910 Bacteria 77032
269 Ga0207654_10065314 3300025911 Bacteria 2142
270 Ga0207707_10003402 3300025912 Bacteria 14108
271 Ga0207707_10004389 3300025912 Bacteria 12455
272 Ga0207707_10017291 3300025912 Bacteria 6285
273 Ga0207707_10043539 3300025912 Bacteria 3916
274 Ga0207707_10059129 3300025912 Bacteria 3335
275 Ga0207693_10000126 3300025915 Bacteria 68560
276 Ga0207693_10001256 3300025915 Bacteria 22567
277 Ga0207693_10007323 3300025915 Bacteria 9076
278 Ga0207693_10012427 3300025915 Bacteria 6879
279 Ga0207693_10014751 3300025915 Bacteria 6278
280 Ga0207693_10065551 3300025915 Bacteria 2844
281 Ga0207663_10006546 3300025916 Bacteria 5974
282 Ga0207663_10006685 3300025916 Bacteria 5929
283 Ga0207663_10006778 3300025916 Bacteria 5895
284 Ga0207660_10008331 3300025917 Bacteria 6702
285 Ga0207660_10083473 3300025917 Bacteria 2353
286 Ga0207657_10000150 3300025919 Bacteria 70716
287 Ga0207657_10001018 3300025919 Bacteria 29759
288 Ga0207657_10002085 3300025919 Bacteria 21637
289 Ga0207657_10002174 3300025919 Bacteria 21240
290 Ga0207657_10003932 3300025919 Bacteria 15776
291 Ga0207657_10039321 3300025919 Bacteria 4205
292 Ga0207657_10098723 3300025919 Bacteria 2426
293 Ga0207652_10010461 3300025921 Bacteria 7467
294 Ga0207652_10014630 3300025921 Bacteria 6359
295 Ga0207652_10046218 3300025921 Bacteria 3714
296 Ga0207646_10015128 3300025922 Bacteria 7300
297 Ga0207646_10017413 3300025922 Bacteria 6725
298 Ga0207646_10026195 3300025922 Bacteria 5324
299 Ga0207681_10087870 3300025923 Bacteria 2213
300 Ga0207650_10001473 3300025925 Bacteria 16896
301 Ga0207687_10001051 3300025927 Bacteria 18717
302 Ga0207687_10006514 3300025927 Bacteria 7712
303 Ga0207687_10017058 3300025927 Bacteria 4774
304 Ga0207700_10000021 3300025928 Bacteria 168335
305 Ga0207700_10008511 3300025928 Bacteria 6363
306 Ga0207700_10073788 3300025928 Bacteria 2636
307 Ga0207664_10009609 3300025929 Bacteria 6795
308 Ga0207664_10011558 3300025929 Bacteria 6284
309 Ga0207664_10033912 3300025929 Bacteria 3928
310 Ga0207664_10082288 3300025929 Bacteria 2622
311 Ga0207690_10017626 3300025932 Bacteria 4366
312 Ga0207706_10015099 3300025933 Bacteria 6991
313 Ga0207706_10110712 3300025933 Bacteria 2416
314 Ga0207709_10000790 3300025935 Bacteria 24700
315 Ga0207709_10030105 3300025935 Bacteria 3155
316 Ga0207709_10037804 3300025935 Bacteria 2870
317 Ga0207709_10058891 3300025935 Bacteria 2389
318 Ga0207709_10061233 3300025935 Bacteria 2351
319 Ga0207670_10011598 3300025936 Bacteria 5123
320 Ga0207669_10011234 3300025937 Bacteria 4349
321 Ga0207704_10001817 3300025938 Bacteria 9562
322 Ga0207665_10000494 3300025939 Bacteria 26650
323 Ga0207665_10004060 3300025939 Bacteria 9772
324 Ga0207691_10012484 3300025940 Bacteria 8145
325 Ga0207689_10104913 3300025942 Bacteria 2322
326 Ga0207661_10063508 3300025944 Bacteria 2991
327 Ga0207679_10086444 3300025945 Bacteria 2412
328 Ga0207667_10005782 3300025949 Bacteria 15087
329 Ga0207712_10002935 3300025961 Bacteria 10891
330 Ga0207668_10034127 3300025972 Bacteria 3377
331 Ga0207639_10116668 3300026041 Bacteria 2186
332 Ga0207678_10006147 3300026067 Bacteria 10682
333 Ga0207708_10000415 3300026075 Bacteria 33470
334 Ga0207708_10007892 3300026075 Bacteria 7886
335 Ga0207708_10019634 3300026075 Bacteria 5096
336 Ga0207708_10024599 3300026075 Bacteria 4555
337 Ga0207702_10008328 3300026078 Bacteria 8754
338 Ga0207702_10009665 3300026078 Bacteria 8098
339 Ga0207702_10049870 3300026078 Bacteria 3533
340 Ga0207702_10068699 3300026078 Bacteria 3045
341 Ga0207702_10084966 3300026078 Bacteria 2757
342 Ga0207641_10025082 3300026088 Bacteria 4914
343 Ga0207641_10117520 3300026088 Bacteria 2368
344 Ga0207648_10000705 3300026089 Bacteria 37489
345 Ga0207648_10078219 3300026089 Bacteria 2885
346 Ga0207676_10001319 3300026095 Bacteria 18435
347 Ga0207676_10062341 3300026095 Bacteria 2957
348 Ga0207674_10001399 3300026116 Bacteria 31115
349 Ga0207674_10018963 3300026116 Bacteria 7458
350 Ga0207674_10022647 3300026116 Bacteria 6742
351 Ga0207674_10078542 3300026116 Bacteria 3305
352 Ga0207675_100001825 3300026118 Bacteria 21355
353 Ga0207675_100006535 3300026118 Bacteria 11037
354 Ga0207675_100062317 3300026118 Bacteria 3483
355 Ga0207675_100068438 3300026118 Bacteria 3318
356 Ga0207683_10001271 3300026121 Bacteria 22865
357 Ga0207683_10023164 3300026121 Bacteria 5337
358 Ga0207683_10045755 3300026121 Bacteria 3827
359 Ga0207683_10110934 3300026121 Bacteria 2456
360 Ga0207698_10120512 3300026142 Bacteria 2219
361 Ga0207698_10130467 3300026142 Bacteria 2147
362 Ga0207428_10008994 3300027907 Bacteria 8998
363 Ga0207428_10011008 3300027907 Bacteria 8042
364 Ga0207428_10012856 3300027907 Bacteria 7339
365 Ga0207428_10013956 3300027907 Bacteria 6998
366 Ga0207428_10016081 3300027907 Bacteria 6447
367 Ga0207428_10037934 3300027907 Bacteria 3920
368 Ga0268266_10019049 3300028379 Bacteria 5846
369 Ga0265334_10026049 3300028573 Bacteria 2364
370 Ga0265318_10001532 3300028577 Bacteria 13453
371 Ga0265318_10003338 3300028577 Bacteria 8117
372 Ga0265322_10010169 3300028654 Bacteria 2728
373 Ga0265338_10000938 3300028800 Bacteria 49159
374 Ga0265338_10003714 3300028800 Bacteria 21233
375 Ga0265338_10007205 3300028800 Bacteria 13900
376 Ga0265338_10040367 3300028800 Bacteria 4384
377 Ga0265332_10004049 3300031238 Bacteria 6964
378 Ga0265339_10020128 3300031249 Bacteria 3903
379 Ga0265327_10001417 3300031251 Bacteria 30531
380 Ga0265327_10005584 3300031251 Bacteria 10432
381 Ga0265316_10033711 3300031344 Bacteria 4167
382 Ga0265316_10064829 3300031344 Bacteria 2829
383 Ga0265313_10003763 3300031595 Bacteria 12046
384 Ga0265314_10017315 3300031711 Bacteria 5660
385 Ga0307405_10005614 3300031731 Bacteria 6068
386 Ga0307410_10060757 3300031852 Bacteria 2584
387 Ga0307406_10016809 3300031901 Bacteria 4257
388 Ga0307415_100032807 3300032126 Bacteria 3363
389 Ga0307415_100047911 3300032126 Bacteria 2880
390 Ga0307415_100048839 3300032126 Bacteria 2857
391 Ga0307415_100085727 3300032126 Bacteria 2264
392 Ga0373930_0002659 3300034816 Bacteria 2782
393 Ga0373926_0002187 3300035083 Bacteria 6164
394 Ga0373944_0001034 3300035089 Bacteria 6881
395 Ga0373951_0009832 3300035091 Bacteria 2150
396 Ga0373932_0000793 3300035112 Bacteria 9331
397 Ga0373936_0000489 3300035113 Bacteria 13402
398 Ga0373936_0015357 3300035113 Bacteria 2935
399 Ga0373945_0000756 3300035116 Bacteria 9431
400 Ga0373945_0001806 3300035116 Bacteria 6608
401 Ga0373960_0006970 3300035121 Bacteria 2665
402 Ga0373943_0000887 3300035170 Bacteria 13160
403 Ga0373943_0011312 3300035170 Bacteria 4015
404 Ga0373947_0004250 3300035725 Bacteria 8402
405 Ga0373947_0004638 3300035725 Bacteria 8060
406 Ga0373947_0007164 3300035725 Bacteria 6465
407 Ga0373937_0009529 3300036401 Bacteria 8445
408 Ga0373925_0004068 3300037068 Bacteria 11107
409 Ga0373925_0006938 3300037068 Bacteria 8287
410 Ga0373925_0015153 3300037068 Bacteria 5574
411 Ga0395899_0000775 3300037312 Bacteria 31562
412 Ga0395899_0001253 3300037312 Bacteria 22068
413 Ga0395899_0001403 3300037312 Bacteria 20652
414 Ga0395899_0002275 3300037312 Bacteria 15690
415 Ga0395899_0002400 3300037312 Bacteria 15216
416 Ga0395899_0006429 3300037312 Bacteria 9104
417 Ga0395899_0007133 3300037312 Bacteria 8647
418 Ga0395899_0020116 3300037312 Bacteria 5065
419 Ga0395899_0044151 3300037312 Bacteria 3322
420 Ga0395899_0084777 3300037312 Bacteria 2303
421 Ga0395900_0001501 3300037418 Bacteria 27705
422 Ga0395900_0002753 3300037418 Bacteria 19204
423 Ga0395900_0002828 3300037418 Bacteria 18940
424 Ga0395900_0003581 3300037418 Bacteria 16697
425 Ga0395900_0004234 3300037418 Bacteria 15230
426 Ga0395900_0004308 3300037418 Bacteria 15090
427 Ga0395900_0006214 3300037418 Bacteria 12470
428 Ga0395900_0010135 3300037418 Bacteria 9637
429 Ga0395900_0011210 3300037418 Bacteria 9167
430 Ga0395900_0011324 3300037418 Bacteria 9124
431 Ga0395900_0013079 3300037418 Bacteria 8477
432 Ga0395900_0016217 3300037418 Bacteria 7590
433 Ga0395900_0018047 3300037418 Bacteria 7202
434 Ga0395900_0027540 3300037418 Bacteria 5822
435 Ga0395900_0028702 3300037418 Bacteria 5703
436 Ga0395900_0031564 3300037418 Archaea 5445
437 Ga0395900_0038511 3300037418 Bacteria 4928
438 Ga0395900_0045079 3300037418 Archaea 4542
439 Ga0395900_0048508 3300037418 Bacteria 4374
440 Ga0395900_0057940 3300037418 Bacteria 3988
441 Ga0395900_0120162 3300037418 Bacteria 2696
442 Ga0395898_0002328 3300037466 Bacteria 22664
443 Ga0395898_0003476 3300037466 Bacteria 17597
444 Ga0395898_0003758 3300037466 Bacteria 16814
445 Ga0395898_0005462 3300037466 Bacteria 13733
446 Ga0395898_0007486 3300037466 Bacteria 11596
447 Ga0395898_0010278 3300037466 Bacteria 9794
448 Ga0395898_0019620 3300037466 Bacteria 6878
449 Ga0395898_0019777 3300037466 Bacteria 6847
450 Ga0395898_0022299 3300037466 Bacteria 6413
451 Ga0395898_0022469 3300037466 Bacteria 6388
452 Ga0395898_0037542 3300037466 Bacteria 4804
453 Ga0395898_0049312 3300037466 Bacteria 4125
454 Ga0395898_0050757 3300037466 Bacteria 4058
455 Ga0395898_0052108 3300037466 Bacteria 3998
456 Ga0395898_0069928 3300037466 Bacteria 3395
457 Ga0395898_0088240 3300037466 Bacteria 2986
458 Ga0395905_0001871 3300037471 Bacteria 24226
459 Ga0395905_0003026 3300037471 Bacteria 18215
460 Ga0395905_0004036 3300037471 Bacteria 15409
461 Ga0395905_0005632 3300037471 Bacteria 12741
462 Ga0395905_0006070 3300037471 Bacteria 12223
463 Ga0395905_0009759 3300037471 Bacteria 9363
464 Ga0395905_0010485 3300037471 Bacteria 9012
465 Ga0395905_0012349 3300037471 Bacteria 8222
466 Ga0395905_0013805 3300037471 Bacteria 7729
467 Ga0395905_0014472 3300037471 Bacteria 7531
468 Ga0395905_0025074 3300037471 Bacteria 5624
469 Ga0395905_0028725 3300037471 Bacteria 5241
470 Ga0395905_0033092 3300037471 Bacteria 4860
471 Ga0395905_0037743 3300037471 Bacteria 4534
472 Ga0395905_0048420 3300037471 Bacteria 3983
473 Ga0395905_0051750 3300037471 Bacteria 3847
474 Ga0395905_0078468 3300037471 Bacteria 3094
475 Ga0395905_0110485 3300037471 Bacteria 2581
476 Ga0436364_0136750 3300037853 Bacteria 3451
477 Ga0395901_0001042 3300038443 Bacteria 29911
478 Ga0395901_0001675 3300038443 Bacteria 22876
479 Ga0395901_0005040 3300038443 Bacteria 13338
480 Ga0395901_0005281 3300038443 Bacteria 13048
481 Ga0395901_0006778 3300038443 Bacteria 11570
482 Ga0395901_0007811 3300038443 Bacteria 10794
483 Ga0395901_0009392 3300038443 Bacteria 9921
484 Ga0395901_0010102 3300038443 Bacteria 9564
485 Ga0395901_0010892 3300038443 Bacteria 9216
486 Ga0395901_0011760 3300038443 Bacteria 8873
487 Ga0395901_0012688 3300038443 Bacteria 8548
488 Ga0395901_0013963 3300038443 Bacteria 8173
489 Ga0395901_0014377 3300038443 Bacteria 8056
490 Ga0395901_0029817 3300038443 Bacteria 5619
491 Ga0395901_0030637 3300038443 Bacteria 5543
492 Ga0395901_0043856 3300038443 Archaea 4639
493 Ga0395901_0049359 3300038443 Bacteria 4372
494 Ga0395901_0053208 3300038443 Bacteria 4207
495 Ga0395901_0064672 3300038443 Bacteria 3807
496 Ga0395901_0065404 3300038443 Bacteria 3786
497 Ga0395901_0069831 3300038443 Bacteria 3659
498 Ga0395901_0086760 3300038443 Bacteria 3272
499 Ga0395901_0160489 3300038443 Bacteria 2361
500 Ga0395901_0206393 3300038443 Bacteria 2058
501 Ga0436360_1342544 3300039438 Bacteria 7974
502 Ga0451789_0349216 3300041443 Bacteria 2473
503 Ga0439462_0000209 3300042015 Bacteria 10242
504 Ga0439446_0000387 3300042156 Bacteria 8478
505 Ga0466963_0000605 3300044694 Bacteria 17157
506 Ga0466963_0003360 3300044694 Bacteria 9137
507 Ga0466963_0003523 3300044694 Bacteria 8988
508 Ga0466963_0008705 3300044694 Bacteria 6091
509 Ga0466963_0009187 3300044694 Bacteria 5947
510 Ga0466971_0030927 3300044719 Bacteria 2396
511 Ga0466957_0021573 3300044842 Bacteria 3797
512 Ga0466960_0002008 3300044901 Bacteria 7548
513 Ga0466959_0006491 3300045049 Bacteria 8107
514 Ga0466959_0015388 3300045049 Bacteria 5571
515 Ga0451576_0017213 3300045051 Bacteria 7950
516 Ga0466958_0008831 3300045836 Bacteria 5599
517 Ga0466958_0009401 3300045836 Bacteria 5447
518 Ga0466958_0028101 3300045836 Bacteria 3332
519 Ga0466958_0033684 3300045836 Bacteria 3053
520 Ga0466958_0044658 3300045836 Bacteria 2671
521 Ga0466958_0061655 3300045836 Bacteria 2285
522 Ga0466967_0000287 3300045976 Bacteria 22450
523 Ga0466967_0001032 3300045976 Bacteria 15276
524 Ga0466967_0002133 3300045976 Bacteria 12125
525 Ga0466967_0010630 3300045976 Bacteria 6916
526 Ga0466967_0018127 3300045976 Bacteria 5616
527 Ga0466967_0025109 3300045976 Bacteria 4909
528 Ga0466967_0030761 3300045976 Bacteria 4508
529 Ga0466967_0038124 3300045976 Bacteria 4119
530 Ga0466967_0062753 3300045976 Bacteria 3299
531 Ga0466967_0108751 3300045976 Bacteria 2544
532 Ga0466967_0116508 3300045976 Bacteria 2461
533 Ga0466967_0117644 3300045976 Bacteria 2450
534 Ga0466967_0186148 3300045976 Bacteria 1960
535 Ga0495592_0044097 3300046454 Bacteria 3334
536 Ga0495603_0000062 3300046455 Bacteria 46880
537 Ga0495603_0008720 3300046455 Bacteria 6130
538 Ga0495603_0008926 3300046455 Bacteria 6062
539 Ga0495603_0009816 3300046455 Bacteria 5792
540 Ga0495603_0017316 3300046455 Bacteria 4363
541 Ga0495603_0026003 3300046455 Bacteria 3539
542 Ga0495629_0002685 3300046459 Bacteria 13623
543 Ga0495629_0018017 3300046459 Bacteria 5061
544 Ga0495641_0000799 3300046461 Bacteria 26716
545 Ga0495641_0001703 3300046461 Bacteria 18371
546 Ga0495641_0004577 3300046461 Bacteria 9694
547 Ga0495651_0043113 3300046462 Bacteria 3501
548 Ga0495653_0058773 3300046463 Bacteria 2922
549 Ga0495580_0029977 3300046472 Bacteria 3944
550 Ga0495582_0000035 3300046473 Bacteria 71933
551 Ga0495582_0000108 3300046473 Bacteria 43115
552 Ga0495582_0007475 3300046473 Bacteria 6043
553 Ga0495605_0059024 3300046474 Bacteria 1843
554 Ga0495639_0000464 3300046475 Bacteria 19302
555 Ga0495639_0002327 3300046475 Bacteria 8305
556 Ga0495662_0004218 3300046476 Bacteria 7234
557 Ga0495662_0004423 3300046476 Bacteria 7055
558 Ga0495584_0005164 3300046491 Bacteria 6930
559 Ga0495594_0000447 3300046499 Bacteria 20925
560 Ga0495607_0069761 3300046501 Bacteria 1966
561 Ga0495608_0004788 3300046511 Bacteria 9677
562 Ga0495628_0002988 3300046516 Bacteria 15157
563 Ga0495630_0020054 3300046517 Bacteria 4924
564 Ga0495644_0000999 3300046523 Bacteria 11776
565 Ga0495663_0008899 3300046525 Bacteria 2784
566 Ga0495666_0047211 3300046526 Bacteria 2074
567 Ga0495665_0008293 3300046531 Bacteria 5632
568 Ga0495640_0044572 3300046533 Bacteria 3083
569 Ga0495586_0004951 3300046535 Bacteria 7124
570 Ga0495586_0021785 3300046535 Bacteria 3419
571 Ga0495587_0047392 3300046536 Bacteria 2549
572 Ga0495609_0011879 3300046538 Bacteria 4139
573 Ga0495667_0009208 3300046559 Bacteria 6704
574 Ga0495656_0001877 3300046615 Bacteria 6927
575 Ga0495634_0028560 3300046642 Bacteria 3870
576 Ga0495635_0007573 3300046663 Bacteria 7575
577 Ga0495635_0060946 3300046663 Bacteria 2592
578 Ga0495588_0000632 3300046674 Bacteria 16378
579 Ga0495588_0003487 3300046674 Bacteria 6854
580 Ga0495658_0000132 3300046683 Bacteria 41217
581 Ga0495658_0000861 3300046683 Bacteria 16333
582 Ga0495658_0001131 3300046683 Bacteria 14107
583 Ga0495613_0003232 3300046689 Bacteria 12199
584 Ga0495613_0031525 3300046689 Bacteria 3938
585 Ga0495624_0062503 3300046690 Bacteria 2329
586 Ga0495589_0010330 3300046794 Bacteria 4848
587 Ga0495589_0023356 3300046794 Bacteria 3152
588 Ga0495589_0029821 3300046794 Bacteria 2750
589 Ga0495589_0039658 3300046794 Bacteria 2353
590 Ga0495600_0030441 3300046809 Bacteria 3496
591 Ga0495581_0000094 3300047315 Bacteria 36744
592 Ga0495581_0000707 3300047315 Bacteria 17559
593 Ga0495581_0001044 3300047315 Bacteria 14988
594 Ga0495581_0004207 3300047315 Bacteria 8298
595 Ga0495581_0013950 3300047315 Bacteria 4660
596 Ga0495604_0024062 3300047317 Bacteria 4861
597 Ga0495604_0074300 3300047317 Bacteria 2562
598 Ga0495674_0015573 3300047319 Bacteria 7103
599 Ga0495674_0048352 3300047319 Bacteria 3764
600 Ga0495676_0000253 3300047321 Bacteria 43107
601 Ga0495676_0000313 3300047321 Bacteria 39431
602 Ga0495676_0006801 3300047321 Bacteria 10512
603 Ga0495676_0008253 3300047321 Bacteria 9554
604 Ga0495676_0041920 3300047321 Bacteria 3763
605 Ga0495676_0047604 3300047321 Bacteria 3464
606 Ga0495680_0001277 3300047322 Bacteria 27465
607 Ga0495680_0002766 3300047322 Bacteria 17688
608 Ga0495680_0010897 3300047322 Bacteria 8081
609 Ga0495675_0036836 3300047444 Bacteria 3118
610 Ga0495684_0002863 3300047471 Bacteria 13586
611 Ga0495684_0027637 3300047471 Bacteria 4356
612 Ga0495593_0000980 3300047673 Bacteria 16745
613 Ga0495614_0001315 3300048089 Bacteria 10711
614 Ga0495614_0001533 3300048089 Bacteria 10012
615 Ga0496100_0011775 3300048903 Bacteria 4990
616 Ga0496100_0028603 3300048903 Bacteria 3439
617 Ga0496100_0030474 3300048903 Bacteria 3347
618 Ga0496101_0009812 3300048904 Bacteria 6305
619 Ga0496101_0025349 3300048904 Bacteria 4114
620 Ga0496101_0033973 3300048904 Bacteria 3601
621 Ga0496102_0008279 3300048905 Bacteria 8905
622 Ga0496102_0022269 3300048905 Bacteria 5614
623 Ga0496102_0052703 3300048905 Bacteria 3708
624 Ga0496102_0066679 3300048905 Bacteria 3299
625 Ga0496103_0005579 3300048906 Bacteria 7521
626 Ga0496103_0009048 3300048906 Bacteria 5899
627 Ga0496103_0029925 3300048906 Bacteria 3311
628 Ga0496104_0001577 3300048907 Bacteria 19614
629 Ga0496104_0002508 3300048907 Bacteria 15797
630 Ga0496104_0003548 3300048907 Bacteria 13455
631 Ga0496104_0006333 3300048907 Bacteria 10411
632 Ga0496104_0030514 3300048907 Bacteria 5010
633 Ga0496104_0062157 3300048907 Bacteria 3541
634 Ga0496104_0087281 3300048907 Bacteria 2979
635 Ga0496104_0104227 3300048907 Bacteria 2717
636 Ga0496105_0000042 3300048908 Bacteria 114886
637 Ga0496105_0000889 3300048908 Bacteria 20439
638 Ga0496105_0001197 3300048908 Bacteria 18056
639 Ga0496105_0002088 3300048908 Bacteria 14454
640 Ga0496105_0004474 3300048908 Bacteria 10522
641 Ga0496105_0007763 3300048908 Bacteria 8325
642 Ga0496105_0058960 3300048908 Bacteria 3167
643 Ga0496106_0000669 3300048909 Bacteria 24543
644 Ga0496106_0002197 3300048909 Bacteria 14586
645 Ga0496106_0004202 3300048909 Bacteria 10732
646 Ga0496106_0004632 3300048909 Bacteria 10202
647 Ga0496106_0007018 3300048909 Bacteria 8318
648 Ga0496106_0050996 3300048909 Bacteria 3119
649 Ga0496107_0000354 3300048910 Bacteria 25040
650 Ga0496107_0003411 3300048910 Bacteria 10628
651 Ga0496107_0008003 3300048910 Bacteria 7297
652 Ga0496107_0023293 3300048910 Bacteria 4378
653 Ga0496107_0025620 3300048910 Bacteria 4176
654 Ga0496108_0002105 3300048911 Bacteria 15931
655 Ga0496108_0005017 3300048911 Bacteria 10694
656 Ga0496108_0005226 3300048911 Bacteria 10483
657 Ga0496108_0008774 3300048911 Bacteria 8195
658 Ga0496108_0011238 3300048911 Bacteria 7273
659 Ga0496109_0001502 3300048912 Bacteria 19387
660 Ga0496109_0001909 3300048912 Bacteria 17319
661 Ga0496109_0003328 3300048912 Bacteria 13441
662 Ga0496109_0003417 3300048912 Bacteria 13283
663 Ga0496109_0007553 3300048912 Bacteria 9216
664 Ga0496109_0007873 3300048912 Bacteria 9032
665 Ga0496109_0012018 3300048912 Bacteria 7456
666 Ga0496109_0012839 3300048912 Bacteria 7239
667 Ga0496109_0016106 3300048912 Bacteria 6533
668 Ga0496109_0025008 3300048912 Bacteria 5316
669 Ga0496109_0034618 3300048912 Bacteria 4551
670 Ga0496109_0044980 3300048912 Bacteria 4006
671 Ga0496110_0000050 3300048913 Bacteria 59023
672 Ga0496110_0000778 3300048913 Bacteria 22185
673 Ga0496110_0001137 3300048913 Bacteria 18822
674 Ga0496110_0001680 3300048913 Bacteria 16243
675 Ga0496110_0001795 3300048913 Bacteria 15825
676 Ga0496110_0008981 3300048913 Bacteria 8062
677 Ga0496110_0017248 3300048913 Bacteria 6039
678 Ga0496110_0076161 3300048913 Bacteria 2983
679 Ga0496110_0079001 3300048913 Bacteria 2929
680 Ga0496110_0131944 3300048913 Bacteria 2256
681 Ga0496111_0000101 3300048914 Bacteria 37061
682 Ga0496111_0000220 3300048914 Bacteria 27215
683 Ga0496111_0000439 3300048914 Bacteria 21067
684 Ga0496111_0000680 3300048914 Bacteria 17874
685 Ga0496111_0012139 3300048914 Bacteria 5826
686 Ga0496111_0023323 3300048914 Bacteria 4344
687 Ga0496111_0093530 3300048914 Bacteria 2204
688 Ga0496112_0000202 3300048915 Bacteria 39070
689 Ga0496112_0002189 3300048915 Bacteria 15555
690 Ga0496112_0004326 3300048915 Bacteria 12008
691 Ga0496112_0006106 3300048915 Bacteria 10531
692 Ga0496112_0023128 3300048915 Bacteria 5933
693 Ga0496112_0026230 3300048915 Bacteria 5604
694 Ga0496112_0036119 3300048915 Bacteria 4819
695 Ga0496112_0043869 3300048915 Bacteria 4379
696 Ga0496112_0044973 3300048915 Bacteria 4327
697 Ga0496112_0113423 3300048915 Bacteria 2681
698 Ga0496113_0000517 3300048916 Bacteria 19082
699 Ga0496113_0034272 3300048916 Bacteria 3703
700 Ga0496113_0058737 3300048916 Bacteria 2895
701 Ga0496114_0008664 3300048917 Bacteria 8063
702 Ga0496114_0010898 3300048917 Bacteria 7243
703 Ga0496114_0013622 3300048917 Bacteria 6520
704 Ga0496114_0021823 3300048917 Bacteria 5211
705 Ga0496114_0095060 3300048917 Bacteria 2535
706 Ga0496115_0001751 3300048918 Bacteria 15571
707 Ga0496115_0009767 3300048918 Bacteria 7147
708 Ga0496115_0024799 3300048918 Bacteria 4664
709 Ga0496115_0060018 3300048918 Bacteria 3064
710 Ga0501031_0001050 3300049568 Bacteria 16750
711 Ga0501031_0001127 3300049568 Bacteria 16242
712 Ga0501031_0002040 3300049568 Bacteria 12709
713 Ga0501031_0005409 3300049568 Bacteria 8312
714 Ga0501031_0009117 3300049568 Bacteria 6454
715 Ga0501031_0012425 3300049568 Bacteria 5554
716 Ga0501031_0033466 3300049568 Bacteria 3353
717 Ga0501031_0034157 3300049568 Bacteria 3319
718 Ga0501031_0081138 3300049568 Bacteria 2115
719 Ga0501032_0021027 3300049569 Bacteria 4538
720 Ga0501032_0025125 3300049569 Bacteria 4107
721 Ga0501032_0029690 3300049569 Bacteria 3750
722 Ga0501032_0039458 3300049569 Bacteria 3211
723 Ga0501033_0001134 3300049570 Bacteria 24113
724 Ga0501033_0008600 3300049570 Bacteria 7901
725 Ga0501033_0009318 3300049570 Bacteria 7561
726 Ga0501033_0016473 3300049570 Bacteria 5599
727 Ga0501033_0041969 3300049570 Bacteria 3412
728 Ga0501033_0051349 3300049570 Bacteria 3056
729 Ga0501034_0011160 3300049571 Bacteria 9324
730 Ga0501034_0013593 3300049571 Bacteria 8378
731 Ga0501036_0000213 3300049572 Bacteria 38685
732 Ga0501036_0000292 3300049572 Bacteria 34675
733 Ga0501036_0007571 3300049572 Bacteria 8862
734 Ga0501036_0016240 3300049572 Bacteria 6218
735 Ga0501036_0026511 3300049572 Bacteria 4892
736 Ga0501036_0076190 3300049572 Bacteria 2837
737 Ga0501036_0078334 3300049572 Bacteria 2795
738 Ga0501036_0103279 3300049572 Bacteria 2411
739 Ga0501037_0002760 3300049573 Bacteria 12707
740 Ga0501037_0003930 3300049573 Bacteria 10783
741 Ga0501038_0001432 3300049574 Bacteria 21878
742 Ga0501038_0015520 3300049574 Bacteria 6923
743 Ga0501038_0029755 3300049574 Bacteria 4836
744 Ga0501038_0041040 3300049574 Bacteria 4037
745 Ga0501039_0000656 3300049575 Bacteria 24952
746 Ga0501039_0001387 3300049575 Bacteria 17786
747 Ga0501039_0004571 3300049575 Bacteria 10455
748 Ga0501039_0005725 3300049575 Bacteria 9415
749 Ga0501039_0006314 3300049575 Bacteria 8999
750 Ga0501039_0007993 3300049575 Bacteria 8060
751 Ga0501039_0013342 3300049575 Bacteria 6282
752 Ga0501039_0017983 3300049575 Bacteria 5422
753 Ga0501039_0021604 3300049575 Bacteria 4937
754 Ga0501039_0025958 3300049575 Bacteria 4503
755 Ga0501039_0048048 3300049575 Bacteria 3298
756 Ga0501040_0000230 3300049576 Bacteria 32730
757 Ga0501040_0002177 3300049576 Bacteria 12637
758 Ga0501040_0003394 3300049576 Bacteria 10273
759 Ga0501040_0004312 3300049576 Bacteria 9241
760 Ga0501040_0032847 3300049576 Bacteria 3512
761 Ga0501040_0034549 3300049576 Bacteria 3424
762 Ga0501041_0000423 3300049577 Bacteria 21392
763 Ga0501041_0000771 3300049577 Bacteria 17161
764 Ga0501041_0001426 3300049577 Bacteria 13217
765 Ga0501041_0003770 3300049577 Bacteria 8716
766 Ga0501041_0006683 3300049577 Bacteria 6756
767 Ga0501041_0010801 3300049577 Bacteria 5386
768 Ga0501041_0016089 3300049577 Bacteria 4442
769 Ga0501041_0071548 3300049577 Bacteria 2129
770 Ga0501042_0000753 3300049578 Bacteria 17604
771 Ga0501042_0002209 3300049578 Bacteria 11869
772 Ga0501042_0002273 3300049578 Bacteria 11734
773 Ga0501042_0008010 3300049578 Bacteria 6953
774 Ga0501042_0009352 3300049578 Bacteria 6528
775 Ga0501042_0013388 3300049578 Bacteria 5580
776 Ga0501042_0014204 3300049578 Bacteria 5431
777 Ga0501042_0041405 3300049578 Bacteria 3275
778 Ga0501042_0078665 3300049578 Bacteria 2362
779 Ga0501043_0000119 3300049579 Bacteria 72862
780 Ga0501043_0018898 3300049579 Bacteria 5408
781 Ga0501043_0157154 3300049579 Bacteria 1778
782 Ga0501046_0002884 3300049580 Bacteria 15940
783 Ga0501046_0004940 3300049580 Bacteria 11984
784 Ga0501046_0005087 3300049580 Bacteria 11792
785 Ga0501046_0005248 3300049580 Bacteria 11583
786 Ga0501046_0009805 3300049580 Bacteria 8257
787 Ga0501046_0024735 3300049580 Bacteria 4921
788 Ga0501046_0025783 3300049580 Bacteria 4807
789 Ga0501047_0000169 3300049581 Bacteria 80218
790 Ga0501047_0129001 3300049581 Bacteria 2409
791 Ga0501048_0001125 3300049582 Bacteria 20081
792 Ga0501048_0001137 3300049582 Bacteria 19970
793 Ga0501048_0002722 3300049582 Bacteria 13486
794 Ga0501048_0002989 3300049582 Bacteria 12905
795 Ga0501048_0009088 3300049582 Bacteria 7480
796 Ga0501048_0009323 3300049582 Bacteria 7368
797 Ga0501048_0015095 3300049582 Bacteria 5709
798 Ga0501048_0020631 3300049582 Bacteria 4829
799 Ga0501048_0027268 3300049582 Bacteria 4154
800 Ga0501048_0080751 3300049582 Bacteria 2294
801 Ga0501067_0000031 3300049583 Bacteria 87732
802 Ga0501067_0001764 3300049583 Bacteria 11889
803 Ga0501067_0002579 3300049583 Bacteria 10014
804 Ga0501067_0008085 3300049583 Bacteria 5844
805 Ga0501067_0016026 3300049583 Bacteria 4145
806 Ga0501067_0021491 3300049583 Bacteria 3571
807 Ga0501068_0000006 3300049584 Bacteria 78334
808 Ga0501068_0000457 3300049584 Bacteria 20687
809 Ga0501068_0000884 3300049584 Bacteria 15631
810 Ga0501068_0048313 3300049584 Bacteria 2569
811 Ga0501069_0000032 3300049585 Bacteria 96425
812 Ga0501069_0000678 3300049585 Bacteria 15834
813 Ga0501069_0006416 3300049585 Bacteria 6150
814 Ga0501069_0008008 3300049585 Bacteria 5550
815 Ga0501069_0009502 3300049585 Bacteria 5133
816 Ga0501069_0014011 3300049585 Bacteria 4283
817 Ga0501069_0024173 3300049585 Bacteria 3314
818 Ga0501070_0000104 3300049586 Bacteria 74572
819 Ga0501070_0004629 3300049586 Bacteria 11798
820 Ga0501070_0005742 3300049586 Bacteria 10579
821 Ga0501070_0022287 3300049586 Bacteria 5307
822 Ga0501070_0043568 3300049586 Bacteria 3734
823 Ga0501070_0054883 3300049586 Bacteria 3304
824 Ga0501070_0086507 3300049586 Bacteria 2595
825 Ga0501070_0107430 3300049586 Bacteria 2306
826 Ga0501071_0000074 3300049587 Bacteria 35629
827 Ga0501071_0001967 3300049587 Bacteria 12260
828 Ga0501071_0002185 3300049587 Bacteria 11766
829 Ga0501071_0007711 3300049587 Bacteria 7094
830 Ga0501071_0014011 3300049587 Bacteria 5479
831 Ga0501071_0014935 3300049587 Bacteria 5321
832 Ga0501071_0041494 3300049587 Bacteria 3295
833 Ga0501071_0057012 3300049587 Bacteria 2823
834 Ga0501071_0073488 3300049587 Bacteria 2494
835 Ga0501071_0106769 3300049587 Bacteria 2067
836 Ga0501071_0135431 3300049587 Bacteria 1832
837 Ga0501072_0000273 3300049588 Bacteria 37334
838 Ga0501072_0004550 3300049588 Bacteria 10546
839 Ga0501072_0012219 3300049588 Bacteria 6562
840 Ga0501072_0013353 3300049588 Bacteria 6288
841 Ga0501072_0025134 3300049588 Bacteria 4637
842 Ga0501072_0028897 3300049588 Bacteria 4328
843 Ga0501072_0041253 3300049588 Bacteria 3625
844 Ga0501072_0080597 3300049588 Bacteria 2579
845 Ga0501072_0086845 3300049588 Bacteria 2482
846 Ga0501072_0122963 3300049588 Bacteria 2067
847 Ga0501073_0002644 3300049589 Bacteria 13427
848 Ga0501073_0023712 3300049589 Bacteria 4405
849 Ga0501073_0027127 3300049589 Bacteria 4099
850 Ga0501073_0089863 3300049589 Bacteria 2135
851 Ga0501074_0000005 3300049590 Bacteria 113618
852 Ga0501074_0002949 3300049590 Bacteria 11955
853 Ga0501074_0008668 3300049590 Bacteria 7365
854 Ga0501074_0029274 3300049590 Bacteria 3989
855 Ga0501074_0035804 3300049590 Bacteria 3596
856 Ga0501075_0000166 3300049591 Bacteria 34245
857 Ga0501075_0000895 3300049591 Bacteria 18813
858 Ga0501075_0001494 3300049591 Bacteria 15232
859 Ga0501075_0001525 3300049591 Bacteria 15097
860 Ga0501075_0003608 3300049591 Bacteria 10378
861 Ga0501075_0008976 3300049591 Bacteria 6975
862 Ga0501075_0009567 3300049591 Bacteria 6785
863 Ga0501075_0014599 3300049591 Bacteria 5628
864 Ga0501076_0000130 3300049592 Bacteria 41963
865 Ga0501076_0001762 3300049592 Bacteria 14639
866 Ga0501076_0002273 3300049592 Bacteria 13140
867 Ga0501076_0002933 3300049592 Bacteria 11822
868 Ga0501076_0005520 3300049592 Bacteria 9109
869 Ga0501076_0011795 3300049592 Bacteria 6526
870 Ga0501076_0022841 3300049592 Bacteria 4812
871 Ga0501076_0023284 3300049592 Bacteria 4772
872 Ga0501076_0031663 3300049592 Bacteria 4127
873 Ga0501076_0039742 3300049592 Bacteria 3694
874 Ga0501076_0045930 3300049592 Bacteria 3449
875 Ga0501077_0000184 3300049593 Bacteria 35865
876 Ga0501077_0000492 3300049593 Bacteria 23928
877 Ga0501077_0000708 3300049593 Bacteria 20146
878 Ga0501077_0001259 3300049593 Bacteria 15274
879 Ga0501077_0004809 3300049593 Bacteria 8211
880 Ga0501077_0006763 3300049593 Bacteria 7058
881 Ga0501077_0012515 3300049593 Bacteria 5312
882 Ga0501077_0022769 3300049593 Bacteria 3971
883 Ga0501077_0026008 3300049593 Bacteria 3713
884 Ga0501077_0038946 3300049593 Bacteria 3027
885 Ga0501077_0041408 3300049593 Bacteria 2932
886 Ga0501077_0049333 3300049593 Bacteria 2675
887 Ga0501079_0000143 3300049741 Bacteria 39337
888 Ga0501079_0002994 3300049741 Bacteria 12357
889 Ga0501079_0003522 3300049741 Bacteria 11503
890 Ga0501079_0004688 3300049741 Bacteria 10126
891 Ga0501079_0005755 3300049741 Bacteria 9265
892 Ga0501079_0014129 3300049741 Bacteria 6086
893 Ga0501079_0019750 3300049741 Bacteria 5147
894 Ga0501079_0032359 3300049741 Bacteria 4020
895 Ga0501079_0034806 3300049741 Bacteria 3876
896 Ga0501079_0059732 3300049741 Bacteria 2941
897 Ga0501079_0077072 3300049741 Bacteria 2578
898 Ga0501079_0171006 3300049741 Bacteria 1694
899 Ga0501080_0001003 3300049742 Bacteria 23169
900 Ga0501080_0001096 3300049742 Bacteria 22313
901 Ga0501080_0011329 3300049742 Bacteria 8162
902 Ga0501080_0016204 3300049742 Bacteria 6881
903 Ga0501080_0016342 3300049742 Bacteria 6854
904 Ga0501080_0025490 3300049742 Bacteria 5488
905 Ga0501080_0115175 3300049742 Bacteria 2492
906 Ga0501081_0000280 3300049743 Bacteria 26904
907 Ga0501081_0000609 3300049743 Bacteria 20408
908 Ga0501081_0002549 3300049743 Bacteria 11494
909 Ga0501081_0004862 3300049743 Bacteria 8636
910 Ga0501081_0014313 3300049743 Bacteria 5229
911 Ga0501081_0018169 3300049743 Bacteria 4667
912 Ga0501081_0029281 3300049743 Bacteria 3720
913 Ga0501081_0038489 3300049743 Bacteria 3267
914 Ga0501081_0041411 3300049743 Bacteria 3154
915 Ga0501081_0061960 3300049743 Bacteria 2593
916 Ga0501083_0000115 3300049744 Bacteria 55075
917 Ga0501083_0001728 3300049744 Bacteria 14875
918 Ga0501083_0004551 3300049744 Bacteria 9796
919 Ga0501083_0005232 3300049744 Bacteria 9175
920 Ga0501083_0015986 3300049744 Bacteria 5255
921 Ga0501083_0039984 3300049744 Bacteria 3184
922 Ga0501035_0004302 3300049822 Bacteria 13526
923 Ga0501035_0005060 3300049822 Bacteria 12491
924 Ga0501035_0005504 3300049822 Bacteria 11964
925 Ga0501035_0021581 3300049822 Bacteria 5921
926 Ga0501035_0042807 3300049822 Bacteria 4083
927 Ga0501035_0077209 3300049822 Bacteria 2943
928 Ga0501044_0005712 3300049823 Bacteria 13791
929 Ga0501045_0000725 3300049824 Bacteria 20990
930 Ga0501045_0000787 3300049824 Bacteria 20408
931 Ga0501045_0001577 3300049824 Bacteria 15194
932 Ga0501045_0001948 3300049824 Bacteria 13943
933 Ga0501045_0002187 3300049824 Bacteria 13257
934 Ga0501045_0004064 3300049824 Bacteria 10095
935 Ga0501045_0006176 3300049824 Bacteria 8295
936 Ga0501045_0009860 3300049824 Bacteria 6681
937 Ga0501045_0013014 3300049824 Bacteria 5865
938 Ga0501045_0019605 3300049824 Bacteria 4825
939 Ga0501045_0051330 3300049824 Bacteria 3010
940 nmdc:mga05p37_116338_c1 3300050507 Bacteria 3286
941 nmdc:mga05p37_155331_c1 3300050507 Bacteria 2797
942 nmdc:mga05p37_157927_c1 3300050507 Bacteria 2771
943 nmdc:mga05p37_21390_c1 3300050507 Bacteria 7834
944 nmdc:mga05p37_24663_c1 3300050507 Bacteria 7310
945 nmdc:mga05p37_3445_c1 3300050507 Bacteria 18465
946 nmdc:mga05p37_40538_c1 3300050507 Bacteria 5718
947 nmdc:mga09592_17549_c1 3300050508 Bacteria 5864
948 nmdc:mga09592_51534_c1 3300050508 Bacteria 3473
949 nmdc:mga09592_6213_c1 3300050508 Bacteria 9720
950 nmdc:mga09592_8952_c1 3300050508 Bacteria 8140
951 nmdc:mga0qj67_14956_c1 3300050509 Bacteria 5871
952 nmdc:mga06r32_302_c1 3300050510 Bacteria 40870
953 nmdc:mga06r32_6991_c1 3300050510 Bacteria 10157
954 nmdc:mga08y16_101226_c1 3300050511 Bacteria 3000
955 nmdc:mga08y16_35919_c1 3300050511 Bacteria 5205
956 nmdc:mga08y16_54867_c1 3300050511 Bacteria 4165
957 nmdc:mga0n895_142302_c1 3300050512 Bacteria 2427
958 nmdc:mga0n895_21311_c1 3300050512 Bacteria 6056
959 nmdc:mga0n895_50588_c1 3300050512 Bacteria 4074
960 nmdc:mga0n895_53458_c1 3300050512 Bacteria 3968
961 nmdc:mga0rr50_18358_c1 3300050513 Bacteria 4697
962 nmdc:mga0rr50_4353_c1 3300050513 Bacteria 8312
963 nmdc:mga0rr50_43589_c1 3300050513 Bacteria 3285
964 nmdc:mga0a205_19741_c1 3300050515 Bacteria 6359
965 nmdc:mga0a205_2952_c1 3300050515 Bacteria 15079
966 nmdc:mga0a205_35039_c1 3300050515 Bacteria 4819
967 nmdc:mga0a205_506_c1 3300050515 Bacteria 30547
968 Ga0495601_0028264 3300053077 Bacteria 3473
969 Ga0495601_0037541 3300053077 Bacteria 3029
970 Ga0495612_0016340 3300053078 Bacteria 2975
971 Ga0495595_0016493 3300053084 Bacteria 3162
972 Ga0495595_0035053 3300053084 Bacteria 2273
973 Ga0495619_0003536 3300053085 Bacteria 10084
974 Ga0495619_0004108 3300053085 Bacteria 9319
975 Ga0495619_0032187 3300053085 Bacteria 3401
976 Ga0501084_0000067 3300054114 Bacteria 79713
977 Ga0501084_0000470 3300054114 Bacteria 31185
978 Ga0501084_0001225 3300054114 Bacteria 20204
979 Ga0501084_0002919 3300054114 Bacteria 13834
980 Ga0501084_0011977 3300054114 Bacteria 7180
981 Ga0501084_0035345 3300054114 Bacteria 4177
982 Ga0501084_0058271 3300054114 Bacteria 3232
983 Ga0501084_0073120 3300054114 Bacteria 2871
984 Ga0501084_0102582 3300054114 Bacteria 2402
985 Ga0501082_0000114 3300060353 Bacteria 63397
986 Ga0501082_0000203 3300060353 Bacteria 51940
987 Ga0501082_0002606 3300060353 Bacteria 15761
988 Ga0501082_0010212 3300060353 Bacteria 8082
989 Ga0501082_0011585 3300060353 Bacteria 7585
990 Ga0501082_0012065 3300060353 Bacteria 7425
991 Ga0501082_0018599 3300060353 Bacteria 5989
992 Ga0501082_0039650 3300060353 Bacteria 4062
993 Ga0501082_0111735 3300060353 Bacteria 2365
994 Ga0466962_0001101 3300061719 Bacteria 12437
995 Ga0530510_0000745 3300061734 Bacteria 21090
996 Ga0530510_0001747 3300061734 Bacteria 14816
997 Ga0530510_0004253 3300061734 Bacteria 9901
998 Ga0530510_0005584 3300061734 Bacteria 8715
999 Ga0530510_0008572 3300061734 Bacteria 7139
1000 Ga0530510_0012967 3300061734 Bacteria 5860
1001 Ga0530510_0013398 3300061734 Bacteria 5765
1002 Ga0530510_0019242 3300061734 Bacteria 4846
1003 Ga0530510_0031535 3300061734 Bacteria 3811
1004 Ga0530510_0038865 3300061734 Bacteria 3436
1005 Ga0530510_0041080 3300061734 Bacteria 3339
1006 Ga0530510_0043087 3300061734 Bacteria 3259
1007 Ga0530510_0092377 3300061734 Bacteria 2209

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0171006 Ga0501079_0171006_107_1675 481
2 3300049579 Ga0501043_0157154 Ga0501043_0157154_205_1764 503
3 3300038443 Ga0395901_0206393 Ga0395901_0206393_422_2035 511
4 3300025923 Ga0207681_10087870 Ga0207681_100878702 524
5 3300026118 Ga0207675_100062317 Ga0207675_1000623173 527
6 3300049587 Ga0501071_0135431 Ga0501071_0135431_86_1777 531
7 3300054114 Ga0501084_0058271 Ga0501084_0058271_1551_3209 531
8 3300048907 Ga0496104_0062157 Ga0496104_0062157_13_1761 541
9 3300046809 Ga0495600_0030441 Ga0495600_0030441_1781_3484 543
10 3300049575 Ga0501039_0048048 Ga0501039_0048048_1562_3253 548
11 3300046474 Ga0495605_0059024 Ga0495605_0059024_68_1816 550
12 3300005471 Ga0070698_100042116 Ga0070698_1000421162 555
13 3300048915 Ga0496112_0026230 Ga0496112_0026230_1307_3010 555
14 3300026089 Ga0207648_10078219 Ga0207648_100782192 556
15 3300049587 Ga0501071_0106769 Ga0501071_0106769_241_2019 560
16 3300049583 Ga0501067_0016026 Ga0501067_0016026_2387_4129 561
17 3300005840 Ga0068870_10000660 Ga0068870_100006605 563
18 3300009176 Ga0105242_10022364 Ga0105242_100223645 563
19 3300025908 Ga0207643_10010383 Ga0207643_100103835 563
20 3300037471 Ga0395905_0110485 Ga0395905_0110485_782_2563 563
21 3300013105 Ga0157369_10047972 Ga0157369_100479724 572
22 3300045976 Ga0466967_0010630 Ga0466967_0010630_750_2621 572
23 3300009147 Ga0114129_10079122 Ga0114129_100791225 573
24 3300009094 Ga0111539_10021145 Ga0111539_100211456 574
25 3300026075 Ga0207708_10024599 Ga0207708_100245992 574
26 3300026121 Ga0207683_10023164 Ga0207683_100231642 574
27 3300005329 Ga0070683_100050303 Ga0070683_1000503032 575
28 3300005331 Ga0070670_100000812 Ga0070670_1000008123 575
29 3300005355 Ga0070671_100067837 Ga0070671_1000678372 575
30 3300005365 Ga0070688_100002653 Ga0070688_10000265310 575
31 3300005535 Ga0070684_100018235 Ga0070684_1000182352 575
32 3300005548 Ga0070665_100017883 Ga0070665_1000178835 575
33 3300009147 Ga0114129_10068366 Ga0114129_100683662 575
34 3300009177 Ga0105248_10099618 Ga0105248_100996182 575
35 3300013308 Ga0157375_10003333 Ga0157375_100033332 575
36 3300014325 Ga0163163_10039669 Ga0163163_100396692 575
37 3300014745 Ga0157377_10019156 Ga0157377_100191562 575
38 3300044694 Ga0466963_0003360 Ga0466963_0003360_3029_4885 575
39 3300044842 Ga0466957_0021573 Ga0466957_0021573_383_2239 575
40 3300045976 Ga0466967_0108751 Ga0466967_0108751_260_2116 575
41 3300048913 Ga0496110_0079001 Ga0496110_0079001_801_2741 575
42 3300050507 nmdc:mga05p37_157927_c1 nmdc:mga05p37_157927_c1_40_1842 575
43 3300005356 Ga0070674_100018143 Ga0070674_1000181432 576
44 3300044694 Ga0466963_0000605 Ga0466963_0000605_8630_10501 578
45 3300045836 Ga0466958_0009401 Ga0466958_0009401_3496_5367 578
46 3300045976 Ga0466967_0062753 Ga0466967_0062753_132_2003 578
47 3300061719 Ga0466962_0001101 Ga0466962_0001101_78_1949 578
48 3300049571 Ga0501034_0013593 Ga0501034_0013593_2650_4455 580
49 3300049586 Ga0501070_0005742 Ga0501070_0005742_6216_8021 580
50 3300049589 Ga0501073_0023712 Ga0501073_0023712_930_2735 580
51 3300049590 Ga0501074_0029274 Ga0501074_0029274_293_2098 580
52 3300049742 Ga0501080_0001096 Ga0501080_0001096_2128_3933 580
53 3300048909 Ga0496106_0000669 Ga0496106_0000669_3060_4925 581
54 3300048910 Ga0496107_0000354 Ga0496107_0000354_3465_5330 581
55 3300048917 Ga0496114_0008664 Ga0496114_0008664_3465_5330 581
56 3300006871 Ga0075434_100012986 Ga0075434_1000129864 583
57 3300007076 Ga0075435_100010516 Ga0075435_1000105166 583
58 3300046501 Ga0495607_0069761 Ga0495607_0069761_48_1913 585
59 3300005406 Ga0070703_10000001 Ga0070703_1000000187 586
60 3300005445 Ga0070708_100002794 Ga0070708_10000279413 586
61 3300005467 Ga0070706_100003986 Ga0070706_10000398615 586
62 3300005468 Ga0070707_100007336 Ga0070707_1000073364 586
63 3300005536 Ga0070697_100030126 Ga0070697_1000301262 586
64 3300005719 Ga0068861_100035750 Ga0068861_1000357503 586
65 3300013105 Ga0157369_10032024 Ga0157369_100320243 586
66 3300013297 Ga0157378_10005708 Ga0157378_100057084 586
67 3300025885 Ga0207653_10000004 Ga0207653_1000000488 586
68 3300025910 Ga0207684_10000271 Ga0207684_1000027165 586
69 3300025922 Ga0207646_10015128 Ga0207646_100151283 586
70 3300026118 Ga0207675_100068438 Ga0207675_1000684382 586
71 3300046455 Ga0495603_0008926 Ga0495603_0008926_4125_5993 586
72 3300046455 Ga0495603_0017316 Ga0495603_0017316_422_2362 586
73 3300049583 Ga0501067_0001764 Ga0501067_0001764_9117_10988 586
74 3300049585 Ga0501069_0000678 Ga0501069_0000678_12235_14106 586
75 3300061734 Ga0530510_0031535 Ga0530510_0031535_305_2176 586
76 3300049582 Ga0501048_0080751 Ga0501048_0080751_398_2284 587
77 3300049586 Ga0501070_0086507 Ga0501070_0086507_630_2585 587
78 3300049588 Ga0501072_0028897 Ga0501072_0028897_496_2460 587
79 3300005329 Ga0070683_100004803 Ga0070683_1000048034 588
80 3300005336 Ga0070680_100007438 Ga0070680_1000074385 588
81 3300005339 Ga0070660_100004049 Ga0070660_1000040492 588
82 3300005530 Ga0070679_100023514 Ga0070679_1000235143 588
83 3300005535 Ga0070684_100004541 Ga0070684_1000045414 588
84 3300025919 Ga0207657_10000150 Ga0207657_1000015023 588
85 3300025921 Ga0207652_10010461 Ga0207652_100104612 588
86 3300025935 Ga0207709_10058891 Ga0207709_100588912 588
87 3300039438 Ga0436360_1342544 Ga0436360_1342544_1496_3349 588
88 3300005329 Ga0070683_100029922 Ga0070683_1000299224 589
89 3300006871 Ga0075434_100016752 Ga0075434_1000167523 589
90 3300009147 Ga0114129_10118259 Ga0114129_101182592 589
91 3300011119 Ga0105246_10016269 Ga0105246_100162692 589
92 3300014325 Ga0163163_10039000 Ga0163163_100390002 589
93 3300028800 Ga0265338_10007205 Ga0265338_100072057 589
94 3300031249 Ga0265339_10020128 Ga0265339_100201281 589
95 3300035725 Ga0373947_0007164 Ga0373947_0007164_3319_5178 589
96 3300037068 Ga0373925_0015153 Ga0373925_0015153_2253_4112 589
97 3300038443 Ga0395901_0011760 Ga0395901_0011760_6969_8828 589
98 3300048903 Ga0496100_0028603 Ga0496100_0028603_1325_3184 589
99 3300048909 Ga0496106_0007018 Ga0496106_0007018_2406_4265 589
100 3300048910 Ga0496107_0023293 Ga0496107_0023293_966_2825 589
101 3300048914 Ga0496111_0093530 Ga0496111_0093530_310_2181 589
102 3300049575 Ga0501039_0013342 Ga0501039_0013342_1575_3440 589
103 3300049592 Ga0501076_0031663 Ga0501076_0031663_642_2693 589
104 3300054114 Ga0501084_0073120 Ga0501084_0073120_47_1912 589
105 3300006914 Ga0075436_100002866 Ga0075436_1000028668 590
106 3300007076 Ga0075435_100029520 Ga0075435_1000295202 590
107 3300010375 Ga0105239_10014060 Ga0105239_100140605 590
108 3300026116 Ga0207674_10078542 Ga0207674_100785422 590
109 3300046455 Ga0495603_0009816 Ga0495603_0009816_1241_3184 590
110 3300049583 Ga0501067_0002579 Ga0501067_0002579_1728_3599 590
111 3300049585 Ga0501069_0006416 Ga0501069_0006416_848_2719 590
112 3300050513 nmdc:mga0rr50_4353_c1 nmdc:mga0rr50_4353_c1_5515_7386 590
113 3300005530 Ga0070679_100009394 Ga0070679_1000093947 591
114 3300005563 Ga0068855_100030905 Ga0068855_1000309054 591
115 3300005937 Ga0081455_10016026 Ga0081455_100160263 591
116 3300009093 Ga0105240_10008964 Ga0105240_100089645 591
117 3300013307 Ga0157372_10138018 Ga0157372_101380182 591
118 3300025919 Ga0207657_10098723 Ga0207657_100987232 591
119 3300038443 Ga0395901_0069831 Ga0395901_0069831_1080_2966 591
120 3300044694 Ga0466963_0008705 Ga0466963_0008705_3357_5228 591
121 3300045836 Ga0466958_0033684 Ga0466958_0033684_904_2775 591
122 3300045976 Ga0466967_0002133 Ga0466967_0002133_8543_10414 591
123 3300045976 Ga0466967_0117644 Ga0466967_0117644_286_2157 591
124 3300048909 Ga0496106_0004632 Ga0496106_0004632_5394_7265 591
125 3300048912 Ga0496109_0003328 Ga0496109_0003328_837_2708 591
126 3300048913 Ga0496110_0008981 Ga0496110_0008981_4962_6833 591
127 3300048915 Ga0496112_0113423 Ga0496112_0113423_18_1889 591
128 3300048917 Ga0496114_0095060 Ga0496114_0095060_116_1987 591
129 3300049586 Ga0501070_0000104 Ga0501070_0000104_70053_71927 591
130 3300005339 Ga0070660_100045420 Ga0070660_1000454202 592
131 3300005983 Ga0081540_1015487 Ga0081540_10154874 592
132 3300006846 Ga0075430_100021782 Ga0075430_1000217824 592
133 3300037312 Ga0395899_0007133 Ga0395899_0007133_4560_6446 592
134 3300038443 Ga0395901_0006778 Ga0395901_0006778_1428_3332 592
135 3300048904 Ga0496101_0025349 Ga0496101_0025349_329_2197 592
136 3300048907 Ga0496104_0001577 Ga0496104_0001577_7077_8945 592
137 3300048908 Ga0496105_0001197 Ga0496105_0001197_2126_3994 592
138 3300048909 Ga0496106_0002197 Ga0496106_0002197_8252_10120 592
139 3300048910 Ga0496107_0003411 Ga0496107_0003411_4076_5944 592
140 3300048912 Ga0496109_0003417 Ga0496109_0003417_1310_3178 592
141 3300048915 Ga0496112_0043869 Ga0496112_0043869_2264_4132 592
142 3300048917 Ga0496114_0010898 Ga0496114_0010898_5162_7030 592
143 3300048918 Ga0496115_0001751 Ga0496115_0001751_2454_4322 592
144 3300050508 nmdc:mga09592_17549_c1 nmdc:mga09592_17549_c1_1530_3416 592
145 3300005329 Ga0070683_100034510 Ga0070683_1000345102 593
146 3300005336 Ga0070680_100088366 Ga0070680_1000883661 593
147 3300005339 Ga0070660_100005641 Ga0070660_1000056417 593
148 3300005344 Ga0070661_100056056 Ga0070661_1000560561 593
149 3300005445 Ga0070708_100003212 Ga0070708_10000321211 593
150 3300005458 Ga0070681_10065077 Ga0070681_100650774 593
151 3300005458 Ga0070681_10179092 Ga0070681_101790921 593
152 3300005530 Ga0070679_100007223 Ga0070679_1000072233 593
153 3300005530 Ga0070679_100023700 Ga0070679_1000237006 593
154 3300005530 Ga0070679_100040175 Ga0070679_1000401752 593
155 3300005548 Ga0070665_100016576 Ga0070665_1000165766 593
156 3300005563 Ga0068855_100009470 Ga0068855_1000094703 593
157 3300005563 Ga0068855_100039047 Ga0068855_1000390472 593
158 3300005577 Ga0068857_100159342 Ga0068857_1001593421 593
159 3300009093 Ga0105240_10033843 Ga0105240_100338433 593
160 3300009093 Ga0105240_10149645 Ga0105240_101496452 593
161 3300013307 Ga0157372_10130872 Ga0157372_101308722 593
162 3300013308 Ga0157375_10086020 Ga0157375_100860201 593
163 3300025912 Ga0207707_10003402 Ga0207707_1000340211 593
164 3300025912 Ga0207707_10043539 Ga0207707_100435392 593
165 3300025912 Ga0207707_10059129 Ga0207707_100591294 593
166 3300025917 Ga0207660_10083473 Ga0207660_100834731 593
167 3300025921 Ga0207652_10046218 Ga0207652_100462182 593
168 3300026041 Ga0207639_10116668 Ga0207639_101166682 593
169 3300026116 Ga0207674_10022647 Ga0207674_100226477 593
170 3300026142 Ga0207698_10130467 Ga0207698_101304672 593
171 3300028379 Ga0268266_10019049 Ga0268266_100190497 593
172 3300037312 Ga0395899_0002275 Ga0395899_0002275_10652_12523 593
173 3300037418 Ga0395900_0011210 Ga0395900_0011210_2329_4209 593
174 3300037418 Ga0395900_0027540 Ga0395900_0027540_699_2570 593
175 3300037418 Ga0395900_0038511 Ga0395900_0038511_386_2257 593
176 3300037466 Ga0395898_0003758 Ga0395898_0003758_9233_11104 593
177 3300037466 Ga0395898_0037542 Ga0395898_0037542_1083_2969 593
178 3300037466 Ga0395898_0050757 Ga0395898_0050757_945_2816 593
179 3300037471 Ga0395905_0003026 Ga0395905_0003026_9100_10971 593
180 3300037471 Ga0395905_0037743 Ga0395905_0037743_67_1953 593
181 3300037853 Ga0436364_0136750 Ga0436364_0136750_480_2351 593
182 3300038443 Ga0395901_0001675 Ga0395901_0001675_11987_13858 593
183 3300038443 Ga0395901_0049359 Ga0395901_0049359_197_2068 593
184 3300045976 Ga0466967_0116508 Ga0466967_0116508_167_2044 593
185 3300046454 Ga0495592_0044097 Ga0495592_0044097_539_2419 593
186 3300046455 Ga0495603_0026003 Ga0495603_0026003_536_2422 593
187 3300046462 Ga0495651_0043113 Ga0495651_0043113_952_2832 593
188 3300046511 Ga0495608_0004788 Ga0495608_0004788_2520_4400 593
189 3300046516 Ga0495628_0002988 Ga0495628_0002988_2551_4431 593
190 3300046559 Ga0495667_0009208 Ga0495667_0009208_1544_3424 593
191 3300046663 Ga0495635_0060946 Ga0495635_0060946_649_2523 593
192 3300047317 Ga0495604_0024062 Ga0495604_0024062_272_2152 593
193 3300047319 Ga0495674_0015573 Ga0495674_0015573_2827_4707 593
194 3300047322 Ga0495680_0001277 Ga0495680_0001277_15021_16901 593
195 3300047444 Ga0495675_0036836 Ga0495675_0036836_744_2615 593
196 3300053077 Ga0495601_0028264 Ga0495601_0028264_1209_3080 593
197 3300053077 Ga0495601_0037541 Ga0495601_0037541_971_2851 593
198 3300037312 Ga0395899_0001403 Ga0395899_0001403_6811_8700 594
199 3300037418 Ga0395900_0003581 Ga0395900_0003581_5333_7222 594
200 3300037466 Ga0395898_0003476 Ga0395898_0003476_5122_7011 594
201 3300037471 Ga0395905_0001871 Ga0395905_0001871_15833_17722 594
202 3300038443 Ga0395901_0009392 Ga0395901_0009392_4579_6468 594
203 3300047315 Ga0495581_0000094 Ga0495581_0000094_4732_6618 594
204 3300047321 Ga0495676_0006801 Ga0495676_0006801_3259_5145 594
205 3300005981 Ga0081538_10000144 Ga0081538_1000014481 595
206 3300006038 Ga0075365_10053960 Ga0075365_100539602 595
207 3300006844 Ga0075428_100041218 Ga0075428_1000412184 595
208 3300006847 Ga0075431_100103418 Ga0075431_1001034182 595
209 3300006914 Ga0075436_100015333 Ga0075436_1000153332 595
210 3300009093 Ga0105240_10134757 Ga0105240_101347572 595
211 3300009147 Ga0114129_10000449 Ga0114129_1000044941 595
212 3300027907 Ga0207428_10016081 Ga0207428_100160815 595
213 3300048918 Ga0496115_0024799 Ga0496115_0024799_1514_3397 595
214 3300049581 Ga0501047_0129001 Ga0501047_0129001_538_2379 595
215 3300009094 Ga0111539_10006801 Ga0111539_100068018 596
216 3300025901 Ga0207688_10004328 Ga0207688_100043282 596
217 3300037418 Ga0395900_0002753 Ga0395900_0002753_519_2450 596
218 3300037466 Ga0395898_0005462 Ga0395898_0005462_7348_9279 596
219 3300037471 Ga0395905_0013805 Ga0395905_0013805_3328_5259 596
220 3300050507 nmdc:mga05p37_155331_c1 nmdc:mga05p37_155331_c1_166_2169 596
221 3300005577 Ga0068857_100118386 Ga0068857_1001183862 597
222 3300025935 Ga0207709_10037804 Ga0207709_100378042 597
223 3300048907 Ga0496104_0006333 Ga0496104_0006333_3583_5460 597
224 3300048908 Ga0496105_0000889 Ga0496105_0000889_2135_4012 597
225 3300005327 Ga0070658_10021473 Ga0070658_100214732 598
226 3300005435 Ga0070714_100041527 Ga0070714_1000415272 598
227 3300005530 Ga0070679_100069896 Ga0070679_1000698961 598
228 3300005563 Ga0068855_100122806 Ga0068855_1001228062 598
229 3300009093 Ga0105240_10145482 Ga0105240_101454822 598
230 3300009553 Ga0105249_10142982 Ga0105249_101429822 598
231 3300025919 Ga0207657_10039321 Ga0207657_100393213 598
232 3300025933 Ga0207706_10015099 Ga0207706_100150993 598
233 3300042015 Ga0439462_0000209 Ga0439462_0000209_3873_5780 598
234 3300042156 Ga0439446_0000387 Ga0439446_0000387_4811_6718 598
235 3300049568 Ga0501031_0002040 Ga0501031_0002040_6865_8748 598
236 3300049570 Ga0501033_0008600 Ga0501033_0008600_3032_4915 598
237 3300049572 Ga0501036_0078334 Ga0501036_0078334_700_2583 598
238 3300049573 Ga0501037_0003930 Ga0501037_0003930_1108_2991 598
239 3300049574 Ga0501038_0015520 Ga0501038_0015520_3849_5732 598
240 3300049576 Ga0501040_0034549 Ga0501040_0034549_103_1986 598
241 3300049577 Ga0501041_0016089 Ga0501041_0016089_609_2492 598
242 3300049579 Ga0501043_0018898 Ga0501043_0018898_2528_4411 598
243 3300049580 Ga0501046_0005087 Ga0501046_0005087_966_2849 598
244 3300049582 Ga0501048_0020631 Ga0501048_0020631_1968_3851 598
245 3300049585 Ga0501069_0009502 Ga0501069_0009502_2062_3945 598
246 3300049586 Ga0501070_0004629 Ga0501070_0004629_2010_3893 598
247 3300049587 Ga0501071_0041494 Ga0501071_0041494_283_2166 598
248 3300049589 Ga0501073_0027127 Ga0501073_0027127_410_2293 598
249 3300049592 Ga0501076_0039742 Ga0501076_0039742_1401_3284 598
250 3300049741 Ga0501079_0077072 Ga0501079_0077072_283_2166 598
251 3300049742 Ga0501080_0025490 Ga0501080_0025490_1108_2991 598
252 3300049743 Ga0501081_0041411 Ga0501081_0041411_103_1986 598
253 3300049822 Ga0501035_0021581 Ga0501035_0021581_2931_4814 598
254 3300049824 Ga0501045_0009860 Ga0501045_0009860_3033_4916 598
255 3300050508 nmdc:mga09592_6213_c1 nmdc:mga09592_6213_c1_1556_3451 598
256 3300050510 nmdc:mga06r32_302_c1 nmdc:mga06r32_302_c1_5468_7363 598
257 3300054114 Ga0501084_0102582 Ga0501084_0102582_283_2166 598
258 3300061734 Ga0530510_0043087 Ga0530510_0043087_411_2294 598
259 3300014497 Ga0182008_10000361 Ga0182008_100003613 599
260 3300025929 Ga0207664_10009609 Ga0207664_100096096 599
261 3300025929 Ga0207664_10082288 Ga0207664_100822882 599
262 3300037418 Ga0395900_0016217 Ga0395900_0016217_1479_3365 599
263 3300037466 Ga0395898_0022469 Ga0395898_0022469_4150_6036 599
264 3300037466 Ga0395898_0069928 Ga0395898_0069928_1330_3207 599
265 3300037471 Ga0395905_0009759 Ga0395905_0009759_1906_3804 599
266 3300038443 Ga0395901_0005040 Ga0395901_0005040_7558_9444 599
267 3300044694 Ga0466963_0003523 Ga0466963_0003523_6523_8385 599
268 3300045836 Ga0466958_0008831 Ga0466958_0008831_587_2449 599
269 3300045976 Ga0466967_0018127 Ga0466967_0018127_2026_3963 599
270 3300045976 Ga0466967_0030761 Ga0466967_0030761_1947_3809 599
271 3300045976 Ga0466967_0038124 Ga0466967_0038124_1673_3535 599
272 3300049568 Ga0501031_0012425 Ga0501031_0012425_2387_4282 599
273 3300049569 Ga0501032_0039458 Ga0501032_0039458_857_2752 599
274 3300049570 Ga0501033_0001134 Ga0501033_0001134_944_2839 599
275 3300049572 Ga0501036_0026511 Ga0501036_0026511_2437_4332 599
276 3300049573 Ga0501037_0002760 Ga0501037_0002760_2380_4275 599
277 3300049574 Ga0501038_0001432 Ga0501038_0001432_1234_3129 599
278 3300049575 Ga0501039_0000656 Ga0501039_0000656_20621_22516 599
279 3300049576 Ga0501040_0003394 Ga0501040_0003394_947_2842 599
280 3300049577 Ga0501041_0000771 Ga0501041_0000771_3959_5854 599
281 3300049578 Ga0501042_0008010 Ga0501042_0008010_979_2874 599
282 3300049579 Ga0501043_0000119 Ga0501043_0000119_68169_70064 599
283 3300049580 Ga0501046_0005248 Ga0501046_0005248_3799_5694 599
284 3300049581 Ga0501047_0000169 Ga0501047_0000169_21728_23623 599
285 3300049582 Ga0501048_0002722 Ga0501048_0002722_10635_12530 599
286 3300049584 Ga0501068_0000006 Ga0501068_0000006_68885_70780 599
287 3300049585 Ga0501069_0024173 Ga0501069_0024173_448_2343 599
288 3300049586 Ga0501070_0022287 Ga0501070_0022287_2319_4214 599
289 3300049587 Ga0501071_0000074 Ga0501071_0000074_11354_13249 599
290 3300049588 Ga0501072_0000273 Ga0501072_0000273_33481_35376 599
291 3300049589 Ga0501073_0002644 Ga0501073_0002644_9292_11187 599
292 3300049590 Ga0501074_0000005 Ga0501074_0000005_47639_49534 599
293 3300049591 Ga0501075_0001494 Ga0501075_0001494_6179_8074 599
294 3300049592 Ga0501076_0045930 Ga0501076_0045930_972_2867 599
295 3300049593 Ga0501077_0000492 Ga0501077_0000492_20239_22134 599
296 3300049741 Ga0501079_0004688 Ga0501079_0004688_3927_5822 599
297 3300049742 Ga0501080_0001003 Ga0501080_0001003_19704_21599 599
298 3300049743 Ga0501081_0004862 Ga0501081_0004862_4305_6200 599
299 3300049744 Ga0501083_0000115 Ga0501083_0000115_1694_3589 599
300 3300049822 Ga0501035_0005060 Ga0501035_0005060_1773_3668 599
301 3300049823 Ga0501044_0005712 Ga0501044_0005712_2483_4378 599
302 3300049824 Ga0501045_0001948 Ga0501045_0001948_979_2874 599
303 3300054114 Ga0501084_0001225 Ga0501084_0001225_11070_12965 599
304 3300060353 Ga0501082_0000114 Ga0501082_0000114_56269_58164 599
305 3300061734 Ga0530510_0004253 Ga0530510_0004253_3927_5822 599
306 3300005547 Ga0070693_100008411 Ga0070693_1000084114 600
307 3300006844 Ga0075428_100021634 Ga0075428_1000216345 600
308 3300006844 Ga0075428_100042353 Ga0075428_1000423533 600
309 3300006847 Ga0075431_100038646 Ga0075431_1000386463 600
310 3300006871 Ga0075434_100022473 Ga0075434_1000224732 600
311 3300007076 Ga0075435_100020496 Ga0075435_1000204963 600
312 3300009147 Ga0114129_10019762 Ga0114129_100197625 600
313 3300027907 Ga0207428_10008994 Ga0207428_100089945 600
314 3300036401 Ga0373937_0009529 Ga0373937_0009529_6541_8421 600
315 3300044694 Ga0466963_0009187 Ga0466963_0009187_1496_3358 600
316 3300046463 Ga0495653_0058773 Ga0495653_0058773_967_2847 600
317 3300046690 Ga0495624_0062503 Ga0495624_0062503_246_2162 600
318 3300047322 Ga0495680_0002766 Ga0495680_0002766_10383_12263 600
319 3300047471 Ga0495684_0027637 Ga0495684_0027637_784_2664 600
320 3300050507 nmdc:mga05p37_24663_c1 nmdc:mga05p37_24663_c1_2052_3938 600
321 3300053084 Ga0495595_0016493 Ga0495595_0016493_1017_2897 600
322 3300005329 Ga0070683_100041044 Ga0070683_1000410443 601
323 3300005468 Ga0070707_100040980 Ga0070707_1000409803 601
324 3300009093 Ga0105240_10015495 Ga0105240_1001549510 601
325 3300025922 Ga0207646_10026195 Ga0207646_100261952 601
326 3300025944 Ga0207661_10063508 Ga0207661_100635082 601
327 3300037312 Ga0395899_0084777 Ga0395899_0084777_153_2012 601
328 3300037418 Ga0395900_0013079 Ga0395900_0013079_422_2281 601
329 3300037471 Ga0395905_0010485 Ga0395905_0010485_6409_8268 601
330 3300038443 Ga0395901_0010892 Ga0395901_0010892_6027_7886 601
331 3300038443 Ga0395901_0086760 Ga0395901_0086760_941_2875 601
332 3300049742 Ga0501080_0115175 Ga0501080_0115175_415_2283 601
333 3300049744 Ga0501083_0001728 Ga0501083_0001728_5382_7250 601
334 3300005981 Ga0081538_10003640 Ga0081538_100036409 602
335 3300005985 Ga0081539_10001744 Ga0081539_1000174415 602
336 3300025928 Ga0207700_10073788 Ga0207700_100737882 602
337 3300028800 Ga0265338_10003714 Ga0265338_100037142 602
338 3300031344 Ga0265316_10064829 Ga0265316_100648292 602
339 3300031711 Ga0265314_10017315 Ga0265314_100173153 602
340 3300037418 Ga0395900_0011324 Ga0395900_0011324_2558_4492 602
341 3300037466 Ga0395898_0019777 Ga0395898_0019777_1710_3644 602
342 3300037471 Ga0395905_0028725 Ga0395905_0028725_2954_4822 602
343 3300037471 Ga0395905_0033092 Ga0395905_0033092_1943_3829 602
344 3300038443 Ga0395901_0007811 Ga0395901_0007811_1449_3317 602
345 3300038443 Ga0395901_0014377 Ga0395901_0014377_4954_6888 602
346 3300046523 Ga0495644_0000999 Ga0495644_0000999_6513_8456 602
347 3300046615 Ga0495656_0001877 Ga0495656_0001877_620_2563 602
348 3300046794 Ga0495589_0023356 Ga0495589_0023356_875_2818 602
349 3300050507 nmdc:mga05p37_116338_c1 nmdc:mga05p37_116338_c1_543_2405 602
350 3300050512 nmdc:mga0n895_142302_c1 nmdc:mga0n895_142302_c1_348_2210 602
351 3300013308 Ga0157375_10004527 Ga0157375_1000452713 603
352 3300025928 Ga0207700_10000021 Ga0207700_10000021118 603
353 3300025939 Ga0207665_10004060 Ga0207665_100040602 603
354 3300038443 Ga0395901_0053208 Ga0395901_0053208_25_1926 603
355 3300045049 Ga0466959_0015388 Ga0466959_0015388_673_2544 603
356 3300048910 Ga0496107_0008003 Ga0496107_0008003_3580_5448 603
357 3300048912 Ga0496109_0001502 Ga0496109_0001502_6927_8861 603
358 3300048913 Ga0496110_0001137 Ga0496110_0001137_6243_8177 603
359 3300048915 Ga0496112_0023128 Ga0496112_0023128_1961_3895 603
360 3300048916 Ga0496113_0058737 Ga0496113_0058737_431_2365 603
361 3300005329 Ga0070683_100000386 Ga0070683_10000038619 604
362 3300005458 Ga0070681_10033577 Ga0070681_100335773 604
363 3300025912 Ga0207707_10017291 Ga0207707_100172913 604
364 3300028577 Ga0265318_10001532 Ga0265318_100015324 604
365 3300028654 Ga0265322_10010169 Ga0265322_100101692 604
366 3300028800 Ga0265338_10040367 Ga0265338_100403672 604
367 3300031238 Ga0265332_10004049 Ga0265332_100040492 604
368 3300031595 Ga0265313_10003763 Ga0265313_100037633 604
369 3300037312 Ga0395899_0044151 Ga0395899_0044151_578_2482 604
370 3300037418 Ga0395900_0001501 Ga0395900_0001501_1598_3502 604
371 3300037418 Ga0395900_0004234 Ga0395900_0004234_1512_3386 604
372 3300037466 Ga0395898_0019620 Ga0395898_0019620_4527_6431 604
373 3300037471 Ga0395905_0006070 Ga0395905_0006070_2295_4199 604
374 3300038443 Ga0395901_0010102 Ga0395901_0010102_4596_6500 604
375 3300044719 Ga0466971_0030927 Ga0466971_0030927_200_2068 604
376 3300045049 Ga0466959_0006491 Ga0466959_0006491_4351_6219 604
377 3300045836 Ga0466958_0028101 Ga0466958_0028101_335_2203 604
378 3300045836 Ga0466958_0044658 Ga0466958_0044658_626_2506 604
379 3300045836 Ga0466958_0061655 Ga0466958_0061655_239_2107 604
380 3300045976 Ga0466967_0000287 Ga0466967_0000287_3530_5407 604
381 3300045976 Ga0466967_0001032 Ga0466967_0001032_6564_8432 604
382 3300049583 Ga0501067_0008085 Ga0501067_0008085_3342_5207 604
383 3300005336 Ga0070680_100010865 Ga0070680_1000108654 605
384 3300005339 Ga0070660_100002458 Ga0070660_1000024589 605
385 3300005530 Ga0070679_100024335 Ga0070679_1000243354 605
386 3300005937 Ga0081455_10028683 Ga0081455_100286836 605
387 3300006846 Ga0075430_100000145 Ga0075430_10000014525 605
388 3300006847 Ga0075431_100000215 Ga0075431_1000002158 605
389 3300006880 Ga0075429_100000588 Ga0075429_10000058824 605
390 3300013105 Ga0157369_10002933 Ga0157369_100029337 605
391 3300020081 Ga0206354_11309496 Ga0206354_113094962 605
392 3300020082 Ga0206353_10274955 Ga0206353_102749558 605
393 3300020082 Ga0206353_10523491 Ga0206353_105234912 605
394 3300025912 Ga0207707_10004389 Ga0207707_100043895 605
395 3300025917 Ga0207660_10008331 Ga0207660_100083314 605
396 3300025919 Ga0207657_10003932 Ga0207657_100039327 605
397 3300025921 Ga0207652_10014630 Ga0207652_100146303 605
398 3300035089 Ga0373944_0001034 Ga0373944_0001034_3442_5331 605
399 3300035116 Ga0373945_0000756 Ga0373945_0000756_415_2304 605
400 3300035170 Ga0373943_0000887 Ga0373943_0000887_3214_5103 605
401 3300035725 Ga0373947_0004250 Ga0373947_0004250_863_2752 605
402 3300037068 Ga0373925_0004068 Ga0373925_0004068_2649_4538 605
403 3300038443 Ga0395901_0064672 Ga0395901_0064672_525_2411 605
404 3300045976 Ga0466967_0025109 Ga0466967_0025109_2360_4240 605
405 3300045976 Ga0466967_0186148 Ga0466967_0186148_42_1919 605
406 3300046459 Ga0495629_0002685 Ga0495629_0002685_9058_10947 605
407 3300046461 Ga0495641_0000799 Ga0495641_0000799_6406_8295 605
408 3300046473 Ga0495582_0000108 Ga0495582_0000108_18040_19929 605
409 3300046475 Ga0495639_0002327 Ga0495639_0002327_631_2520 605
410 3300046476 Ga0495662_0004423 Ga0495662_0004423_112_2001 605
411 3300046531 Ga0495665_0008293 Ga0495665_0008293_2676_4565 605
412 3300046533 Ga0495640_0044572 Ga0495640_0044572_861_2750 605
413 3300046536 Ga0495587_0047392 Ga0495587_0047392_573_2459 605
414 3300046683 Ga0495658_0000132 Ga0495658_0000132_33103_34992 605
415 3300046689 Ga0495613_0003232 Ga0495613_0003232_2576_4465 605
416 3300047315 Ga0495581_0001044 Ga0495581_0001044_5183_7072 605
417 3300047317 Ga0495604_0074300 Ga0495604_0074300_180_2069 605
418 3300047319 Ga0495674_0048352 Ga0495674_0048352_902_2791 605
419 3300047321 Ga0495676_0000313 Ga0495676_0000313_21672_23561 605
420 3300047322 Ga0495680_0010897 Ga0495680_0010897_3999_5888 605
421 3300047471 Ga0495684_0002863 Ga0495684_0002863_9514_11403 605
422 3300048089 Ga0495614_0001315 Ga0495614_0001315_6487_8376 605
423 3300048912 Ga0496109_0044980 Ga0496109_0044980_1466_3415 605
424 3300053084 Ga0495595_0035053 Ga0495595_0035053_195_2066 605
425 3300053085 Ga0495619_0004108 Ga0495619_0004108_1205_3094 605
426 3300053085 Ga0495619_0032187 Ga0495619_0032187_45_1934 605
427 iso_pu_bacteria 2738543028 2739332539 605
428 3300005436 Ga0070713_100099589 Ga0070713_1000995891 606
429 3300005444 Ga0070694_100000704 Ga0070694_10000070416 606
430 3300005563 Ga0068855_100005058 Ga0068855_10000505810 606
431 3300006028 Ga0070717_10009361 Ga0070717_100093613 606
432 3300009147 Ga0114129_10003593 Ga0114129_1000359318 606
433 3300025919 Ga0207657_10002085 Ga0207657_100020854 606
434 3300026088 Ga0207641_10117520 Ga0207641_101175202 606
435 3300027907 Ga0207428_10037934 Ga0207428_100379342 606
436 3300028573 Ga0265334_10026049 Ga0265334_100260491 606
437 3300028577 Ga0265318_10003338 Ga0265318_100033381 606
438 3300028800 Ga0265338_10000938 Ga0265338_1000093845 606
439 3300031251 Ga0265327_10005584 Ga0265327_100055846 606
440 3300031344 Ga0265316_10033711 Ga0265316_100337112 606
441 3300037471 Ga0395905_0048420 Ga0395905_0048420_1731_3608 606
442 3300046535 Ga0495586_0021785 Ga0495586_0021785_1423_3306 606
443 3300048912 Ga0496109_0007873 Ga0496109_0007873_3882_5759 606
444 3300048914 Ga0496111_0023323 Ga0496111_0023323_181_2058 606
445 3300048915 Ga0496112_0004326 Ga0496112_0004326_2105_3982 606
446 3300048915 Ga0496112_0036119 Ga0496112_0036119_28_1905 606
447 3300049744 Ga0501083_0005232 Ga0501083_0005232_6316_8250 606
448 3300053078 Ga0495612_0016340 Ga0495612_0016340_120_2003 606
449 3300005345 Ga0070692_10005008 Ga0070692_100050084 607
450 3300005366 Ga0070659_100043312 Ga0070659_1000433122 607
451 3300005937 Ga0081455_10057998 Ga0081455_100579983 607
452 3300005981 Ga0081538_10000026 Ga0081538_1000002656 607
453 3300006844 Ga0075428_100009214 Ga0075428_10000921411 607
454 3300009147 Ga0114129_10006238 Ga0114129_1000623814 607
455 3300009148 Ga0105243_10006619 Ga0105243_100066195 607
456 3300009176 Ga0105242_10028885 Ga0105242_100288854 607
457 3300013105 Ga0157369_10161047 Ga0157369_101610472 607
458 3300037312 Ga0395899_0006429 Ga0395899_0006429_157_2103 607
459 3300037466 Ga0395898_0049312 Ga0395898_0049312_601_2547 607
460 3300038443 Ga0395901_0013963 Ga0395901_0013963_5916_7862 607
461 3300045051 Ga0451576_0017213 Ga0451576_0017213_568_2505 607
462 3300046473 Ga0495582_0000035 Ga0495582_0000035_53877_55841 607
463 3300046683 Ga0495658_0001131 Ga0495658_0001131_1932_3896 607
464 3300047315 Ga0495581_0000707 Ga0495581_0000707_14231_16195 607
465 3300049568 Ga0501031_0001050 Ga0501031_0001050_13704_15623 607
466 3300049568 Ga0501031_0081138 Ga0501031_0081138_211_2103 607
467 3300049572 Ga0501036_0007571 Ga0501036_0007571_6625_8544 607
468 3300049574 Ga0501038_0041040 Ga0501038_0041040_99_1991 607
469 3300049575 Ga0501039_0006314 Ga0501039_0006314_2617_4536 607
470 3300049575 Ga0501039_0021604 Ga0501039_0021604_200_2092 607
471 3300049577 Ga0501041_0006683 Ga0501041_0006683_56_1975 607
472 3300049577 Ga0501041_0071548 Ga0501041_0071548_152_2044 607
473 3300049578 Ga0501042_0009352 Ga0501042_0009352_4610_6502 607
474 3300049578 Ga0501042_0014204 Ga0501042_0014204_3058_4977 607
475 3300049580 Ga0501046_0025783 Ga0501046_0025783_1182_3101 607
476 3300049582 Ga0501048_0001137 Ga0501048_0001137_17136_19055 607
477 3300049586 Ga0501070_0107430 Ga0501070_0107430_53_1972 607
478 3300049587 Ga0501071_0007711 Ga0501071_0007711_3522_5414 607
479 3300049587 Ga0501071_0057012 Ga0501071_0057012_448_2367 607
480 3300049588 Ga0501072_0013353 Ga0501072_0013353_1604_3496 607
481 3300049588 Ga0501072_0080597 Ga0501072_0080597_248_2140 607
482 3300049588 Ga0501072_0086845 Ga0501072_0086845_471_2390 607
483 3300049591 Ga0501075_0000895 Ga0501075_0000895_8293_10212 607
484 3300049591 Ga0501075_0003608 Ga0501075_0003608_4444_6336 607
485 3300049591 Ga0501075_0009567 Ga0501075_0009567_932_2893 607
486 3300049592 Ga0501076_0002273 Ga0501076_0002273_1740_3659 607
487 3300049592 Ga0501076_0002933 Ga0501076_0002933_2525_4444 607
488 3300049592 Ga0501076_0022841 Ga0501076_0022841_2517_4409 607
489 3300049593 Ga0501077_0012515 Ga0501077_0012515_1929_3848 607
490 3300049741 Ga0501079_0003522 Ga0501079_0003522_2517_4409 607
491 3300049741 Ga0501079_0019750 Ga0501079_0019750_2449_4341 607
492 3300049741 Ga0501079_0034806 Ga0501079_0034806_361_2280 607
493 3300049742 Ga0501080_0016342 Ga0501080_0016342_253_2172 607
494 3300049743 Ga0501081_0002549 Ga0501081_0002549_1746_3665 607
495 3300049743 Ga0501081_0014313 Ga0501081_0014313_845_2764 607
496 3300049822 Ga0501035_0004302 Ga0501035_0004302_7105_9024 607
497 3300049824 Ga0501045_0000725 Ga0501045_0000725_11329_13248 607
498 3300049824 Ga0501045_0002187 Ga0501045_0002187_1681_3573 607
499 3300049824 Ga0501045_0019605 Ga0501045_0019605_2507_4426 607
500 3300049824 Ga0501045_0051330 Ga0501045_0051330_638_2557 607
501 3300050507 nmdc:mga05p37_3445_c1 nmdc:mga05p37_3445_c1_12693_14585 607
502 3300050508 nmdc:mga09592_8952_c1 nmdc:mga09592_8952_c1_3941_5833 607
503 3300054114 Ga0501084_0002919 Ga0501084_0002919_7949_9868 607
504 3300060353 Ga0501082_0002606 Ga0501082_0002606_11499_13391 607
505 3300060353 Ga0501082_0012065 Ga0501082_0012065_5218_7137 607
506 3300061734 Ga0530510_0008572 Ga0530510_0008572_586_2478 607
507 3300061734 Ga0530510_0013398 Ga0530510_0013398_2158_4077 607
508 3300061734 Ga0530510_0041080 Ga0530510_0041080_362_2287 607
509 3300005544 Ga0070686_100011217 Ga0070686_1000112174 608
510 3300009987 Ga0105030_100636 Ga0105030_1006363 608
511 3300025935 Ga0207709_10030105 Ga0207709_100301053 608
512 3300026075 Ga0207708_10019634 Ga0207708_100196342 608
513 3300049568 Ga0501031_0033466 Ga0501031_0033466_1349_3241 608
514 3300049570 Ga0501033_0041969 Ga0501033_0041969_775_2667 608
515 3300049575 Ga0501039_0001387 Ga0501039_0001387_1774_3666 608
516 3300049576 Ga0501040_0032847 Ga0501040_0032847_1524_3416 608
517 3300049580 Ga0501046_0024735 Ga0501046_0024735_952_2844 608
518 3300049582 Ga0501048_0009323 Ga0501048_0009323_1021_2913 608
519 3300049587 Ga0501071_0001967 Ga0501071_0001967_4188_6080 608
520 3300049588 Ga0501072_0025134 Ga0501072_0025134_30_1922 608
521 3300049592 Ga0501076_0011795 Ga0501076_0011795_2079_3971 608
522 3300049593 Ga0501077_0038946 Ga0501077_0038946_41_1933 608
523 3300049741 Ga0501079_0002994 Ga0501079_0002994_9335_11227 608
524 3300049741 Ga0501079_0059732 Ga0501079_0059732_85_2007 608
525 3300049743 Ga0501081_0061960 Ga0501081_0061960_653_2545 608
526 3300049822 Ga0501035_0042807 Ga0501035_0042807_1441_3333 608
527 3300049824 Ga0501045_0004064 Ga0501045_0004064_3072_4964 608
528 3300060353 Ga0501082_0018599 Ga0501082_0018599_1791_3683 608
529 3300061734 Ga0530510_0092377 Ga0530510_0092377_23_1918 608
530 3300005331 Ga0070670_100017978 Ga0070670_1000179782 609
531 3300005344 Ga0070661_100015433 Ga0070661_1000154335 609
532 3300005437 Ga0070710_10016280 Ga0070710_100162803 609
533 3300005441 Ga0070700_100004326 Ga0070700_1000043265 609
534 3300005445 Ga0070708_100002195 Ga0070708_10000219514 609
535 3300005455 Ga0070663_100021872 Ga0070663_1000218724 609
536 3300005564 Ga0070664_100003282 Ga0070664_1000032829 609
537 3300005564 Ga0070664_100051834 Ga0070664_1000518342 609
538 3300005618 Ga0068864_100003608 Ga0068864_1000036086 609
539 3300005937 Ga0081455_10003035 Ga0081455_1000303513 609
540 3300006852 Ga0075433_10000183 Ga0075433_1000018318 609
541 3300006852 Ga0075433_10007444 Ga0075433_100074443 609
542 3300006871 Ga0075434_100001199 Ga0075434_10000119915 609
543 3300006871 Ga0075434_100011468 Ga0075434_1000114685 609
544 3300009094 Ga0111539_10001159 Ga0111539_1000115915 609
545 3300009147 Ga0114129_10026358 Ga0114129_100263583 609
546 3300009147 Ga0114129_10029773 Ga0114129_100297731 609
547 3300013306 Ga0163162_10095468 Ga0163162_100954683 609
548 3300025885 Ga0207653_10001283 Ga0207653_100012836 609
549 3300025908 Ga0207643_10000271 Ga0207643_100002719 609
550 3300025925 Ga0207650_10001473 Ga0207650_100014736 609
551 3300025942 Ga0207689_10104913 Ga0207689_101049132 609
552 3300026078 Ga0207702_10068699 Ga0207702_100686992 609
553 3300026088 Ga0207641_10025082 Ga0207641_100250822 609
554 3300026095 Ga0207676_10001319 Ga0207676_1000131912 609
555 3300026116 Ga0207674_10001399 Ga0207674_1000139919 609
556 3300027907 Ga0207428_10013956 Ga0207428_100139565 609
557 3300037418 Ga0395900_0048508 Ga0395900_0048508_2063_3991 609
558 3300037466 Ga0395898_0088240 Ga0395898_0088240_997_2913 609
559 3300038443 Ga0395901_0160489 Ga0395901_0160489_48_1964 609
560 3300046689 Ga0495613_0031525 Ga0495613_0031525_219_2150 609
561 3300049571 Ga0501034_0011160 Ga0501034_0011160_7316_9304 609
562 3300049583 Ga0501067_0000031 Ga0501067_0000031_62157_64106 609
563 3300049584 Ga0501068_0000884 Ga0501068_0000884_777_2726 609
564 3300049584 Ga0501068_0048313 Ga0501068_0048313_130_2061 609
565 3300049585 Ga0501069_0000032 Ga0501069_0000032_27157_29106 609
566 3300049587 Ga0501071_0073488 Ga0501071_0073488_231_2180 609
567 3300050511 nmdc:mga08y16_54867_c1 nmdc:mga08y16_54867_c1_910_2841 609
568 3300050512 nmdc:mga0n895_21311_c1 nmdc:mga0n895_21311_c1_2765_4756 609
569 3300050512 nmdc:mga0n895_53458_c1 nmdc:mga0n895_53458_c1_138_2069 609
570 3300050515 nmdc:mga0a205_2952_c1 nmdc:mga0a205_2952_c1_3323_5254 609
571 3300050515 nmdc:mga0a205_506_c1 nmdc:mga0a205_506_c1_23467_25398 609
572 3300061734 Ga0530510_0000745 Ga0530510_0000745_3420_5369 609
573 3300005338 Ga0068868_100003392 Ga0068868_1000033925 610
574 3300005339 Ga0070660_100004634 Ga0070660_1000046342 610
575 3300005341 Ga0070691_10025959 Ga0070691_100259592 610
576 3300005435 Ga0070714_100026666 Ga0070714_1000266663 610
577 3300005436 Ga0070713_100037973 Ga0070713_1000379732 610
578 3300005439 Ga0070711_100009319 Ga0070711_1000093193 610
579 3300005444 Ga0070694_100027400 Ga0070694_1000274001 610
580 3300005445 Ga0070708_100048686 Ga0070708_1000486863 610
581 3300005456 Ga0070678_100049775 Ga0070678_1000497752 610
582 3300005467 Ga0070706_100019230 Ga0070706_1000192304 610
583 3300005547 Ga0070693_100018093 Ga0070693_1000180932 610
584 3300005563 Ga0068855_100012319 Ga0068855_1000123193 610
585 3300005563 Ga0068855_100107571 Ga0068855_1001075712 610
586 3300005614 Ga0068856_100099345 Ga0068856_1000993452 610
587 3300005937 Ga0081455_10017541 Ga0081455_100175415 610
588 3300005981 Ga0081538_10004394 Ga0081538_100043949 610
589 3300005983 Ga0081540_1002674 Ga0081540_100267412 610
590 3300005983 Ga0081540_1007427 Ga0081540_10074275 610
591 3300005983 Ga0081540_1044867 Ga0081540_10448671 610
592 3300005985 Ga0081539_10001238 Ga0081539_1000123820 610
593 3300006028 Ga0070717_10021733 Ga0070717_100217334 610
594 3300006844 Ga0075428_100031527 Ga0075428_1000315274 610
595 3300006846 Ga0075430_100000493 Ga0075430_10000049313 610
596 3300006847 Ga0075431_100017146 Ga0075431_1000171462 610
597 3300006880 Ga0075429_100022644 Ga0075429_1000226444 610
598 3300009098 Ga0105245_10003127 Ga0105245_100031279 610
599 3300009098 Ga0105245_10007097 Ga0105245_100070974 610
600 3300009176 Ga0105242_10053401 Ga0105242_100534011 610
601 3300009551 Ga0105238_10019519 Ga0105238_100195196 610
602 3300011119 Ga0105246_10040428 Ga0105246_100404282 610
603 3300013297 Ga0157378_10033396 Ga0157378_100333963 610
604 3300013307 Ga0157372_10059797 Ga0157372_100597973 610
605 3300013308 Ga0157375_10049716 Ga0157375_100497162 610
606 3300014325 Ga0163163_10002871 Ga0163163_1000287110 610
607 3300014325 Ga0163163_10074682 Ga0163163_100746822 610
608 3300025901 Ga0207688_10016056 Ga0207688_100160561 610
609 3300025907 Ga0207645_10014375 Ga0207645_100143754 610
610 3300025911 Ga0207654_10065314 Ga0207654_100653141 610
611 3300025915 Ga0207693_10007323 Ga0207693_100073233 610
612 3300025915 Ga0207693_10065551 Ga0207693_100655513 610
613 3300025916 Ga0207663_10006685 Ga0207663_100066852 610
614 3300025916 Ga0207663_10006778 Ga0207663_100067784 610
615 3300025919 Ga0207657_10001018 Ga0207657_1000101823 610
616 3300025927 Ga0207687_10001051 Ga0207687_100010517 610
617 3300025927 Ga0207687_10017058 Ga0207687_100170583 610
618 3300025928 Ga0207700_10008511 Ga0207700_100085112 610
619 3300025929 Ga0207664_10011558 Ga0207664_100115583 610
620 3300025929 Ga0207664_10033912 Ga0207664_100339123 610
621 3300025932 Ga0207690_10017626 Ga0207690_100176263 610
622 3300025935 Ga0207709_10061233 Ga0207709_100612332 610
623 3300025939 Ga0207665_10000494 Ga0207665_1000049414 610
624 3300025949 Ga0207667_10005782 Ga0207667_100057822 610
625 3300026075 Ga0207708_10007892 Ga0207708_100078925 610
626 3300026078 Ga0207702_10008328 Ga0207702_100083286 610
627 3300026078 Ga0207702_10009665 Ga0207702_100096658 610
628 3300026121 Ga0207683_10110934 Ga0207683_101109342 610
629 3300026142 Ga0207698_10120512 Ga0207698_101205121 610
630 3300027907 Ga0207428_10012856 Ga0207428_100128564 610
631 3300032126 Ga0307415_100085727 Ga0307415_1000857271 610
632 3300035113 Ga0373936_0015357 Ga0373936_0015357_791_2731 610
633 3300035116 Ga0373945_0001806 Ga0373945_0001806_613_2550 610
634 3300035725 Ga0373947_0004638 Ga0373947_0004638_4574_6511 610
635 3300037068 Ga0373925_0006938 Ga0373925_0006938_1363_3300 610
636 3300037312 Ga0395899_0000775 Ga0395899_0000775_8776_10713 610
637 3300037312 Ga0395899_0002400 Ga0395899_0002400_10956_12902 610
638 3300037418 Ga0395900_0004308 Ga0395900_0004308_12325_14271 610
639 3300037418 Ga0395900_0010135 Ga0395900_0010135_6109_8046 610
640 3300037466 Ga0395898_0002328 Ga0395898_0002328_16798_18744 610
641 3300037466 Ga0395898_0010278 Ga0395898_0010278_7246_9183 610
642 3300037471 Ga0395905_0004036 Ga0395905_0004036_2302_4248 610
643 3300037471 Ga0395905_0078468 Ga0395905_0078468_209_2146 610
644 3300038443 Ga0395901_0005281 Ga0395901_0005281_8196_10142 610
645 3300046455 Ga0495603_0000062 Ga0495603_0000062_40936_42873 610
646 3300046461 Ga0495641_0001703 Ga0495641_0001703_7936_9873 610
647 3300046473 Ga0495582_0007475 Ga0495582_0007475_1250_3187 610
648 3300046499 Ga0495594_0000447 Ga0495594_0000447_16197_18134 610
649 3300046517 Ga0495630_0020054 Ga0495630_0020054_682_2619 610
650 3300046674 Ga0495588_0000632 Ga0495588_0000632_566_2503 610
651 3300047315 Ga0495581_0013950 Ga0495581_0013950_2325_4265 610
652 3300047321 Ga0495676_0000253 Ga0495676_0000253_5478_7415 610
653 3300048905 Ga0496102_0052703 Ga0496102_0052703_679_2616 610
654 3300048905 Ga0496102_0066679 Ga0496102_0066679_630_2576 610
655 3300048906 Ga0496103_0005579 Ga0496103_0005579_3560_5497 610
656 3300048907 Ga0496104_0002508 Ga0496104_0002508_3913_5850 610
657 3300048907 Ga0496104_0003548 Ga0496104_0003548_9668_11605 610
658 3300048907 Ga0496104_0104227 Ga0496104_0104227_403_2340 610
659 3300048908 Ga0496105_0000042 Ga0496105_0000042_79563_81500 610
660 3300048908 Ga0496105_0002088 Ga0496105_0002088_12139_14076 610
661 3300048908 Ga0496105_0007763 Ga0496105_0007763_5272_7206 610
662 3300048909 Ga0496106_0050996 Ga0496106_0050996_1019_2956 610
663 3300048910 Ga0496107_0025620 Ga0496107_0025620_920_2857 610
664 3300048911 Ga0496108_0002105 Ga0496108_0002105_11217_13154 610
665 3300048911 Ga0496108_0008774 Ga0496108_0008774_5350_7284 610
666 3300048912 Ga0496109_0001909 Ga0496109_0001909_11101_13038 610
667 3300048912 Ga0496109_0007553 Ga0496109_0007553_1170_3107 610
668 3300048912 Ga0496109_0012839 Ga0496109_0012839_911_2845 610
669 3300048912 Ga0496109_0034618 Ga0496109_0034618_2338_4284 610
670 3300048913 Ga0496110_0000050 Ga0496110_0000050_20500_22437 610
671 3300048913 Ga0496110_0001680 Ga0496110_0001680_1160_3094 610
672 3300048913 Ga0496110_0001795 Ga0496110_0001795_11050_12987 610
673 3300048913 Ga0496110_0017248 Ga0496110_0017248_1769_3715 610
674 3300048914 Ga0496111_0000220 Ga0496111_0000220_6110_8047 610
675 3300048914 Ga0496111_0000439 Ga0496111_0000439_13904_15841 610
676 3300048914 Ga0496111_0000680 Ga0496111_0000680_1001_2935 610
677 3300048915 Ga0496112_0000202 Ga0496112_0000202_28930_30819 610
678 3300048915 Ga0496112_0002189 Ga0496112_0002189_4263_6200 610
679 3300048915 Ga0496112_0006106 Ga0496112_0006106_1120_3054 610
680 3300048916 Ga0496113_0000517 Ga0496113_0000517_12333_14270 610
681 3300048916 Ga0496113_0034272 Ga0496113_0034272_900_2834 610
682 3300048917 Ga0496114_0021823 Ga0496114_0021823_964_2910 610
683 3300048918 Ga0496115_0009767 Ga0496115_0009767_4864_6807 610
684 3300049568 Ga0501031_0009117 Ga0501031_0009117_2341_4233 610
685 3300049568 Ga0501031_0034157 Ga0501031_0034157_271_2184 610
686 3300049570 Ga0501033_0016473 Ga0501033_0016473_804_2696 610
687 3300049572 Ga0501036_0000292 Ga0501036_0000292_2495_4387 610
688 3300049572 Ga0501036_0016240 Ga0501036_0016240_3869_5782 610
689 3300049572 Ga0501036_0103279 Ga0501036_0103279_130_2076 610
690 3300049575 Ga0501039_0007993 Ga0501039_0007993_3538_5451 610
691 3300049576 Ga0501040_0004312 Ga0501040_0004312_2399_4291 610
692 3300049577 Ga0501041_0003770 Ga0501041_0003770_3202_5115 610
693 3300049577 Ga0501041_0010801 Ga0501041_0010801_2229_4121 610
694 3300049578 Ga0501042_0002209 Ga0501042_0002209_1839_3731 610
695 3300049578 Ga0501042_0013388 Ga0501042_0013388_520_2433 610
696 3300049580 Ga0501046_0009805 Ga0501046_0009805_2229_4121 610
697 3300049582 Ga0501048_0009088 Ga0501048_0009088_3235_5127 610
698 3300049585 Ga0501069_0014011 Ga0501069_0014011_1603_3516 610
699 3300049586 Ga0501070_0054883 Ga0501070_0054883_392_2284 610
700 3300049587 Ga0501071_0002185 Ga0501071_0002185_8601_10514 610
701 3300049588 Ga0501072_0012219 Ga0501072_0012219_2442_4334 610
702 3300049588 Ga0501072_0041253 Ga0501072_0041253_262_2208 610
703 3300049589 Ga0501073_0089863 Ga0501073_0089863_84_1976 610
704 3300049591 Ga0501075_0000166 Ga0501075_0000166_2186_4078 610
705 3300049591 Ga0501075_0014599 Ga0501075_0014599_3536_5449 610
706 3300049592 Ga0501076_0001762 Ga0501076_0001762_10621_12513 610
707 3300049592 Ga0501076_0005520 Ga0501076_0005520_4079_5992 610
708 3300049593 Ga0501077_0000708 Ga0501077_0000708_16765_18657 610
709 3300049593 Ga0501077_0004809 Ga0501077_0004809_6107_8020 610
710 3300049593 Ga0501077_0026008 Ga0501077_0026008_310_2238 610
711 3300049741 Ga0501079_0014129 Ga0501079_0014129_1764_3656 610
712 3300049741 Ga0501079_0032359 Ga0501079_0032359_1354_3267 610
713 3300049742 Ga0501080_0016204 Ga0501080_0016204_598_2511 610
714 3300049743 Ga0501081_0000280 Ga0501081_0000280_17776_19668 610
715 3300049744 Ga0501083_0039984 Ga0501083_0039984_106_1998 610
716 3300049822 Ga0501035_0077209 Ga0501035_0077209_1019_2911 610
717 3300049824 Ga0501045_0006176 Ga0501045_0006176_2355_4247 610
718 3300049824 Ga0501045_0013014 Ga0501045_0013014_3850_5763 610
719 3300050508 nmdc:mga09592_51534_c1 nmdc:mga09592_51534_c1_57_1970 610
720 3300050509 nmdc:mga0qj67_14956_c1 nmdc:mga0qj67_14956_c1_644_2557 610
721 3300050510 nmdc:mga06r32_6991_c1 nmdc:mga06r32_6991_c1_1703_3616 610
722 3300054114 Ga0501084_0000470 Ga0501084_0000470_27061_28953 610
723 3300054114 Ga0501084_0035345 Ga0501084_0035345_692_2605 610
724 3300060353 Ga0501082_0010212 Ga0501082_0010212_105_2018 610
725 3300060353 Ga0501082_0011585 Ga0501082_0011585_2502_4394 610
726 3300061734 Ga0530510_0012967 Ga0530510_0012967_1496_3388 610
727 3300061734 Ga0530510_0019242 Ga0530510_0019242_1577_3490 610
728 3300005347 Ga0070668_100055286 Ga0070668_1000552862 611
729 3300005437 Ga0070710_10023947 Ga0070710_100239473 611
730 3300005439 Ga0070711_100003234 Ga0070711_1000032345 611
731 3300005439 Ga0070711_100016246 Ga0070711_1000162461 611
732 3300005445 Ga0070708_100020586 Ga0070708_1000205864 611
733 3300005445 Ga0070708_100071796 Ga0070708_1000717962 611
734 3300005457 Ga0070662_100010040 Ga0070662_1000100403 611
735 3300005467 Ga0070706_100061519 Ga0070706_1000615192 611
736 3300005467 Ga0070706_100066422 Ga0070706_1000664222 611
737 3300005468 Ga0070707_100015833 Ga0070707_1000158332 611
738 3300005546 Ga0070696_100005413 Ga0070696_1000054132 611
739 3300005549 Ga0070704_100055585 Ga0070704_1000555852 611
740 3300005719 Ga0068861_100004853 Ga0068861_1000048533 611
741 3300005985 Ga0081539_10002467 Ga0081539_100024679 611
742 3300006163 Ga0070715_10005573 Ga0070715_100055733 611
743 3300006175 Ga0070712_100020541 Ga0070712_1000205412 611
744 3300006852 Ga0075433_10006740 Ga0075433_100067405 611
745 3300006914 Ga0075436_100016196 Ga0075436_1000161963 611
746 3300006914 Ga0075436_100033015 Ga0075436_1000330151 611
747 3300007076 Ga0075435_100008499 Ga0075435_1000084996 611
748 3300009098 Ga0105245_10105693 Ga0105245_101056932 611
749 3300009147 Ga0114129_10007461 Ga0114129_1000746111 611
750 3300009147 Ga0114129_10033600 Ga0114129_100336003 611
751 3300009176 Ga0105242_10042999 Ga0105242_100429992 611
752 3300009176 Ga0105242_10094813 Ga0105242_100948132 611
753 3300009553 Ga0105249_10003122 Ga0105249_1000312211 611
754 3300010375 Ga0105239_10096388 Ga0105239_100963883 611
755 3300013307 Ga0157372_10113791 Ga0157372_101137911 611
756 3300025906 Ga0207699_10056313 Ga0207699_100563132 611
757 3300025915 Ga0207693_10000126 Ga0207693_100001266 611
758 3300025915 Ga0207693_10012427 Ga0207693_100124271 611
759 3300025915 Ga0207693_10014751 Ga0207693_100147514 611
760 3300025916 Ga0207663_10006546 Ga0207663_100065462 611
761 3300025927 Ga0207687_10006514 Ga0207687_100065146 611
762 3300025933 Ga0207706_10110712 Ga0207706_101107122 611
763 3300026118 Ga0207675_100001825 Ga0207675_10000182517 611
764 3300026118 Ga0207675_100006535 Ga0207675_1000065353 611
765 3300026121 Ga0207683_10045755 Ga0207683_100457552 611
766 3300031251 Ga0265327_10001417 Ga0265327_1000141724 611
767 3300034816 Ga0373930_0002659 Ga0373930_0002659_169_2106 611
768 3300035083 Ga0373926_0002187 Ga0373926_0002187_1085_3034 611
769 3300035091 Ga0373951_0009832 Ga0373951_0009832_194_2131 611
770 3300035112 Ga0373932_0000793 Ga0373932_0000793_5026_6963 611
771 3300035113 Ga0373936_0000489 Ga0373936_0000489_10070_12019 611
772 3300035121 Ga0373960_0006970 Ga0373960_0006970_472_2409 611
773 3300035170 Ga0373943_0011312 Ga0373943_0011312_1213_3162 611
774 3300037418 Ga0395900_0031564 Ga0395900_0031564_1304_3241 611
775 3300037418 Ga0395900_0120162 Ga0395900_0120162_25_1962 611
776 3300037471 Ga0395905_0025074 Ga0395905_0025074_407_2344 611
777 3300038443 Ga0395901_0043856 Ga0395901_0043856_389_2326 611
778 3300041443 Ga0451789_0349216 Ga0451789_0349216_118_2055 611
779 3300044901 Ga0466960_0002008 Ga0466960_0002008_3787_5724 611
780 3300046459 Ga0495629_0018017 Ga0495629_0018017_2614_4563 611
781 3300046461 Ga0495641_0004577 Ga0495641_0004577_5236_7185 611
782 3300046472 Ga0495580_0029977 Ga0495580_0029977_1012_2961 611
783 3300046475 Ga0495639_0000464 Ga0495639_0000464_4660_6609 611
784 3300046476 Ga0495662_0004218 Ga0495662_0004218_2342_4291 611
785 3300046526 Ga0495666_0047211 Ga0495666_0047211_104_2041 611
786 3300046535 Ga0495586_0004951 Ga0495586_0004951_4283_6232 611
787 3300046642 Ga0495634_0028560 Ga0495634_0028560_998_2947 611
788 3300046663 Ga0495635_0007573 Ga0495635_0007573_2543_4492 611
789 3300046674 Ga0495588_0003487 Ga0495588_0003487_2523_4472 611
790 3300046683 Ga0495658_0000861 Ga0495658_0000861_12518_14467 611
791 3300047315 Ga0495581_0004207 Ga0495581_0004207_3573_5504 611
792 3300047321 Ga0495676_0008253 Ga0495676_0008253_205_2115 611
793 3300047321 Ga0495676_0041920 Ga0495676_0041920_1332_3281 611
794 3300047321 Ga0495676_0047604 Ga0495676_0047604_854_2803 611
795 3300047673 Ga0495593_0000980 Ga0495593_0000980_556_2505 611
796 3300048089 Ga0495614_0001533 Ga0495614_0001533_2518_4467 611
797 3300048904 Ga0496101_0009812 Ga0496101_0009812_92_2029 611
798 3300048905 Ga0496102_0008279 Ga0496102_0008279_1985_3934 611
799 3300048908 Ga0496105_0058960 Ga0496105_0058960_188_2125 611
800 3300048911 Ga0496108_0005226 Ga0496108_0005226_8336_10273 611
801 3300048913 Ga0496110_0131944 Ga0496110_0131944_14_1975 611
802 3300048917 Ga0496114_0013622 Ga0496114_0013622_4535_6472 611
803 3300048918 Ga0496115_0060018 Ga0496115_0060018_947_2884 611
804 3300049575 Ga0501039_0017983 Ga0501039_0017983_2518_4461 611
805 3300049578 Ga0501042_0078665 Ga0501042_0078665_159_2102 611
806 3300049582 Ga0501048_0015095 Ga0501048_0015095_2685_4628 611
807 3300049587 Ga0501071_0014011 Ga0501071_0014011_1102_3045 611
808 3300049588 Ga0501072_0122963 Ga0501072_0122963_101_2044 611
809 3300049593 Ga0501077_0022769 Ga0501077_0022769_1179_3092 611
810 3300049743 Ga0501081_0018169 Ga0501081_0018169_1482_3425 611
811 3300050507 nmdc:mga05p37_21390_c1 nmdc:mga05p37_21390_c1_373_2310 611
812 3300050511 nmdc:mga08y16_101226_c1 nmdc:mga08y16_101226_c1_640_2595 611
813 3300050513 nmdc:mga0rr50_43589_c1 nmdc:mga0rr50_43589_c1_56_2011 611
814 3300050515 nmdc:mga0a205_19741_c1 nmdc:mga0a205_19741_c1_3130_5085 611
815 3300053085 Ga0495619_0003536 Ga0495619_0003536_6103_8052 611
816 3300005335 Ga0070666_10058430 Ga0070666_100584302 612
817 3300005337 Ga0070682_100006396 Ga0070682_1000063965 612
818 3300005339 Ga0070660_100019362 Ga0070660_1000193623 612
819 3300005340 Ga0070689_100010798 Ga0070689_1000107981 612
820 3300005341 Ga0070691_10013350 Ga0070691_100133502 612
821 3300005345 Ga0070692_10003291 Ga0070692_100032912 612
822 3300005355 Ga0070671_100012207 Ga0070671_1000122076 612
823 3300005356 Ga0070674_100004968 Ga0070674_1000049683 612
824 3300005364 Ga0070673_100077886 Ga0070673_1000778861 612
825 3300005365 Ga0070688_100037856 Ga0070688_1000378562 612
826 3300005436 Ga0070713_100067357 Ga0070713_1000673571 612
827 3300005439 Ga0070711_100004428 Ga0070711_1000044287 612
828 3300005455 Ga0070663_100051613 Ga0070663_1000516132 612
829 3300005456 Ga0070678_100006896 Ga0070678_1000068964 612
830 3300005459 Ga0068867_100001828 Ga0068867_1000018282 612
831 3300005467 Ga0070706_100114182 Ga0070706_1001141822 612
832 3300005468 Ga0070707_100004992 Ga0070707_1000049928 612
833 3300005471 Ga0070698_100010086 Ga0070698_1000100864 612
834 3300005471 Ga0070698_100014636 Ga0070698_1000146367 612
835 3300005539 Ga0068853_100006599 Ga0068853_1000065994 612
836 3300005544 Ga0070686_100000943 Ga0070686_1000009436 612
837 3300005545 Ga0070695_100051818 Ga0070695_1000518182 612
838 3300005548 Ga0070665_100009747 Ga0070665_1000097472 612
839 3300005718 Ga0068866_10000474 Ga0068866_1000047418 612
840 3300005981 Ga0081538_10004398 Ga0081538_100043983 612
841 3300005985 Ga0081539_10001695 Ga0081539_1000169511 612
842 3300006028 Ga0070717_10023224 Ga0070717_100232242 612
843 3300006038 Ga0075365_10032436 Ga0075365_100324363 612
844 3300006358 Ga0068871_100008129 Ga0068871_1000081297 612
845 3300006881 Ga0068865_100001504 Ga0068865_1000015047 612
846 3300009147 Ga0114129_10045084 Ga0114129_100450843 612
847 3300009177 Ga0105248_10018672 Ga0105248_100186725 612
848 3300009553 Ga0105249_10000587 Ga0105249_1000058731 612
849 3300010375 Ga0105239_10031155 Ga0105239_100311552 612
850 3300013306 Ga0163162_10001280 Ga0163162_1000128014 612
851 3300014326 Ga0157380_10003890 Ga0157380_100038902 612
852 3300014745 Ga0157377_10000519 Ga0157377_1000051910 612
853 3300014969 Ga0157376_10013471 Ga0157376_100134712 612
854 3300025898 Ga0207692_10022193 Ga0207692_100221931 612
855 3300025903 Ga0207680_10032036 Ga0207680_100320362 612
856 3300025915 Ga0207693_10001256 Ga0207693_1000125620 612
857 3300025919 Ga0207657_10002174 Ga0207657_100021742 612
858 3300025922 Ga0207646_10017413 Ga0207646_100174134 612
859 3300025935 Ga0207709_10000790 Ga0207709_1000079011 612
860 3300025936 Ga0207670_10011598 Ga0207670_100115983 612
861 3300025937 Ga0207669_10011234 Ga0207669_100112342 612
862 3300025938 Ga0207704_10001817 Ga0207704_100018178 612
863 3300025940 Ga0207691_10012484 Ga0207691_100124845 612
864 3300025961 Ga0207712_10002935 Ga0207712_1000293511 612
865 3300025972 Ga0207668_10034127 Ga0207668_100341272 612
866 3300026067 Ga0207678_10006147 Ga0207678_100061473 612
867 3300026075 Ga0207708_10000415 Ga0207708_1000041513 612
868 3300026078 Ga0207702_10049870 Ga0207702_100498702 612
869 3300026078 Ga0207702_10084966 Ga0207702_100849662 612
870 3300026089 Ga0207648_10000705 Ga0207648_1000070526 612
871 3300026121 Ga0207683_10001271 Ga0207683_1000127116 612
872 3300027907 Ga0207428_10011008 Ga0207428_100110083 612
873 3300032126 Ga0307415_100047911 Ga0307415_1000479112 612
874 3300037312 Ga0395899_0020116 Ga0395899_0020116_2474_4408 612
875 3300037418 Ga0395900_0002828 Ga0395900_0002828_16029_17963 612
876 3300037418 Ga0395900_0018047 Ga0395900_0018047_4948_6894 612
877 3300037418 Ga0395900_0028702 Ga0395900_0028702_200_2143 612
878 3300037418 Ga0395900_0045079 Ga0395900_0045079_2384_4348 612
879 3300037418 Ga0395900_0057940 Ga0395900_0057940_1248_3290 612
880 3300037466 Ga0395898_0007486 Ga0395898_0007486_1477_3420 612
881 3300037466 Ga0395898_0022299 Ga0395898_0022299_4369_6315 612
882 3300037466 Ga0395898_0052108 Ga0395898_0052108_564_2498 612
883 3300037471 Ga0395905_0005632 Ga0395905_0005632_4662_6605 612
884 3300037471 Ga0395905_0014472 Ga0395905_0014472_1517_3451 612
885 3300037471 Ga0395905_0051750 Ga0395905_0051750_1647_3689 612
886 3300038443 Ga0395901_0001042 Ga0395901_0001042_17139_19082 612
887 3300038443 Ga0395901_0012688 Ga0395901_0012688_28_1974 612
888 3300038443 Ga0395901_0029817 Ga0395901_0029817_2514_4556 612
889 3300038443 Ga0395901_0030637 Ga0395901_0030637_24_1988 612
890 3300038443 Ga0395901_0065404 Ga0395901_0065404_66_1997 612
891 3300046455 Ga0495603_0008720 Ga0495603_0008720_471_2405 612
892 3300046491 Ga0495584_0005164 Ga0495584_0005164_2485_4419 612
893 3300046525 Ga0495663_0008899 Ga0495663_0008899_783_2717 612
894 3300046538 Ga0495609_0011879 Ga0495609_0011879_702_2636 612
895 3300046794 Ga0495589_0010330 Ga0495589_0010330_693_2627 612
896 3300046794 Ga0495589_0029821 Ga0495589_0029821_755_2689 612
897 3300048903 Ga0496100_0011775 Ga0496100_0011775_2908_4842 612
898 3300048903 Ga0496100_0030474 Ga0496100_0030474_325_2274 612
899 3300048904 Ga0496101_0033973 Ga0496101_0033973_378_2327 612
900 3300048905 Ga0496102_0022269 Ga0496102_0022269_647_2584 612
901 3300048906 Ga0496103_0009048 Ga0496103_0009048_538_2472 612
902 3300048906 Ga0496103_0029925 Ga0496103_0029925_592_2529 612
903 3300048907 Ga0496104_0030514 Ga0496104_0030514_770_2704 612
904 3300048907 Ga0496104_0087281 Ga0496104_0087281_856_2805 612
905 3300048908 Ga0496105_0004474 Ga0496105_0004474_7219_9168 612
906 3300048909 Ga0496106_0004202 Ga0496106_0004202_3035_4969 612
907 3300048911 Ga0496108_0011238 Ga0496108_0011238_1798_3747 612
908 3300048912 Ga0496109_0012018 Ga0496109_0012018_4317_6254 612
909 3300048912 Ga0496109_0016106 Ga0496109_0016106_1765_3699 612
910 3300048913 Ga0496110_0076161 Ga0496110_0076161_369_2324 612
911 3300048914 Ga0496111_0012139 Ga0496111_0012139_1402_3351 612
912 3300048915 Ga0496112_0044973 Ga0496112_0044973_350_2284 612
913 3300049568 Ga0501031_0001127 Ga0501031_0001127_1500_3443 612
914 3300049568 Ga0501031_0005409 Ga0501031_0005409_1743_3638 612
915 3300049569 Ga0501032_0021027 Ga0501032_0021027_2388_4283 612
916 3300049569 Ga0501032_0025125 Ga0501032_0025125_1483_3435 612
917 3300049569 Ga0501032_0029690 Ga0501032_0029690_275_2218 612
918 3300049570 Ga0501033_0009318 Ga0501033_0009318_3782_5725 612
919 3300049570 Ga0501033_0051349 Ga0501033_0051349_289_2241 612
920 3300049572 Ga0501036_0000213 Ga0501036_0000213_5628_7523 612
921 3300049572 Ga0501036_0076190 Ga0501036_0076190_816_2768 612
922 3300049574 Ga0501038_0029755 Ga0501038_0029755_1230_3173 612
923 3300049575 Ga0501039_0004571 Ga0501039_0004571_1545_3440 612
924 3300049575 Ga0501039_0005725 Ga0501039_0005725_6539_8482 612
925 3300049575 Ga0501039_0025958 Ga0501039_0025958_300_2252 612
926 3300049576 Ga0501040_0000230 Ga0501040_0000230_21030_22925 612
927 3300049576 Ga0501040_0002177 Ga0501040_0002177_5308_7251 612
928 3300049577 Ga0501041_0000423 Ga0501041_0000423_13060_14955 612
929 3300049577 Ga0501041_0001426 Ga0501041_0001426_2573_4516 612
930 3300049578 Ga0501042_0000753 Ga0501042_0000753_12204_14099 612
931 3300049578 Ga0501042_0002273 Ga0501042_0002273_4526_6469 612
932 3300049578 Ga0501042_0041405 Ga0501042_0041405_794_2746 612
933 3300049580 Ga0501046_0002884 Ga0501046_0002884_13360_15303 612
934 3300049580 Ga0501046_0004940 Ga0501046_0004940_3652_5547 612
935 3300049582 Ga0501048_0001125 Ga0501048_0001125_12627_14570 612
936 3300049582 Ga0501048_0002989 Ga0501048_0002989_8751_10646 612
937 3300049582 Ga0501048_0027268 Ga0501048_0027268_1368_3320 612
938 3300049583 Ga0501067_0021491 Ga0501067_0021491_1620_3542 612
939 3300049584 Ga0501068_0000457 Ga0501068_0000457_14127_16070 612
940 3300049585 Ga0501069_0008008 Ga0501069_0008008_3225_5168 612
941 3300049586 Ga0501070_0043568 Ga0501070_0043568_1489_3441 612
942 3300049587 Ga0501071_0014935 Ga0501071_0014935_1646_3589 612
943 3300049588 Ga0501072_0004550 Ga0501072_0004550_5680_7623 612
944 3300049590 Ga0501074_0002949 Ga0501074_0002949_4709_6652 612
945 3300049590 Ga0501074_0008668 Ga0501074_0008668_1819_3714 612
946 3300049590 Ga0501074_0035804 Ga0501074_0035804_325_2277 612
947 3300049591 Ga0501075_0001525 Ga0501075_0001525_846_2741 612
948 3300049591 Ga0501075_0008976 Ga0501075_0008976_4845_6788 612
949 3300049592 Ga0501076_0000130 Ga0501076_0000130_39685_41580 612
950 3300049592 Ga0501076_0023284 Ga0501076_0023284_1230_3173 612
951 3300049593 Ga0501077_0000184 Ga0501077_0000184_27637_29532 612
952 3300049593 Ga0501077_0001259 Ga0501077_0001259_2057_3976 612
953 3300049593 Ga0501077_0006763 Ga0501077_0006763_307_2250 612
954 3300049593 Ga0501077_0041408 Ga0501077_0041408_802_2754 612
955 3300049593 Ga0501077_0049333 Ga0501077_0049333_680_2632 612
956 3300049741 Ga0501079_0000143 Ga0501079_0000143_27637_29532 612
957 3300049741 Ga0501079_0005755 Ga0501079_0005755_413_2356 612
958 3300049742 Ga0501080_0011329 Ga0501080_0011329_1467_3410 612
959 3300049743 Ga0501081_0000609 Ga0501081_0000609_12076_13971 612
960 3300049743 Ga0501081_0029281 Ga0501081_0029281_825_2777 612
961 3300049743 Ga0501081_0038489 Ga0501081_0038489_934_2877 612
962 3300049744 Ga0501083_0004551 Ga0501083_0004551_6357_8252 612
963 3300049744 Ga0501083_0015986 Ga0501083_0015986_2102_4045 612
964 3300049822 Ga0501035_0005504 Ga0501035_0005504_6264_8159 612
965 3300049824 Ga0501045_0000787 Ga0501045_0000787_12076_13971 612
966 3300049824 Ga0501045_0001577 Ga0501045_0001577_12861_14804 612
967 3300050507 nmdc:mga05p37_40538_c1 nmdc:mga05p37_40538_c1_1498_3471 612
968 3300050512 nmdc:mga0n895_50588_c1 nmdc:mga0n895_50588_c1_824_2752 612
969 3300050513 nmdc:mga0rr50_18358_c1 nmdc:mga0rr50_18358_c1_101_2029 612
970 3300050515 nmdc:mga0a205_35039_c1 nmdc:mga0a205_35039_c1_385_2313 612
971 3300054114 Ga0501084_0000067 Ga0501084_0000067_6666_8561 612
972 3300054114 Ga0501084_0011977 Ga0501084_0011977_3602_5545 612
973 3300060353 Ga0501082_0000203 Ga0501082_0000203_10031_11926 612
974 3300060353 Ga0501082_0039650 Ga0501082_0039650_521_2464 612
975 3300060353 Ga0501082_0111735 Ga0501082_0111735_136_2088 612
976 3300061734 Ga0530510_0001747 Ga0530510_0001747_718_2613 612
977 3300061734 Ga0530510_0005584 Ga0530510_0005584_934_2877 612
978 3300061734 Ga0530510_0038865 Ga0530510_0038865_974_2926 612
979 3300005535 Ga0070684_100032630 Ga0070684_1000326302 613
980 3300005544 Ga0070686_100061000 Ga0070686_1000610002 613
981 3300005618 Ga0068864_100101593 Ga0068864_1001015932 613
982 3300005937 Ga0081455_10008204 Ga0081455_100082043 613
983 3300005981 Ga0081538_10007781 Ga0081538_100077815 613
984 3300006844 Ga0075428_100143897 Ga0075428_1001438972 613
985 3300009177 Ga0105248_10028500 Ga0105248_100285004 613
986 3300010375 Ga0105239_10189391 Ga0105239_101893912 613
987 3300025945 Ga0207679_10086444 Ga0207679_100864442 613
988 3300026095 Ga0207676_10062341 Ga0207676_100623412 613
989 3300026116 Ga0207674_10018963 Ga0207674_100189636 613
990 3300031731 Ga0307405_10005614 Ga0307405_100056143 613
991 3300031852 Ga0307410_10060757 Ga0307410_100607571 613
992 3300031901 Ga0307406_10016809 Ga0307406_100168093 613
993 3300032126 Ga0307415_100032807 Ga0307415_1000328072 613
994 3300032126 Ga0307415_100048839 Ga0307415_1000488391 613
995 3300037312 Ga0395899_0001253 Ga0395899_0001253_12552_14462 613
996 3300037418 Ga0395900_0006214 Ga0395900_0006214_7428_9338 613
997 3300037471 Ga0395905_0012349 Ga0395905_0012349_5879_7789 613
998 3300046794 Ga0495589_0039658 Ga0495589_0039658_230_2122 613
999 3300048911 Ga0496108_0005017 Ga0496108_0005017_7715_9607 613
1000 3300048912 Ga0496109_0025008 Ga0496109_0025008_2481_4373 613
1001 3300048913 Ga0496110_0000778 Ga0496110_0000778_7329_9221 613
1002 3300048914 Ga0496111_0000101 Ga0496111_0000101_25650_27542 613
1003 3300050511 nmdc:mga08y16_35919_c1 nmdc:mga08y16_35919_c1_1264_3156 613
1004 3300003203 JGI25406J46586_10010917 JGI25406J46586_100109172 614
1005 3300003373 JGI25407J50210_10001197 JGI25407J50210_100011973 614
1006 3300005937 Ga0081455_10001632 Ga0081455_100016323 614
1007 3300005981 Ga0081538_10012502 Ga0081538_100125026 614
1008 3300005985 Ga0081539_10001603 Ga0081539_1000160316 614

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16177

ACAS_N

Acetyl-coenzyme A synthetase N-terminus

69

126

0.97

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

567

645

0.95

PF00501

AMP-binding

AMP-binding enzyme

127

514

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7knp-assembly1.cif.gz_C crystal structure of acetyl-coa synthetase in complex with adenosine-5'-butylphosphate from cryptococcus neoformans var. grubii serotype a (h99) 0.9498 29 500
5vpv-assembly3.cif.gz_C crystal structure of apo cryptococcus neoformans h99 acetyl-coa synthetase with an acetylated active site lysine 0.9402 20 503
8v5g-assembly1.cif.gz_B crystal structure of acetyl-coa synthetase from cryptococcus neoformans h99 in complex with an ethylsulfamide amp inhibitor 0.9383 34 594
5u29-assembly1.cif.gz_A crystal structure of cryptococcus neoformans h99 acetyl-coa synthetase in complex with ac-ams 0.9356 20 613
8g0v-assembly1.cif.gz_C crystal structure of acetyl-coa synthetase in complex with a propyne ester amp inhibitor from cryptococcus neoformans h99 0.9327 20 613
ID Description Score Start End Superfamily
af_C6KTB4_488_811_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9645 233 505 3.40.50.12780
5ifiC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9473 34 505 3.40.50.12780
af_F1QQH3_177_548_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9449 168 503 3.40.50.12780
af_Q554Z5_50_550_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.944 28 505 3.40.50.12780
af_I1LVS4_438_521_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9366 506 560 3.30.300.30
ID Description Score Start End GO Terms
AF-A0A833G705-F1-model_v4 AMP-binding protein 0.9715 5 409 GO:0003987
GO:0006085
AF-A0A382QVT1-F1-model_v4 acetate--CoA ligase (EC 6.2.1.1) 0.9674 240 551 GO:0003987
GO:0005524
GO:0006085
AF-A0A7S1FSN4-F1-model_v4 Acetyl-coenzyme A synthetase (EC 6.2.1.1) 0.9634 30 614 GO:0003987
GO:0005524
GO:0016208
GO:0019427
AF-A0A094CL01-F1-model_v4 acetate--CoA ligase (EC 6.2.1.1) 0.9614 30 604 GO:0003987
GO:0005524
GO:0005829
GO:0016208
GO:0019427
AF-A0A674N4U0-F1-model_v4 Acetyl-coenzyme A synthetase (EC 6.2.1.1) 0.9588 20 551 GO:0003987
GO:0005524
GO:0005739
GO:0006629
GO:0016208
GO:0019427

Feature Viewer

pLDDT pTM Quality
90.36 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map