F488063
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1008 | 461 | 2016 | 368 |
Family's Representative Sequence
| Representative Sequence | 3300009011|Ga0105251_10027854|Ga0105251_100278544 |
| Length | 391 |
| Sequence | MAGLPRADPLGLNLLQEQQMRHQKHDLLAPLPGTARQIHSFHFGPQPANGKIYIQASLHADEMPGMLVAWHLKQRLAELEAAGRLRSEIVLVPIANPVGLEQVLMDVPLGRYELESGQNFNRWFVDLSEEVGNAIEGKLGDDPQRNQQLIRSSLREALARQSADTQLQSQRLTLQRLACDADMVLDLHCDFEAVAHLYTTPDAWPQVEPLARYIGAEASLLATDSGGQSFDECFTLLWWQLKERFGEHFDIPPGSFSVTVELRGQGDVNHPLASRDCQALIDYLIHFGAIAGEPAPLPDLPYPATPLAGVEPVATPAGGLLVFIALPGQYLEAGQLIAEVIDPINDRVTPVHCCAAGLMYARSLRRMATAGMVIAHVAGTEAYRSGYLLSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 38 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 39 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 56 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 96 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 97 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 99 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 100 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 105 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 108 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 109 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 110 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 111 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 112 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 113 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 114 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 115 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 116 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 117 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 118 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 119 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 120 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 121 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 122 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 123 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 124 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 125 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 126 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 127 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 128 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 129 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 130 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 131 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 132 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 216 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 217 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 220 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 221 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 222 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 225 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 226 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 229 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 230 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 231 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 232 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 233 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 234 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 235 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 236 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 237 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 238 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 239 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 240 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 241 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 242 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 243 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 244 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 245 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 246 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 247 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 248 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 249 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 250 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 251 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 252 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 253 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 254 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 255 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 256 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 257 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 258 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 259 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 260 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 261 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 262 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 263 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 264 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 265 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 266 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 267 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 268 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 269 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 270 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 271 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 272 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 273 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 274 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 275 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 276 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 277 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 278 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 279 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 280 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 281 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 282 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 283 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 284 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 285 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 286 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 287 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 288 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 289 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 290 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 291 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 292 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 293 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 294 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 295 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 296 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 297 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 298 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 299 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 300 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 301 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 302 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 303 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 304 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 305 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 306 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 307 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 308 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 309 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 310 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 311 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 312 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 313 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 314 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 315 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 316 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 317 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 318 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 319 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 320 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 321 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 322 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 323 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 324 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 325 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 326 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 327 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 328 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 329 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 330 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 331 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 332 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 333 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 334 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 335 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 336 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 337 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 338 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 339 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 340 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 341 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 342 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 343 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 344 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 345 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 346 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 347 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 348 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 349 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 350 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 351 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 352 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 353 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 354 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 355 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 356 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 357 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 358 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 359 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 360 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 361 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 362 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 363 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 364 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 365 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 366 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 367 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 368 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 369 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 370 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 371 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 372 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 373 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 374 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 375 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 376 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 377 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 378 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 379 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 380 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 381 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 382 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 383 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 384 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 385 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 386 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 387 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 388 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 389 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 390 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 391 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 392 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 393 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 394 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 395 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 396 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 397 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 398 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 399 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 400 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 401 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 402 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 403 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 404 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 405 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 406 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 407 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 408 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 409 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 410 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 411 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 412 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 413 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 414 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 415 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 416 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 417 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 418 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 419 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 420 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 421 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 422 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 423 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 424 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 425 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 426 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 427 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 428 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 429 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 430 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 431 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 432 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 433 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 434 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 435 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 436 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 437 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 438 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 439 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 440 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 441 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 442 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 443 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 444 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 445 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 446 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 447 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 448 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 449 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 450 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 451 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 452 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 453 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 454 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 455 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 456 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 457 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 458 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 459 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 460 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 461 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.88 |
| Metatranscriptomes | 0.1 |
| Isolates | 23.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 6.25 |
| Nodule | 2.68 |
| Rhizoplane | 7.34 |
| Rhizosphere | 71.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105251_10027854 | 3300009011 | Bacteria | 2859 |
| 2 | MRS2a_Contig_1297 | 2124908027 | Bacteria | 12330 |
| 3 | SwRhRL2b_contig_2880077 | 2162886007 | Bacteria | 3138 |
| 4 | JGI24735J21928_10001609 | 3300002067 | Bacteria | 7996 |
| 5 | JGI25162J39368_1000241 | 3300002737 | Bacteria | 54556 |
| 6 | JGI25162J39368_1000264 | 3300002737 | Bacteria | 50429 |
| 7 | JGI25163J39215_1001351 | 3300002771 | Bacteria | 4190 |
| 8 | JGI25163J39215_1003184 | 3300002771 | Bacteria | 1395 |
| 9 | JGI25164J39214_1000188 | 3300002772 | Bacteria | 54558 |
| 10 | JGI25164J39214_1000210 | 3300002772 | Bacteria | 49474 |
| 11 | JGI25152J39213_1001957 | 3300002773 | Bacteria | 8171 |
| 12 | JGI25165J46597_1000339 | 3300003214 | Bacteria | 54558 |
| 13 | JGI25165J46597_1000367 | 3300003214 | Bacteria | 50429 |
| 14 | JGI25153J46596_10020172 | 3300003215 | Bacteria | 2527 |
| 15 | rootH1_10034871 | 3300003323 | Bacteria | 2865 |
| 16 | rootH1_10143890 | 3300003323 | Bacteria | 1714 |
| 17 | Ga0006562J51391_1013932 | 3300003578 | Bacteria | 3060 |
| 18 | Ga0055538_1000096 | 3300003751 | Bacteria | 73286 |
| 19 | Ga0055539_1000142 | 3300003752 | Bacteria | 73286 |
| 20 | Ga0055533_1000146 | 3300003756 | Bacteria | 73286 |
| 21 | Ga0055532_1000132 | 3300003758 | Bacteria | 73282 |
| 22 | Ga0055525_1000701 | 3300003759 | Bacteria | 12158 |
| 23 | Ga0055536_1001175 | 3300003781 | Bacteria | 16293 |
| 24 | Ga0055530_10000296 | 3300003791 | Bacteria | 45176 |
| 25 | Ga0055530_10000427 | 3300003791 | Bacteria | 37349 |
| 26 | Ga0055540_1000377 | 3300003792 | Bacteria | 37349 |
| 27 | Ga0055540_1001027 | 3300003792 | Bacteria | 17928 |
| 28 | Ga0055540_1003008 | 3300003792 | Bacteria | 8430 |
| 29 | Ga0055531_10001697 | 3300003794 | Bacteria | 15794 |
| 30 | Ga0055541_1000096 | 3300003841 | Bacteria | 73286 |
| 31 | Ga0065714_10000562 | 3300005288 | Bacteria | 4077 |
| 32 | Ga0065714_10002540 | 3300005288 | Bacteria | 29164 |
| 33 | Ga0065714_10015600 | 3300005288 | Bacteria | 3048 |
| 34 | Ga0065714_10017507 | 3300005288 | Bacteria | 1338 |
| 35 | Ga0065714_10067767 | 3300005288 | Bacteria | 5213 |
| 36 | Ga0065714_10070980 | 3300005288 | Bacteria | 3710 |
| 37 | Ga0065704_10070421 | 3300005289 | Bacteria | 25665 |
| 38 | Ga0065712_10001739 | 3300005290 | Bacteria | 5833 |
| 39 | Ga0065715_10002374 | 3300005293 | Bacteria | 4849 |
| 40 | Ga0070670_100001614 | 3300005331 | Bacteria | 18233 |
| 41 | Ga0070670_100011386 | 3300005331 | Bacteria | 7605 |
| 42 | Ga0070661_100000306 | 3300005344 | Bacteria | 39537 |
| 43 | Ga0070669_100001132 | 3300005353 | Bacteria | 19477 |
| 44 | Ga0070669_100007596 | 3300005353 | Bacteria | 7752 |
| 45 | Ga0070662_100106296 | 3300005457 | Bacteria | 2131 |
| 46 | Ga0068853_100005599 | 3300005539 | Bacteria | 9864 |
| 47 | Ga0070664_100002817 | 3300005564 | Bacteria | 14062 |
| 48 | Ga0068851_10000019 | 3300005834 | Bacteria | 135877 |
| 49 | Ga0075364_10023132 | 3300006051 | Bacteria | 3932 |
| 50 | Ga0075364_10209946 | 3300006051 | Bacteria | 1320 |
| 51 | Ga0075364_10217112 | 3300006051 | Bacteria | 1297 |
| 52 | Ga0075432_10001851 | 3300006058 | Bacteria | 6981 |
| 53 | Ga0075432_10003492 | 3300006058 | Bacteria | 5320 |
| 54 | Ga0075432_10003640 | 3300006058 | Bacteria | 5244 |
| 55 | Ga0075432_10011138 | 3300006058 | Bacteria | 3053 |
| 56 | Ga0075432_10029067 | 3300006058 | Bacteria | 1907 |
| 57 | Ga0075432_10036507 | 3300006058 | Bacteria | 1708 |
| 58 | Ga0075432_10037462 | 3300006058 | Bacteria | 1688 |
| 59 | Ga0075362_10114852 | 3300006177 | Bacteria | 1270 |
| 60 | Ga0079104_1000459 | 3300006946 | Bacteria | 46066 |
| 61 | Ga0079104_1000484 | 3300006946 | Bacteria | 44056 |
| 62 | Ga0079104_1000689 | 3300006946 | Bacteria | 30929 |
| 63 | Ga0099826_10000372 | 3300006948 | Bacteria | 20776 |
| 64 | Ga0105251_10000123 | 3300009011 | Bacteria | 77428 |
| 65 | Ga0105251_10000202 | 3300009011 | Bacteria | 59944 |
| 66 | Ga0105251_10001180 | 3300009011 | Bacteria | 22637 |
| 67 | Ga0105251_10002278 | 3300009011 | Bacteria | 15224 |
| 68 | Ga0105251_10107041 | 3300009011 | Bacteria | 1276 |
| 69 | Ga0105244_10001713 | 3300009036 | Bacteria | 17317 |
| 70 | Ga0105244_10005248 | 3300009036 | Bacteria | 8644 |
| 71 | Ga0105244_10008962 | 3300009036 | Bacteria | 6192 |
| 72 | Ga0105244_10020710 | 3300009036 | Bacteria | 3648 |
| 73 | Ga0105244_10024875 | 3300009036 | Bacteria | 3262 |
| 74 | Ga0105244_10025801 | 3300009036 | Bacteria | 3188 |
| 75 | Ga0105244_10028240 | 3300009036 | Bacteria | 3012 |
| 76 | Ga0105244_10066476 | 3300009036 | Bacteria | 1804 |
| 77 | Ga0105244_10081177 | 3300009036 | Bacteria | 1605 |
| 78 | Ga0105250_10000273 | 3300009092 | Bacteria | 41912 |
| 79 | Ga0105250_10001623 | 3300009092 | Bacteria | 12016 |
| 80 | Ga0105250_10006346 | 3300009092 | Bacteria | 5174 |
| 81 | Ga0105250_10053662 | 3300009092 | Bacteria | 1617 |
| 82 | Ga0105243_10000580 | 3300009148 | Bacteria | 36794 |
| 83 | Ga0105243_10009538 | 3300009148 | Bacteria | 7391 |
| 84 | Ga0105243_10116290 | 3300009148 | Bacteria | 2246 |
| 85 | Ga0105243_10315110 | 3300009148 | Bacteria | 1423 |
| 86 | Ga0105242_10001061 | 3300009176 | Bacteria | 21612 |
| 87 | Ga0105248_10051756 | 3300009177 | Bacteria | 4608 |
| 88 | Ga0105237_10002041 | 3300009545 | Bacteria | 25677 |
| 89 | Ga0105238_10083853 | 3300009551 | Bacteria | 3176 |
| 90 | Ga0105246_10000136 | 3300011119 | Bacteria | 34129 |
| 91 | Ga0105246_10003726 | 3300011119 | Bacteria | 9228 |
| 92 | Ga0105246_10030965 | 3300011119 | Bacteria | 3538 |
| 93 | Ga0105246_10031219 | 3300011119 | Bacteria | 3524 |
| 94 | Ga0157345_1002079 | 3300012498 | Bacteria | 1407 |
| 95 | Ga0157373_10012223 | 3300013100 | Bacteria | 6313 |
| 96 | Ga0157373_10020232 | 3300013100 | Bacteria | 4841 |
| 97 | Ga0157373_10052963 | 3300013100 | Bacteria | 2886 |
| 98 | Ga0157373_10056597 | 3300013100 | Bacteria | 2784 |
| 99 | Ga0157373_10083973 | 3300013100 | Bacteria | 2245 |
| 100 | Ga0157373_10092745 | 3300013100 | Bacteria | 2127 |
| 101 | Ga0157373_10096556 | 3300013100 | Bacteria | 2080 |
| 102 | Ga0157373_10213477 | 3300013100 | Bacteria | 1361 |
| 103 | Ga0157371_10000885 | 3300013102 | Bacteria | 33767 |
| 104 | Ga0157371_10003010 | 3300013102 | Bacteria | 15648 |
| 105 | Ga0157371_10008487 | 3300013102 | Bacteria | 8176 |
| 106 | Ga0157371_10023644 | 3300013102 | Bacteria | 4493 |
| 107 | Ga0157371_10143904 | 3300013102 | Bacteria | 1699 |
| 108 | Ga0157370_10002321 | 3300013104 | Bacteria | 23039 |
| 109 | Ga0157370_10078317 | 3300013104 | Bacteria | 3113 |
| 110 | Ga0157370_10092406 | 3300013104 | Bacteria | 2840 |
| 111 | Ga0157370_10112250 | 3300013104 | Bacteria | 2548 |
| 112 | Ga0157369_10013137 | 3300013105 | Bacteria | 9370 |
| 113 | Ga0157369_10015624 | 3300013105 | Bacteria | 8555 |
| 114 | Ga0157369_10105954 | 3300013105 | Bacteria | 2992 |
| 115 | Ga0157369_10115321 | 3300013105 | Bacteria | 2853 |
| 116 | Ga0157369_10131282 | 3300013105 | Bacteria | 2654 |
| 117 | Ga0157369_10136240 | 3300013105 | Bacteria | 2599 |
| 118 | Ga0163162_10019587 | 3300013306 | Bacteria | 6642 |
| 119 | Ga0163162_10063153 | 3300013306 | Bacteria | 3745 |
| 120 | Ga0163162_10138115 | 3300013306 | Bacteria | 2549 |
| 121 | Ga0157372_10524353 | 3300013307 | Bacteria | 1381 |
| 122 | Ga0157375_10008459 | 3300013308 | Bacteria | 9011 |
| 123 | Ga0157375_10051069 | 3300013308 | Bacteria | 4059 |
| 124 | Ga0182008_10000338 | 3300014497 | Bacteria | 36590 |
| 125 | Ga0182008_10007133 | 3300014497 | Bacteria | 6188 |
| 126 | Ga0182008_10009529 | 3300014497 | Bacteria | 5236 |
| 127 | Ga0182008_10022789 | 3300014497 | Bacteria | 3205 |
| 128 | Ga0182008_10106239 | 3300014497 | Bacteria | 1389 |
| 129 | Ga0182008_10133102 | 3300014497 | Bacteria | 1241 |
| 130 | Ga0182006_1002421 | 3300015261 | Bacteria | 10196 |
| 131 | Ga0182006_1002996 | 3300015261 | Bacteria | 8885 |
| 132 | Ga0182006_1006404 | 3300015261 | Bacteria | 5474 |
| 133 | Ga0182006_1015077 | 3300015261 | Bacteria | 3319 |
| 134 | Ga0182006_1015891 | 3300015261 | Bacteria | 3218 |
| 135 | Ga0182006_1025166 | 3300015261 | Bacteria | 2447 |
| 136 | Ga0182006_1064506 | 3300015261 | Bacteria | 1373 |
| 137 | Ga0182006_1064966 | 3300015261 | Bacteria | 1367 |
| 138 | Ga0182007_10012551 | 3300015262 | Bacteria | 3254 |
| 139 | Ga0182007_10024065 | 3300015262 | Bacteria | 2135 |
| 140 | Ga0182005_1007871 | 3300015265 | Bacteria | 3169 |
| 141 | Ga0182005_1010432 | 3300015265 | Bacteria | 2672 |
| 142 | Ga0182005_1012885 | 3300015265 | Bacteria | 2356 |
| 143 | Ga0163161_10023874 | 3300017792 | Bacteria | 4315 |
| 144 | Ga0163161_10184304 | 3300017792 | Bacteria | 1602 |
| 145 | Ga0163161_10215782 | 3300017792 | Bacteria | 1484 |
| 146 | Ga0163161_10246841 | 3300017792 | Bacteria | 1390 |
| 147 | Ga0163161_10312226 | 3300017792 | Bacteria | 1241 |
| 148 | Ga0209760_100099 | 3300025207 | Bacteria | 66726 |
| 149 | Ga0209760_100111 | 3300025207 | Bacteria | 57882 |
| 150 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 151 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 152 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 153 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 154 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 155 | Ga0209563_100795 | 3300025230 | Bacteria | 9503 |
| 156 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 157 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 158 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 159 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 160 | Ga0209646_1000220 | 3300025246 | Bacteria | 61752 |
| 161 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 162 | Ga0209759_1007233 | 3300025256 | Bacteria | 3603 |
| 163 | Ga0209759_1020340 | 3300025256 | Bacteria | 1543 |
| 164 | Ga0209129_1000164 | 3300025258 | Bacteria | 98984 |
| 165 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 166 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 167 | Ga0209673_1005011 | 3300025273 | Bacteria | 6845 |
| 168 | Ga0209675_1004641 | 3300025291 | Bacteria | 6042 |
| 169 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 170 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 171 | Ga0209676_1000080 | 3300025292 | Bacteria | 287400 |
| 172 | Ga0209676_1006347 | 3300025292 | Bacteria | 5861 |
| 173 | Ga0209564_1000062 | 3300025295 | Bacteria | 321275 |
| 174 | Ga0209758_1000820 | 3300025297 | Bacteria | 43617 |
| 175 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 176 | Ga0209050_1000117 | 3300025298 | Bacteria | 202979 |
| 177 | Ga0209050_1000187 | 3300025298 | Bacteria | 139437 |
| 178 | Ga0209050_1001895 | 3300025298 | Bacteria | 20032 |
| 179 | Ga0209051_1000077 | 3300025303 | Bacteria | 202959 |
| 180 | Ga0209051_1000131 | 3300025303 | Bacteria | 139437 |
| 181 | Ga0209051_1001300 | 3300025303 | Bacteria | 21966 |
| 182 | Ga0209257_1000173 | 3300025304 | Bacteria | 166678 |
| 183 | Ga0207656_10000042 | 3300025321 | Bacteria | 53832 |
| 184 | Ga0207696_1000044 | 3300025711 | Bacteria | 300953 |
| 185 | Ga0207696_1000083 | 3300025711 | Bacteria | 197352 |
| 186 | Ga0207696_1000111 | 3300025711 | Bacteria | 155243 |
| 187 | Ga0207696_1005821 | 3300025711 | Bacteria | 5061 |
| 188 | Ga0207655_1000021 | 3300025728 | Bacteria | 518596 |
| 189 | Ga0207655_1000844 | 3300025728 | Bacteria | 32918 |
| 190 | Ga0207655_1000896 | 3300025728 | Bacteria | 31326 |
| 191 | Ga0207655_1001857 | 3300025728 | Bacteria | 18236 |
| 192 | Ga0207655_1002011 | 3300025728 | Bacteria | 17238 |
| 193 | Ga0207655_1003971 | 3300025728 | Bacteria | 10699 |
| 194 | Ga0207655_1005141 | 3300025728 | Bacteria | 9007 |
| 195 | Ga0207655_1006841 | 3300025728 | Bacteria | 7491 |
| 196 | Ga0207655_1006862 | 3300025728 | Bacteria | 7474 |
| 197 | Ga0207655_1026197 | 3300025728 | Bacteria | 2805 |
| 198 | Ga0207655_1030587 | 3300025728 | Bacteria | 2501 |
| 199 | Ga0207655_1061065 | 3300025728 | Bacteria | 1458 |
| 200 | Ga0207713_1000085 | 3300025735 | Bacteria | 160800 |
| 201 | Ga0207713_1000177 | 3300025735 | Bacteria | 91799 |
| 202 | Ga0207713_1001940 | 3300025735 | Bacteria | 15644 |
| 203 | Ga0207713_1004803 | 3300025735 | Bacteria | 8675 |
| 204 | Ga0207713_1006134 | 3300025735 | Bacteria | 7390 |
| 205 | Ga0207713_1007165 | 3300025735 | Bacteria | 6649 |
| 206 | Ga0207713_1007166 | 3300025735 | Bacteria | 6649 |
| 207 | Ga0207713_1007257 | 3300025735 | Bacteria | 6577 |
| 208 | Ga0207713_1008504 | 3300025735 | Bacteria | 5902 |
| 209 | Ga0207713_1011057 | 3300025735 | Bacteria | 4942 |
| 210 | Ga0207713_1019500 | 3300025735 | Bacteria | 3314 |
| 211 | Ga0207695_10109931 | 3300025913 | Bacteria | 2737 |
| 212 | Ga0207671_10000420 | 3300025914 | Bacteria | 58883 |
| 213 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 214 | Ga0207681_10000815 | 3300025923 | Bacteria | 20503 |
| 215 | Ga0207650_10000385 | 3300025925 | Bacteria | 40899 |
| 216 | Ga0207650_10000606 | 3300025925 | Bacteria | 28719 |
| 217 | Ga0207706_10000239 | 3300025933 | Bacteria | 60455 |
| 218 | Ga0207706_10027482 | 3300025933 | Bacteria | 5087 |
| 219 | Ga0207709_10000036 | 3300025935 | Bacteria | 292568 |
| 220 | Ga0207709_10000517 | 3300025935 | Bacteria | 33655 |
| 221 | Ga0207709_10017697 | 3300025935 | Bacteria | 3981 |
| 222 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 223 | Ga0207640_10002221 | 3300025981 | Bacteria | 10444 |
| 224 | Ga0207639_10001932 | 3300026041 | Bacteria | 13918 |
| 225 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 226 | Ga0209281_1000202 | 3300027111 | Bacteria | 135240 |
| 227 | Ga0209281_1000228 | 3300027111 | Bacteria | 118988 |
| 228 | Ga0209282_1024930 | 3300027666 | Bacteria | 3745 |
| 229 | Ga0207428_10009097 | 3300027907 | Bacteria | 8930 |
| 230 | Ga0207428_10014425 | 3300027907 | Bacteria | 6868 |
| 231 | Ga0207428_10033826 | 3300027907 | Bacteria | 4193 |
| 232 | Ga0207428_10062040 | 3300027907 | Bacteria | 2957 |
| 233 | Ga0207428_10127473 | 3300027907 | Bacteria | 1949 |
| 234 | Ga0207428_10171876 | 3300027907 | Bacteria | 1641 |
| 235 | Ga0316177_1057153 | 3300030731 | Bacteria | 2739 |
| 236 | Ga0316178_1012035 | 3300030735 | Bacteria | 3023 |
| 237 | Ga0316181_1118663 | 3300030744 | Bacteria | 4188 |
| 238 | Ga0307408_100005464 | 3300031548 | Bacteria | 8502 |
| 239 | Ga0307408_100009729 | 3300031548 | Bacteria | 6335 |
| 240 | Ga0307405_10006269 | 3300031731 | Bacteria | 5834 |
| 241 | Ga0307405_10021368 | 3300031731 | Bacteria | 3636 |
| 242 | Ga0307412_10001346 | 3300031911 | Bacteria | 13689 |
| 243 | Ga0307412_10004492 | 3300031911 | Bacteria | 7775 |
| 244 | Ga0307412_10026460 | 3300031911 | Bacteria | 3605 |
| 245 | Ga0307414_10073135 | 3300032004 | Bacteria | 2478 |
| 246 | Ga0307411_10095926 | 3300032005 | Bacteria | 2083 |
| 247 | Ga0307510_10234409 | 3300033180 | Bacteria | 1335 |
| 248 | Ga0395905_0006687 | 3300037471 | Bacteria | 11554 |
| 249 | Ga0237819_02356 | 3300038705 | Bacteria | 3863 |
| 250 | Ga0439438_006442 | 3300041405 | Bacteria | 4136 |
| 251 | Ga0439438_008741 | 3300041405 | Bacteria | 3330 |
| 252 | Ga0439438_018622 | 3300041405 | Bacteria | 1974 |
| 253 | Ga0439438_019128 | 3300041405 | Bacteria | 1939 |
| 254 | Ga0439447_008055 | 3300041407 | Bacteria | 3289 |
| 255 | Ga0439447_009761 | 3300041407 | Bacteria | 2887 |
| 256 | Ga0439466_0006533 | 3300041411 | Bacteria | 4428 |
| 257 | Ga0439466_0008215 | 3300041411 | Bacteria | 3936 |
| 258 | Ga0439466_0009264 | 3300041411 | Bacteria | 3684 |
| 259 | Ga0439466_0010012 | 3300041411 | Bacteria | 3527 |
| 260 | Ga0439466_0012574 | 3300041411 | Bacteria | 3115 |
| 261 | Ga0439466_0021397 | 3300041411 | Bacteria | 2293 |
| 262 | Ga0439466_0044850 | 3300041411 | Bacteria | 1463 |
| 263 | Ga0439465_0055313 | 3300041413 | Bacteria | 1306 |
| 264 | Ga0439432_000475 | 3300042006 | Bacteria | 15068 |
| 265 | Ga0439432_010108 | 3300042006 | Bacteria | 3280 |
| 266 | Ga0439432_010714 | 3300042006 | Bacteria | 3170 |
| 267 | Ga0439432_011316 | 3300042006 | Bacteria | 3075 |
| 268 | Ga0439432_033483 | 3300042006 | Bacteria | 1652 |
| 269 | Ga0439451_002750 | 3300042009 | Bacteria | 3574 |
| 270 | Ga0439451_006322 | 3300042009 | Bacteria | 2421 |
| 271 | Ga0439451_011997 | 3300042009 | Bacteria | 1747 |
| 272 | Ga0439451_016844 | 3300042009 | Bacteria | 1471 |
| 273 | Ga0439452_001491 | 3300042010 | Bacteria | 9502 |
| 274 | Ga0439452_001907 | 3300042010 | Bacteria | 8015 |
| 275 | Ga0439452_002387 | 3300042010 | Bacteria | 6965 |
| 276 | Ga0439452_015378 | 3300042010 | Bacteria | 2101 |
| 277 | Ga0439452_016118 | 3300042010 | Bacteria | 2034 |
| 278 | Ga0439456_000044 | 3300042013 | Bacteria | 45075 |
| 279 | Ga0439456_001180 | 3300042013 | Bacteria | 5187 |
| 280 | Ga0439456_002027 | 3300042013 | Bacteria | 4074 |
| 281 | Ga0439463_001204 | 3300042016 | Bacteria | 6908 |
| 282 | Ga0439463_001324 | 3300042016 | Bacteria | 6593 |
| 283 | Ga0450911_000236 | 3300042115 | Bacteria | 20967 |
| 284 | Ga0450911_001300 | 3300042115 | Bacteria | 5921 |
| 285 | Ga0450920_017200 | 3300042122 | Bacteria | 1381 |
| 286 | Ga0450922_001574 | 3300042124 | Bacteria | 2239 |
| 287 | Ga0450902_006654 | 3300042137 | Bacteria | 1773 |
| 288 | Ga0450903_002065 | 3300042138 | Bacteria | 3613 |
| 289 | Ga0450903_010236 | 3300042138 | Bacteria | 1520 |
| 290 | Ga0450904_003414 | 3300042139 | Bacteria | 1727 |
| 291 | Ga0450906_000783 | 3300042145 | Bacteria | 6936 |
| 292 | Ga0450906_002670 | 3300042145 | Bacteria | 3882 |
| 293 | Ga0450907_000081 | 3300042146 | Bacteria | 37093 |
| 294 | Ga0439446_0005417 | 3300042156 | Bacteria | 3282 |
| 295 | Ga0450908_012189 | 3300042184 | Bacteria | 1562 |
| 296 | Ga0450909_005626 | 3300042185 | Bacteria | 1803 |
| 297 | Ga0450909_008459 | 3300042185 | Bacteria | 1497 |
| 298 | Ga0439434_0005081 | 3300042435 | Bacteria | 3846 |
| 299 | Ga0439460_0000433 | 3300042461 | Bacteria | 8933 |
| 300 | Ga0439460_0004979 | 3300042461 | Bacteria | 3246 |
| 301 | Ga0439440_0008589 | 3300042993 | Bacteria | 2100 |
| 302 | Ga0495617_005153 | 3300046452 | Bacteria | 4666 |
| 303 | Ga0495617_010376 | 3300046452 | Bacteria | 3190 |
| 304 | Ga0495617_050050 | 3300046452 | Bacteria | 1390 |
| 305 | Ga0495617_070165 | 3300046452 | Bacteria | 1152 |
| 306 | Ga0495627_000495 | 3300046453 | Bacteria | 33051 |
| 307 | Ga0495627_001902 | 3300046453 | Bacteria | 10949 |
| 308 | Ga0495627_008013 | 3300046453 | Bacteria | 3990 |
| 309 | Ga0495627_036910 | 3300046453 | Bacteria | 1517 |
| 310 | Ga0495627_041598 | 3300046453 | Bacteria | 1410 |
| 311 | Ga0495627_045508 | 3300046453 | Bacteria | 1336 |
| 312 | Ga0495627_048879 | 3300046453 | Bacteria | 1278 |
| 313 | Ga0495603_0016430 | 3300046455 | Bacteria | 4477 |
| 314 | Ga0495603_0021967 | 3300046455 | Bacteria | 3863 |
| 315 | Ga0495603_0111148 | 3300046455 | Bacteria | 1598 |
| 316 | Ga0495603_0128467 | 3300046455 | Bacteria | 1476 |
| 317 | Ga0495590_0000613 | 3300046457 | Bacteria | 16650 |
| 318 | Ga0495590_0004867 | 3300046457 | Bacteria | 5369 |
| 319 | Ga0495590_0007136 | 3300046457 | Bacteria | 4323 |
| 320 | Ga0495590_0013318 | 3300046457 | Bacteria | 3028 |
| 321 | Ga0495590_0072503 | 3300046457 | Bacteria | 1209 |
| 322 | Ga0495591_000035 | 3300046458 | Bacteria | 169656 |
| 323 | Ga0495591_001453 | 3300046458 | Bacteria | 14688 |
| 324 | Ga0495591_003662 | 3300046458 | Bacteria | 7818 |
| 325 | Ga0495591_004116 | 3300046458 | Bacteria | 7232 |
| 326 | Ga0495591_004442 | 3300046458 | Bacteria | 6872 |
| 327 | Ga0495591_004480 | 3300046458 | Bacteria | 6828 |
| 328 | Ga0495591_004811 | 3300046458 | Bacteria | 6441 |
| 329 | Ga0495591_009507 | 3300046458 | Bacteria | 3853 |
| 330 | Ga0495591_009898 | 3300046458 | Bacteria | 3746 |
| 331 | Ga0495591_026108 | 3300046458 | Bacteria | 1821 |
| 332 | Ga0495591_039510 | 3300046458 | Bacteria | 1352 |
| 333 | Ga0495629_0036903 | 3300046459 | Bacteria | 3447 |
| 334 | Ga0495629_0154423 | 3300046459 | Bacteria | 1595 |
| 335 | Ga0495638_0001212 | 3300046460 | Bacteria | 24592 |
| 336 | Ga0495638_0010929 | 3300046460 | Bacteria | 6276 |
| 337 | Ga0495638_0013448 | 3300046460 | Bacteria | 5571 |
| 338 | Ga0495638_0104886 | 3300046460 | Bacteria | 1685 |
| 339 | Ga0495653_0009903 | 3300046463 | Bacteria | 7794 |
| 340 | Ga0495653_0028529 | 3300046463 | Bacteria | 4462 |
| 341 | Ga0495653_0090216 | 3300046463 | Bacteria | 2244 |
| 342 | Ga0495653_0156518 | 3300046463 | Bacteria | 1586 |
| 343 | Ga0495653_0200526 | 3300046463 | Bacteria | 1354 |
| 344 | Ga0495650_0000630 | 3300046471 | Bacteria | 47358 |
| 345 | Ga0495650_0001566 | 3300046471 | Bacteria | 21553 |
| 346 | Ga0495650_0008327 | 3300046471 | Bacteria | 6065 |
| 347 | Ga0495650_0023135 | 3300046471 | Bacteria | 2964 |
| 348 | Ga0495650_0040135 | 3300046471 | Bacteria | 2013 |
| 349 | Ga0495650_0072102 | 3300046471 | Bacteria | 1352 |
| 350 | Ga0495650_0076320 | 3300046471 | Bacteria | 1302 |
| 351 | Ga0495650_0079801 | 3300046471 | Bacteria | 1264 |
| 352 | Ga0495582_0098189 | 3300046473 | Bacteria | 1638 |
| 353 | Ga0495605_0000137 | 3300046474 | Bacteria | 94482 |
| 354 | Ga0495605_0000592 | 3300046474 | Bacteria | 28836 |
| 355 | Ga0495605_0001267 | 3300046474 | Bacteria | 16727 |
| 356 | Ga0495605_0003821 | 3300046474 | Bacteria | 8933 |
| 357 | Ga0495605_0004089 | 3300046474 | Bacteria | 8608 |
| 358 | Ga0495605_0005419 | 3300046474 | Bacteria | 7430 |
| 359 | Ga0495605_0008221 | 3300046474 | Bacteria | 5901 |
| 360 | Ga0495605_0022401 | 3300046474 | Bacteria | 3336 |
| 361 | Ga0495605_0038391 | 3300046474 | Bacteria | 2402 |
| 362 | Ga0495605_0054862 | 3300046474 | Bacteria | 1928 |
| 363 | Ga0495605_0076390 | 3300046474 | Bacteria | 1573 |
| 364 | Ga0495605_0081759 | 3300046474 | Bacteria | 1510 |
| 365 | Ga0495605_0138035 | 3300046474 | Bacteria | 1095 |
| 366 | Ga0495639_0000127 | 3300046475 | Bacteria | 39107 |
| 367 | Ga0495639_0118036 | 3300046475 | Bacteria | 1263 |
| 368 | Ga0495664_0105641 | 3300046477 | Bacteria | 1697 |
| 369 | Ga0495584_0003718 | 3300046491 | Bacteria | 8318 |
| 370 | Ga0495584_0004136 | 3300046491 | Bacteria | 7832 |
| 371 | Ga0495584_0022843 | 3300046491 | Bacteria | 3173 |
| 372 | Ga0495584_0025094 | 3300046491 | Bacteria | 3021 |
| 373 | Ga0495584_0079907 | 3300046491 | Bacteria | 1645 |
| 374 | Ga0495585_0005546 | 3300046492 | Bacteria | 7937 |
| 375 | Ga0495585_0008293 | 3300046492 | Bacteria | 6305 |
| 376 | Ga0495585_0028276 | 3300046492 | Bacteria | 3198 |
| 377 | Ga0495585_0036928 | 3300046492 | Bacteria | 2753 |
| 378 | Ga0495585_0087306 | 3300046492 | Bacteria | 1683 |
| 379 | Ga0495585_0087860 | 3300046492 | Bacteria | 1677 |
| 380 | Ga0495585_0108398 | 3300046492 | Bacteria | 1479 |
| 381 | Ga0495594_0012836 | 3300046499 | Bacteria | 4368 |
| 382 | Ga0495596_0000390 | 3300046500 | Bacteria | 27952 |
| 383 | Ga0495607_0000376 | 3300046501 | Bacteria | 46064 |
| 384 | Ga0495607_0000642 | 3300046501 | Bacteria | 33955 |
| 385 | Ga0495607_0002114 | 3300046501 | Bacteria | 16578 |
| 386 | Ga0495607_0004572 | 3300046501 | Bacteria | 10141 |
| 387 | Ga0495607_0008126 | 3300046501 | Bacteria | 7199 |
| 388 | Ga0495607_0010704 | 3300046501 | Bacteria | 6146 |
| 389 | Ga0495607_0011076 | 3300046501 | Bacteria | 6021 |
| 390 | Ga0495607_0023829 | 3300046501 | Bacteria | 3825 |
| 391 | Ga0495607_0024964 | 3300046501 | Bacteria | 3721 |
| 392 | Ga0495607_0038531 | 3300046501 | Bacteria | 2862 |
| 393 | Ga0495607_0053501 | 3300046501 | Bacteria | 2332 |
| 394 | Ga0495607_0081118 | 3300046501 | Bacteria | 1782 |
| 395 | Ga0495607_0085590 | 3300046501 | Bacteria | 1721 |
| 396 | Ga0495607_0099605 | 3300046501 | Bacteria | 1559 |
| 397 | Ga0495583_0000565 | 3300046506 | Bacteria | 51302 |
| 398 | Ga0495583_0000689 | 3300046506 | Bacteria | 43732 |
| 399 | Ga0495583_0000894 | 3300046506 | Bacteria | 35676 |
| 400 | Ga0495583_0003193 | 3300046506 | Bacteria | 12857 |
| 401 | Ga0495583_0004738 | 3300046506 | Bacteria | 9563 |
| 402 | Ga0495583_0007443 | 3300046506 | Bacteria | 6875 |
| 403 | Ga0495583_0024131 | 3300046506 | Bacteria | 3062 |
| 404 | Ga0495583_0096856 | 3300046506 | Bacteria | 1263 |
| 405 | Ga0495606_0000320 | 3300046507 | Bacteria | 82551 |
| 406 | Ga0495606_0001236 | 3300046507 | Bacteria | 35710 |
| 407 | Ga0495606_0003472 | 3300046507 | Bacteria | 16708 |
| 408 | Ga0495606_0012494 | 3300046507 | Bacteria | 6801 |
| 409 | Ga0495606_0013491 | 3300046507 | Bacteria | 6447 |
| 410 | Ga0495606_0016152 | 3300046507 | Bacteria | 5708 |
| 411 | Ga0495606_0018892 | 3300046507 | Bacteria | 5153 |
| 412 | Ga0495606_0028589 | 3300046507 | Bacteria | 3929 |
| 413 | Ga0495606_0031518 | 3300046507 | Bacteria | 3684 |
| 414 | Ga0495606_0033533 | 3300046507 | Bacteria | 3540 |
| 415 | Ga0495606_0113380 | 3300046507 | Bacteria | 1632 |
| 416 | Ga0495606_0147848 | 3300046507 | Bacteria | 1381 |
| 417 | Ga0495606_0163132 | 3300046507 | Bacteria | 1298 |
| 418 | Ga0495606_0167667 | 3300046507 | Bacteria | 1276 |
| 419 | Ga0495610_0004779 | 3300046512 | Bacteria | 9885 |
| 420 | Ga0495610_0005166 | 3300046512 | Bacteria | 9359 |
| 421 | Ga0495610_0007789 | 3300046512 | Bacteria | 7062 |
| 422 | Ga0495610_0021439 | 3300046512 | Bacteria | 3553 |
| 423 | Ga0495610_0021482 | 3300046512 | Bacteria | 3548 |
| 424 | Ga0495610_0024964 | 3300046512 | Bacteria | 3218 |
| 425 | Ga0495610_0094020 | 3300046512 | Bacteria | 1354 |
| 426 | Ga0495610_0103491 | 3300046512 | Bacteria | 1271 |
| 427 | Ga0495610_0105794 | 3300046512 | Bacteria | 1253 |
| 428 | Ga0495610_0106319 | 3300046512 | Bacteria | 1249 |
| 429 | Ga0495616_0004648 | 3300046513 | Bacteria | 8620 |
| 430 | Ga0495616_0008281 | 3300046513 | Bacteria | 6169 |
| 431 | Ga0495616_0020229 | 3300046513 | Bacteria | 3623 |
| 432 | Ga0495616_0026778 | 3300046513 | Bacteria | 3064 |
| 433 | Ga0495616_0034541 | 3300046513 | Bacteria | 2626 |
| 434 | Ga0495616_0039778 | 3300046513 | Bacteria | 2406 |
| 435 | Ga0495616_0059157 | 3300046513 | Bacteria | 1885 |
| 436 | Ga0495616_0097543 | 3300046513 | Bacteria | 1382 |
| 437 | Ga0495616_0112232 | 3300046513 | Bacteria | 1265 |
| 438 | Ga0495620_0000212 | 3300046515 | Bacteria | 43700 |
| 439 | Ga0495620_0000374 | 3300046515 | Bacteria | 30623 |
| 440 | Ga0495620_0001385 | 3300046515 | Bacteria | 14577 |
| 441 | Ga0495620_0004148 | 3300046515 | Bacteria | 8218 |
| 442 | Ga0495620_0005071 | 3300046515 | Bacteria | 7373 |
| 443 | Ga0495620_0005301 | 3300046515 | Bacteria | 7212 |
| 444 | Ga0495620_0006105 | 3300046515 | Bacteria | 6656 |
| 445 | Ga0495620_0063286 | 3300046515 | Bacteria | 1534 |
| 446 | Ga0495630_0066108 | 3300046517 | Bacteria | 2717 |
| 447 | Ga0495630_0242936 | 3300046517 | Bacteria | 1376 |
| 448 | Ga0495631_0003637 | 3300046518 | Bacteria | 8416 |
| 449 | Ga0495631_0006304 | 3300046518 | Bacteria | 6137 |
| 450 | Ga0495631_0006465 | 3300046518 | Bacteria | 6045 |
| 451 | Ga0495631_0058971 | 3300046518 | Bacteria | 1668 |
| 452 | Ga0495631_0081499 | 3300046518 | Bacteria | 1396 |
| 453 | Ga0495632_0001087 | 3300046519 | Bacteria | 23308 |
| 454 | Ga0495632_0004088 | 3300046519 | Bacteria | 10060 |
| 455 | Ga0495632_0018928 | 3300046519 | Bacteria | 3761 |
| 456 | Ga0495632_0021081 | 3300046519 | Bacteria | 3516 |
| 457 | Ga0495632_0024016 | 3300046519 | Bacteria | 3245 |
| 458 | Ga0495632_0062131 | 3300046519 | Bacteria | 1811 |
| 459 | Ga0495632_0099595 | 3300046519 | Bacteria | 1370 |
| 460 | Ga0495637_0000303 | 3300046520 | Bacteria | 38131 |
| 461 | Ga0495637_0000319 | 3300046520 | Bacteria | 37329 |
| 462 | Ga0495637_0004280 | 3300046520 | Bacteria | 7410 |
| 463 | Ga0495637_0005944 | 3300046520 | Bacteria | 6170 |
| 464 | Ga0495637_0010951 | 3300046520 | Bacteria | 4370 |
| 465 | Ga0495637_0016701 | 3300046520 | Bacteria | 3429 |
| 466 | Ga0495637_0019496 | 3300046520 | Bacteria | 3135 |
| 467 | Ga0495637_0026272 | 3300046520 | Bacteria | 2616 |
| 468 | Ga0495637_0029396 | 3300046520 | Bacteria | 2446 |
| 469 | Ga0495637_0036201 | 3300046520 | Bacteria | 2151 |
| 470 | Ga0495637_0040369 | 3300046520 | Bacteria | 2009 |
| 471 | Ga0495637_0040574 | 3300046520 | Bacteria | 2003 |
| 472 | Ga0495637_0049177 | 3300046520 | Bacteria | 1772 |
| 473 | Ga0495637_0061048 | 3300046520 | Bacteria | 1546 |
| 474 | Ga0495637_0075710 | 3300046520 | Bacteria | 1349 |
| 475 | Ga0495637_0077183 | 3300046520 | Bacteria | 1333 |
| 476 | Ga0495643_0000870 | 3300046522 | Bacteria | 32223 |
| 477 | Ga0495643_0078050 | 3300046522 | Bacteria | 1729 |
| 478 | Ga0495643_0120705 | 3300046522 | Bacteria | 1324 |
| 479 | Ga0495643_0126159 | 3300046522 | Bacteria | 1288 |
| 480 | Ga0495644_0003678 | 3300046523 | Bacteria | 6035 |
| 481 | Ga0495644_0009151 | 3300046523 | Bacteria | 3816 |
| 482 | Ga0495648_0000133 | 3300046524 | Bacteria | 87909 |
| 483 | Ga0495648_0014373 | 3300046524 | Bacteria | 5799 |
| 484 | Ga0495648_0024895 | 3300046524 | Bacteria | 4063 |
| 485 | Ga0495648_0026605 | 3300046524 | Bacteria | 3891 |
| 486 | Ga0495648_0027018 | 3300046524 | Bacteria | 3851 |
| 487 | Ga0495648_0027789 | 3300046524 | Bacteria | 3780 |
| 488 | Ga0495648_0041593 | 3300046524 | Bacteria | 2900 |
| 489 | Ga0495648_0052974 | 3300046524 | Bacteria | 2461 |
| 490 | Ga0495648_0102022 | 3300046524 | Bacteria | 1581 |
| 491 | Ga0495648_0116762 | 3300046524 | Bacteria | 1441 |
| 492 | Ga0495648_0133647 | 3300046524 | Bacteria | 1315 |
| 493 | Ga0495648_0133797 | 3300046524 | Bacteria | 1314 |
| 494 | Ga0495642_0000076 | 3300046528 | Bacteria | 58157 |
| 495 | Ga0495642_0006736 | 3300046528 | Bacteria | 4403 |
| 496 | Ga0495642_0015515 | 3300046528 | Bacteria | 2962 |
| 497 | Ga0495652_0015091 | 3300046529 | Bacteria | 6920 |
| 498 | Ga0495654_0000247 | 3300046530 | Bacteria | 50392 |
| 499 | Ga0495654_0002646 | 3300046530 | Bacteria | 11381 |
| 500 | Ga0495654_0006092 | 3300046530 | Bacteria | 6915 |
| 501 | Ga0495654_0013101 | 3300046530 | Bacteria | 4441 |
| 502 | Ga0495654_0015555 | 3300046530 | Bacteria | 4038 |
| 503 | Ga0495654_0018908 | 3300046530 | Bacteria | 3605 |
| 504 | Ga0495654_0028242 | 3300046530 | Bacteria | 2869 |
| 505 | Ga0495654_0035326 | 3300046530 | Bacteria | 2518 |
| 506 | Ga0495654_0041153 | 3300046530 | Bacteria | 2299 |
| 507 | Ga0495654_0084790 | 3300046530 | Bacteria | 1479 |
| 508 | Ga0495654_0098140 | 3300046530 | Bacteria | 1352 |
| 509 | Ga0495654_0103483 | 3300046530 | Bacteria | 1307 |
| 510 | Ga0495587_0090241 | 3300046536 | Bacteria | 1770 |
| 511 | Ga0495609_0000265 | 3300046538 | Bacteria | 49286 |
| 512 | Ga0495609_0000273 | 3300046538 | Bacteria | 48181 |
| 513 | Ga0495609_0000397 | 3300046538 | Bacteria | 36568 |
| 514 | Ga0495609_0006959 | 3300046538 | Bacteria | 5704 |
| 515 | Ga0495609_0010523 | 3300046538 | Bacteria | 4434 |
| 516 | Ga0495609_0061892 | 3300046538 | Bacteria | 1653 |
| 517 | Ga0495609_0099553 | 3300046538 | Bacteria | 1260 |
| 518 | Ga0495597_0000200 | 3300046542 | Bacteria | 54946 |
| 519 | Ga0495597_0003293 | 3300046542 | Bacteria | 9559 |
| 520 | Ga0495597_0021246 | 3300046542 | Bacteria | 3019 |
| 521 | Ga0495597_0028566 | 3300046542 | Bacteria | 2552 |
| 522 | Ga0495597_0075111 | 3300046542 | Bacteria | 1451 |
| 523 | Ga0495597_0075507 | 3300046542 | Bacteria | 1446 |
| 524 | Ga0495622_0014670 | 3300046557 | Bacteria | 3640 |
| 525 | Ga0495622_0017397 | 3300046557 | Bacteria | 3345 |
| 526 | Ga0495622_0018407 | 3300046557 | Bacteria | 3252 |
| 527 | Ga0495622_0018677 | 3300046557 | Bacteria | 3230 |
| 528 | Ga0495622_0094212 | 3300046557 | Bacteria | 1374 |
| 529 | Ga0495622_0097757 | 3300046557 | Bacteria | 1346 |
| 530 | Ga0495633_0000428 | 3300046558 | Bacteria | 43681 |
| 531 | Ga0495633_0056833 | 3300046558 | Bacteria | 1838 |
| 532 | Ga0495633_0100649 | 3300046558 | Bacteria | 1341 |
| 533 | Ga0495656_0005947 | 3300046615 | Bacteria | 4245 |
| 534 | Ga0495668_0007072 | 3300046616 | Bacteria | 7224 |
| 535 | Ga0495668_0025208 | 3300046616 | Bacteria | 3381 |
| 536 | Ga0495668_0072792 | 3300046616 | Bacteria | 1887 |
| 537 | Ga0495634_0010366 | 3300046642 | Bacteria | 6829 |
| 538 | Ga0495611_0001566 | 3300046648 | Bacteria | 11204 |
| 539 | Ga0495611_0003735 | 3300046648 | Bacteria | 6646 |
| 540 | Ga0495611_0010002 | 3300046648 | Bacteria | 4013 |
| 541 | Ga0495611_0073079 | 3300046648 | Bacteria | 1569 |
| 542 | Ga0495611_0107088 | 3300046648 | Bacteria | 1300 |
| 543 | Ga0495625_0000076 | 3300046660 | Bacteria | 163580 |
| 544 | Ga0495625_0013277 | 3300046660 | Bacteria | 6626 |
| 545 | Ga0495625_0059673 | 3300046660 | Bacteria | 2705 |
| 546 | Ga0495625_0191309 | 3300046660 | Bacteria | 1355 |
| 547 | Ga0495625_0201162 | 3300046660 | Bacteria | 1314 |
| 548 | Ga0495635_0020767 | 3300046663 | Bacteria | 4575 |
| 549 | Ga0495635_0032880 | 3300046663 | Bacteria | 3597 |
| 550 | Ga0495635_0107844 | 3300046663 | Bacteria | 1902 |
| 551 | Ga0495659_0010803 | 3300046664 | Bacteria | 2938 |
| 552 | Ga0495661_0000030 | 3300046665 | Bacteria | 171980 |
| 553 | Ga0495661_0000432 | 3300046665 | Bacteria | 44289 |
| 554 | Ga0495661_0000517 | 3300046665 | Bacteria | 40087 |
| 555 | Ga0495661_0000828 | 3300046665 | Bacteria | 28985 |
| 556 | Ga0495661_0005510 | 3300046665 | Bacteria | 8983 |
| 557 | Ga0495661_0009036 | 3300046665 | Bacteria | 6858 |
| 558 | Ga0495588_0006428 | 3300046674 | Bacteria | 5291 |
| 559 | Ga0495588_0023275 | 3300046674 | Bacteria | 3066 |
| 560 | Ga0495623_0008011 | 3300046679 | Bacteria | 6865 |
| 561 | Ga0495646_0023582 | 3300046680 | Bacteria | 3873 |
| 562 | Ga0495646_0139534 | 3300046680 | Bacteria | 1356 |
| 563 | Ga0495646_0144144 | 3300046680 | Bacteria | 1329 |
| 564 | Ga0495669_0002556 | 3300046684 | Bacteria | 7430 |
| 565 | Ga0495669_0028578 | 3300046684 | Bacteria | 2443 |
| 566 | Ga0495613_0220252 | 3300046689 | Bacteria | 1332 |
| 567 | Ga0495624_0001085 | 3300046690 | Bacteria | 21505 |
| 568 | Ga0495624_0004157 | 3300046690 | Bacteria | 10639 |
| 569 | Ga0495670_0001799 | 3300046691 | Bacteria | 10532 |
| 570 | Ga0495670_0019024 | 3300046691 | Bacteria | 3384 |
| 571 | Ga0495670_0023057 | 3300046691 | Bacteria | 3073 |
| 572 | Ga0495670_0054418 | 3300046691 | Bacteria | 2005 |
| 573 | Ga0495670_0072069 | 3300046691 | Bacteria | 1750 |
| 574 | Ga0495670_0113827 | 3300046691 | Bacteria | 1401 |
| 575 | Ga0495670_0142851 | 3300046691 | Bacteria | 1252 |
| 576 | Ga0495670_0148562 | 3300046691 | Bacteria | 1228 |
| 577 | Ga0495671_0003778 | 3300046692 | Bacteria | 9203 |
| 578 | Ga0495671_0009761 | 3300046692 | Bacteria | 5347 |
| 579 | Ga0495671_0011686 | 3300046692 | Bacteria | 4816 |
| 580 | Ga0495671_0023096 | 3300046692 | Bacteria | 3251 |
| 581 | Ga0495671_0023598 | 3300046692 | Bacteria | 3212 |
| 582 | Ga0495671_0072790 | 3300046692 | Bacteria | 1687 |
| 583 | Ga0495671_0080626 | 3300046692 | Bacteria | 1594 |
| 584 | Ga0495671_0115495 | 3300046692 | Bacteria | 1310 |
| 585 | Ga0495649_0001766 | 3300046694 | Bacteria | 15936 |
| 586 | Ga0495649_0004016 | 3300046694 | Bacteria | 9693 |
| 587 | Ga0495649_0006523 | 3300046694 | Bacteria | 7260 |
| 588 | Ga0495649_0011115 | 3300046694 | Bacteria | 5298 |
| 589 | Ga0495649_0012999 | 3300046694 | Bacteria | 4818 |
| 590 | Ga0495649_0017155 | 3300046694 | Bacteria | 4089 |
| 591 | Ga0495649_0019461 | 3300046694 | Bacteria | 3814 |
| 592 | Ga0495649_0026106 | 3300046694 | Bacteria | 3252 |
| 593 | Ga0495649_0035012 | 3300046694 | Bacteria | 2761 |
| 594 | Ga0495649_0058916 | 3300046694 | Bacteria | 2068 |
| 595 | Ga0495649_0130765 | 3300046694 | Bacteria | 1324 |
| 596 | Ga0495649_0134031 | 3300046694 | Bacteria | 1306 |
| 597 | Ga0495589_0001106 | 3300046794 | Bacteria | 16077 |
| 598 | Ga0495589_0001608 | 3300046794 | Bacteria | 12945 |
| 599 | Ga0495589_0002515 | 3300046794 | Bacteria | 10219 |
| 600 | Ga0495589_0003963 | 3300046794 | Bacteria | 7945 |
| 601 | Ga0495589_0019956 | 3300046794 | Bacteria | 3427 |
| 602 | Ga0495589_0021143 | 3300046794 | Bacteria | 3325 |
| 603 | Ga0495589_0103072 | 3300046794 | Bacteria | 1379 |
| 604 | Ga0495660_0002665 | 3300046810 | Bacteria | 11306 |
| 605 | Ga0495660_0003517 | 3300046810 | Bacteria | 9662 |
| 606 | Ga0495660_0008839 | 3300046810 | Bacteria | 5882 |
| 607 | Ga0495660_0065694 | 3300046810 | Bacteria | 1936 |
| 608 | Ga0495660_0121555 | 3300046810 | Bacteria | 1320 |
| 609 | Ga0495660_0125898 | 3300046810 | Bacteria | 1291 |
| 610 | Ga0495660_0128682 | 3300046810 | Bacteria | 1272 |
| 611 | Ga0495581_0172636 | 3300047315 | Bacteria | 1264 |
| 612 | Ga0495604_0009862 | 3300047317 | Bacteria | 7560 |
| 613 | Ga0495604_0014934 | 3300047317 | Bacteria | 6195 |
| 614 | Ga0495604_0091974 | 3300047317 | Bacteria | 2248 |
| 615 | Ga0495636_0006833 | 3300047318 | Bacteria | 4486 |
| 616 | Ga0495636_0020541 | 3300047318 | Bacteria | 2661 |
| 617 | Ga0495674_0049521 | 3300047319 | Bacteria | 3712 |
| 618 | Ga0495672_0001317 | 3300047320 | Bacteria | 24681 |
| 619 | Ga0495672_0002286 | 3300047320 | Bacteria | 17780 |
| 620 | Ga0495672_0002383 | 3300047320 | Bacteria | 17353 |
| 621 | Ga0495672_0007121 | 3300047320 | Bacteria | 8471 |
| 622 | Ga0495672_0017179 | 3300047320 | Bacteria | 4844 |
| 623 | Ga0495672_0020575 | 3300047320 | Bacteria | 4318 |
| 624 | Ga0495672_0021868 | 3300047320 | Bacteria | 4165 |
| 625 | Ga0495672_0061213 | 3300047320 | Bacteria | 2170 |
| 626 | Ga0495672_0066715 | 3300047320 | Bacteria | 2052 |
| 627 | Ga0495672_0093575 | 3300047320 | Bacteria | 1645 |
| 628 | Ga0495672_0127919 | 3300047320 | Bacteria | 1340 |
| 629 | Ga0495676_0000016 | 3300047321 | Bacteria | 196310 |
| 630 | Ga0495676_0006902 | 3300047321 | Bacteria | 10427 |
| 631 | Ga0495676_0206094 | 3300047321 | Bacteria | 1363 |
| 632 | Ga0495680_0001587 | 3300047322 | Bacteria | 24283 |
| 633 | Ga0495680_0007916 | 3300047322 | Bacteria | 9692 |
| 634 | Ga0495680_0014686 | 3300047322 | Bacteria | 6774 |
| 635 | Ga0495680_0220065 | 3300047322 | Bacteria | 1355 |
| 636 | Ga0495683_0000286 | 3300047323 | Bacteria | 43731 |
| 637 | Ga0495683_0000726 | 3300047323 | Bacteria | 23960 |
| 638 | Ga0495683_0000910 | 3300047323 | Bacteria | 20890 |
| 639 | Ga0495683_0003909 | 3300047323 | Bacteria | 8576 |
| 640 | Ga0495683_0017809 | 3300047323 | Bacteria | 3677 |
| 641 | Ga0495683_0021311 | 3300047323 | Bacteria | 3339 |
| 642 | Ga0495683_0022560 | 3300047323 | Bacteria | 3236 |
| 643 | Ga0495687_000029 | 3300047443 | Bacteria | 293244 |
| 644 | Ga0495687_012960 | 3300047443 | Bacteria | 4376 |
| 645 | Ga0495687_020460 | 3300047443 | Bacteria | 3223 |
| 646 | Ga0495687_021838 | 3300047443 | Bacteria | 3085 |
| 647 | Ga0495675_0025176 | 3300047444 | Bacteria | 3795 |
| 648 | Ga0495675_0068501 | 3300047444 | Bacteria | 2241 |
| 649 | Ga0495677_0011575 | 3300047445 | Bacteria | 3225 |
| 650 | Ga0495679_001655 | 3300047446 | Bacteria | 12412 |
| 651 | Ga0495679_002801 | 3300047446 | Bacteria | 8666 |
| 652 | Ga0495679_045944 | 3300047446 | Bacteria | 1331 |
| 653 | Ga0495679_050731 | 3300047446 | Bacteria | 1246 |
| 654 | Ga0495673_0000472 | 3300047469 | Bacteria | 43659 |
| 655 | Ga0495673_0000586 | 3300047469 | Bacteria | 36563 |
| 656 | Ga0495673_0003108 | 3300047469 | Bacteria | 11124 |
| 657 | Ga0495673_0005060 | 3300047469 | Bacteria | 8071 |
| 658 | Ga0495673_0005065 | 3300047469 | Bacteria | 8068 |
| 659 | Ga0495673_0006701 | 3300047469 | Bacteria | 6742 |
| 660 | Ga0495673_0014840 | 3300047469 | Bacteria | 4036 |
| 661 | Ga0495673_0016424 | 3300047469 | Bacteria | 3784 |
| 662 | Ga0495673_0020472 | 3300047469 | Bacteria | 3292 |
| 663 | Ga0495673_0040233 | 3300047469 | Bacteria | 2114 |
| 664 | Ga0495673_0048399 | 3300047469 | Bacteria | 1874 |
| 665 | Ga0495673_0072730 | 3300047469 | Bacteria | 1442 |
| 666 | Ga0495673_0085711 | 3300047469 | Bacteria | 1296 |
| 667 | Ga0495673_0089797 | 3300047469 | Bacteria | 1257 |
| 668 | Ga0495681_0000366 | 3300047470 | Bacteria | 35238 |
| 669 | Ga0495681_0003150 | 3300047470 | Bacteria | 11551 |
| 670 | Ga0495681_0006402 | 3300047470 | Bacteria | 7747 |
| 671 | Ga0495681_0008629 | 3300047470 | Bacteria | 6363 |
| 672 | Ga0495681_0009080 | 3300047470 | Bacteria | 6161 |
| 673 | Ga0495681_0022794 | 3300047470 | Bacteria | 3341 |
| 674 | Ga0495681_0044845 | 3300047470 | Bacteria | 2121 |
| 675 | Ga0495681_0052872 | 3300047470 | Bacteria | 1903 |
| 676 | Ga0495681_0077499 | 3300047470 | Bacteria | 1491 |
| 677 | Ga0495681_0081326 | 3300047470 | Bacteria | 1445 |
| 678 | Ga0495681_0083532 | 3300047470 | Bacteria | 1421 |
| 679 | Ga0495681_0096939 | 3300047470 | Bacteria | 1294 |
| 680 | Ga0495681_0125442 | 3300047470 | Bacteria | 1097 |
| 681 | Ga0495686_0035589 | 3300047472 | Bacteria | 3199 |
| 682 | Ga0495686_0121194 | 3300047472 | Bacteria | 1558 |
| 683 | Ga0495686_0124789 | 3300047472 | Bacteria | 1531 |
| 684 | Ga0495686_0150470 | 3300047472 | Bacteria | 1366 |
| 685 | Ga0495593_0015085 | 3300047673 | Bacteria | 4388 |
| 686 | Ga0495593_0128294 | 3300047673 | Bacteria | 1288 |
| 687 | Ga0495602_0000543 | 3300048088 | Bacteria | 35196 |
| 688 | Ga0495602_0246227 | 3300048088 | Bacteria | 1334 |
| 689 | Ga0495626_0000336 | 3300048091 | Bacteria | 49874 |
| 690 | Ga0495626_0001604 | 3300048091 | Bacteria | 17630 |
| 691 | Ga0495626_0001636 | 3300048091 | Bacteria | 17386 |
| 692 | Ga0495626_0012804 | 3300048091 | Bacteria | 4379 |
| 693 | Ga0495626_0015302 | 3300048091 | Bacteria | 3932 |
| 694 | Ga0495626_0017986 | 3300048091 | Bacteria | 3561 |
| 695 | Ga0495626_0025012 | 3300048091 | Bacteria | 2922 |
| 696 | Ga0495626_0059261 | 3300048091 | Bacteria | 1747 |
| 697 | Ga0495626_0061420 | 3300048091 | Bacteria | 1708 |
| 698 | Ga0495626_0091880 | 3300048091 | Bacteria | 1333 |
| 699 | Ga0496102_0007461 | 3300048905 | Bacteria | 9342 |
| 700 | Ga0496102_0014410 | 3300048905 | Bacteria | 6869 |
| 701 | Ga0496103_0065253 | 3300048906 | Bacteria | 2270 |
| 702 | Ga0496104_0188188 | 3300048907 | Bacteria | 1975 |
| 703 | Ga0496106_0018644 | 3300048909 | Bacteria | 5136 |
| 704 | Ga0496107_0029852 | 3300048910 | Bacteria | 3882 |
| 705 | Ga0496110_0004433 | 3300048913 | Bacteria | 10881 |
| 706 | Ga0496112_0003428 | 3300048915 | Bacteria | 13094 |
| 707 | Ga0496115_0280840 | 3300048918 | Bacteria | 1367 |
| 708 | Ga0496116_0000913 | 3300048919 | Bacteria | 36517 |
| 709 | Ga0496116_0002975 | 3300048919 | Bacteria | 17220 |
| 710 | Ga0496116_0013303 | 3300048919 | Bacteria | 6647 |
| 711 | Ga0496116_0014797 | 3300048919 | Bacteria | 6205 |
| 712 | Ga0496116_0146131 | 3300048919 | Bacteria | 1321 |
| 713 | Ga0496116_0148792 | 3300048919 | Bacteria | 1304 |
| 714 | Ga0496117_0000935 | 3300048920 | Bacteria | 44757 |
| 715 | Ga0496117_0001277 | 3300048920 | Bacteria | 37322 |
| 716 | Ga0496117_0001851 | 3300048920 | Bacteria | 28533 |
| 717 | Ga0496117_0015146 | 3300048920 | Bacteria | 6598 |
| 718 | Ga0496117_0043434 | 3300048920 | Bacteria | 3268 |
| 719 | Ga0496117_0122707 | 3300048920 | Bacteria | 1592 |
| 720 | Ga0496118_0002130 | 3300048921 | Bacteria | 27647 |
| 721 | Ga0496118_0019808 | 3300048921 | Bacteria | 6000 |
| 722 | Ga0496118_0048726 | 3300048921 | Bacteria | 3267 |
| 723 | Ga0496118_0071479 | 3300048921 | Bacteria | 2498 |
| 724 | Ga0496118_0150394 | 3300048921 | Bacteria | 1458 |
| 725 | Ga0496118_0183376 | 3300048921 | Bacteria | 1262 |
| 726 | Ga0496119_0136202 | 3300048922 | Bacteria | 1331 |
| 727 | Ga0496120_0021830 | 3300048923 | Bacteria | 4037 |
| 728 | Ga0496120_0132881 | 3300048923 | Bacteria | 1272 |
| 729 | Ga0496121_0002654 | 3300048924 | Bacteria | 26822 |
| 730 | Ga0496121_0007389 | 3300048924 | Bacteria | 13277 |
| 731 | Ga0496121_0010782 | 3300048924 | Bacteria | 10245 |
| 732 | Ga0496122_0000447 | 3300048925 | Bacteria | 86474 |
| 733 | Ga0496122_0008181 | 3300048925 | Bacteria | 11368 |
| 734 | Ga0496122_0010122 | 3300048925 | Bacteria | 9781 |
| 735 | Ga0496122_0012522 | 3300048925 | Bacteria | 8431 |
| 736 | Ga0496122_0018931 | 3300048925 | Bacteria | 6322 |
| 737 | Ga0496122_0170207 | 3300048925 | Bacteria | 1314 |
| 738 | Ga0496123_0000348 | 3300048926 | Bacteria | 86724 |
| 739 | Ga0496123_0005030 | 3300048926 | Bacteria | 13527 |
| 740 | Ga0496123_0018067 | 3300048926 | Bacteria | 5638 |
| 741 | Ga0496123_0090900 | 3300048926 | Bacteria | 1813 |
| 742 | Ga0496124_0001241 | 3300048927 | Bacteria | 39178 |
| 743 | Ga0496124_0002369 | 3300048927 | Bacteria | 24838 |
| 744 | Ga0496124_0011175 | 3300048927 | Bacteria | 9003 |
| 745 | Ga0496124_0011845 | 3300048927 | Bacteria | 8683 |
| 746 | Ga0496124_0016748 | 3300048927 | Bacteria | 6951 |
| 747 | Ga0496124_0025923 | 3300048927 | Bacteria | 5297 |
| 748 | Ga0496124_0051186 | 3300048927 | Bacteria | 3515 |
| 749 | Ga0496124_0094043 | 3300048927 | Bacteria | 2439 |
| 750 | Ga0496124_0131014 | 3300048927 | Bacteria | 1992 |
| 751 | Ga0496125_0001176 | 3300048928 | Bacteria | 39651 |
| 752 | Ga0496125_0001804 | 3300048928 | Bacteria | 29576 |
| 753 | Ga0496125_0013580 | 3300048928 | Bacteria | 7999 |
| 754 | Ga0496125_0051194 | 3300048928 | Bacteria | 3409 |
| 755 | Ga0496125_0082745 | 3300048928 | Bacteria | 2445 |
| 756 | Ga0496125_0170251 | 3300048928 | Bacteria | 1465 |
| 757 | Ga0496126_0038236 | 3300048929 | Bacteria | 4467 |
| 758 | Ga0496126_0050359 | 3300048929 | Bacteria | 3796 |
| 759 | Ga0496126_0078941 | 3300048929 | Bacteria | 2915 |
| 760 | Ga0495678_000401 | 3300049459 | Bacteria | 43725 |
| 761 | Ga0495678_000504 | 3300049459 | Bacteria | 38278 |
| 762 | Ga0495678_007305 | 3300049459 | Bacteria | 5745 |
| 763 | Ga0495678_007458 | 3300049459 | Bacteria | 5665 |
| 764 | Ga0495678_020048 | 3300049459 | Bacteria | 2969 |
| 765 | Ga0495678_023128 | 3300049459 | Bacteria | 2708 |
| 766 | Ga0495678_039161 | 3300049459 | Bacteria | 1913 |
| 767 | Ga0495678_063473 | 3300049459 | Bacteria | 1379 |
| 768 | Ga0495678_070192 | 3300049459 | Bacteria | 1286 |
| 769 | Ga0495682_0000153 | 3300049460 | Bacteria | 59021 |
| 770 | Ga0495682_0000309 | 3300049460 | Bacteria | 36784 |
| 771 | Ga0495682_0060758 | 3300049460 | Bacteria | 1364 |
| 772 | Ga0495682_0068648 | 3300049460 | Bacteria | 1276 |
| 773 | nmdc:mga00v17_193671_c1 | 3300050491 | Bacteria | 1313 |
| 774 | Ga0500572_040673 | 3300053111 | Bacteria | 1346 |
| 775 | Ga0500618_024476 | 3300053125 | Bacteria | 1454 |
| 776 | Ga0500573_0039393 | 3300053140 | Bacteria | 2730 |
| 777 | 2510281642 | 2510065053 | Bacteria | 5005518 |
| 778 | 2510292188 | 2510065055 | Bacteria | 5037935 |
| 779 | 2510309790 | 2510065058 | Bacteria | 5005894 |
| 780 | 2511257063 | 2511231004 | Bacteria | 6669789 |
| 781 | 2511264478 | 2511231006 | Bacteria | 6794709 |
| 782 | 2511273567 | 2511231007 | Bacteria | 6306603 |
| 783 | 2511279049 | 2511231008 | Bacteria | 6624100 |
| 784 | 2511290181 | 2511231010 | Bacteria | 6373152 |
| 785 | 2511294044 | 2511231011 | Bacteria | 6149768 |
| 786 | 2511300053 | 2511231012 | Bacteria | 6738011 |
| 787 | 2511311369 | 2511231014 | Bacteria | 6462302 |
| 788 | 2511319580 | 2511231015 | Bacteria | 6598026 |
| 789 | 2511326599 | 2511231016 | Bacteria | 6704427 |
| 790 | 2511330180 | 2511231017 | Bacteria | 6503007 |
| 791 | 2511338893 | 2511231018 | Bacteria | 6436256 |
| 792 | 2511343904 | 2511231019 | Bacteria | 6520662 |
| 793 | 2511351753 | 2511231020 | Bacteria | 6115223 |
| 794 | 2511357258 | 2511231021 | Bacteria | 7302637 |
| 795 | 2511363735 | 2511231022 | Bacteria | 6719296 |
| 796 | 2511370288 | 2511231023 | Bacteria | 6808468 |
| 797 | 2511415685 | 2511231031 | Bacteria | 6558529 |
| 798 | 2511823211 | 2511231156 | Bacteria | 6845832 |
| 799 | 2555668241 | 2554235341 | Bacteria | 6867980 |
| 800 | 2583790776 | 2582580891 | Bacteria | 6800976 |
| 801 | 2597856458 | 2597489887 | Bacteria | 6666321 |
| 802 | 2597862567 | 2597489888 | Bacteria | 6179543 |
| 803 | 2597868412 | 2597489889 | Bacteria | 6297495 |
| 804 | 2599330168 | 2599185155 | Bacteria | 5827168 |
| 805 | 2599355242 | 2599185160 | Bacteria | 6844013 |
| 806 | 2599360935 | 2599185161 | Bacteria | 6960462 |
| 807 | 2599367257 | 2599185162 | Bacteria | 6957254 |
| 808 | 2599374047 | 2599185163 | Bacteria | 6995158 |
| 809 | 2599380348 | 2599185164 | Bacteria | 6841688 |
| 810 | 2599386795 | 2599185165 | Bacteria | 6843250 |
| 811 | 2599392905 | 2599185166 | Bacteria | 6959206 |
| 812 | 2599396841 | 2599185167 | Bacteria | 6353609 |
| 813 | 2599404672 | 2599185168 | Bacteria | 6997636 |
| 814 | 2599448819 | 2599185179 | Bacteria | 6611171 |
| 815 | 2599462076 | 2599185181 | Bacteria | 6844519 |
| 816 | 2599466881 | 2599185182 | Bacteria | 6883168 |
| 817 | 2599483289 | 2599185185 | Bacteria | 6652270 |
| 818 | 2599490832 | 2599185186 | Bacteria | 6831633 |
| 819 | 2599501331 | 2599185188 | Bacteria | 6164180 |
| 820 | 2599507791 | 2599185189 | Bacteria | 5862825 |
| 821 | 2599511422 | 2599185190 | Bacteria | 6285678 |
| 822 | 2599517638 | 2599185191 | Bacteria | 6297582 |
| 823 | 2599616867 | 2599185212 | Bacteria | 6765997 |
| 824 | 2599770600 | 2599185248 | Bacteria | 6696816 |
| 825 | 2599805189 | 2599185257 | Bacteria | 6492581 |
| 826 | 2599879878 | 2599185288 | Bacteria | 6666191 |
| 827 | 2599886482 | 2599185289 | Bacteria | 6778765 |
| 828 | 2599890796 | 2599185290 | Bacteria | 6289611 |
| 829 | 2599896847 | 2599185291 | Bacteria | 6775623 |
| 830 | 2599931632 | 2599185300 | Bacteria | 6062622 |
| 831 | 2599945639 | 2599185302 | Bacteria | 5954930 |
| 832 | 2599948386 | 2599185303 | Bacteria | 6512725 |
| 833 | 2599957392 | 2599185304 | Bacteria | 5951361 |
| 834 | 2599959618 | 2599185305 | Bacteria | 6748700 |
| 835 | 2599966119 | 2599185306 | Bacteria | 6637356 |
| 836 | 2599974983 | 2599185307 | Bacteria | 6194719 |
| 837 | 2599980766 | 2599185308 | Bacteria | 6621546 |
| 838 | 2599986548 | 2599185309 | Bacteria | 5969593 |
| 839 | 2599987069 | 2599185310 | Bacteria | 6014457 |
| 840 | 2599996408 | 2599185311 | Bacteria | 6354990 |
| 841 | 2600002639 | 2599185312 | Bacteria | 5912071 |
| 842 | 2600006464 | 2599185313 | Bacteria | 6658188 |
| 843 | 2600014677 | 2599185314 | Bacteria | 6621749 |
| 844 | 2600016812 | 2599185315 | Bacteria | 6771107 |
| 845 | 2600024152 | 2599185316 | Bacteria | 6320029 |
| 846 | 2600031179 | 2599185317 | Bacteria | 6435722 |
| 847 | 2600035335 | 2599185318 | Bacteria | 6961590 |
| 848 | 2600042689 | 2599185319 | Bacteria | 6637840 |
| 849 | 2600050574 | 2599185320 | Bacteria | 5963263 |
| 850 | 2600053707 | 2599185321 | Bacteria | 6764560 |
| 851 | 2600058288 | 2599185322 | Bacteria | 6763055 |
| 852 | 2600064036 | 2599185323 | Bacteria | 6688755 |
| 853 | 2600074674 | 2599185324 | Bacteria | 6590677 |
| 854 | 2600078484 | 2599185325 | Bacteria | 6324919 |
| 855 | 2600214698 | 2599185356 | Bacteria | 6843884 |
| 856 | 2600360132 | 2600254930 | Bacteria | 6431253 |
| 857 | 2600363897 | 2600254931 | Bacteria | 6734225 |
| 858 | 2601625663 | 2600255283 | Bacteria | 6061572 |
| 859 | 2601691155 | 2600255296 | Bacteria | 5784754 |
| 860 | 2601774597 | 2600255313 | Bacteria | 6842543 |
| 861 | 2601800286 | 2600255318 | Bacteria | 6383414 |
| 862 | 2606074448 | 2603880185 | Bacteria | 6379190 |
| 863 | 2606127311 | 2603880199 | Bacteria | 6377649 |
| 864 | 2621301295 | 2619619299 | Bacteria | 6649820 |
| 865 | 2624479038 | 2623620443 | Bacteria | 6427864 |
| 866 | 2624493965 | 2623620446 | Bacteria | 6500345 |
| 867 | 2643845342 | 2643221565 | Bacteria | 6216018 |
| 868 | 2643873213 | 2643221571 | Bacteria | 6228673 |
| 869 | 2643952107 | 2643221589 | Bacteria | 6250934 |
| 870 | 2643955499 | 2643221589 | Bacteria | 6250934 |
| 871 | 2644023851 | 2643221602 | Bacteria | 6249926 |
| 872 | 2644024134 | 2643221602 | Bacteria | 6249926 |
| 873 | 2644184818 | 2643221633 | Bacteria | 6733554 |
| 874 | 2644282289 | 2643221650 | Bacteria | 7029547 |
| 875 | 2644624248 | 2643221713 | Bacteria | 6554480 |
| 876 | 2652547337 | 2651869719 | Bacteria | 6047974 |
| 877 | 2671092203 | 2667528170 | Bacteria | 6786960 |
| 878 | 2671097843 | 2667528171 | Bacteria | 6900659 |
| 879 | 2671127572 | 2667528176 | Bacteria | 6724917 |
| 880 | 2671768076 | 2671180172 | Bacteria | 6495783 |
| 881 | 2677897715 | 2675903420 | Bacteria | 6247433 |
| 882 | 2678261752 | 2675903515 | Bacteria | 6580491 |
| 883 | 2715752946 | 2713897148 | Bacteria | 5883533 |
| 884 | 2715758759 | 2713897149 | Bacteria | 6506249 |
| 885 | 2718632924 | 2718217725 | Bacteria | 5758958 |
| 886 | 2723247451 | 2721755607 | Bacteria | 5841722 |
| 887 | 2738673934 | 2738541265 | Bacteria | 6594665 |
| 888 | 2738691481 | 2738541271 | Bacteria | 5657310 |
| 889 | 2738752327 | 2738541282 | Bacteria | 6593925 |
| 890 | 2738809341 | 2738541294 | Bacteria | 6925949 |
| 891 | 2738861368 | 2738541303 | Bacteria | 6591772 |
| 892 | 2738896701 | 2738541309 | Bacteria | 6926455 |
| 893 | 2739198571 | 2738543004 | Bacteria | 6381073 |
| 894 | 2739256665 | 2738543015 | Bacteria | 6750701 |
| 895 | 2739267256 | 2738543016 | Bacteria | 5657564 |
| 896 | 2739288262 | 2738543020 | Bacteria | 5718238 |
| 897 | 2739293409 | 2738543021 | Bacteria | 5718241 |
| 898 | 2739313000 | 2738543025 | Bacteria | 6600348 |
| 899 | 2743735873 | 2740892503 | Bacteria | 6855563 |
| 900 | 2745008101 | 2744054620 | Bacteria | 6551379 |
| 901 | 2774121548 | 2773857670 | Bacteria | 6407454 |
| 902 | 2774130207 | 2773857672 | Bacteria | 4993178 |
| 903 | 2774136166 | 2773857673 | Bacteria | 6513460 |
| 904 | 2784260242 | 2784132063 | Bacteria | 6262788 |
| 905 | 2784315565 | 2784132072 | Bacteria | 6596533 |
| 906 | 2794594559 | 2791355520 | Bacteria | 5948615 |
| 907 | 2808856462 | 2808606361 | Bacteria | 6136259 |
| 908 | 2808924548 | 2808606376 | Bacteria | 6248667 |
| 909 | 2808929423 | 2808606377 | Bacteria | 6646337 |
| 910 | 2808936390 | 2808606378 | Bacteria | 6177535 |
| 911 | 2808946619 | 2808606380 | Bacteria | 6248705 |
| 912 | 2808951469 | 2808606381 | Bacteria | 6646461 |
| 913 | 2808960327 | 2808606382 | Bacteria | 6841132 |
| 914 | 2808964811 | 2808606383 | Bacteria | 6138645 |
| 915 | 2808975488 | 2808606385 | Bacteria | 6711065 |
| 916 | 2808990873 | 2808606388 | Bacteria | 6706662 |
| 917 | 2808999703 | 2808606389 | Bacteria | 6138126 |
| 918 | 2809216011 | 2808606445 | Bacteria | 6057339 |
| 919 | 2817489340 | 2816332298 | Bacteria | 6852809 |
| 920 | 2819658589 | 2818991456 | Bacteria | 6123676 |
| 921 | 2819702927 | 2818991464 | Bacteria | 6907494 |
| 922 | 2825653521 | 2825651385 | Bacteria | 6715909 |
| 923 | 2826586133 | 2826581358 | Bacteria | 5963467 |
| 924 | 2834029244 | 2834028612 | Bacteria | 6354979 |
| 925 | 2842806101 | 2842805378 | Bacteria | 5385175 |
| 926 | 2842820671 | 2842815866 | Bacteria | 5947510 |
| 927 | 2842828947 | 2842826826 | Bacteria | 5974129 |
| 928 | 2842833130 | 2842832357 | Bacteria | 5959113 |
| 929 | 2842839858 | 2842837860 | Bacteria | 6066181 |
| 930 | 2842847242 | 2842843487 | Bacteria | 6004777 |
| 931 | 2842853297 | 2842849001 | Bacteria | 5924277 |
| 932 | 2842857071 | 2842854478 | Bacteria | 6143501 |
| 933 | 2844668764 | 2844665904 | Bacteria | 6817974 |
| 934 | 2852615277 | 2852612431 | Bacteria | 6885235 |
| 935 | 2852658534 | 2852657418 | Bacteria | 6472974 |
| 936 | 2852670245 | 2852667396 | Bacteria | 6885555 |
| 937 | 2860340452 | 2860339153 | Bacteria | 6846989 |
| 938 | 2860869299 | 2860867994 | Bacteria | 5645326 |
| 939 | 2880231914 | 2880230671 | Bacteria | 6140320 |
| 940 | 2904520952 | 2904518522 | Bacteria | 6068986 |
| 941 | 2904551699 | 2904550169 | Bacteria | 6221258 |
| 942 | 2908448152 | 2908446538 | Bacteria | 6829095 |
| 943 | 2912967878 | 2912963787 | Bacteria | 5646108 |
| 944 | 2913038102 | 2913036834 | Bacteria | 6704877 |
| 945 | 2917072007 | 2917070673 | Bacteria | 6868303 |
| 946 | 2917832471 | 2917832318 | Bacteria | 5346010 |
| 947 | 2919064490 | 2919063839 | Bacteria | 6302690 |
| 948 | 2919125274 | 2919125081 | Bacteria | 5385106 |
| 949 | 2919386037 | 2919385768 | Bacteria | 5897293 |
| 950 | 2919458110 | 2919456309 | Bacteria | 6586567 |
| 951 | 2919483013 | 2919481497 | Bacteria | 6907839 |
| 952 | 2919490830 | 2919487758 | Bacteria | 5929766 |
| 953 | 2919700117 | 2919697872 | Bacteria | 6553725 |
| 954 | 2923154882 | 2923153595 | Bacteria | 6870622 |
| 955 | 2923590777 | 2923586266 | Bacteria | 6565975 |
| 956 | 2929145544 | 2929144301 | Bacteria | 6622272 |
| 957 | 2929191270 | 2929189879 | Bacteria | 5930554 |
| 958 | 2931371121 | 2931369376 | Bacteria | 6847892 |
| 959 | 2931392260 | 2931390751 | Bacteria | 6273349 |
| 960 | 2931399644 | 2931396565 | Bacteria | 7251677 |
| 961 | 2935354179 | 2935353572 | Unclassified | 6955622 |
| 962 | 2939637871 | 2939636861 | Bacteria | 6297853 |
| 963 | 2939656022 | 2939651529 | Bacteria | 5895393 |
| 964 | 2945929309 | 2945928738 | Bacteria | 6053221 |
| 965 | 2945961508 | 2945961074 | Bacteria | 7342064 |
| 966 | 2946011586 | 2946006987 | Bacteria | 6705746 |
| 967 | 2946029494 | 2946027586 | Bacteria | 6049274 |
| 968 | 2947236083 | 2947233263 | Bacteria | 6439278 |
| 969 | 2969305823 | 2969304461 | Bacteria | 6601805 |
| 970 | 2974292561 | 2974289157 | Bacteria | 6080362 |
| 971 | 2974300577 | 2974298342 | Bacteria | 4840922 |
| 972 | 2984291149 | 2984286254 | Bacteria | 6702062 |
| 973 | 2984502959 | 2984499530 | Bacteria | 5020881 |
| 974 | 2984508481 | 2984504281 | Bacteria | 5262371 |
| 975 | 2988733095 | 2988728565 | Bacteria | 6124362 |
| 976 | 2998141246 | 2998139840 | Bacteria | 6073514 |
| 977 | 3007400402 | 3007395558 | Bacteria | 6755444 |
| 978 | 3007424835 | 3007419365 | Bacteria | 7026924 |
| 979 | 3007512616 | 3007511990 | Bacteria | 6481491 |
| 980 | 3007614988 | 3007614139 | Bacteria | 6053559 |
| 981 | 3007623088 | 3007619802 | Bacteria | 6411688 |
| 982 | 3007720980 | 3007718800 | Bacteria | 5971527 |
| 983 | 3007860327 | 3007855910 | Bacteria | 5637581 |
| 984 | 3007863521 | 3007861166 | Bacteria | 6045338 |
| 985 | 3007871598 | 3007866637 | Bacteria | 5899198 |
| 986 | 637318604 | 637000220 | Bacteria | 7074893 |
| 987 | 8015689114 | 8015687852 | Bacteria | 6613826 |
| 988 | 8016729270 | 8016728285 | Bacteria | 5263933 |
| 989 | 8019770805 | 8019769354 | Bacteria | 6924660 |
| 990 | 8019776784 | 8019775933 | Bacteria | 6858656 |
| 991 | 8029999501 | 8029995093 | Bacteria | 5990776 |
| 992 | 8052498827 | 8052494512 | Bacteria | 5765634 |
| 993 | 8054285572 | 8054285046 | Bacteria | 6919322 |
| 994 | 8054348307 | 8054347763 | Bacteria | 5901107 |
| 995 | 8054504834 | 8054503363 | Bacteria | 6101651 |
| 996 | 8055772233 | 8055770955 | Bacteria | 6827675 |
| 997 | 8055884136 | 8055878733 | Bacteria | 5907058 |
| 998 | 8056127295 | 8056125926 | Bacteria | 6228218 |
| 999 | 8056133198 | 8056131705 | Bacteria | 6107031 |
| 1000 | 8056147725 | 8056143049 | Bacteria | 6307666 |
| 1001 | 8056149445 | 8056148874 | Bacteria | 6479865 |
| 1002 | 8056159530 | 8056155041 | Bacteria | 6486948 |
| 1003 | 8056164612 | 8056161164 | Bacteria | 6106669 |
| 1004 | 8056169811 | 8056166840 | Bacteria | 5820959 |
| 1005 | 8056175923 | 8056172158 | Bacteria | 6133900 |
| 1006 | 8056180364 | 8056177738 | Bacteria | 6748268 |
| 1007 | 8056569906 | 8056569372 | Bacteria | 5997322 |
| 1008 | 8057803557 | 8057798959 | Bacteria | 6713499 |
| 1009 | Ga0105251_10027854 | |||
| 1010 | MRS2a_Contig_1297 | |||
| 1011 | SwRhRL2b_contig_2880077 | |||
| 1012 | JGI24735J21928_10001609 | |||
| 1013 | JGI25162J39368_1000241 | |||
| 1014 | JGI25162J39368_1000264 | |||
| 1015 | JGI25163J39215_1001351 | |||
| 1016 | JGI25163J39215_1003184 | |||
| 1017 | JGI25164J39214_1000188 | |||
| 1018 | JGI25164J39214_1000210 | |||
| 1019 | JGI25152J39213_1001957 | |||
| 1020 | JGI25165J46597_1000339 | |||
| 1021 | JGI25165J46597_1000367 | |||
| 1022 | JGI25153J46596_10020172 | |||
| 1023 | rootH1_10034871 | |||
| 1024 | rootH1_10143890 | |||
| 1025 | Ga0006562J51391_1013932 | |||
| 1026 | Ga0055538_1000096 | |||
| 1027 | Ga0055539_1000142 | |||
| 1028 | Ga0055533_1000146 | |||
| 1029 | Ga0055532_1000132 | |||
| 1030 | Ga0055525_1000701 | |||
| 1031 | Ga0055536_1001175 | |||
| 1032 | Ga0055530_10000296 | |||
| 1033 | Ga0055530_10000427 | |||
| 1034 | Ga0055540_1000377 | |||
| 1035 | Ga0055540_1001027 | |||
| 1036 | Ga0055540_1003008 | |||
| 1037 | Ga0055531_10001697 | |||
| 1038 | Ga0055541_1000096 | |||
| 1039 | Ga0065714_10000562 | |||
| 1040 | Ga0065714_10002540 | |||
| 1041 | Ga0065714_10015600 | |||
| 1042 | Ga0065714_10017507 | |||
| 1043 | Ga0065714_10067767 | |||
| 1044 | Ga0065714_10070980 | |||
| 1045 | Ga0065704_10070421 | |||
| 1046 | Ga0065712_10001739 | |||
| 1047 | Ga0065715_10002374 | |||
| 1048 | Ga0070670_100001614 | |||
| 1049 | Ga0070670_100011386 | |||
| 1050 | Ga0070661_100000306 | |||
| 1051 | Ga0070669_100001132 | |||
| 1052 | Ga0070669_100007596 | |||
| 1053 | Ga0070662_100106296 | |||
| 1054 | Ga0068853_100005599 | |||
| 1055 | Ga0070664_100002817 | |||
| 1056 | Ga0068851_10000019 | |||
| 1057 | Ga0075364_10023132 | |||
| 1058 | Ga0075364_10209946 | |||
| 1059 | Ga0075364_10217112 | |||
| 1060 | Ga0075432_10001851 | |||
| 1061 | Ga0075432_10003492 | |||
| 1062 | Ga0075432_10003640 | |||
| 1063 | Ga0075432_10011138 | |||
| 1064 | Ga0075432_10029067 | |||
| 1065 | Ga0075432_10036507 | |||
| 1066 | Ga0075432_10037462 | |||
| 1067 | Ga0075362_10114852 | |||
| 1068 | Ga0079104_1000459 | |||
| 1069 | Ga0079104_1000484 | |||
| 1070 | Ga0079104_1000689 | |||
| 1071 | Ga0099826_10000372 | |||
| 1072 | Ga0105251_10000123 | |||
| 1073 | Ga0105251_10000202 | |||
| 1074 | Ga0105251_10001180 | |||
| 1075 | Ga0105251_10002278 | |||
| 1076 | Ga0105251_10107041 | |||
| 1077 | Ga0105244_10001713 | |||
| 1078 | Ga0105244_10005248 | |||
| 1079 | Ga0105244_10008962 | |||
| 1080 | Ga0105244_10020710 | |||
| 1081 | Ga0105244_10024875 | |||
| 1082 | Ga0105244_10025801 | |||
| 1083 | Ga0105244_10028240 | |||
| 1084 | Ga0105244_10066476 | |||
| 1085 | Ga0105244_10081177 | |||
| 1086 | Ga0105250_10000273 | |||
| 1087 | Ga0105250_10001623 | |||
| 1088 | Ga0105250_10006346 | |||
| 1089 | Ga0105250_10053662 | |||
| 1090 | Ga0105243_10000580 | |||
| 1091 | Ga0105243_10009538 | |||
| 1092 | Ga0105243_10116290 | |||
| 1093 | Ga0105243_10315110 | |||
| 1094 | Ga0105242_10001061 | |||
| 1095 | Ga0105248_10051756 | |||
| 1096 | Ga0105237_10002041 | |||
| 1097 | Ga0105238_10083853 | |||
| 1098 | Ga0105246_10000136 | |||
| 1099 | Ga0105246_10003726 | |||
| 1100 | Ga0105246_10030965 | |||
| 1101 | Ga0105246_10031219 | |||
| 1102 | Ga0157345_1002079 | |||
| 1103 | Ga0157373_10012223 | |||
| 1104 | Ga0157373_10020232 | |||
| 1105 | Ga0157373_10052963 | |||
| 1106 | Ga0157373_10056597 | |||
| 1107 | Ga0157373_10083973 | |||
| 1108 | Ga0157373_10092745 | |||
| 1109 | Ga0157373_10096556 | |||
| 1110 | Ga0157373_10213477 | |||
| 1111 | Ga0157371_10000885 | |||
| 1112 | Ga0157371_10003010 | |||
| 1113 | Ga0157371_10008487 | |||
| 1114 | Ga0157371_10023644 | |||
| 1115 | Ga0157371_10143904 | |||
| 1116 | Ga0157370_10002321 | |||
| 1117 | Ga0157370_10078317 | |||
| 1118 | Ga0157370_10092406 | |||
| 1119 | Ga0157370_10112250 | |||
| 1120 | Ga0157369_10013137 | |||
| 1121 | Ga0157369_10015624 | |||
| 1122 | Ga0157369_10105954 | |||
| 1123 | Ga0157369_10115321 | |||
| 1124 | Ga0157369_10131282 | |||
| 1125 | Ga0157369_10136240 | |||
| 1126 | Ga0163162_10019587 | |||
| 1127 | Ga0163162_10063153 | |||
| 1128 | Ga0163162_10138115 | |||
| 1129 | Ga0157372_10524353 | |||
| 1130 | Ga0157375_10008459 | |||
| 1131 | Ga0157375_10051069 | |||
| 1132 | Ga0182008_10000338 | |||
| 1133 | Ga0182008_10007133 | |||
| 1134 | Ga0182008_10009529 | |||
| 1135 | Ga0182008_10022789 | |||
| 1136 | Ga0182008_10106239 | |||
| 1137 | Ga0182008_10133102 | |||
| 1138 | Ga0182006_1002421 | |||
| 1139 | Ga0182006_1002996 | |||
| 1140 | Ga0182006_1006404 | |||
| 1141 | Ga0182006_1015077 | |||
| 1142 | Ga0182006_1015891 | |||
| 1143 | Ga0182006_1025166 | |||
| 1144 | Ga0182006_1064506 | |||
| 1145 | Ga0182006_1064966 | |||
| 1146 | Ga0182007_10012551 | |||
| 1147 | Ga0182007_10024065 | |||
| 1148 | Ga0182005_1007871 | |||
| 1149 | Ga0182005_1010432 | |||
| 1150 | Ga0182005_1012885 | |||
| 1151 | Ga0163161_10023874 | |||
| 1152 | Ga0163161_10184304 | |||
| 1153 | Ga0163161_10215782 | |||
| 1154 | Ga0163161_10246841 | |||
| 1155 | Ga0163161_10312226 | |||
| 1156 | Ga0209760_100099 | |||
| 1157 | Ga0209760_100111 | |||
| 1158 | Ga0209784_100015 | |||
| 1159 | Ga0209566_100012 | |||
| 1160 | Ga0209674_100027 | |||
| 1161 | Ga0209147_100019 | |||
| 1162 | Ga0209563_100031 | |||
| 1163 | Ga0209563_100795 | |||
| 1164 | Ga0207427_100001 | |||
| 1165 | Ga0207427_100029 | |||
| 1166 | Ga0209437_100003 | |||
| 1167 | Ga0209437_100009 | |||
| 1168 | Ga0209646_1000220 | |||
| 1169 | Ga0209677_100016 | |||
| 1170 | Ga0209759_1007233 | |||
| 1171 | Ga0209759_1020340 | |||
| 1172 | Ga0209129_1000164 | |||
| 1173 | Ga0209233_1000007 | |||
| 1174 | Ga0209233_1000032 | |||
| 1175 | Ga0209673_1005011 | |||
| 1176 | Ga0209675_1004641 | |||
| 1177 | Ga0209676_1000016 | |||
| 1178 | Ga0209676_1000033 | |||
| 1179 | Ga0209676_1000080 | |||
| 1180 | Ga0209676_1006347 | |||
| 1181 | Ga0209564_1000062 | |||
| 1182 | Ga0209758_1000820 | |||
| 1183 | Ga0209050_1000036 | |||
| 1184 | Ga0209050_1000117 | |||
| 1185 | Ga0209050_1000187 | |||
| 1186 | Ga0209050_1001895 | |||
| 1187 | Ga0209051_1000077 | |||
| 1188 | Ga0209051_1000131 | |||
| 1189 | Ga0209051_1001300 | |||
| 1190 | Ga0209257_1000173 | |||
| 1191 | Ga0207656_10000042 | |||
| 1192 | Ga0207696_1000044 | |||
| 1193 | Ga0207696_1000083 | |||
| 1194 | Ga0207696_1000111 | |||
| 1195 | Ga0207696_1005821 | |||
| 1196 | Ga0207655_1000021 | |||
| 1197 | Ga0207655_1000844 | |||
| 1198 | Ga0207655_1000896 | |||
| 1199 | Ga0207655_1001857 | |||
| 1200 | Ga0207655_1002011 | |||
| 1201 | Ga0207655_1003971 | |||
| 1202 | Ga0207655_1005141 | |||
| 1203 | Ga0207655_1006841 | |||
| 1204 | Ga0207655_1006862 | |||
| 1205 | Ga0207655_1026197 | |||
| 1206 | Ga0207655_1030587 | |||
| 1207 | Ga0207655_1061065 | |||
| 1208 | Ga0207713_1000085 | |||
| 1209 | Ga0207713_1000177 | |||
| 1210 | Ga0207713_1001940 | |||
| 1211 | Ga0207713_1004803 | |||
| 1212 | Ga0207713_1006134 | |||
| 1213 | Ga0207713_1007165 | |||
| 1214 | Ga0207713_1007166 | |||
| 1215 | Ga0207713_1007257 | |||
| 1216 | Ga0207713_1008504 | |||
| 1217 | Ga0207713_1011057 | |||
| 1218 | Ga0207713_1019500 | |||
| 1219 | Ga0207695_10109931 | |||
| 1220 | Ga0207671_10000420 | |||
| 1221 | Ga0207649_10000002 | |||
| 1222 | Ga0207681_10000815 | |||
| 1223 | Ga0207650_10000385 | |||
| 1224 | Ga0207650_10000606 | |||
| 1225 | Ga0207706_10000239 | |||
| 1226 | Ga0207706_10027482 | |||
| 1227 | Ga0207709_10000036 | |||
| 1228 | Ga0207709_10000517 | |||
| 1229 | Ga0207709_10017697 | |||
| 1230 | Ga0207679_10000006 | |||
| 1231 | Ga0207640_10002221 | |||
| 1232 | Ga0207639_10001932 | |||
| 1233 | Ga0209281_1000013 | |||
| 1234 | Ga0209281_1000202 | |||
| 1235 | Ga0209281_1000228 | |||
| 1236 | Ga0209282_1024930 | |||
| 1237 | Ga0207428_10009097 | |||
| 1238 | Ga0207428_10014425 | |||
| 1239 | Ga0207428_10033826 | |||
| 1240 | Ga0207428_10062040 | |||
| 1241 | Ga0207428_10127473 | |||
| 1242 | Ga0207428_10171876 | |||
| 1243 | Ga0316177_1057153 | |||
| 1244 | Ga0316178_1012035 | |||
| 1245 | Ga0316181_1118663 | |||
| 1246 | Ga0307408_100005464 | |||
| 1247 | Ga0307408_100009729 | |||
| 1248 | Ga0307405_10006269 | |||
| 1249 | Ga0307405_10021368 | |||
| 1250 | Ga0307412_10001346 | |||
| 1251 | Ga0307412_10004492 | |||
| 1252 | Ga0307412_10026460 | |||
| 1253 | Ga0307414_10073135 | |||
| 1254 | Ga0307411_10095926 | |||
| 1255 | Ga0307510_10234409 | |||
| 1256 | Ga0395905_0006687 | |||
| 1257 | Ga0237819_02356 | |||
| 1258 | Ga0439438_006442 | |||
| 1259 | Ga0439438_008741 | |||
| 1260 | Ga0439438_018622 | |||
| 1261 | Ga0439438_019128 | |||
| 1262 | Ga0439447_008055 | |||
| 1263 | Ga0439447_009761 | |||
| 1264 | Ga0439466_0006533 | |||
| 1265 | Ga0439466_0008215 | |||
| 1266 | Ga0439466_0009264 | |||
| 1267 | Ga0439466_0010012 | |||
| 1268 | Ga0439466_0012574 | |||
| 1269 | Ga0439466_0021397 | |||
| 1270 | Ga0439466_0044850 | |||
| 1271 | Ga0439465_0055313 | |||
| 1272 | Ga0439432_000475 | |||
| 1273 | Ga0439432_010108 | |||
| 1274 | Ga0439432_010714 | |||
| 1275 | Ga0439432_011316 | |||
| 1276 | Ga0439432_033483 | |||
| 1277 | Ga0439451_002750 | |||
| 1278 | Ga0439451_006322 | |||
| 1279 | Ga0439451_011997 | |||
| 1280 | Ga0439451_016844 | |||
| 1281 | Ga0439452_001491 | |||
| 1282 | Ga0439452_001907 | |||
| 1283 | Ga0439452_002387 | |||
| 1284 | Ga0439452_015378 | |||
| 1285 | Ga0439452_016118 | |||
| 1286 | Ga0439456_000044 | |||
| 1287 | Ga0439456_001180 | |||
| 1288 | Ga0439456_002027 | |||
| 1289 | Ga0439463_001204 | |||
| 1290 | Ga0439463_001324 | |||
| 1291 | Ga0450911_000236 | |||
| 1292 | Ga0450911_001300 | |||
| 1293 | Ga0450920_017200 | |||
| 1294 | Ga0450922_001574 | |||
| 1295 | Ga0450902_006654 | |||
| 1296 | Ga0450903_002065 | |||
| 1297 | Ga0450903_010236 | |||
| 1298 | Ga0450904_003414 | |||
| 1299 | Ga0450906_000783 | |||
| 1300 | Ga0450906_002670 | |||
| 1301 | Ga0450907_000081 | |||
| 1302 | Ga0439446_0005417 | |||
| 1303 | Ga0450908_012189 | |||
| 1304 | Ga0450909_005626 | |||
| 1305 | Ga0450909_008459 | |||
| 1306 | Ga0439434_0005081 | |||
| 1307 | Ga0439460_0000433 | |||
| 1308 | Ga0439460_0004979 | |||
| 1309 | Ga0439440_0008589 | |||
| 1310 | Ga0495617_005153 | |||
| 1311 | Ga0495617_010376 | |||
| 1312 | Ga0495617_050050 | |||
| 1313 | Ga0495617_070165 | |||
| 1314 | Ga0495627_000495 | |||
| 1315 | Ga0495627_001902 | |||
| 1316 | Ga0495627_008013 | |||
| 1317 | Ga0495627_036910 | |||
| 1318 | Ga0495627_041598 | |||
| 1319 | Ga0495627_045508 | |||
| 1320 | Ga0495627_048879 | |||
| 1321 | Ga0495603_0016430 | |||
| 1322 | Ga0495603_0021967 | |||
| 1323 | Ga0495603_0111148 | |||
| 1324 | Ga0495603_0128467 | |||
| 1325 | Ga0495590_0000613 | |||
| 1326 | Ga0495590_0004867 | |||
| 1327 | Ga0495590_0007136 | |||
| 1328 | Ga0495590_0013318 | |||
| 1329 | Ga0495590_0072503 | |||
| 1330 | Ga0495591_000035 | |||
| 1331 | Ga0495591_001453 | |||
| 1332 | Ga0495591_003662 | |||
| 1333 | Ga0495591_004116 | |||
| 1334 | Ga0495591_004442 | |||
| 1335 | Ga0495591_004480 | |||
| 1336 | Ga0495591_004811 | |||
| 1337 | Ga0495591_009507 | |||
| 1338 | Ga0495591_009898 | |||
| 1339 | Ga0495591_026108 | |||
| 1340 | Ga0495591_039510 | |||
| 1341 | Ga0495629_0036903 | |||
| 1342 | Ga0495629_0154423 | |||
| 1343 | Ga0495638_0001212 | |||
| 1344 | Ga0495638_0010929 | |||
| 1345 | Ga0495638_0013448 | |||
| 1346 | Ga0495638_0104886 | |||
| 1347 | Ga0495653_0009903 | |||
| 1348 | Ga0495653_0028529 | |||
| 1349 | Ga0495653_0090216 | |||
| 1350 | Ga0495653_0156518 | |||
| 1351 | Ga0495653_0200526 | |||
| 1352 | Ga0495650_0000630 | |||
| 1353 | Ga0495650_0001566 | |||
| 1354 | Ga0495650_0008327 | |||
| 1355 | Ga0495650_0023135 | |||
| 1356 | Ga0495650_0040135 | |||
| 1357 | Ga0495650_0072102 | |||
| 1358 | Ga0495650_0076320 | |||
| 1359 | Ga0495650_0079801 | |||
| 1360 | Ga0495582_0098189 | |||
| 1361 | Ga0495605_0000137 | |||
| 1362 | Ga0495605_0000592 | |||
| 1363 | Ga0495605_0001267 | |||
| 1364 | Ga0495605_0003821 | |||
| 1365 | Ga0495605_0004089 | |||
| 1366 | Ga0495605_0005419 | |||
| 1367 | Ga0495605_0008221 | |||
| 1368 | Ga0495605_0022401 | |||
| 1369 | Ga0495605_0038391 | |||
| 1370 | Ga0495605_0054862 | |||
| 1371 | Ga0495605_0076390 | |||
| 1372 | Ga0495605_0081759 | |||
| 1373 | Ga0495605_0138035 | |||
| 1374 | Ga0495639_0000127 | |||
| 1375 | Ga0495639_0118036 | |||
| 1376 | Ga0495664_0105641 | |||
| 1377 | Ga0495584_0003718 | |||
| 1378 | Ga0495584_0004136 | |||
| 1379 | Ga0495584_0022843 | |||
| 1380 | Ga0495584_0025094 | |||
| 1381 | Ga0495584_0079907 | |||
| 1382 | Ga0495585_0005546 | |||
| 1383 | Ga0495585_0008293 | |||
| 1384 | Ga0495585_0028276 | |||
| 1385 | Ga0495585_0036928 | |||
| 1386 | Ga0495585_0087306 | |||
| 1387 | Ga0495585_0087860 | |||
| 1388 | Ga0495585_0108398 | |||
| 1389 | Ga0495594_0012836 | |||
| 1390 | Ga0495596_0000390 | |||
| 1391 | Ga0495607_0000376 | |||
| 1392 | Ga0495607_0000642 | |||
| 1393 | Ga0495607_0002114 | |||
| 1394 | Ga0495607_0004572 | |||
| 1395 | Ga0495607_0008126 | |||
| 1396 | Ga0495607_0010704 | |||
| 1397 | Ga0495607_0011076 | |||
| 1398 | Ga0495607_0023829 | |||
| 1399 | Ga0495607_0024964 | |||
| 1400 | Ga0495607_0038531 | |||
| 1401 | Ga0495607_0053501 | |||
| 1402 | Ga0495607_0081118 | |||
| 1403 | Ga0495607_0085590 | |||
| 1404 | Ga0495607_0099605 | |||
| 1405 | Ga0495583_0000565 | |||
| 1406 | Ga0495583_0000689 | |||
| 1407 | Ga0495583_0000894 | |||
| 1408 | Ga0495583_0003193 | |||
| 1409 | Ga0495583_0004738 | |||
| 1410 | Ga0495583_0007443 | |||
| 1411 | Ga0495583_0024131 | |||
| 1412 | Ga0495583_0096856 | |||
| 1413 | Ga0495606_0000320 | |||
| 1414 | Ga0495606_0001236 | |||
| 1415 | Ga0495606_0003472 | |||
| 1416 | Ga0495606_0012494 | |||
| 1417 | Ga0495606_0013491 | |||
| 1418 | Ga0495606_0016152 | |||
| 1419 | Ga0495606_0018892 | |||
| 1420 | Ga0495606_0028589 | |||
| 1421 | Ga0495606_0031518 | |||
| 1422 | Ga0495606_0033533 | |||
| 1423 | Ga0495606_0113380 | |||
| 1424 | Ga0495606_0147848 | |||
| 1425 | Ga0495606_0163132 | |||
| 1426 | Ga0495606_0167667 | |||
| 1427 | Ga0495610_0004779 | |||
| 1428 | Ga0495610_0005166 | |||
| 1429 | Ga0495610_0007789 | |||
| 1430 | Ga0495610_0021439 | |||
| 1431 | Ga0495610_0021482 | |||
| 1432 | Ga0495610_0024964 | |||
| 1433 | Ga0495610_0094020 | |||
| 1434 | Ga0495610_0103491 | |||
| 1435 | Ga0495610_0105794 | |||
| 1436 | Ga0495610_0106319 | |||
| 1437 | Ga0495616_0004648 | |||
| 1438 | Ga0495616_0008281 | |||
| 1439 | Ga0495616_0020229 | |||
| 1440 | Ga0495616_0026778 | |||
| 1441 | Ga0495616_0034541 | |||
| 1442 | Ga0495616_0039778 | |||
| 1443 | Ga0495616_0059157 | |||
| 1444 | Ga0495616_0097543 | |||
| 1445 | Ga0495616_0112232 | |||
| 1446 | Ga0495620_0000212 | |||
| 1447 | Ga0495620_0000374 | |||
| 1448 | Ga0495620_0001385 | |||
| 1449 | Ga0495620_0004148 | |||
| 1450 | Ga0495620_0005071 | |||
| 1451 | Ga0495620_0005301 | |||
| 1452 | Ga0495620_0006105 | |||
| 1453 | Ga0495620_0063286 | |||
| 1454 | Ga0495630_0066108 | |||
| 1455 | Ga0495630_0242936 | |||
| 1456 | Ga0495631_0003637 | |||
| 1457 | Ga0495631_0006304 | |||
| 1458 | Ga0495631_0006465 | |||
| 1459 | Ga0495631_0058971 | |||
| 1460 | Ga0495631_0081499 | |||
| 1461 | Ga0495632_0001087 | |||
| 1462 | Ga0495632_0004088 | |||
| 1463 | Ga0495632_0018928 | |||
| 1464 | Ga0495632_0021081 | |||
| 1465 | Ga0495632_0024016 | |||
| 1466 | Ga0495632_0062131 | |||
| 1467 | Ga0495632_0099595 | |||
| 1468 | Ga0495637_0000303 | |||
| 1469 | Ga0495637_0000319 | |||
| 1470 | Ga0495637_0004280 | |||
| 1471 | Ga0495637_0005944 | |||
| 1472 | Ga0495637_0010951 | |||
| 1473 | Ga0495637_0016701 | |||
| 1474 | Ga0495637_0019496 | |||
| 1475 | Ga0495637_0026272 | |||
| 1476 | Ga0495637_0029396 | |||
| 1477 | Ga0495637_0036201 | |||
| 1478 | Ga0495637_0040369 | |||
| 1479 | Ga0495637_0040574 | |||
| 1480 | Ga0495637_0049177 | |||
| 1481 | Ga0495637_0061048 | |||
| 1482 | Ga0495637_0075710 | |||
| 1483 | Ga0495637_0077183 | |||
| 1484 | Ga0495643_0000870 | |||
| 1485 | Ga0495643_0078050 | |||
| 1486 | Ga0495643_0120705 | |||
| 1487 | Ga0495643_0126159 | |||
| 1488 | Ga0495644_0003678 | |||
| 1489 | Ga0495644_0009151 | |||
| 1490 | Ga0495648_0000133 | |||
| 1491 | Ga0495648_0014373 | |||
| 1492 | Ga0495648_0024895 | |||
| 1493 | Ga0495648_0026605 | |||
| 1494 | Ga0495648_0027018 | |||
| 1495 | Ga0495648_0027789 | |||
| 1496 | Ga0495648_0041593 | |||
| 1497 | Ga0495648_0052974 | |||
| 1498 | Ga0495648_0102022 | |||
| 1499 | Ga0495648_0116762 | |||
| 1500 | Ga0495648_0133647 | |||
| 1501 | Ga0495648_0133797 | |||
| 1502 | Ga0495642_0000076 | |||
| 1503 | Ga0495642_0006736 | |||
| 1504 | Ga0495642_0015515 | |||
| 1505 | Ga0495652_0015091 | |||
| 1506 | Ga0495654_0000247 | |||
| 1507 | Ga0495654_0002646 | |||
| 1508 | Ga0495654_0006092 | |||
| 1509 | Ga0495654_0013101 | |||
| 1510 | Ga0495654_0015555 | |||
| 1511 | Ga0495654_0018908 | |||
| 1512 | Ga0495654_0028242 | |||
| 1513 | Ga0495654_0035326 | |||
| 1514 | Ga0495654_0041153 | |||
| 1515 | Ga0495654_0084790 | |||
| 1516 | Ga0495654_0098140 | |||
| 1517 | Ga0495654_0103483 | |||
| 1518 | Ga0495587_0090241 | |||
| 1519 | Ga0495609_0000265 | |||
| 1520 | Ga0495609_0000273 | |||
| 1521 | Ga0495609_0000397 | |||
| 1522 | Ga0495609_0006959 | |||
| 1523 | Ga0495609_0010523 | |||
| 1524 | Ga0495609_0061892 | |||
| 1525 | Ga0495609_0099553 | |||
| 1526 | Ga0495597_0000200 | |||
| 1527 | Ga0495597_0003293 | |||
| 1528 | Ga0495597_0021246 | |||
| 1529 | Ga0495597_0028566 | |||
| 1530 | Ga0495597_0075111 | |||
| 1531 | Ga0495597_0075507 | |||
| 1532 | Ga0495622_0014670 | |||
| 1533 | Ga0495622_0017397 | |||
| 1534 | Ga0495622_0018407 | |||
| 1535 | Ga0495622_0018677 | |||
| 1536 | Ga0495622_0094212 | |||
| 1537 | Ga0495622_0097757 | |||
| 1538 | Ga0495633_0000428 | |||
| 1539 | Ga0495633_0056833 | |||
| 1540 | Ga0495633_0100649 | |||
| 1541 | Ga0495656_0005947 | |||
| 1542 | Ga0495668_0007072 | |||
| 1543 | Ga0495668_0025208 | |||
| 1544 | Ga0495668_0072792 | |||
| 1545 | Ga0495634_0010366 | |||
| 1546 | Ga0495611_0001566 | |||
| 1547 | Ga0495611_0003735 | |||
| 1548 | Ga0495611_0010002 | |||
| 1549 | Ga0495611_0073079 | |||
| 1550 | Ga0495611_0107088 | |||
| 1551 | Ga0495625_0000076 | |||
| 1552 | Ga0495625_0013277 | |||
| 1553 | Ga0495625_0059673 | |||
| 1554 | Ga0495625_0191309 | |||
| 1555 | Ga0495625_0201162 | |||
| 1556 | Ga0495635_0020767 | |||
| 1557 | Ga0495635_0032880 | |||
| 1558 | Ga0495635_0107844 | |||
| 1559 | Ga0495659_0010803 | |||
| 1560 | Ga0495661_0000030 | |||
| 1561 | Ga0495661_0000432 | |||
| 1562 | Ga0495661_0000517 | |||
| 1563 | Ga0495661_0000828 | |||
| 1564 | Ga0495661_0005510 | |||
| 1565 | Ga0495661_0009036 | |||
| 1566 | Ga0495588_0006428 | |||
| 1567 | Ga0495588_0023275 | |||
| 1568 | Ga0495623_0008011 | |||
| 1569 | Ga0495646_0023582 | |||
| 1570 | Ga0495646_0139534 | |||
| 1571 | Ga0495646_0144144 | |||
| 1572 | Ga0495669_0002556 | |||
| 1573 | Ga0495669_0028578 | |||
| 1574 | Ga0495613_0220252 | |||
| 1575 | Ga0495624_0001085 | |||
| 1576 | Ga0495624_0004157 | |||
| 1577 | Ga0495670_0001799 | |||
| 1578 | Ga0495670_0019024 | |||
| 1579 | Ga0495670_0023057 | |||
| 1580 | Ga0495670_0054418 | |||
| 1581 | Ga0495670_0072069 | |||
| 1582 | Ga0495670_0113827 | |||
| 1583 | Ga0495670_0142851 | |||
| 1584 | Ga0495670_0148562 | |||
| 1585 | Ga0495671_0003778 | |||
| 1586 | Ga0495671_0009761 | |||
| 1587 | Ga0495671_0011686 | |||
| 1588 | Ga0495671_0023096 | |||
| 1589 | Ga0495671_0023598 | |||
| 1590 | Ga0495671_0072790 | |||
| 1591 | Ga0495671_0080626 | |||
| 1592 | Ga0495671_0115495 | |||
| 1593 | Ga0495649_0001766 | |||
| 1594 | Ga0495649_0004016 | |||
| 1595 | Ga0495649_0006523 | |||
| 1596 | Ga0495649_0011115 | |||
| 1597 | Ga0495649_0012999 | |||
| 1598 | Ga0495649_0017155 | |||
| 1599 | Ga0495649_0019461 | |||
| 1600 | Ga0495649_0026106 | |||
| 1601 | Ga0495649_0035012 | |||
| 1602 | Ga0495649_0058916 | |||
| 1603 | Ga0495649_0130765 | |||
| 1604 | Ga0495649_0134031 | |||
| 1605 | Ga0495589_0001106 | |||
| 1606 | Ga0495589_0001608 | |||
| 1607 | Ga0495589_0002515 | |||
| 1608 | Ga0495589_0003963 | |||
| 1609 | Ga0495589_0019956 | |||
| 1610 | Ga0495589_0021143 | |||
| 1611 | Ga0495589_0103072 | |||
| 1612 | Ga0495660_0002665 | |||
| 1613 | Ga0495660_0003517 | |||
| 1614 | Ga0495660_0008839 | |||
| 1615 | Ga0495660_0065694 | |||
| 1616 | Ga0495660_0121555 | |||
| 1617 | Ga0495660_0125898 | |||
| 1618 | Ga0495660_0128682 | |||
| 1619 | Ga0495581_0172636 | |||
| 1620 | Ga0495604_0009862 | |||
| 1621 | Ga0495604_0014934 | |||
| 1622 | Ga0495604_0091974 | |||
| 1623 | Ga0495636_0006833 | |||
| 1624 | Ga0495636_0020541 | |||
| 1625 | Ga0495674_0049521 | |||
| 1626 | Ga0495672_0001317 | |||
| 1627 | Ga0495672_0002286 | |||
| 1628 | Ga0495672_0002383 | |||
| 1629 | Ga0495672_0007121 | |||
| 1630 | Ga0495672_0017179 | |||
| 1631 | Ga0495672_0020575 | |||
| 1632 | Ga0495672_0021868 | |||
| 1633 | Ga0495672_0061213 | |||
| 1634 | Ga0495672_0066715 | |||
| 1635 | Ga0495672_0093575 | |||
| 1636 | Ga0495672_0127919 | |||
| 1637 | Ga0495676_0000016 | |||
| 1638 | Ga0495676_0006902 | |||
| 1639 | Ga0495676_0206094 | |||
| 1640 | Ga0495680_0001587 | |||
| 1641 | Ga0495680_0007916 | |||
| 1642 | Ga0495680_0014686 | |||
| 1643 | Ga0495680_0220065 | |||
| 1644 | Ga0495683_0000286 | |||
| 1645 | Ga0495683_0000726 | |||
| 1646 | Ga0495683_0000910 | |||
| 1647 | Ga0495683_0003909 | |||
| 1648 | Ga0495683_0017809 | |||
| 1649 | Ga0495683_0021311 | |||
| 1650 | Ga0495683_0022560 | |||
| 1651 | Ga0495687_000029 | |||
| 1652 | Ga0495687_012960 | |||
| 1653 | Ga0495687_020460 | |||
| 1654 | Ga0495687_021838 | |||
| 1655 | Ga0495675_0025176 | |||
| 1656 | Ga0495675_0068501 | |||
| 1657 | Ga0495677_0011575 | |||
| 1658 | Ga0495679_001655 | |||
| 1659 | Ga0495679_002801 | |||
| 1660 | Ga0495679_045944 | |||
| 1661 | Ga0495679_050731 | |||
| 1662 | Ga0495673_0000472 | |||
| 1663 | Ga0495673_0000586 | |||
| 1664 | Ga0495673_0003108 | |||
| 1665 | Ga0495673_0005060 | |||
| 1666 | Ga0495673_0005065 | |||
| 1667 | Ga0495673_0006701 | |||
| 1668 | Ga0495673_0014840 | |||
| 1669 | Ga0495673_0016424 | |||
| 1670 | Ga0495673_0020472 | |||
| 1671 | Ga0495673_0040233 | |||
| 1672 | Ga0495673_0048399 | |||
| 1673 | Ga0495673_0072730 | |||
| 1674 | Ga0495673_0085711 | |||
| 1675 | Ga0495673_0089797 | |||
| 1676 | Ga0495681_0000366 | |||
| 1677 | Ga0495681_0003150 | |||
| 1678 | Ga0495681_0006402 | |||
| 1679 | Ga0495681_0008629 | |||
| 1680 | Ga0495681_0009080 | |||
| 1681 | Ga0495681_0022794 | |||
| 1682 | Ga0495681_0044845 | |||
| 1683 | Ga0495681_0052872 | |||
| 1684 | Ga0495681_0077499 | |||
| 1685 | Ga0495681_0081326 | |||
| 1686 | Ga0495681_0083532 | |||
| 1687 | Ga0495681_0096939 | |||
| 1688 | Ga0495681_0125442 | |||
| 1689 | Ga0495686_0035589 | |||
| 1690 | Ga0495686_0121194 | |||
| 1691 | Ga0495686_0124789 | |||
| 1692 | Ga0495686_0150470 | |||
| 1693 | Ga0495593_0015085 | |||
| 1694 | Ga0495593_0128294 | |||
| 1695 | Ga0495602_0000543 | |||
| 1696 | Ga0495602_0246227 | |||
| 1697 | Ga0495626_0000336 | |||
| 1698 | Ga0495626_0001604 | |||
| 1699 | Ga0495626_0001636 | |||
| 1700 | Ga0495626_0012804 | |||
| 1701 | Ga0495626_0015302 | |||
| 1702 | Ga0495626_0017986 | |||
| 1703 | Ga0495626_0025012 | |||
| 1704 | Ga0495626_0059261 | |||
| 1705 | Ga0495626_0061420 | |||
| 1706 | Ga0495626_0091880 | |||
| 1707 | Ga0496102_0007461 | |||
| 1708 | Ga0496102_0014410 | |||
| 1709 | Ga0496103_0065253 | |||
| 1710 | Ga0496104_0188188 | |||
| 1711 | Ga0496106_0018644 | |||
| 1712 | Ga0496107_0029852 | |||
| 1713 | Ga0496110_0004433 | |||
| 1714 | Ga0496112_0003428 | |||
| 1715 | Ga0496115_0280840 | |||
| 1716 | Ga0496116_0000913 | |||
| 1717 | Ga0496116_0002975 | |||
| 1718 | Ga0496116_0013303 | |||
| 1719 | Ga0496116_0014797 | |||
| 1720 | Ga0496116_0146131 | |||
| 1721 | Ga0496116_0148792 | |||
| 1722 | Ga0496117_0000935 | |||
| 1723 | Ga0496117_0001277 | |||
| 1724 | Ga0496117_0001851 | |||
| 1725 | Ga0496117_0015146 | |||
| 1726 | Ga0496117_0043434 | |||
| 1727 | Ga0496117_0122707 | |||
| 1728 | Ga0496118_0002130 | |||
| 1729 | Ga0496118_0019808 | |||
| 1730 | Ga0496118_0048726 | |||
| 1731 | Ga0496118_0071479 | |||
| 1732 | Ga0496118_0150394 | |||
| 1733 | Ga0496118_0183376 | |||
| 1734 | Ga0496119_0136202 | |||
| 1735 | Ga0496120_0021830 | |||
| 1736 | Ga0496120_0132881 | |||
| 1737 | Ga0496121_0002654 | |||
| 1738 | Ga0496121_0007389 | |||
| 1739 | Ga0496121_0010782 | |||
| 1740 | Ga0496122_0000447 | |||
| 1741 | Ga0496122_0008181 | |||
| 1742 | Ga0496122_0010122 | |||
| 1743 | Ga0496122_0012522 | |||
| 1744 | Ga0496122_0018931 | |||
| 1745 | Ga0496122_0170207 | |||
| 1746 | Ga0496123_0000348 | |||
| 1747 | Ga0496123_0005030 | |||
| 1748 | Ga0496123_0018067 | |||
| 1749 | Ga0496123_0090900 | |||
| 1750 | Ga0496124_0001241 | |||
| 1751 | Ga0496124_0002369 | |||
| 1752 | Ga0496124_0011175 | |||
| 1753 | Ga0496124_0011845 | |||
| 1754 | Ga0496124_0016748 | |||
| 1755 | Ga0496124_0025923 | |||
| 1756 | Ga0496124_0051186 | |||
| 1757 | Ga0496124_0094043 | |||
| 1758 | Ga0496124_0131014 | |||
| 1759 | Ga0496125_0001176 | |||
| 1760 | Ga0496125_0001804 | |||
| 1761 | Ga0496125_0013580 | |||
| 1762 | Ga0496125_0051194 | |||
| 1763 | Ga0496125_0082745 | |||
| 1764 | Ga0496125_0170251 | |||
| 1765 | Ga0496126_0038236 | |||
| 1766 | Ga0496126_0050359 | |||
| 1767 | Ga0496126_0078941 | |||
| 1768 | Ga0495678_000401 | |||
| 1769 | Ga0495678_000504 | |||
| 1770 | Ga0495678_007305 | |||
| 1771 | Ga0495678_007458 | |||
| 1772 | Ga0495678_020048 | |||
| 1773 | Ga0495678_023128 | |||
| 1774 | Ga0495678_039161 | |||
| 1775 | Ga0495678_063473 | |||
| 1776 | Ga0495678_070192 | |||
| 1777 | Ga0495682_0000153 | |||
| 1778 | Ga0495682_0000309 | |||
| 1779 | Ga0495682_0060758 | |||
| 1780 | Ga0495682_0068648 | |||
| 1781 | nmdc:mga00v17_193671_c1 | |||
| 1782 | Ga0500572_040673 | |||
| 1783 | Ga0500618_024476 | |||
| 1784 | Ga0500573_0039393 | |||
| 1785 | 2510281642 | |||
| 1786 | 2510292188 | |||
| 1787 | 2510309790 | |||
| 1788 | 2511257063 | |||
| 1789 | 2511264478 | |||
| 1790 | 2511273567 | |||
| 1791 | 2511279049 | |||
| 1792 | 2511290181 | |||
| 1793 | 2511294044 | |||
| 1794 | 2511300053 | |||
| 1795 | 2511311369 | |||
| 1796 | 2511319580 | |||
| 1797 | 2511326599 | |||
| 1798 | 2511330180 | |||
| 1799 | 2511338893 | |||
| 1800 | 2511343904 | |||
| 1801 | 2511351753 | |||
| 1802 | 2511357258 | |||
| 1803 | 2511363735 | |||
| 1804 | 2511370288 | |||
| 1805 | 2511415685 | |||
| 1806 | 2511823211 | |||
| 1807 | 2555668241 | |||
| 1808 | 2583790776 | |||
| 1809 | 2597856458 | |||
| 1810 | 2597862567 | |||
| 1811 | 2597868412 | |||
| 1812 | 2599330168 | |||
| 1813 | 2599355242 | |||
| 1814 | 2599360935 | |||
| 1815 | 2599367257 | |||
| 1816 | 2599374047 | |||
| 1817 | 2599380348 | |||
| 1818 | 2599386795 | |||
| 1819 | 2599392905 | |||
| 1820 | 2599396841 | |||
| 1821 | 2599404672 | |||
| 1822 | 2599448819 | |||
| 1823 | 2599462076 | |||
| 1824 | 2599466881 | |||
| 1825 | 2599483289 | |||
| 1826 | 2599490832 | |||
| 1827 | 2599501331 | |||
| 1828 | 2599507791 | |||
| 1829 | 2599511422 | |||
| 1830 | 2599517638 | |||
| 1831 | 2599616867 | |||
| 1832 | 2599770600 | |||
| 1833 | 2599805189 | |||
| 1834 | 2599879878 | |||
| 1835 | 2599886482 | |||
| 1836 | 2599890796 | |||
| 1837 | 2599896847 | |||
| 1838 | 2599931632 | |||
| 1839 | 2599945639 | |||
| 1840 | 2599948386 | |||
| 1841 | 2599957392 | |||
| 1842 | 2599959618 | |||
| 1843 | 2599966119 | |||
| 1844 | 2599974983 | |||
| 1845 | 2599980766 | |||
| 1846 | 2599986548 | |||
| 1847 | 2599987069 | |||
| 1848 | 2599996408 | |||
| 1849 | 2600002639 | |||
| 1850 | 2600006464 | |||
| 1851 | 2600014677 | |||
| 1852 | 2600016812 | |||
| 1853 | 2600024152 | |||
| 1854 | 2600031179 | |||
| 1855 | 2600035335 | |||
| 1856 | 2600042689 | |||
| 1857 | 2600050574 | |||
| 1858 | 2600053707 | |||
| 1859 | 2600058288 | |||
| 1860 | 2600064036 | |||
| 1861 | 2600074674 | |||
| 1862 | 2600078484 | |||
| 1863 | 2600214698 | |||
| 1864 | 2600360132 | |||
| 1865 | 2600363897 | |||
| 1866 | 2601625663 | |||
| 1867 | 2601691155 | |||
| 1868 | 2601774597 | |||
| 1869 | 2601800286 | |||
| 1870 | 2606074448 | |||
| 1871 | 2606127311 | |||
| 1872 | 2621301295 | |||
| 1873 | 2624479038 | |||
| 1874 | 2624493965 | |||
| 1875 | 2643845342 | |||
| 1876 | 2643873213 | |||
| 1877 | 2643952107 | |||
| 1878 | 2643955499 | |||
| 1879 | 2644023851 | |||
| 1880 | 2644024134 | |||
| 1881 | 2644184818 | |||
| 1882 | 2644282289 | |||
| 1883 | 2644624248 | |||
| 1884 | 2652547337 | |||
| 1885 | 2671092203 | |||
| 1886 | 2671097843 | |||
| 1887 | 2671127572 | |||
| 1888 | 2671768076 | |||
| 1889 | 2677897715 | |||
| 1890 | 2678261752 | |||
| 1891 | 2715752946 | |||
| 1892 | 2715758759 | |||
| 1893 | 2718632924 | |||
| 1894 | 2723247451 | |||
| 1895 | 2738673934 | |||
| 1896 | 2738691481 | |||
| 1897 | 2738752327 | |||
| 1898 | 2738809341 | |||
| 1899 | 2738861368 | |||
| 1900 | 2738896701 | |||
| 1901 | 2739198571 | |||
| 1902 | 2739256665 | |||
| 1903 | 2739267256 | |||
| 1904 | 2739288262 | |||
| 1905 | 2739293409 | |||
| 1906 | 2739313000 | |||
| 1907 | 2743735873 | |||
| 1908 | 2745008101 | |||
| 1909 | 2774121548 | |||
| 1910 | 2774130207 | |||
| 1911 | 2774136166 | |||
| 1912 | 2784260242 | |||
| 1913 | 2784315565 | |||
| 1914 | 2794594559 | |||
| 1915 | 2808856462 | |||
| 1916 | 2808924548 | |||
| 1917 | 2808929423 | |||
| 1918 | 2808936390 | |||
| 1919 | 2808946619 | |||
| 1920 | 2808951469 | |||
| 1921 | 2808960327 | |||
| 1922 | 2808964811 | |||
| 1923 | 2808975488 | |||
| 1924 | 2808990873 | |||
| 1925 | 2808999703 | |||
| 1926 | 2809216011 | |||
| 1927 | 2817489340 | |||
| 1928 | 2819658589 | |||
| 1929 | 2819702927 | |||
| 1930 | 2825653521 | |||
| 1931 | 2826586133 | |||
| 1932 | 2834029244 | |||
| 1933 | 2842806101 | |||
| 1934 | 2842820671 | |||
| 1935 | 2842828947 | |||
| 1936 | 2842833130 | |||
| 1937 | 2842839858 | |||
| 1938 | 2842847242 | |||
| 1939 | 2842853297 | |||
| 1940 | 2842857071 | |||
| 1941 | 2844668764 | |||
| 1942 | 2852615277 | |||
| 1943 | 2852658534 | |||
| 1944 | 2852670245 | |||
| 1945 | 2860340452 | |||
| 1946 | 2860869299 | |||
| 1947 | 2880231914 | |||
| 1948 | 2904520952 | |||
| 1949 | 2904551699 | |||
| 1950 | 2908448152 | |||
| 1951 | 2912967878 | |||
| 1952 | 2913038102 | |||
| 1953 | 2917072007 | |||
| 1954 | 2917832471 | |||
| 1955 | 2919064490 | |||
| 1956 | 2919125274 | |||
| 1957 | 2919386037 | |||
| 1958 | 2919458110 | |||
| 1959 | 2919483013 | |||
| 1960 | 2919490830 | |||
| 1961 | 2919700117 | |||
| 1962 | 2923154882 | |||
| 1963 | 2923590777 | |||
| 1964 | 2929145544 | |||
| 1965 | 2929191270 | |||
| 1966 | 2931371121 | |||
| 1967 | 2931392260 | |||
| 1968 | 2931399644 | |||
| 1969 | 2935354179 | |||
| 1970 | 2939637871 | |||
| 1971 | 2939656022 | |||
| 1972 | 2945929309 | |||
| 1973 | 2945961508 | |||
| 1974 | 2946011586 | |||
| 1975 | 2946029494 | |||
| 1976 | 2947236083 | |||
| 1977 | 2969305823 | |||
| 1978 | 2974292561 | |||
| 1979 | 2974300577 | |||
| 1980 | 2984291149 | |||
| 1981 | 2984502959 | |||
| 1982 | 2984508481 | |||
| 1983 | 2988733095 | |||
| 1984 | 2998141246 | |||
| 1985 | 3007400402 | |||
| 1986 | 3007424835 | |||
| 1987 | 3007512616 | |||
| 1988 | 3007614988 | |||
| 1989 | 3007623088 | |||
| 1990 | 3007720980 | |||
| 1991 | 3007860327 | |||
| 1992 | 3007863521 | |||
| 1993 | 3007871598 | |||
| 1994 | 637318604 | |||
| 1995 | 8015689114 | |||
| 1996 | 8016729270 | |||
| 1997 | 8019770805 | |||
| 1998 | 8019776784 | |||
| 1999 | 8029999501 | |||
| 2000 | 8052498827 | |||
| 2001 | 8054285572 | |||
| 2002 | 8054348307 | |||
| 2003 | 8054504834 | |||
| 2004 | 8055772233 | |||
| 2005 | 8055884136 | |||
| 2006 | 8056127295 | |||
| 2007 | 8056133198 | |||
| 2008 | 8056147725 | |||
| 2009 | 8056149445 | |||
| 2010 | 8056159530 | |||
| 2011 | 8056164612 | |||
| 2012 | 8056169811 | |||
| 2013 | 8056175923 | |||
| 2014 | 8056180364 | |||
| 2015 | 8056569906 | |||
| 2016 | 8057803557 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ein-assembly1.cif.gz_A | crystal structure of wt cyanophycin dipeptide hydrolase cphz from acinetobacter baylyi dsm587 | 0.9411 | 2 | 350 |
| 8eip-assembly1.cif.gz_D | crystal structure of cyanophycin dipeptide hydrolase cphz e251a from acinetobacter baylyi dsm587 in complex with beta-asp-arg | 0.9384 | 1 | 354 |
| 8eip-assembly1.cif.gz_D | crystal structure of cyanophycin dipeptide hydrolase cphz e251a from acinetobacter baylyi dsm587 in complex with beta-asp-arg | 0.9209 | 1 | 354 |
| 8ein-assembly1.cif.gz_A | crystal structure of wt cyanophycin dipeptide hydrolase cphz from acinetobacter baylyi dsm587 | 0.9108 | 2 | 350 |
| 2ejg-assembly1.cif.gz_C | crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 | 0.8729 | 282 | 347 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71538_589_656_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.904 | 282 | 348 | 2.40.50.100 |
| af_P9WPQ1_4_71_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8908 | 282 | 347 | 2.40.50.100 |
| af_Q2FXX0_70_148_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8892 | 279 | 346 | 2.40.50.100 |
| af_A4I3X3_25_102_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8891 | 280 | 348 | 2.40.50.100 |
| 3fmcD02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8887 | 283 | 344 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M5ZE23-F1-model_v4 | deleted | 0.9788 | 154 | 360 |
|
| AF-A0A7H4P0C4-F1-model_v4 | Succinylglutamate desuccinylase | 0.978 | 277 | 352 |
|
| AF-A0A0P9PQP7-F1-model_v4 | Succinylglutamate desuccinylase/aspartoacylase family protein | 0.9752 | 223 | 360 |
|
| AF-A0A6V8CXW8-F1-model_v4 | Uncharacterized protein | 0.972 | 279 | 350 |
|
| AF-A0A522IS68-F1-model_v4 | Succinylglutamate desuccinylase | 0.9706 | 230 | 360 |
|